3H1JJ

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1jJ00
3CXHI 3TGUJ 3H1IJ 3L75J 3L74J 3H1LJ 3CX5I 4PD4I 3H1JJ 1SQQJ 2BCCJ 3L71J 1KB9I 3BCCJ 3L73J 1BE3J 1NTKJ 1PP9J 1SQBJ 1L0LJ 5KLVJ 1NTZJ 4U3FJ 1NU1J 1KYOI 3CWBJ 1SQXJ 1BGYJ 1EZVI 1SQVJ 3H1HJ 2FYUJ 4D6TJ 3L70J 2IBZI 1P84I 1NTMJ 1L0NJ 3L72J 1BCCJ 3H1KJ 1SQPJ
chains in the Genus database with same CATH superfamily
4TT3H 2FYUG 1SQVE 1BCCE 3TGUJ 2NPSB 1SQPE 1ZP0C 3L74J 3Q3DA 1SQXG 2W6BA 4OWFA 4PD4I 2H88C 2ZYGA 1AVOA 1VPCA 2R5DA 5L8RJ 3G4SP 1BE3D 1HVVA 4Y99C 2LXBA 2WZ7A 1S3JA 3HE4B 2YXQB 1KILB 2R3CA 4H13D 2M3EA 1NTKJ 1NYHA 5AVRB 3TDKA 2H7HA 3AEAC 3AE3C 4KHXA 1A02J 1N7SB 3PJSK 1WRGA 2OYIC 2DW3A 1RQVA 2WSCH 1KB9E 1PP9E 1OFCX 1SFCB 1T3UA 1JTHA 4N78D 4YTPC 3RK3E 3G6EP 1FOSF 1M7LA 1IK9A 1YI2P 1RE4A 1PIXA 1EZVI 2K1AA 4ASWA 1PPJG 2FYZA 1JB0J 2D2CB 1M57D 1QX8A 3FGAD 2E74C 1BSHA 1N7SA 1OW6A 3KZIE 1YJNP 1LT9C 2IFMA 3O6QB 5BU5A 1K9MQ 2KI7B 2KXPB 1HH0A 1CSBA 3E7KA 2WSFJ 3MUDC 2V7QJ 2WPRA 2Y0EA 3F89A 3GW6A 1T3JA 4GIFA 2E75B 4ASVA 3CXHI 1HF9A 3P8CE 2KB7P 3CX5I 1WT6A 2J5UA 4H13B 1SQQJ 2BCCJ 3VP9A 1EC5A 3D70A 1ZW0A 2WSEJ 2Q3IA 1KB9I 2FXOA 3VMXA 1DD4A 3EWKA 3LW5H 4KJMA 4A7PA 4N6JA 4Y28J 1GL2C 3HD7C 3M9HA 3CCUP 2C9NY 2OTJP 1PV3A 2KS1B 2WPVB 1SQXE 2RMZA 1BGYD 1VQ4P 2KNCA 1Z56A 2WMMA 2XDJA 1HTLC 1NU1E 3HTKB 2NPSD 3KYQA 3L73G 3TYYA 1FZCA 2FXPA 2QJPC 2YIUC 1VQPP 2Z5HA 3HE5A 3GMAA 2KSJA 1M90Q 2QG4A 3A5TA 2AEFA 2H43A 2Q6QA 3AE6C 1FDIA 1EDKA 2K9YA 2A06E 2YKQA 3L35A 2IBZE 5AVSB 3T97A 3WU2E 3D71A 1JY2N 3MGNA 5AW2B 4EOTA 4U3FD 5KJ7A 2N1TD 1DH3A 2WVRA 1Q2NA 1URQA 3MUDA 3G71P 1ZOYC 1RE3C 3H1JJ 4YXDC 1L2PA 4D6TD 2HPCB 1VQ7P 1LNQA 2XKMA 1VF5B 3BCCJ 3L73J 3CC7P 1LTJB 1SQPD 3NTNA 4ZKUA 2QA4P 1X79B 3BATA 1LWUB 1L0LE 3G3ZA 4LGDE 4U3FE 3U59A 2AEJA 5B66H 3CCSP 1GDTA 1IO4A 1X9VA 1GL2A 3B5NB 1J2JB 2O3JA 3H1KD 4IFFA 3L70D 4IL6X 1SQXJ 3MP7B 3IF4A 3L74G 3PHLA 4W80A 2QM7A 2W6AA 1EDIA 1NTZD 2BCCG 3E1RA 1IFNA 3GF3A 2P7JA 3BCCE 3H1LE 1LWUC 1QEXA 3L70J 1G2CA 1LT9B 5GTHE 1OZHA 2PAJA 3SFEC 1NTKK 1NAFA 5M1BA 3II6A 2L91A 5APYA 1KB9D 2R3SA 1D7MA 1AQTA 4RJTA 1KTMA 5AVWB 2RN0A 3IN6A 