3H1IH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1iH00
3CWBH 3L70H 1L0LH 3L71H 4U3FH 1PPJH 2BCCH 4D6TH 3H1LH 1SQVH 2IBZH 3L73H 1NTMH 1SQXH 3H1KH 1SQBH 1BGYH 3H1HH 2FYUH 1BE3H 1PP9H 3L75H 3L74H 1NTZH 2A06H 3TGUH 1BCCH 3CX5F 1P84F 3H1JH 1KYOF 1L0NH 1KB9F 5KLVH 3L72H 1NTKH 3BCCH 1EZVH 1SQPH 3H1IH 3CXHF 1NU1H 1SQQH 4PD4F
chains in the Genus database with same CATH superfamily
2PUSA 2ZE5A 2B1GA 3W7SA 1MOFA 1SKVA 3C3SA 2AGAA 5D5QA 4ZI7A 2XNDG 2VQEO 4CH4A 3DXRB 1R3LC 1Y6XA 3FAVA 4I5SA 1ZTEA 4KFMA 4PDVA 2WLLB 2IJKA 1SQFA 4B3SO 1YEWA 1UPGA 1M93A 3RVYA 4ZKIA 4X1YB 3RBZA 2E3CA 2VQEB 1WJZA 4FLXA 5GTHZ 1DF5A 3H9VA 2FYUH 3WG7B 1VF7A 4CH6A 2QKAA 1PM9A 4B3SB 3K04A 2QEXV 1W0JG 2ZR3A 3W7TA 5IDJA 4NTYA 2YIDA 3A8TA 3K5OA 1XREA 5IYZB 4BWAA 4CS3A 1L8DA 5KHJA 3I56V 1Q6HA 1FXKC 4PV1B 1YTFD 4GX0A 3RYIA 4FLWA 1ORQC 3KCYA 3OGCC 4FLUA 1V54B 1QNMA 1HNWO 1SQGA 4FIPC 1TA8A 3DC6A 4PI0A 1Q6UA 2XT9A 5BMVA 2N74A 1W2BU 2JGDA 5H5NA 1QLEC 4I9WA 1K73W 2PY5A 3BA9A 2GUZA 1WB8A 4DR3O 3FB7C 4I50A 1SQBH 5E79Z 3TXSA 1VEWA 3T2MA 1H2MA 2N04A 5IYBO 3K58A 2HEPA 4EFEA 1Y67A 4JAVA 3OMAB 2QTOA 1WPBA 2AXTZ 5IJ9B 2YI8A 2HKOA 4MTXA 4LF4O 4PD4F 3ABUA 5KMGA 2BE3A 5LGNA 4DR3B 4XDJA 1PKXA 2BOBC 4J10A 4JI4O 4HNAB 4J42A 1EN4A 5EZYB 3OTOO 4X66O 4DR2O 1VF5B 3UCSC 1WLEA 4LF5B 2QGNA 3AG7A 1IZ3A 3OEEG 3HKEA 3P3NA 4N23A 1SC5B 3CX5F 1P84F 4DW1A 4MW3A 3BHPA 4LF4B 1NTKH 3CC4V 1G6UA 2FTKA 5GTIZ 5JH7A 2F95B 4KL1A 2NNUA 3OTOB 1N33O 4X66B 4UV9A 4DR2B 1MMMA 3VQVA 4GX5A 4MTOA 1GN2A 4ASUG 3CCSV 1BQZA 3CC2V 2UXDO 3ASNC 1ZSPA 2W6IG 3ASOB 3CB2A 3ZRXA 1N33B 2PYJA 1R6KA 5KHHA 3FYEB 5KX5A 3ZEDA 3D3IA 1HW7A 2NN4A 5LXTA 2WLKA 3JSNA 2UXDB 3E2EA 1KP3A 2MW2B 3JD4A 4I0XA 2ZXWC 3JALA 3P3PA 1AILA 3OR6C 1KD1W 2JDIG 2QWPB 2RQ6A 3JYCA 3SPCA 4G2KA 4NR1A 3STZC 1KMIZ 1OCZC 2KG7B 5TISZ 2EIKB 1K4DC 3SR2C 2LW1A 1WP8A 3AK3A 3E22B 2ADQB 2OCCB 1FS0G 1R6TA 2V7QG 4PELA 2RMKB 3TK1A 1Q43A 5LBQA 4JTCB 5AG2A 4WFAV 1JFFB 2ZE7A 4WBNB 4O2BB 1QQCA 3A2FA 5LOVB 1JJ2U 2KSDA 2QWQB 5FLXN 1PV0A 3G67A 3SJAC 4R6ZA 1VMGA 2OIGA 3AG1C 3DXRA 4KUMA 1NS1A 1SQPH 3TXQA 5EIBC 1MNGA 2WLLA 3OTFA 4YJ2B 1VQ4V 4JI5O 3H1LH 2BOCC 2CGNA 4XBFA 2ZCEA 4JI2O 2OWOA 4X1YA 4FFKA 2UUCO 1DGSA 1XOUA 3K9SA 3AEIA 5KUMA 2W6JG 2HVJC 3QVNA 4YHHO 2ODMA 3UM7A 5CBFA 3EXAA 4UVBA 2YXHA 3G6EV 4GX2A 4JI8O 4FM2A 1JVMA 4JI5B 5CA1B 4MVOA 4JI2B 4O4IA 4GX1A 2R9RB 2UUCB 2RNBA 3ML0A 5IYZA 3UKMA 4IHJA 3K9AA 4EEQA 3LSSA 2WA4A 1SZTA 4O4LB 4YHHB 1ZWIC 4BIOA 1QLNA 4OPHA 4JI7O 1ZUQA 1HP8A 4JI8B 4DV3O 1YIJV 4LH7A 3BY6A 1N32O 1SF9A 4B3RO 2Z5UA 3AK2A 2F93B 4AHCA 3FB8C 5LP6C 4FFBB 1QVGU 5GW7A 2PYLA 4LF8O 5FPRA 1AP6A 4TQDA 4JI7B 5EYPB 5IWAO 4QJFB 1YF2A 4DW0A 2YIAA 2QM7A 4DV3B 1N32B 3GWOA 4B3RB 1GM8A 3L9DA 4BW9A 5FL7G 1FFXB 5EBLC 1VQMV 1DK1A 1M9NA 2EULA 4BIZA 1ZAUA 4LF8B 3N2GB 4GUNA 2JIZG 4FZ1A 1SRYA 5KAIZ 3WU2Z 2FMLA 5IWAB 2CTQA 4HNAA 2VRZA 3SYQA 5EZYA 2F43G 3E8BA 4DV0O 1K5QA 4JASA 3CCRV 3ZMZA 1GN4A 4PDMA 2ILMA 1NVPD 3NXSA 3G4SV 3ZMTA 3B8NA 5DN6G 3ABLB 3W7UA 2OTLV 3J7AU 3CYOA 2FKXA 4UXNA 3FX7A 3FAVB 4BW5A 1G8MA 4UCVA 2R9AA 3VQXA 5L3FA 1B6QA 4LF7O 4GYCB 1BT8A 4JGSA 2QTSA 4PA3A 1M90W 4Z2WA 4MVZA 4DV5B 1BQ0A 1OCRC 1NZ6A 2DJVA 1VARA 4LF7B 5JVDA 1DLBA 3K5MA 3K3WA 5IY5C 3LUTB 3CE2A 1VQ9V 1AROP 1MSDA 4BR6A 4GKJO 3ETGA 2JEXA 2KG7A 2X6CA 5C93A 1KUQA 4GZRB 1R73A 3KKYA 1S77D 4FLVA 1S5LZ 2E5LB 3E22A 2ZIMA 1B04A 4JZGA 4CBCA 2Q67A 4MTFA 3ZN0A 4DR6O 3H1IH 2ZQMA 3HPLC 4GKJB 2GUZB 2VS0A 5K1PA 2QWRB 1BSMA 3IC9A 4CH5A 3G71V 1IBMB 2Y69C 3D36C 3CCEV 1ROPA 2WA3A 4WBNA 4O2BA 5LOVA 1I5XA 3RYHB 4L87A 4RUEA 3L74H 2A9HA 1T5EA 2WPDG 4Z1VA 4DR6B 2ITDC 4I55A 1XBLA 4NXMO 5KMGB 5KHIA 4J9YB 2VQFO 1J95A 4B7KA 3ABKB 4YJ2A 3JATB 3G80A 2AHYA 1P4RA 2EZPA 1KECA 3ZHTA 3EVKA 4NXMB 1D5AA 2VQFB 4WFHA 3T1HO 5JH7B 2F4VB 4QPJA 4J9ZB 4LFAB 3RGBA 2A7WA 1PNLA 4E4EA 1AR4A 4EFBA 4TQFA 1YVWA 2YS8A 5H6RA 4RWUA 5KA5A 1SQVH 1M56C 3CMEV 3CCLV 3OD4A 2RDCA 3RYFB 3T1HB 4HZ3A 3M99B 4O4LA 3TGUH 4J41A 4LFBO 2ZM6O 3SJCC 2DE0X 2ADPA 1G1XB 1I0HA 4FLYA 1IXMA 4FFBA 5ITZB 3JD3A 1O9GA 1N8RW 1FKAO 1H8HG 3LSUA 5LMUO 5EYPA 5J9PC 2JGUA 2ZDIA 1TAEA 4ABMA 1AP5A 3IGAC 3F7VC 3UT5A 3JASB 2DYRC 5EIBD 1FFXA 2YXYA 1VQNV 1H2GA 2JEUA 5KA6A 1EZJA 3BA8A 5JJNB 1IBKO 2DW4A 3J80N 4JYYA 2DN9A 4UCUA 1L1FA 1YSCA 2XHBA 1Q90D 1J5EO 1KC8W 4GKKB 3D8CA 2LQTA 3BVOA 1K5SA 2YICA 2GBOA 4UCSA 5LA6B 1IBKB 1RP3B 2B1IA 3AG4C 3RT3C 2EIJB 1SETA 2P7TC 5LYJB 4CS2A 3IAYA 1AB3A 1RM1B 1J5EB 3CRQA 4B3MO 2ZNIA 4UB8Z 2AZ0A 3JAWB 5FPOA 4NKGB 2YIBA 1GAXA 2HR3A 3HR0A 4NTWA 4G28B 4PDLA 3BFRA 4PDRA 1KP2A 1GN6A 1AR5A 5L3EA 4B3MB 5B1OA 5LGTA 3OW2U 3ICXA 5IYCO 4DR5O 2IJHA 1LR1A 1IX9A 4O4IB 3QNEA 2P06A 4IHJB 2XAJA 3B2EE 1N0NA 1GRJA 4FMTA 2LW7A 2YUAA 1FYJA 2JS5A 4MVRA 2OIEA 2EILC 2IU3A 4I4TA 1N36O 4UVCA 1D2DA 3CRMA 5LMNO 3K5NA 3A0RA 1R6NA 4E2LA 2Q7GA 3JAMN 1KKDA 3CEIA 2PTMA 2HHHO 1OCOC 2YC0A 4TT3G 4N21A 1HNWB 3CP1A 4PA6A 3L75H 3M8AA 1IDSA 2EZOA 4MVUA 4FJCC 4QPKA 1F4MA 2C2AA 3RYHA 4EKWA 4FZ0A 4FPPA 1GM9A 3W7XA 5KHGA 2Y4UA 3STLC 3JARA 5BR8O 2HHHB 3APQA 4X1KB 1IBLO 2YEVB 2IBZH 2XAGA 4D7TA 5JJEB 1WAZA 3JATA 1OCCC 2Q5ZA 4LBEC 1JCHA 3ZMVA 4IGGA 4FM0A 2Q7HA 2F1MA 4WFFA 1AJQA 2YSUB 4FVMA 1BHAA 1IBLB 1FPOA 4JI4B 4RUFA 1S5JA 2Q8VA 4J7KA 3DGEA 5B3SC 5JCOA 2JK5C 1X4TA 2DMXA 2DYSB 3ZHUA 3OAAG 3U0ZA 2D3OW 4Q6GA 4UCRA 4R7CA 4BAYA 1GN3A 3RYCA 1FFTB 5JJJB 3RYFA 5H6QA 3ABKC 2GTAA 2WWWA 1VF6A 2NLJC 1FXVA 3AG2B 3N2KA 3QO8A 4YXWG 3HKDB 4CS4A 2QR4A 4H44B 4JAAA 1JPXA 3DSQA 1GO3F 4IT5A 3F5TA 3TCUA 1Y76B 5JVDB 5ITZA 3MD0A 2LFSA 3EFFK 3M7MX 3ZS8C 4D7SA 1K97A 2HJDA 1TVKB 2KQXA 4DK1A 1L0LH 3AG3C 3JASA 4DO2A 2YDEA 3ZN1A 4DK0A 2ZINA 2YXLA 4J7ZA 5HFMA 2P22C 1FJGO 4DR1O 1M5IA 1RPOA 3LDEA 1YCIA 3E86A 1Y66A 1H8EG 1Q7YW 5H2FZ 5JWPA 4LNUA 3L70H 4G27B 1K4CC 1A32A 5J2TA 1K92A 2YI9A 1NTMH 4HYOA 3VOUA 5LA6A 1FJGB 1BL8A 1W0KG 5DEDA 1XUQA 2WLJA 4I55B 1XHZA 2XASA 1XQ8A 5LYJA 3FB5C 2Y48A 1KB9F 2Q73A 3DTUB 3SYAA 1TUBB 1TUEB 3JAWA 4L8JA 1MZEA 2Z0AA 3CJHB 1K34A 1KBHA 1H38A 1NJIW 4JYAO 5FNVB 1EN6A 1CXZB 1H2SB 1UFIA 4RQFA 2EINB 2CE4A 4H33A 2GSMB 2P90A 3PJSK 3PN1A 2BTOA 4RO2A 1SESA 5DM6V 1OHHG 4IIJA 5DECA 1URFA 2RCVA 2CUGA 1FXHA 5B1BB 2QE7G 5LP6A 1QBZA 2JVDA 4UV8A 1NH2D 3ABMB 2CTPA 2EIMB 3WG7C 4CH3A 4ZIBA 2Y4TA 3X2QB 3GVMA 3JD1A 4LR3A 1JJOA 1M1KW 1X59A 4BIUA 1BE3H 3E83A 2Q7EA 2CGOA 4ZBMA 4JI1O 2WLNA 1VQPV 3UT5B 2QM8A 4MVQA 1Q3EA 5IJ0B 3UQ8A 2E74B 2CK3G 2IH3C 4DV1O 3K03A 4PA4A 1V54C 1PPJH 3GWKC 1LUVA 4X1KA 2YEVA 3T4DA 3SPJA 4JI1B 4F6EA 1XEQA 2LJ2A 1NQTA 1BMFG 4OXSA 2QA4V 4DV1B 4DV6O 4NTXA 2M6YA 4OX9O 1DTOA 3ZHQA 2IJIA 3WB2A 1EN5A 4U7OA 1JX9A 2GDSA 4LH6A 1VQKV 2KB1A 1JA8A 4DV0B 3BRCA 5GONB 1WN7A 2OTJV 4QE9A 2Q69A 4HAMA 4DV6B 4OX9B 5CMUA 3Q4HB 1VQOV 3HKCB 1NVPB 3CD6V 4H0LB 1XMQO 2WLIA 1P49A 3HKDA 1H2KA 3C3TA 1XNQO 3KZIZ 1S72V 3ETQA 5IT9N 3OEHG 1FXKB 1E79G 1ZL8B 5KUKA 4EB6A 1ZX3A 1JMKC 2XTAA 1Y76A 3N27A 1VP7A 4HBNA 4W4KA 3NR7A 2A3QA 1XMQB 4FM1A 2DYSC 1Q86W 1EBOA 1XNQB 5CBHA 1IXBA 3CPWU 3SGIA 3BPZA 2QSAA 2JS3A 1TVKA 2F23A 4TV8A 1QLEB 4I4TB 2EJ7A 2P67A 3ASOC 1NR1A 4H13B 2UUBO 3E35A 3D36A 4DUZO 2OYQA 2ZD9A 3J81N 1VQ6V 3GB7C 3ZBHA 3FB6C 3BAAA 2UUBB 2FL4A 3BEHA 2G38A 2IM9A 5HFLA 4DUZB 1BZKA 2ZE8A 2EIKC 1KYOF 1XHXA 4DV2O 3JARB 2E76B 3K79A 5KAFZ 1TUBA 1AI7A 3JCZA 4W4LA 5F2VO 3SJQC 2OCCC 3TETA 3P30A 4Q20A 1QVFU 3CJHA 3ETDA 1Z2GA 3EHBB 4KHPO 1HNXO 4OGQB 1KQSU 5FNVA 2QWNB 2DQ3A 1B06A 4O4HB 4MVMA 3ZX6A 4X8AA 1HWYA 1WB7A 3APOA 4X89A 3K08A 3ASNB 2GHYA 3MHSC 1LUWA 2H94A 4LWSB 4FLZA 1SQXH 3OUFA 3IC7A 4KHPB 3RFRA 4FK5C 1YI2V 1HNXB 3RYCB 1RFYA 1M57B 4U3JA 2Q6AA 1NTZH 4UFZA 4WFGA 3I5DA 4O2AA 3QF7A 1IURA 2Z3YA 2RJZA 3N2KB 3CXCU 4JZ2A 4WFBV 4JTAB 2ZXWB 3UO2A 4JF3A 2M7WA 1VQ7V 4K8ZA 4GLXA 2O57A 3CCJV 1ENVA 1GM7A 1K9MW 2UXCO 1BGYH 1OCZB 3H1HH 