3NXSA 4BRYB 3V2NA 3RL0D 2ZYAA 5AW4B 3M9BA 1Q7YQ 5KJ7C 2FYUD 2QIWA 2Q1KA 3U1AA 5KJ7D 2N1TA 3HUSC 4D6TG 3A0HE 2KLVA 2YMKA 1NKNA 1W5CE 3EFFK 3M91A 3TK1A 1P84H 1KYOI 3W68A 4DZOA 5KKZB 3CWBG 4XA4A 1H0TA 1SQVJ 1YTZI 3S9OA 3N7NA 1N86A 2OARA 3SWKA 5CCHC 3TGUE 2BEZF 2WT7A 1NOHA 2W6JH 3L72E 1RF1B 1L4AA 3BRTB 4QMAA 2GUVA 1NU1D 1JY2P 3H1HD 3HUSB 3V2QA 1YTZT 4HB1A 1NTME 1X8YA 1S5LE 2ZAEB 2ZT9B 3GLMA 2KK7A 1XTCC 1YJ9P 1SQPJ 3L74E 1FOSE 1JNMA 2QEXP 3CC2P 3VOPA 2JO1A 3H32A 3CCJP 2Q5UA 5KAIE 1SQQE 3FWNA 1AJYA 1NHLA 3ITKA 1JMBA 1NH4A 5AW8B 2M3BA 2PFXA 2ZYDA 4L76A 4WY4D 5H2FE 3TSIA 2XV5A 3VP8A 4UB8E 1KD1Q 2OYIB 1UIIA 4C7NB 1RF0C 1KILA 2IBZG 2N9BA 1RF1C 2Y9ZA 1NTKE 4WB4A 3GF7A 1IFPA 2B9BA 2YO2A 2WWWA 1VQ6P 1J1DC 2YKPA 3D6ZA 5KLVG 1L0NJ 1DEBA 2KIKA 2ZVNB 1SQBK 1NTZE 1SS1A 3QWOC 3RGUA 4D6TE 1BCCJ 2Y0CA 4XE5B 2RH0A 2BASA 3AEBC 4PV1D 4UB6H 2R44A 1HGVA 1L0LD 2W27A 2KLUA 3N4XA 2KUBA 5CCGD 1RE3A 1RHZB 2QRXA 3B4SA 1URQC 4JF7A 1EZVE 4EI2A 5AVXB 3VN0A 1MKMA 2P1JA 3KHUA 4R4LA 2P10A 5CHXA 1ZRTD 4C46A 1GU5A 3HD7B 1PGJA 4IFDK 4JPZB 5KLVJ 2IBZD 1K8AQ 2YO3A 5CBOA 1GMJA 3L75G 1M1JC 4IFMA 1NVOA 1CZQA 1T6AA 3H1JE 3V6IA 1QVFO 1EDLA 1H0TB 2WSSH 5AVYB 3RBZA 1NAYA 3L75E 1J1EB 1VQ8P 3CX5E 1T8ZA 4U3FG 2E75C 3SWYA 3B5NC 1PFIA 1VL2A 1AFOA 1RF0A 2O01H 5CMZA 5BU8B 4L73A 2R5BA 3TGUD 3CD6P 4ZMDA 3OAKA 3V5BA 1ZR2A 1LTIC 4XFJA 1U57A 1SQQK 1ZN5A 3CCEP 1AV1A 3H1HE 4GODA 2KOGA 2FYNB 1K05A 1LT1A 1FZCB 1IJDB 1MFTA 3L71J 1IFJA 2E74D 1SQPG 3VTPC 2IX7C 3TGUG 5KKZC 2PGDA 1Y9BA 4IL6E 2O1KA 1X22A 2LXCB 5AVUB 1Q90D 1VQNP 3AE1C 1L0LJ 1OIPA 1LJ2A 2IFNA 2B88A 1FS0E 1PPJE 1PL5A 3L71G 1MV8A 2CK3H 3LW5J 1KORA 5KAFE 5GTIH 1VQ5P 3AEDC 5CCHA 3L71E 1HUCA 1L0ND 1IFDA 3H1IE 1NTZK 5AW6B 2OYHB 5E79E 1DIPA 1EDJA 2G8YA 1KFMA 1QVGO 1SQBG 3HD7D 3M0DC 1USEA 2P58A 1AA0A 2V7QH 4LLHA 4NPFX 1GL2D 3GHGB 2IYPA 1GZLA 4N78E 4OGQD 2Q9IA 1KZUB 5AW3B 1WMKA 5APXA 4L74A 1BSNA 4Y99B 1GU4A 4H13C 2QJKC 1JTHB 5BVZA 3A7OA 1LTAC 1ZMEC 3H1LD 1U7JA 1JY3P 2K9JA 4GKGA 3IR9A 1W2EA 1M56D 2LR2A 4JBZA 5APVA 4Z1MH 1IK7A 2L5GB 1JM0A 2UWJE 3IFMA 4ZKPA 5KLVE 1A02F 1T2KC 2WSCJ 4GOEA 4JQ0D 1CI6A 2JWDA 