2CDYA 1VIBA 2WAMA 3JAKB 3W7WA 2D2CB 2NR5A 1CEZA 4LFBB 1BCCH 2ETNA 2ZM6B 2UXNA 5EBMC 2UU9O 5CB4A 1AR1B 1NR7A 4JI0O 2UXCB 4P30A 5J2UB 5IJ0A 2Q4PA 2ITCC 2AZ2A 4YJ3B 1US6A 3CHXA 1EFRG 1Y74B 3ABMC 4MVSA 5LMUB 4X1IB 4H37A 4X88A 1R3IC 3X2QC 2RN9A 1YJWV 2Q0AA 4X62O 4JI0B 4I7ZB 4LNUB 3ZMSA 1GK9A 2E75B 2FB5A 4DV4O 5J2TB 5EK0A 5L3CA 1GKFA 5B1NA 1DF4A 2ZDIC 3LDCA 3HKBB 2VWJA 2WLHA 5BY1A 5C8YB 2JRIA 3I55V 1CPYA 5B1AB 5GONA 3FFQA 2ZKOA 4X62B 2WLMA 5LL6Y 4DV4B 5BZBA 1G4YB 3CRCA 3Q4HA 3HKCA 5BXZA 3OR7C 2JJ2G 1ZLZA 2BTQB 1HNZO 1FXKA 1QR8A 1H2LA 4LC1A 3ABLC 1ZL8A 4WF9V 2XAQA 5L3BA 3B09A 2K9PA 1QHTA 1O9HA 4IIJB 5IYDO 4PA7A 3VBBA 3K5LA 1YJ9V 5CA0A 2QKSA 1VQ5V 1N4CA 3OMIB 5LP6B 1LNQA 1HNZB 4DR5B 5H9CA 1P7GA 3B40A 2BSKB 2EX3A 3RWRD 2XAFA 4TUYB 1PL0A 1PNKA 4K0KO 4B3TO 4TV9B 3THOA 3L73H 5LHIA 1YTFB 4KP4A 1N36B 3K06A 3R66A 1BS3A 1MABG 3ZMUA 1THZA 5LMNB 1N0JA 1AJNA 1KKCA 5D5PA 4LF6O 3WB1A 4K0KB 4B3TB 3QG5A 5L3DA 4GCZA 4DRXB 4ZOLB 4D6TH 3JSLA 3SDLA 1I08A 2ATKC 2PI5A 1CP9A 2LGWA 2QDOA 4U7NA 4K3AA 1PP9H 5CN0A 1K7DA 1MG1A 3FYIB 4LF5O 2R72A 4LF6B 5KLVH 1JOYA 3OUSA 3H01A 1K8AW 3ZHSA 4O4HA 5BR8B 2JJ1G 2GTSA 4JYBA 4JPRA 3VQWA 2H8PC 1SA0A 4UCTA 1NBMG 4B7EA 4ICGA 4MSWC 4DR7O 3T1CA 1WA8A 1I94O 1COWG 3ABTA 4LWSA 2X0LA 2Q9LA 4LFCO 1OCRB 3HB3B 4YIOA 2IW5A 2DQ0A 3FD9A 5JQGA 4X65O 2WLIB 1MA1A 5IY5B 2B9ZA 4DR7B 2CTRA 1QR9A 1XI1A 1I94B 2MK3A 4TOIA 1K33A 2X7RB 4EB6B 1U97A 3QTCA 4XDKA 1V9PA 4X20B 4LFCB 3VQYA 3JAKA 3ZCCA 1V55B 3O65A 4X65B 1RSOB 1FD9A 5JCOC 2Y0IA 5A9GA 2A0LA 2UXXA 3B77A 3MDSA 1M57C 2Y0PA 1VF6C 2CTWA 4TV8B 3ZRWB 3LNNA 4IL6Z 5J2UA 1NT2B 3R65A 5EBWC 3WFVA 4YJ3A 2Y69B 1Y74A 1W59A 2QM4A 1AI6A 2X6BA 4X1IA 4AI8A 1Y4MA 3QO5A 3LDDA 4JYCA 4F4LA 1B3QA 3CCQV 1VQLV 5KHKA 3D3QA 2LP7A 5IE9A 3HKBA 4DR1B 4XDLA 4PA9A 2N05A 2ZR2A 2P6JA 5C8YA 2W0FC 5LHHA 1IVSA 3F5WC 2IU0A 1GMGA 2UUAO 1R3JC 4O4JA 4ZHQA 4X64O 1Q81W 4DV7O 4MW8A 1PL4A 1WP7A 3P32A 2DWEC 4F6RB 1NI8A 1YZBA 3OGIB 4QIWF 3SPHA 2ZT9B 1PD3A 3RW0A 1XILA 4MS2A 3T4ZA 4K35A 1M56B 2BTQA 1WNSA 2L6LA 2UUAB 4RAIA 4I9QA 4X64B 1EZVH 4DV7B 4QGPA 1EM1A 2VWKA 1XL6A 3RN4A 4DXWA 1JR9A 2EIJC 3ETEA 4J7JA 1RM1C 4DYLA 5B1AC 4JYAB 3B4SA 4U3JB 2XUMA 4NYKA 4O2AB 4PJ0Z 4C7UA 4PI2A 1GH6A 2HLDG 2X6AA 4J80A 4B08A 3A0HZ 1YITV 3BCCH 4NVPA 1YJNV 2BSKA 4IYHA 4KXRA 1P7BA 1XMOO 4TUYA 2XOKG 2F66C 3K0GA 4TV9A 2ZIOA 2DYRB 1I7FA 4DUYO 3O9OA 1Q82W 5CB4B 2DOSA 4WFEA 5CBGA 1Z5WA 3UO3A 3ZHRA 4JV5O 4LF9O 1XMOB 1AJPA 1NH2B 3K57A 4AQYO 3JCUZ 4DUYB 4DRXA 1YXBA 4ZOLA 2W0XA 1AI5A 2P4VA 4A5UB 1U96A 2P4KA 2XAHA 4JV5B 1L0NH 4LF9B 3AG4B 5IJ9A 4YIPA 5LGUA 2QWOB 1XNRO 3CXHF 4AQYB 1YHQV 1S76D 2CH7B 4FLTA 2LFRA 4DR4O 3CRAA 3SYOA 3ZRVA 4CC6A 1TGOA 2HP8A 2YIBD 3E8HA 3K0DA 4WCEV 1XNRB 2V1DA 2K1EA 3SJBC 1FAFA 2KKWA 4DR4B 2PZSA 3WB0A 3CWBH 4ZI7B 5L3GA 4P9PA 2EBOA 5EC1C 2ZE6A 2IH1C 4UCOA 4DV5O 3RVZA 4RQEA 3DC5A 5LHGA 1KU9A 1Q5OA 1Q6IA 3TJTA 3L72H 4X20A 2EILB 4UUJC 1RSOA 1SQQH 3AK1A 3LSQA 5CA0B 1F7YA 3FKSG 3OT7A 4OPAA 3OMNB 1OJHA 3ZRWA 2HFEC 1BHBA 1PNMA 4UB6Z 3AG2C 2AW9A 2P5OA 1OCOB 2HG5C 2WSSG 3KCXA 2E5LO 4TSFG 1F23A 2AHZA 4J11A 3RYIB 1HDJA 4R50A 2IJJA 1YDXA 4X9QA 4LCUC 5B66Z 2R9IA 2CAZC 1IBMO 4TWKA 1OZ0A 1V55C 2DWDC 1R1BA 4NB5A 2LGQA 4CC5A 3JD2A 1I5YA 1D5NA 5BMVB 3SPGA 1OCCB 2JGDB 3CRRA 4LP8A 1MZFA 3E8FA 4GT1A 1GTOA 3MAQA 3KG2A 4QNHB 4I50B 4U3FH 1XL4A 3L71H 3CC7V 1K3EA 2V4DA 1JFFA 3S3XA 1H2NA 5B5EZ 3OM3B 5CA3A 4AILC 3JD0A 4F6RA 1AI4A 2GV9A 3OFNG 1AVMA 2EJRA 1F51A 4UVAA 3E8GA 2OT5A 3SYCA 5B3SB 2UXBO 4DV2B 3E89A 3C90A 1N34O 3OE7G 1S0VA 3ZRSA 3B8MA 2F4VO 1F4NA 1SA0B 1QCEA 3IJ4A 4LFAO 1SERA 4QE7A 2PF4E 1E1QG 1WA8B 1Z5VA 1SZXA 3F7YC 3HKEB 2UXBB 5A2QN 2Q68A 3ZJZA 3A0BZ 1UJWB 1N34B 2ARHA 2QJ1A 5JQGB 4JI6O 2L35A 5EC2C 3IFXA 4K8XA 3U10A 4PHZA 3G6BA 4JTDB 4Z1MG 3T1YO 5CA1A 4MTGA 2EINC 1S5HC 2HJFC 1R3KC 1E1RG 1QU7A 3CCUV 2B5UA 2A79B 3AG3B 4JAUA 4JI6B 1SS3A 4NXNO 1S3JA 1Q8IA 4MT8A 3S3WA 4CZZA 5E1AC 4R8CA 2OCHA 2PI4A 3T1YB 5KX5B 4YY3O 3CSXA 3MHHC 3U11A 5LXTB 4IYIA 5B1BC 1HR0O 3CCVV 3H1KH 2ZNJA 3BABA 1JQ0A 2R70A 4I0XB 3CCMV 3JALB 4NXNB 2Q0OC 5K1XA 2LO1A 3LNMB 3ZIAG 1WPXA 2A06H 2UU9B 2EIMC 3ZHVA 3SPIA 4P2ZA 4YY3B 1MSWD 2PGGA 3SYPA 1RPRA 3AG1B 1HR0B 2HVKC 4P9OA 4JI3O 4GKKO 2BCCH 3CS5A 2CH7A 3N2GA 2QKCA 1NKDA 1M4UA 3H1JH 1OV9A 2H3OA 1XDCA 4O4JB 4ZHQB 1VQ8V 3K59A 4JI3B 3CMAV 1NU1H 3QO7A
chains in the Genus database with same CATH topology
3CWBH 3L70H 1L0LH 3L71H 4U3FH 1PPJH 2BCCH 4D6TH 3H1LH 1SQVH 2IBZH 3L73H 1NTMH 1SQXH 3H1KH 1SQBH 1BGYH 3H1HH 2FYUH 1BE3H 1PP9H 3L75H 3L74H 1NTZH 2A06H 3TGUH 1BCCH 3CX5F 1P84F 3H1JH 1KYOF 1L0NH 1KB9F 5KLVH 3L72H 1NTKH 3BCCH 1EZVH 1SQPH 3H1IH 3CXHF 1NU1H 1SQQH 4PD4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB H;  3L70 H;  1L0L H;  3L71 H;  4U3F H;  1PPJ H;  2BCC H;  4D6T H;  3H1L H;  1SQV H;  2IBZ H;  3L73 H;  1NTM H;  1SQX H;  3H1K H;  1SQB H;  1BGY H;  3H1H H;  2FYU H;  1BE3 H;  1PP9 H;  3L75 H;  3L74 H;  1NTZ H;  2A06 H;  3TGU H;  1BCC H;  3CX5 F;  1P84 F;  3H1J H;  1KYO F;  1L0N H;  1KB9 F;  5KLV H;  3L72 H;  1NTK H;  3BCC H;  1EZV H;  1SQP H;  3H1I H;  3CXH F;  1NU1 H;  1SQQ H;  4PD4 F; 
#chains in the Genus database with same CATH topology
 2PUS A;  2ZE5 A;  2B1G A;  3W7S A;  1MOF A;  1SKV A;  3C3S A;  2AGA A;  5D5Q A;  4ZI7 A;  2XND G;  2VQE O;  4CH4 A;  3DXR B;  1R3L C;  1Y6X A;  3FAV A;  4I5S A;  1ZTE A;  4KFM A;  4PDV A;  2WLL B;  2IJK A;  1SQF A;  4B3S O;  1YEW A;  1UPG A;  1M93 A;  3RVY A;  4ZKI A;  4X1Y B;  3RBZ A;  2E3C A;  2VQE B;  1WJZ A;  4FLX A;  5GTH Z;  1DF5 A;  3H9V A;  2FYU H;  3WG7 B;  1VF7 A;  4CH6 A;  2QKA A;  1PM9 A;  4B3S B;  3K04 A;  2QEX V;  1W0J G;  2ZR3 A;  3W7T A;  5IDJ A;  4NTY A;  2YID A;  3A8T A;  3K5O A;  1XRE A;  5IYZ B;  4BWA A;  4CS3 A;  1L8D A;  5KHJ A;  3I56 V;  1Q6H A;  1FXK C;  4PV1 B;  1YTF D;  4GX0 A;  3RYI A;  4FLW A;  1ORQ C;  3KCY A;  3OGC C;  4FLU A;  1V54 B;  1QNM A;  1HNW O;  1SQG A;  4FIP C;  1TA8 A;  3DC6 A;  4PI0 A;  1Q6U A;  2XT9 A;  5BMV A;  2N74 A;  1W2B U;  2JGD A;  5H5N A;  1QLE C;  4I9W A;  1K73 W;  2PY5 A;  3BA9 A;  2GUZ A;  1WB8 A;  4DR3 O;  3FB7 C;  4I50 A;  1SQB H;  5E79 Z;  3TXS A;  1VEW A;  3T2M A;  1H2M A;  2N04 A;  5IYB O;  3K58 A;  2HEP A;  4EFE A;  1Y67 A;  4JAV A;  3OMA B;  2QTO A;  1WPB A;  2AXT Z;  5IJ9 B;  2YI8 A;  2HKO A;  4MTX A;  4LF4 O;  4PD4 F;  3ABU A;  5KMG A;  2BE3 A;  5LGN A;  4DR3 B;  4XDJ A;  1PKX A;  2BOB C;  4J10 A;  4JI4 O;  4HNA B;  4J42 A;  1EN4 A;  5EZY B;  3OTO O;  4X66 O;  4DR2 O;  1VF5 B;  3UCS C;  1WLE A;  4LF5 B;  2QGN A;  3AG7 A;  1IZ3 A;  3OEE G;  3HKE A;  3P3N A;  4N23 A;  1SC5 B;  3CX5 F;  1P84 F;  4DW1 A;  4MW3 A;  3BHP A;  4LF4 B;  1NTK H;  3CC4 V;  1G6U A;  2FTK A;  5GTI Z;  5JH7 A;  2F95 B;  4KL1 A;  2NNU A;  3OTO B;  1N33 O;  4X66 B;  4UV9 A;  4DR2 B;  1MMM A;  3VQV A;  4GX5 A;  4MTO A;  1GN2 A;  4ASU G;  3CCS V;  1BQZ A;  3CC2 V;  2UXD O;  3ASN C;  1ZSP A;  2W6I G;  3ASO B;  3CB2 A;  3ZRX A;  1N33 B;  2PYJ A;  1R6K A;  5KHH A;  3FYE B;  5KX5 A;  3ZED A;  3D3I A;  1HW7 A;  2NN4 A;  5LXT A;  2WLK A;  3JSN A;  2UXD B;  3E2E A;  1KP3 A;  2MW2 B;  3JD4 A;  4I0X A;  2ZXW C;  3JAL A;  3P3P A;  1AIL A;  3OR6 C;  1KD1 W;  2JDI G;  2QWP B;  2RQ6 A;  3JYC A;  3SPC A;  4G2K A;  4NR1 A;  3STZ C;  1KMI Z;  1OCZ C;  2KG7 B;  5TIS Z;  2EIK B;  1K4D C;  3SR2 C;  2LW1 A;  1WP8 A;  3AK3 A;  3E22 B;  2ADQ B;  2OCC B;  1FS0 G;  1R6T A;  2V7Q G;  4PEL A;  2RMK B;  3TK1 A;  1Q43 A;  5LBQ A;  4JTC B;  5AG2 A;  4WFA V;  1JFF B;  2ZE7 A;  4WBN B;  4O2B B;  1QQC A;  3A2F A;  5LOV B;  1JJ2 U;  2KSD A;  2QWQ B;  5FLX N;  1PV0 A;  3G67 A;  3SJA C;  4R6Z A;  1VMG A;  2OIG A;  3AG1 C;  3DXR A;  4KUM A;  1NS1 A;  1SQP H;  3TXQ A;  5EIB