3L70G 3RBXA 1MZ9A 2HG5D 4JYCA 1S9KE 1S1CX 1NO4A 1SQQG 1KQLA 1KQGB 3AEEC 3H1HJ 2N9YB 2OTKE 5E79H 1BDCA 4D6TJ 1YITP 2K3RA 3A0BH 1L0LK 2E5TA 1KB9H 4EDFA 2FBWC 1NJIQ 2FKWB 3ABVC 1S9KD 1JY2O 1OVVA 4WY4C 1QLED 2JDIH 3R2PA 1FDOA 3ZDMA 4PJ0H 3PP5A 3RK2C 2FFDB 5AVQB 1HWTC 1ZRTE 1JMMA 1FC2C 2A06G 2JEEA 2MJZA 5AW1B 1XTGB 1KYOE 1KFNA 2I1JA 2WQYC 4WVZA 2LKMA 1IZNB 3OW2O 3AE7C 3HD7A 3V2RA 2C9LY 1JY3O 3O8ZA 1LP1A 3HUSA 3NMDA 3B8EB 5B66E 4ZNCA 2ZXXA 4OGQB 1J1EC 3HE5B 3I56P 2A06D 3M06A 1EXIA 5APWA 2Q7CA 5KLIC 3FXEA 1JO5A 2WTYA 1R5LA 1X0TA 2FYUE 2XNXA 1GTWA 1SFCA 2JWAA 3GHGA 2FYUJ 1FE6A 1NTZG 1EZVD 1PGOA 2BCCD 2JJLA 2QJYB 1P84I 3KXDA 3T97B 3CCVP 1LP1B 3CLQA 1L4AC 3OA7A 3B5ND 3EQ2A 3L72J 1KQSO 2KP8A 1SQBD 1LGHB 5DJTB 2M8RA 1EXJA 3PRJA 1G1JA 5KAFH 1N7LA 1R5SA 4LC1A 3L4FA 3RK2B 1OVUA 4KT0J 1N7SD 4DCKA 1N73C 3GG2A 2NPSA 3BCCD 1S72P 1JUNA 2Z5IA 3USSA 2O01J 2HR3A 3L71D 1NWQA 1FU1A 1NTMK 1SQBJ 1VF5C 2MKVA 3OJAB 3CXHE 1L0NK 1N8RQ 1P84E 3CWBE 3Q5RA 2AXTE 2XNDH 3MD0A 1LT9A 2QSIA 2H8PD 3AE4C 3SWFA 3IAOA 3CMEP 1GW3A 1JCCA 1FZBA 2A45H 1NKZB 2KZIA 3LIEA 4WBAA 1LTTC 3GHGC 1CW5A 1BE3E 2XZRA 3TF5A 2BEQD 4W7YA 4AUWA 2IBZI 2YKOA 3AEFC 1NTMJ 2K37A 4HJGH 1BE3G 3L73D 3O6QA 4CPGA 3MHVA 2J59M 2QJYC 4K3AA 3L72G 3KQGA 4AQRD 4WWIA 1SQXD 1PP9D 1Y8AA 2C0WA 2M0BA 2WPQA 3WUVA 4B86A 3BASA 2ZFCA 3RK3C 3CCLP 1FJKA 1Y47A 3H1LG 5KLVD 3FXDA 1YQ3C 4H0LB 3L73E 2FFDA 1SQVG 1OW7A 5KLIB 1HJ0A 2VRSA 1GW4A 3L75D 3L72D 1GL2B 3B5NA 3C1LA 5KAIH 1E5WA 2JP3A 1USDA 3S4RA 3C9IA 2HODB 3RK3B 3CMAP 3Q2YA 1YQ4C 2ZJSE 4H44D 2FYUK 2B87B 2AXTH 4O9BA 4PD4D 4U3FJ 3KDPB 1L4AB 5AVVB 3RL0B 4I7ZC 3D6YA 3W67A 3JC22 2WT7B 1BGYJ 1HGZA 1JY3N 1SQVK 1BGYG 3UIAA 3KZIH 2KNCB 3HTKA 3P8MC 3MIWA 1M1JB 1J1DB 2ZXEB 2Y0DA 1FJPA 2D2CD 1M8OB 1S4XA 2K88A 3AE9C 3FX0A 1S5LX 2E43A 2QVAA 4RKUJ 2J58A 4AYCA 3Q5PA 1G2CB 4NPDA 1H88A 2O01N 1DX7A 1OVRA 2IZ1A 2ITAA 2IYOA 2G3AA 3AEGC 3H1IJ 1U7MA 3H1LJ 3P7KA 5AW0B 1YJWP 1R8EA 2E76D 5AW7B 2KZJA 4C7NA 1SFCC 1NTKD 1N73B 2E75D 1L0NE 1KV4A 3H1ID 2OGUA 2W83C 1BE3J 3AE5C 3AECC 4H44B 2OYOA 3JCUH 1LTJA 4U7JA 5APSA 3RL0C 1L0NG 1L4AD 1EZVG 3CCMP 1LWUA 