C;  1MNG A;  2WLL A;  3OTF A;  4YJ2 B;  1VQ4 V;  4JI5 O;  3H1L H;  2BOC C;  2CGN A;  4XBF A;  2ZCE A;  4JI2 O;  2OWO A;  4X1Y A;  4FFK A;  2UUC O;  1DGS A;  1XOU A;  3K9S A;  3AEI A;  5KUM A;  2W6J G;  2HVJ C;  3QVN A;  4YHH O;  2ODM A;  3UM7 A;  5CBF A;  3EXA A;  4UVB A;  2YXH A;  3G6E V;  4GX2 A;  4JI8 O;  4FM2 A;  1JVM A;  4JI5 B;  5CA1 B;  4MVO A;  4JI2 B;  4O4I A;  4GX1 A;  2R9R B;  2UUC B;  2RNB A;  3ML0 A;  5IYZ A;  3UKM A;  4IHJ A;  3K9A A;  4EEQ A;  3LSS A;  2WA4 A;  1SZT A;  4O4L B;  4YHH B;  1ZWI C;  4BIO A;  1QLN A;  4OPH A;  4JI7 O;  1ZUQ A;  1HP8 A;  4JI8 B;  4DV3 O;  1YIJ V;  4LH7 A;  3BY6 A;  1N32 O;  1SF9 A;  4B3R O;  2Z5U A;  3AK2 A;  2F93 B;  4AHC A;  3FB8 C;  5LP6 C;  4FFB B;  1QVG U;  5GW7 A;  2PYL A;  4LF8 O;  5FPR A;  1AP6 A;  4TQD A;  4JI7 B;  5EYP B;  5IWA O;  4QJF B;  1YF2 A;  4DW0 A;  2YIA A;  2QM7 A;  4DV3 B;  1N32 B;  3GWO A;  4B3R B;  1GM8 A;  3L9D A;  4BW9 A;  5FL7 G;  1FFX B;  5EBL C;  1VQM V;  1DK1 A;  1M9N A;  2EUL A;  4BIZ A;  1ZAU A;  4LF8 B;  3N2G B;  4GUN A;  2JIZ G;  4FZ1 A;  1SRY A;  5KAI Z;  3WU2 Z;  2FML A;  5IWA B;  2CTQ A;  4HNA A;  2VRZ A;  3SYQ A;  5EZY A;  2F43 G;  3E8B A;  4DV0 O;  1K5Q A;  4JAS A;  3CCR V;  3ZMZ A;  1GN4 A;  4PDM A;  2ILM A;  1NVP D;  3NXS A;  3G4S V;  3ZMT A;  3B8N A;  5DN6 G;  3ABL B;  3W7U A;  2OTL V;  3J7A U;  3CYO A;  2FKX A;  4UXN A;  3FX7 A;  3FAV B;  4BW5 A;  1G8M A;  4UCV A;  2R9A A;  3VQX A;  5L3F A;  1B6Q A;  4LF7 O;  4GYC B;  1BT8 A;  4JGS A;  2QTS A;  4PA3 A;  1M90 W;  4Z2W A;  4MVZ A;  4DV5 B;  1BQ0 A;  1OCR C;  1NZ6 A;  2DJV A;  1VAR A;  4LF7 B;  5JVD A;  1DLB A;  3K5M A;  3K3W A;  5IY5 C;  3LUT B;  3CE2 A;  1VQ9 V;  1ARO P;  1MSD A;  4BR6 A;  4GKJ O;  3ETG A;  2JEX A;  2KG7 A;  2X6C A;  5C93 A;  1KUQ A;  4GZR B;  1R73 A;  3KKY A;  1S77 D;  4FLV A;  1S5L Z;  2E5L B;  3E22 A;  2ZIM A;  1B04 A;  4JZG A;  4CBC A;  2Q67 A;  4MTF A;  3ZN0 A;  4DR6 O;  3H1I H;  2ZQM A;  3HPL C;  4GKJ B;  2GUZ B;  2VS0 A;  5K1P A;  2QWR B;  1BSM A;  3IC9 A;  4CH5 A;  3G71 V;  1IBM B;  2Y69 C;  3D36 C;  3CCE V;  1ROP A;  2WA3 A;  4WBN A;  4O2B A;  5LOV A;  1I5X A;  3RYH B;  4L87 A;  4RUE A;  3L74 H;  2A9H A;  1T5E A;  2WPD G;  4Z1V A;  4DR6 B;  2ITD C;  4I55 A;  1XBL A;  4NXM O;  5KMG B;  5KHI A;  4J9Y B;  2VQF O;  1J95 A;  4B7K A;  3ABK B;  4YJ2 A;  3JAT B;  3G80 A;  2AHY A;  1P4R A;  2EZP A;  1KEC A;  3ZHT A;  3EVK A;  4NXM B;  1D5A A;  2VQF B;  4WFH A;  3T1H O;  5JH7 B;  2F4V B;  4QPJ A;  4J9Z B;  4LFA B;  3RGB A;  2A7W A;  1PNL A;  4E4E A;  1AR4 A;  4EFB A;  4TQF A;  1YVW A;  2YS8 A;  5H6R A;  4RWU A;  5KA5 A;  1SQV H;  1M56 C;  3CME V;  3CCL V;  3OD4 A;  2RDC A;  3RYF B;  3T1H B;  4HZ3 A;  3M99 B;  4O4L A;  3TGU H;  4J41 A;  4LFB O;  2ZM6 O;  3SJC C;  2DE0 X;  2ADP A;  1G1X B;  1I0H A;  4FLY A;  1IXM A;  4FFB A;  5ITZ B;  3JD3 A;  1O9G A;  1N8R W;  1FKA O;  1H8H G;  3LSU A;  5LMU O;  5EYP A;  5J9P C;  2JGU A;  2ZDI A;  1TAE A;  4ABM A;  1AP5 A;  3IGA C;  3F7V C;  3UT5 A;  3JAS B;  2DYR C;  5EIB D;  1FFX A;  2YXY A;  1VQN V;  1H2G A;  2JEU A;  5KA6 A;  1EZJ A;  3BA8 A;  5JJN B;  1IBK O;  2DW4 A;  3J80 N;  4JYY A;  2DN9 A;  4UCU A;  1L1F A;  1YSC A;  2XHB A;  1Q90 D;  1J5E O;  1KC8 W;  4GKK B;  3D8C A;  2LQT A;  3BVO A;  1K5S A;  2YIC A;  2GBO A;  4UCS A;  5LA6 B;  1IBK B;  1RP3 B;  2B1I A;  3AG4 C;  3RT3 C;  2EIJ B;  1SET A;  2P7T C;  5LYJ B;  4CS2 A;  3IAY A;  1AB3 A;  1RM1 B;  1J5E B;  3CRQ A;  4B3M O;  2ZNI A;  4UB8 Z;  2AZ0 A;  3JAW B;  5FPO A;  4NKG B;  2YIB A;  1GAX A;  2HR3 A;  3HR0 A;  4NTW A;  4G28 B;  4PDL A;  3BFR A;  4PDR A;  1KP2 A;  1GN6 A;  1AR5 A;  5L3E A;  4B3M B;  5B1O A;  5LGT A;  3OW2 U;  3ICX A;  5IYC O;  4DR5 O;  2IJH A;  1LR1 A;  1IX9 A;  4O4I B;  3QNE A;  2P06 A;  4IHJ B;  2XAJ A;  3B2E E;  1N0N A;  1GRJ A;  