1RF1A 1SQVD 1QL1A 4I1LA 3MTUE 1NTMD 5CJ0A 1RQUA 1Q81Q 1LTSC 2HPCA 2I1KA 3CWBJ 2O1JA 4DJGA 5B5EE 4H0LD 4YXWH 1ZV8A 3CXHD 3Q1MA 1KYOD 2N1TB 4EYYQ 3JSVC 4YPCA 1SQQD 2NZ2A 3V4WA 3WU2H 2HFED 4UB8H 5APTA 1DEEG 3H25A 2I8DA 4N3YB 3RK3D 3VMYA 1ZR4A 1DD3A 2HLOA 1IC2A 1G1IA 3L75J 4TLFA 1OXZA 1VQLP 2WPSA 3LIDA 3M0DA 1IFMA 4PV1B 1KN7A 1KMIZ 1L0LG 1FZEA 1AQ5A 3B71A 1FZFA 1PP9J 2PP6A 4BRYA 2IDBA 4GT1A 4OH8B 2QJKB 4OGQC 3RK2D 1NTZJ 1VDFA 1FZCC 4MN4C 1MUUA 3H1IG 5APQA 5AW9B 2E5YA 4K35A 1KILE 2N1TC 2W8ZA 4I6MC 5B5EH 5GTIE 3WUTA 1BCCG 2ZVOB 2JKVA 1URQD 1AVYA 2OQQA 3VMAA 5GTHH 2E76B 1HJBA 5TISE 1KYOH 1HBWA 2CPSA 5KLVK 4DT0A 1MFZA 1M1JA 3H6PA 2IPPA 1YBKA 1KILD 2YXRB 3F5HA 3G9RA 1P84D 2QJPB 2YIUB 3CWBD 3EFGA 3H1KJ 4H44C 4PD4H 1PPJD 4PJ0E 3CPWO 2K9JB 1YIJP 2GM4A 2E76C 2RKLA 4EIJA 1SFCD 2FFDC 4NPEA 2AEMA 3H32B 1KC8Q 4WY4B 5C39A 3Q5SA 3CC4P 2FYNC 3M0AA 3H1KG 4M3LA 1VQKP 2HODA 3L70E 1FBMA 1S2EA 2C0XA 1BCCD 3A3YB 2JR8A 3HE4A 3HRNA 2D2CC 3L36A 3H1HG 4IOIH 3V2PA 4L75A 1OW8A 2FY8A 1URQB 3K5BA 5CCGA 2OYHA 2ZT9D 2FXMA 3CCRP 1Q82Q 2WITA 2HYNA 2OYIA 5TISH 3I5CA 2AXCA 1NTMG 1YYCA 3V4QA 5AVZB 3TNUA 1PP9G 1PGQA 2GUSA 2WSEH 2QM8A 3A0BE 2YMYA 1FZAA 5CBNA 1VQOP 4PD4E 3RL0g 4GOFA 1RY3A 3H1JD 4OVNF 1W2BO 1BGYE 3P32A 1SLQA 4W7ZA 4C7RA 1K73Q 5AVTB 2NPSC 3BRVB 4I2LC 1TU3F 4HH2A 1N73A 2WSFH 3KPEA 3CX5D 3QH9A 3H1JG 1QL2A 4H0LC 4RESB 1NU1G 3VYIA 2B89A 5CCHD 1FZGA 1GK6A 1JEKA 1SQPK 5K5GB 4HKZH 1LTJC 4BWNA 1LTGC 1CI6B 1T2KD 1EQ7A 2CPBA 1H89A 1IFIA 3CL3D 1ZXGA 1K04A 1NU1J 3A0HH 4BXLA 5H2FH 3I55P 1OWAA 1JCDA 2R32A 2SPZA 1GK4A 5AW5B 5TJHA 2W90A 2XU6A 2POHA 3A2AA 2ZT9C 5APUA 3AE2C 2IZ0A 1N2DC 2A45I 3MZWB 3WMM0 3U1CA 1VQMP 3P8CD 1NTKG 2B87A 3C8VA 1Q86Q 2P2UA 1M1KQ 1QGKB 2Z4EA 3BVHA 1VF5D 4HYTB 4RO0A 4IL6H 3L37A 4WY4A 3SSUA 5KTBA 1H8AA 3E1IA 3PLNA 5CCGC 2OYHC 3FWLA 1YHQP 2OTLP 3CI9A 4JYBA 2KYVA 1SP4A 2QE7H 1E79H 1JOCA 3CX5H 2BCCE 1N7SC 4I7ZB 5EFWB 2E42A 1OX3A 3BCCG 2Q3EA 1OMIA 2M5AB 2V4HA 3CXHH 1S5LH 1SVFA 1KQFB 1KILC 1ZLLA 3PTZA 3SFDC 3L74D 1SQBE 1RE4C 4PV1C 1BDDA 4GDOA 1LTBC 3PH0A 3WUUA 4R4MA 2GA1A 2P67A 1VQ9P 1PGPA 2KS1A 1RH5B 1SQXK 2A45G 3R4YA 3CCQP 3AE8C 1FAVA 1NU1K 2NRGA 3M9QA 1GD2E 1UIXA 2M5AA 3S1KA 4DOJA 2E74B 2PRRA 3H1KE 2Y9YA 3TNUB 5CJ4A 1PZQA 2YNYA 5DJUB 1NGMB 3NFQA 3JCUE 2H89C 3VMZA 2KSEA 1FDMA 4UB6E