4FMT A;  2LW7 A;  2YUA A;  1FYJ A;  2JS5 A;  4MVR A;  2OIE A;  2EIL C;  2IU3 A;  4I4T A;  1N36 O;  4UVC A;  1D2D A;  3CRM A;  5LMN O;  3K5N A;  3A0R A;  1R6N A;  4E2L A;  2Q7G A;  3JAM N;  1KKD A;  3CEI A;  2PTM A;  2HHH O;  1OCO C;  2YC0 A;  4TT3 G;  4N21 A;  1HNW B;  3CP1 A;  4PA6 A;  3L75 H;  3M8A A;  1IDS A;  2EZO A;  4MVU A;  4FJC C;  4QPK A;  1F4M A;  2C2A A;  3RYH A;  4EKW A;  4FZ0 A;  4FPP A;  1GM9 A;  3W7X A;  5KHG A;  2Y4U A;  3STL C;  3JAR A;  5BR8 O;  2HHH B;  3APQ A;  4X1K B;  1IBL O;  2YEV B;  2IBZ H;  2XAG A;  4D7T A;  5JJE B;  1WAZ A;  3JAT A;  1OCC C;  2Q5Z A;  4LBE C;  1JCH A;  3ZMV A;  4IGG A;  4FM0 A;  2Q7H A;  2F1M A;  4WFF A;  1AJQ A;  2YSU B;  4FVM A;  1BHA A;  1IBL B;  1FPO A;  4JI4 B;  4RUF A;  1S5J A;  2Q8V A;  4J7K A;  3DGE A;  5B3S C;  5JCO A;  2JK5 C;  1X4T A;  2DMX A;  2DYS B;  3ZHU A;  3OAA G;  3U0Z A;  2D3O W;  4Q6G A;  4UCR A;  4R7C A;  4BAY A;  1GN3 A;  3RYC A;  1FFT B;  5JJJ B;  3RYF A;  5H6Q A;  3ABK C;  2GTA A;  2WWW A;  1VF6 A;  2NLJ C;  1FXV A;  3AG2 B;  3N2K A;  3QO8 A;  4YXW G;  3HKD B;  4CS4 A;  2QR4 A;  4H44 B;  4JAA A;  1JPX A;  3DSQ A;  1GO3 F;  4IT5 A;  3F5T A;  3TCU A;  1Y76 B;  5JVD B;  5ITZ A;  3MD0 A;  2LFS A;  3EFF K;  3M7M X;  3ZS8 C;  4D7S A;  1K97 A;  2HJD A;  1TVK B;  2KQX A;  4DK1 A;  1L0L H;  3AG3 C;  3JAS A;  4DO2 A;  2YDE A;  3ZN1 A;  4DK0 A;  2ZIN A;  2YXL A;  4J7Z A;  5HFM A;  2P22 C;  1FJG O;  4DR1 O;  1M5I A;  1RPO A;  3LDE A;  1YCI A;  3E86 A;  1Y66 A;  1H8E G;  1Q7Y W;  5H2F Z;  5JWP A;  4LNU A;  3L70 H;  4G27 B;  1K4C C;  1A32 A;  5J2T A;  1K92 A;  2YI9 A;  1NTM H;  4HYO A;  3VOU A;  5LA6 A;  1FJG B;  1BL8 A;  1W0K G;  5DED A;  1XUQ A;  2WLJ A;  4I55 B;  1XHZ A;  2XAS A;  1XQ8 A;  5LYJ A;  3FB5 C;  2Y48 A;  1KB9 F;  2Q73 A;  3DTU B;  3SYA A;  1TUB B;  1TUE B;  3JAW A;  4L8J A;  1MZE A;  2Z0A A;  3CJH B;  1K34 A;  1KBH A;  1H38 A;  1NJI W;  4JYA O;  5FNV B;  1EN6 A;  1CXZ B;  1H2S B;  1UFI A;  4RQF A;  2EIN B;  2CE4 A;  4H33 A;  2GSM B;  2P90 A;  3PJS K;  3PN1 A;  2BTO A;  4RO2 A;  1SES A;  5DM6 V;  1OHH G;  4IIJ A;  5DEC A;  1URF A;  2RCV A;  2CUG A;  1FXH A;  5B1B B;  2QE7 G;  5LP6 A;  1QBZ A;  2JVD A;  4UV8 A;  1NH2 D;  3ABM B;  2CTP A;  2EIM B;  3WG7 C;  4CH3 A;  4ZIB A;  2Y4T A;  3X2Q B;  3GVM A;  3JD1 A;  4LR3 A;  1JJO A;  1M1K W;  1X59 A;  4BIU A;  1BE3 H;  3E83 A;  2Q7E A;  2CGO A;  4ZBM A;  4JI1 O;  2WLN A;  1VQP V;  3UT5 B;  2QM8 A;  4MVQ A;  1Q3E A;  5IJ0 B;  3UQ8 A;  2E74 B;  2CK3 G;  2IH3 C;  4DV1 O;  3K03 A;  4PA4 A;  1V54 C;  1PPJ H;  3GWK C;  1LUV A;  4X1K A;  2YEV A;  3T4D A;  3SPJ A;  4JI1 B;  4F6E A;  1XEQ A;  2LJ2 A;  1NQT A;  1BMF G;  4OXS A;  2QA4 V;  4DV1 B;  4DV6 O;  4NTX A;  2M6Y A;  4OX9 O;  1DTO A;  3ZHQ A;  2IJI A;  3WB2 A;  1EN5 A;  4U7O A;  1JX9 A;  2GDS A;  4LH6 A;  1VQK V;  2KB1 A;  1JA8 A;  4DV0 B;  3BRC A;  5GON B;  1WN7 A;  2OTJ V;  4QE9 A;  2Q69 A;  4HAM A;  4DV6 B;  4OX9 B;  5CMU A;  3Q4H B;  1VQO V;  3HKC B;  1NVP B;  3CD6 V;  4H0L B;  1XMQ O;  2WLI A;  1P49 A;  3HKD A;  1H2K A;  3C3T A;  1XNQ O;  3KZI Z;  1S72 V;  3ETQ A;  5IT9 N;  3OEH G;  1FXK B;  1E79 G;  1ZL8 B;  5KUK A;  4EB6 A;  1ZX3 A;  1JMK C;  2XTA A;  1Y76 A;  3N27 A;  1VP7 A;  4HBN A;  4W4K A;  3NR7 A;  2A3Q A;  1XMQ B;  4FM1 A;  2DYS C;  1Q86 W;  1EBO A;  1XNQ B;  5CBH A;  1IXB A;  3CPW U;  3SGI A;  3BPZ A;  2QSA A;  2JS3 A;  1TVK A;  2F23 A;  4TV8 A;  1QLE B;  4I4T B;  2EJ7 A;  2P67 A;  3ASO C;  1NR1 A;  4H13 B;  2UUB O;  3E35 A;  3D36 A;  4DUZ O;  2OYQ A;  2ZD9 A;  3J81 N;  1VQ6 V;  3GB7 C;  3ZBH A;  3FB6 C;  3BAA A;  2UUB B;  2FL4 A;  3BEH A;  2G38 A;  2IM9 A;  5HFL A;  4DUZ B;  1BZK A;  2ZE8 A;  2EIK C;  1KYO F;  1XHX A;  4DV2 O;  3JAR B;  2E76 B;  3K79 A;  5KAF Z;  1TUB A;  1AI7 A;  3JCZ A;  4W4L A;  5F2V O;  3SJQ C;  2OCC