chains in the Genus database with same CATH topology
3CXHI 3TGUJ 3H1IJ 3L75J 3L74J 3H1LJ 3CX5I 4PD4I 3H1JJ 1SQQJ 2BCCJ 3L71J 1KB9I 3BCCJ 3L73J 1BE3J 1NTKJ 1PP9J 1SQBJ 1L0LJ 5KLVJ 1NTZJ 4U3FJ 1NU1J 1KYOI 3CWBJ 1SQXJ 1BGYJ 1EZVI 1SQVJ 3H1HJ 2FYUJ 4D6TJ 3L70J 2IBZI 1P84I 1NTMJ 1L0NJ 3L72J 1BCCJ 3H1KJ 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH I;  3TGU J;  3H1I J;  3L75 J;  3L74 J;  3H1L J;  3CX5 I;  4PD4 I;  3H1J J;  1SQQ J;  2BCC J;  3L71 J;  1KB9 I;  3BCC J;  3L73 J;  1BE3 J;  1NTK J;  1PP9 J;  1SQB J;  1L0L J;  5KLV J;  1NTZ J;  4U3F J;  1NU1 J;  1KYO I;  3CWB J;  1SQX J;  1BGY J;  1EZV I;  1SQV J;  3H1H J;  2FYU J;  4D6T J;  3L70 J;  2IBZ I;  1P84 I;  1NTM J;  1L0N J;  3L72 J;  1BCC J;  3H1K J;  1SQP J; 
#chains in the Genus database with same CATH topology
 4TT3 H;  2FYU G;  1SQV E;  1BCC E;  3TGU J;  2NPS B;  1SQP E;  1ZP0 C;  3L74 J;  3Q3D A;  1SQX G;  2W6B A;  4OWF A;  4PD4 I;  2H88 C;  2ZYG A;  1AVO A;  1VPC A;  2R5D A;  5L8R J;  3G4S P;  1BE3 D;  1HVV A;  4Y99 C;  2LXB A;  2WZ7 A;  1S3J A;  3HE4 B;  2YXQ B;  1KIL B;  2R3C A;  4H13 D;  2M3E A;  1NTK J;  1NYH A;  5AVR B;  3TDK A;  2H7H A;  3AEA C;  3AE3 C;  4KHX A;  1A02 J;  1N7S B;  3PJS K;  1WRG A;  2OYI C;  2DW3 A;  1RQV A;  2WSC H;  1KB9 E;  1PP9 E;  1OFC X;  1SFC B;  1T3U A;  1JTH A;  4N78 D;  4YTP C;  3RK3 E;  3G6E P;  1FOS F;  1M7L A;  1IK9 A;  1YI2 P;  1RE4 A;  1PIX A;  1EZV I;  2K1A A;  4ASW A;  1PPJ G;  2FYZ A;  1JB0 J;  2D2C B;  1M57 D;  1QX8 A;  3FGA D;  2E74 C;  1BSH A;  1N7S A;  1OW6 A;  3KZI E;  1YJN P;  1LT9 C;  2IFM A;  3O6Q B;  5BU5 A;  1K9M Q;  2KI7 B;  2KXP B;  1HH0 A;  1CSB A;  3E7K A;  2WSF J;  3MUD C;  2V7Q J;  2WPR A;  2Y0E A;  3F89 A;  3GW6 A;  1T3J A;  4GIF A;  2E75 B;  4ASV A;  3CXH I;  1HF9 A;  3P8C E;  2KB7 P;  3CX5 I;  1WT6 A;  2J5U A;  4H13 B;  1SQQ J;  2BCC J;  3VP9 A;  1EC5 A;  3D70 A;  1ZW0 A;  2WSE J;  2Q3I A;  1KB9 I;  2FXO A;  3VMX A;  1DD4 A;  3EWK A;  3LW5 H;  4KJM A;  4A7P A;  4N6J A;  4Y28 J;  1GL2 C;  3HD7 C;  3M9H A;  3CCU P;  2C9N Y;  2OTJ P;  1PV3 A;  2KS1 B;  2WPV B;  1SQX E;  2RMZ A;  1BGY D;  1VQ4 P;  2KNC A;  1Z56 A;  2WMM A;  2XDJ A;  1HTL C;  1NU1 E;  3HTK B;  2NPS D;  3KYQ A;  3L73 G;  3TYY A;  1FZC A;  2FXP A;  2QJP C;  2YIU C;  1VQP P;  2Z5H A;  3HE5 A;  3GMA A;  2KSJ A;  1M90 Q;  2QG4 A;  3A5T A;  2AEF A;  2H43 A;  2Q6Q A;  3AE6 C;  1FDI A;  1EDK A;  2K9Y A;  2A06 E;  2YKQ A;  3L35 A;  2IBZ E;  5AVS B;  3T97 A;  3WU2 E;  3D71 A;  1JY2 N;  3MGN A;  5AW2 B;  4EOT A;  4U3F D;  5KJ7 A;  2N1T D;  1DH3 A;  2WVR A;  1Q2N A;  1URQ A;  3MUD A;  3G71 P;  1ZOY C;  1RE3 C;  3H1J J;  4YXD C;  1L2P A;  4D6T D;  2HPC B;  1VQ7 P;  1LNQ A;  2XKM A;  1VF5 B;  3BCC J;  3L73 J;  3CC7 P;  1LTJ B;  1SQP D;  3NTN A;  4ZKU A;  2QA4 P;  1X79 B;  3BAT A;  1LWU B;  1L0L E;  3G3Z A;  4LGD E;  4U3F E;  3U59 A;  2AEJ A;  5B66 H;  3CCS P;  1GDT A;  1IO4 A;  1X9V A;  1GL2 A;  3B5N B;  1J2J B;  2O3J A;  3H1K D;  4IFF A;  3L70 D;  4IL6 X;  1SQX J;  3MP7 B;  3IF4 A;  3L74 G;  3PHL A;  4W80 A;  2QM7 A;  2W6A A;  1EDI A;  1NTZ D;  2BCC G;  3E1R A;  1IFN A;  3GF3 A;  2P7J A;  3BCC E;  3H1L E;  1LWU C;  1QEX A;  3L70 J;  1G2C A;  1LT9 B;  5GTH E;  1OZH A;  2PAJ A;  3SFE C;  1NTK K;  1NAF A;  5M1B A;  3II6 A;  2L91 A;  5APY A;  1KB9 D;  2R3S A;  1D7M A;  1AQT A;  4RJT A;  1KTM A;  5AVW B;  2RN0 A;  3IN6 A;  3NXS A;  4BRY B;  3V2N A;  3RL0 D;  2ZYA A;  5AW4 B;  3M9B A;  1Q7Y Q;  5KJ7 C;  2FYU D;  2QIW A;  2Q1K A;  3U1A A;  5KJ7 D;  2N1T A;  3HUS C;  4D6T G;  3A0H E;  2KLV A;  2YMK A;  1NKN A;  1W5C E;  3EFF K;  3M91 A;  3TK1 A;  1P84 H;  1KYO I;  3W68 A;  4DZO A;  5KKZ B;  3CWB G;  4XA4 A;  1H0T A;  1SQV J;  1YTZ I;  3S9O A;  3N7N A;  1N86 A;  2OAR A;  3SWK A;  5CCH C;  3TGU E;  2BEZ F;  2WT7 A;  1NOH A;  2W6J H;  3L72 E;  1RF1 B;  1L4A A;  3BRT B;  4QMA A;  2GUV A;  1NU1 D;  1JY2 P;  3H1H D;  3HUS B;  3V2Q A;  1YTZ T;  4HB1 A;  1NTM E;  1X8Y A;  1S5L E;  2ZAE B;  2ZT9 B;  3GLM A;  2KK7 A;  1XTC C;  1YJ9 P;  1SQP