C;  3TET A;  3P30 A;  4Q20 A;  1QVF U;  3CJH A;  3ETD A;  1Z2G A;  3EHB B;  4KHP O;  1HNX O;  4OGQ B;  1KQS U;  5FNV A;  2QWN B;  2DQ3 A;  1B06 A;  4O4H B;  4MVM A;  3ZX6 A;  4X8A A;  1HWY A;  1WB7 A;  3APO A;  4X89 A;  3K08 A;  3ASN B;  2GHY A;  3MHS C;  1LUW A;  2H94 A;  4LWS B;  4FLZ A;  1SQX H;  3OUF A;  3IC7 A;  4KHP B;  3RFR A;  4FK5 C;  1YI2 V;  1HNX B;  3RYC B;  1RFY A;  1M57 B;  4U3J A;  2Q6A A;  1NTZ H;  4UFZ A;  4WFG A;  3I5D A;  4O2A A;  3QF7 A;  1IUR A;  2Z3Y A;  2RJZ A;  3N2K B;  3CXC U;  4JZ2 A;  4WFB V;  4JTA B;  2ZXW B;  3UO2 A;  4JF3 A;  2M7W A;  1VQ7 V;  4K8Z A;  4GLX A;  2O57 A;  3CCJ V;  1ENV A;  1GM7 A;  1K9M W;  2UXC O;  1BGY H;  1OCZ B;  3H1H H;  2CDY A;  1VIB A;  2WAM A;  3JAK B;  3W7W A;  2D2C B;  2NR5 A;  1CEZ A;  4LFB B;  1BCC H;  2ETN A;  2ZM6 B;  2UXN A;  5EBM C;  2UU9 O;  5CB4 A;  1AR1 B;  1NR7 A;  4JI0 O;  2UXC B;  4P30 A;  5J2U B;  5IJ0 A;  2Q4P A;  2ITC C;  2AZ2 A;  4YJ3 B;  1US6 A;  3CHX A;  1EFR G;  1Y74 B;  3ABM C;  4MVS A;  5LMU B;  4X1I B;  4H37 A;  4X88 A;  1R3I C;  3X2Q C;  2RN9 A;  1YJW V;  2Q0A A;  4X62 O;  4JI0 B;  4I7Z B;  4LNU B;  3ZMS A;  1GK9 A;  2E75 B;  2FB5 A;  4DV4 O;  5J2T B;  5EK0 A;  5L3C A;  1GKF A;  5B1N A;  1DF4 A;  2ZDI C;  3LDC A;  3HKB B;  2VWJ A;  2WLH A;  5BY1 A;  5C8Y B;  2JRI A;  3I55 V;  1CPY A;  5B1A B;  5GON A;  3FFQ A;  2ZKO A;  4X62 B;  2WLM A;  5LL6 Y;  4DV4 B;  5BZB A;  1G4Y B;  3CRC A;  3Q4H A;  3HKC A;  5BXZ A;  3OR7 C;  2JJ2 G;  1ZLZ A;  2BTQ B;  1HNZ O;  1FXK A;  1QR8 A;  1H2L A;  4LC1 A;  3ABL C;  1ZL8 A;  4WF9 V;  2XAQ A;  5L3B A;  3B09 A;  2K9P A;  1QHT A;  1O9H A;  4IIJ B;  5IYD O;  4PA7 A;  3VBB A;  3K5L A;  1YJ9 V;  5CA0 A;  2QKS A;  1VQ5 V;  1N4C A;  3OMI B;  5LP6 B;  1LNQ A;  1HNZ B;  4DR5 B;  5H9C A;  1P7G A;  3B40 A;  2BSK B;  2EX3 A;  3RWR D;  2XAF A;  4TUY B;  1PL0 A;  1PNK A;  4K0K O;  4B3T O;  4TV9 B;  3THO A;  3L73 H;  5LHI A;  1YTF B;  4KP4 A;  1N36 B;  3K06 A;  3R66 A;  1BS3 A;  1MAB G;  3ZMU A;  1THZ A;  5LMN B;  1N0J A;  1AJN A;  1KKC A;  5D5P A;  4LF6 O;  3WB1 A;  4K0K B;  4B3T B;  3QG5 A;  5L3D A;  4GCZ A;  4DRX B;  4ZOL B;  4D6T H;  3JSL A;  3SDL A;  1I08 A;  2ATK C;  2PI5 A;  1CP9 A;  2LGW A;  2QDO A;  4U7N A;  4K3A A;  1PP9 H;  5CN0 A;  1K7D A;  1MG1 A;  3FYI B;  4LF5 O;  2R72 A;  4LF6 B;  5KLV H;  1JOY A;  3OUS A;  3H01 A;  1K8A W;  3ZHS A;  4O4H A;  5BR8 B;  2JJ1 G;  2GTS A;  4JYB A;  4JPR A;  3VQW A;  2H8P C;  1SA0 A;  4UCT A;  1NBM G;  4B7E A;  4ICG A;  4MSW C;  4DR7 O;  3T1C A;  1WA8 A;  1I94 O;  1COW G;  3ABT A;  4LWS A;  2X0L A;  2Q9L A;  4LFC O;  1OCR B;  3HB3 B;  4YIO A;  2IW5 A;  2DQ0 A;  3FD9 A;  5JQG A;  4X65 O;  2WLI B;  1MA1 A;  5IY5 B;  2B9Z A;  4DR7 B;  2CTR A;  1QR9 A;  1XI1 A;  1I94 B;  2MK3 A;  4TOI A;  1K33 A;  2X7R B;  4EB6 B;  1U97 A;  3QTC A;  4XDK A;  1V9P A;  4X20 B;  4LFC B;  3VQY A;  3JAK A;  3ZCC A;  1V55 B;  3O65 A;  4X65 B;  1RSO B;  1FD9 A;  5JCO C;  2Y0I A;  5A9G A;  2A0L A;  2UXX A;  3B77 A;  3MDS A;  1M57 C;  2Y0P A;  1VF6 C;  2CTW A;  4TV8 B;  3ZRW B;  3LNN A;  4IL6 Z;  5J2U A;  1NT2 B;  3R65 A;  5EBW C;  3WFV A;  4YJ3 A;  2Y69 B;  1Y74 A;  1W59 A;  2QM4 A;  1AI6 A;  2X6B A;  4X1I A;  4AI8 A;  1Y4M A;  3QO5 A;  3LDD A;  4JYC A;  4F4L A;  1B3Q A;  3CCQ V;  1VQL V;  5KHK A;  3D3Q A;  2LP7 A;  5IE9 A;  3HKB A;  4DR1 B;  4XDL A;  4PA9 A;  2N05 A;  2ZR2 A;  2P6J A;  5C8Y A;  2W0F C;  5LHH A;  1IVS A;  3F5W C;  2IU0 A;  1GMG A;  2UUA O;  1R3J C;  4O4J A;  4ZHQ A;  4X64 O;  1Q81 W;  4DV7 O;  4MW8 A;  1PL4 A;  1WP7 A;  3P32 A;  2DWE C;  4F6R B;  1NI8 A;  1YZB A;  3OGI B;  4QIW F;  3SPH A;  2ZT9 B;  1PD3 A;  3RW0 A;  1XIL A;  4MS2 A;  3T4Z A;  4K35 A;  1M56 B;  2BTQ A;  1WNS A;  2L6L A;  2UUA B;  4RAI A;  4I9Q A;  4X64 B;  1EZV H;  4DV7 B;  4QGP A;  1EM1 A;  2VWK A;  1XL6 A;  3RN4 A;  4DXW A;  1JR9 A;  2EIJ C;  3ETE A;  4J7J A;  1RM1 C;  4DYL A;  5B1A C;  4JYA B;  3B4S A;  4U3J B;  2XUM A;  4NYK A;  4O2A B;  4PJ0 Z;  4C7U A;  4PI2 A;  1GH6 A;  2HLD G;  2X6A A;  4J80 A;  4B08 A;  3A0H Z;  1YIT V;  3BCC H;  4NVP A;  1YJN V;  2BSK A;  4IYH A;  4KXR A;  1P7B A;  1XMO O;  4TUY A;  2XOK G;  2F66 C;  3K0G A;  4TV9 A;  2ZIO A;  2DYR B;  1I7F A;  4DUY O;  3O9O A;  1Q82 W;  5CB4 B;  2DOS A;  4WFE A;  5CBG A;  1Z5W A;  3UO3 A;  3ZHR A;  4JV5 O;  4LF9 O;  1XMO B;  1AJP A;  1NH2 B;  3K57 A;  4AQY O;  3JCU Z;  4DUY B;  4DRX A;  1YXB A;  4ZOL A;  2W0X A;  1AI5 A;  2P4V A;  4A5U B;  1U96 A;  2P4K A;  2XAH A;  4JV5 B;  1L0N H;  4LF9 B;  3AG4 B;  5IJ9 A;  4YIP A;  5LGU A;  2QWO B;  1XNR O;  3CXH F;  4AQY B;  1YHQ V;  1S76 D;  2CH7 B;  4FLT A;  2LFR A;  4DR4 O;  3CRA A;  3SYO A;  3ZRV A;  4CC6 A;  1TGO A;  2HP8 A;  2YIB D;  3E8H A;  3K0D A;  4WCE V;  1XNR B;  2V1D A;  2K1E A;  3SJB C;  1FAF A;  2KKW A;  4DR4 B;  2PZS A;  3WB0 A;  3CWB H;  4ZI7 B;  5L3G A;  4P9P A;  2EBO A;  5EC1 C;  2ZE6 A;  2IH1 C;  4UCO A;  4DV5 O;  3RVZ A;  4RQE A;  3DC5 A;  5LHG A;  1KU9 A;  1Q5O A;  1Q6I A;  3TJT A;  3L72 H;  4X20 A;  2EIL B;  4UUJ C;  1RSO A;  1SQQ H;  3AK1 A;  3LSQ A;  5CA0 B;  1F7Y A;  3FKS G;  3OT7 A;  4OPA A;  3OMN B;  1OJH A;  3ZRW A;  2HFE C;  1BHB A;  1PNM A;  4UB6 Z;  3AG2 C;  2AW9 A;  2P5O A;  1OCO B;  2HG5 C;  2WSS G;  3KCX A;  2E5L O;  4TSF G;  1F23 A;  2AHZ A;  4J11 A;  3RYI B;  1HDJ A;  4R50 A;  2IJJ A;  1YDX A;  4X9Q A;  4LCU C;  5B66 Z;  2R9I A;  2CAZ C;  1IBM O;  4TWK A;  1OZ0 A;  1V55 C;  2DWD C;  1R1B A;  4NB5 A;  2LGQ A;  4CC5 A;  3JD2 A;  1I5Y A;  1D5N A;  5BMV B;  3SPG A;  1OCC B;  2JGD B;  3CRR A;  4LP8 A;  1MZF A;  3E8F A;  4GT1 A;  1GTO A;  3MAQ A;  3KG2 A;  4QNH B;  4I50 B;  4U3F H;  1XL4 A;  3L71 H;  3CC7 V;  1K3E A;  2V4D A;  1JFF A;  3S3X A;  1H2N A;  5B5E Z;  3OM3 B;  5CA3 A;  4AIL C;  3JD0 A;  4F6R A;  1AI4 A;  2GV9 A;  3OFN G;  1AVM A;  2EJR A;  1F51 A;  4UVA A;  3E8G A;  2OT5 A;  3SYC A;  5B3S B;  2UXB O;  4DV2 B;  3E89 A;  3C90 A;  1N34 O;  3OE7 G;  1S0V A;  3ZRS A;  3B8M A;  2F4V O;  1F4N A;  1SA0 B;  1QCE A;  3IJ4 A;  4LFA O;  1SER A;  4QE7 A;  2PF4 E;  1E1Q G;  1WA8 B;  1Z5V A;  1SZX A;  3F7Y C;  3HKE B;  2UXB B;  5A2Q N;  2Q68 A;  3ZJZ A;  3A0B Z;  1UJW B;  1N34 B;  2ARH A;  2QJ1 A;  5JQG B;  4JI6 O;  2L35 A;  5EC2 C;  3IFX A;  4K8X A;  3U10 A;  4PHZ A;  3G6B A;  4JTD B;  4Z1M G;  3T1Y O;  5CA1 A;  4MTG A;  2EIN C;  1S5H C;  2HJF C;  1R3K C;  1E1R G;  1QU7 A;  3CCU V;  2B5U A;  2A79 B;  3AG3 B;  4JAU A;  4JI6 B;  1SS3 A;  4NXN O;  1S3J A;  1Q8I A;  4MT8 A;  3S3W A;  4CZZ A;  5E1A C;  4R8C A;  2OCH A;  2PI4 A;  3T1Y B;  5KX5 B;  4YY3 O;  3CSX A;  3MHH C;  3U11 A;  5LXT B;  4IYI A;  5B1B C;  1HR0 O;  3CCV V;  3H1K H;  2ZNJ A;  3BAB A;  1JQ0 A;  2R70 A;  4I0X B;  3CCM V;  3JAL B;  4NXN B;  2Q0O C;  5K1X A;  2LO1 A;  3LNM B;  3ZIA G;  1WPX A;  2A06 H;  2UU9 B;  2EIM C;  3ZHV A;  3SPI A;  4P2Z A;  4YY3 B;  1MSW D;  2PGG A;  3SYP A;  1RPR A;  3AG1 B;  1HR0 B;  2HVK C;  4P9O A;  4JI3 O;  4GKK O;  2BCC H;  3CS5 A;  2CH7 A;  3N2G A;  2QKC A;  1NKD A;  1M4U A;  3H1J H;  1OV9 A;  2H3O A;  1XDC A;  4O4J B;  4ZHQ B;  1VQ8 V;  3K59 A;  4JI3 B;  3CMA V;  1NU1 H;  3QO7 A; 
#chains in the Genus database with same CATH homology
 3CWB H;  3L70 H;  1L0L H;  3L71 H;  4U3F H;  1PPJ H;  2BCC H;  4D6T H;  3H1L H;  1SQV H;  2IBZ H;  3L73 H;  1NTM H;  1SQX H;  3H1K H;  1SQB H;  1BGY H;  3H1H H;  2FYU H;  1BE3 H;  1PP9 H;  3L75 H;  3L74 H;  1NTZ H;  2A06 H;  3TGU H;  1BCC H;  3CX5 F;  1P84 F;  3H1J H;  1KYO F;  1L0N H;  1KB9 F;  5KLV H;  3L72 H;  1NTK H;  3BCC H;  1EZV H;  1SQP H;  3H1I H;  3CXH F;  1NU1 H;  1SQQ H;  4PD4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...