J;  3L74 E;  1FOS E;  1JNM A;  2QEX P;  3CC2 P;  3VOP A;  2JO1 A;  3H32 A;  3CCJ P;  2Q5U A;  5KAI E;  1SQQ E;  3FWN A;  1AJY A;  1NHL A;  3ITK A;  1JMB A;  1NH4 A;  5AW8 B;  2M3B A;  2PFX A;  2ZYD A;  4L76 A;  4WY4 D;  5H2F E;  3TSI A;  2XV5 A;  3VP8 A;  4UB8 E;  1KD1 Q;  2OYI B;  1UII A;  4C7N B;  1RF0 C;  1KIL A;  2IBZ G;  2N9B A;  1RF1 C;  2Y9Z A;  1NTK E;  4WB4 A;  3GF7 A;  1IFP A;  2B9B A;  2YO2 A;  2WWW A;  1VQ6 P;  1J1D C;  2YKP A;  3D6Z A;  5KLV G;  1L0N J;  1DEB A;  2KIK A;  2ZVN B;  1SQB K;  1NTZ E;  1SS1 A;  3QWO C;  3RGU A;  4D6T E;  1BCC J;  2Y0C A;  4XE5 B;  2RH0 A;  2BAS A;  3AEB C;  4PV1 D;  4UB6 H;  2R44 A;  1HGV A;  1L0L D;  2W27 A;  2KLU A;  3N4X A;  2KUB A;  5CCG D;  1RE3 A;  1RHZ B;  2QRX A;  3B4S A;  1URQ C;  4JF7 A;  1EZV E;  4EI2 A;  5AVX B;  3VN0 A;  1MKM A;  2P1J A;  3KHU A;  4R4L A;  2P10 A;  5CHX A;  1ZRT D;  4C46 A;  1GU5 A;  3HD7 B;  1PGJ A;  4IFD K;  4JPZ B;  5KLV J;  2IBZ D;  1K8A Q;  2YO3 A;  5CBO A;  1GMJ A;  3L75 G;  1M1J C;  4IFM A;  1NVO A;  1CZQ A;  1T6A A;  3H1J E;  3V6I A;  1QVF O;  1EDL A;  1H0T B;  2WSS H;  5AVY B;  3RBZ A;  1NAY A;  3L75 E;  1J1E B;  1VQ8 P;  3CX5 E;  1T8Z A;  4U3F G;  2E75 C;  3SWY A;  3B5N C;  1PFI A;  1VL2 A;  1AFO A;  1RF0 A;  2O01 H;  5CMZ A;  5BU8 B;  4L73 A;  2R5B A;  3TGU D;  3CD6 P;  4ZMD A;  3OAK A;  3V5B A;  1ZR2 A;  1LTI C;  4XFJ A;  1U57 A;  1SQQ K;  1ZN5 A;  3CCE P;  1AV1 A;  3H1H E;  4GOD A;  2KOG A;  2FYN B;  1K05 A;  1LT1 A;  1FZC B;  1IJD B;  1MFT A;  3L71 J;  1IFJ A;  2E74 D;  1SQP G;  3VTP C;  2IX7 C;  3TGU G;  5KKZ C;  2PGD A;  1Y9B A;  4IL6 E;  2O1K A;  1X22 A;  2LXC B;  5AVU B;  1Q90 D;  1VQN P;  3AE1 C;  1L0L J;  1OIP A;  1LJ2 A;  2IFN A;  2B88 A;  1FS0 E;  1PPJ E;  1PL5 A;  3L71 G;  1MV8 A;  2CK3 H;  3LW5 J;  1KOR A;  5KAF E;  5GTI H;  1VQ5 P;  3AED C;  5CCH A;  3L71 E;  1HUC A;  1L0N D;  1IFD A;  3H1I E;  1NTZ K;  5AW6 B;  2OYH B;  5E79 E;  1DIP A;  1EDJ A;  2G8Y A;  1KFM A;  1QVG O;  1SQB G;  3HD7 D;  3M0D C;  1USE A;  2P58 A;  1AA0 A;  2V7Q H;  4LLH A;  4NPF X;  1GL2 D;  3GHG B;  2IYP A;  1GZL A;  4N78 E;  4OGQ D;  2Q9I A;  1KZU B;  5AW3 B;  1WMK A;  5APX A;  4L74 A;  1BSN A;  4Y99 B;  1GU4 A;  4H13 C;  2QJK C;  1JTH B;  5BVZ A;  3A7O A;  1LTA C;  1ZME C;  3H1L D;  1U7J A;  1JY3 P;  2K9J A;  4GKG A;  3IR9 A;  1W2E A;  1M56 D;  2LR2 A;  4JBZ A;  5APV A;  4Z1M H;  1IK7 A;  2L5G B;  1JM0 A;  2UWJ E;  3IFM A;  4ZKP A;  5KLV E;  1A02 F;  1T2K C;  2WSC J;  4GOE A;  4JQ0 D;  1CI6 A;  2JWD A;  3L70 G;  3RBX A;  1MZ9 A;  2HG5 D;  4JYC A;  1S9K E;  1S1C X;  1NO4 A;  1SQQ G;  1KQL A;  1KQG B;  3AEE C;  3H1H J;  2N9Y B;  2OTK E;  5E79 H;  1BDC A;  4D6T J;  1YIT P;  2K3R A;  3A0B H;  1L0L K;  2E5T A;  1KB9 H;  4EDF A;  2FBW C;  1NJI Q;  2FKW B;  3ABV C;  1S9K D;  1JY2 O;  1OVV A;  4WY4 C;  1QLE D;  2JDI H;  3R2P A;  1FDO A;  3ZDM A;  4PJ0 H;  3PP5 A;  3RK2 C;  2FFD B;  5AVQ B;  1HWT C;  1ZRT E;  1JMM A;  1FC2 C;  2A06 G;  2JEE A;  2MJZ A;  5AW1 B;  1XTG B;  1KYO E;  1KFN A;  2I1J A;  2WQY C;  4WVZ A;  2LKM A;  1IZN B;  3OW2 O;  3AE7 C;  3HD7 A;  3V2R A;  2C9L Y;  1JY3 O;  3O8Z A;  1LP1 A;  3HUS A;  3NMD A;  3B8E B;  5B66 E;  4ZNC A;  2ZXX A;  4OGQ B;  1J1E C;  3HE5 B;  3I56 P;  2A06 D;  3M06 A;  1EXI A;  5APW A;  2Q7C A;  5KLI C;  3FXE A;  1JO5 A;  2WTY A;  1R5L A;  1X0T A;  2FYU E;  2XNX A;  1GTW A;  1SFC A;  2JWA A;  3GHG A;  2FYU J;  1FE6 A;  1NTZ G;  1EZV D;  1PGO A;  2BCC D;  2JJL A;  2QJY B;  1P84 I;  3KXD A;  3T97 B;  3CCV P;  1LP1 B;  3CLQ A;  1L4A C;  3OA7 A;  3B5N D;  3EQ2 A;  3L72 J;  1KQS O;  2KP8 A;  1SQB D;  1LGH B;  5DJT B;  2M8R A;  1EXJ A;  3PRJ A;  1G1J A;  5KAF H;  1N7L A;  1R5S A;  4LC1 A;  3L4F A;  3RK2 B;  1OVU A;  4KT0 J;  1N7S D;  4DCK A;  1N73 C;  3GG2 A;  2NPS A;  3BCC D;  1S72 P;  1JUN A;  2Z5I A;  3USS A;  2O01 J;  2HR3 A;  3L71 D;  1NWQ A;  1FU1 A;  1NTM K;  1SQB J;  1VF5 C;  2MKV A;  3OJA B;  3CXH E;  1L0N K;  1N8R Q;  1P84 E;  3CWB E;  3Q5R A;  2AXT E;  2XND H;  3MD0 A;  1LT9 A;  2QSI A;  2H8P D;  3AE4 C;  3SWF A;  3IAO A;  3CME P;  1GW3 A;  1JCC A;  1FZB A;  2A45 H;  1NKZ B;  2KZI A;  3LIE A;  4WBA A;  1LTT C;  3GHG C;  1CW5 A;  1BE3 E;  2XZR A;  3TF5 A;  2BEQ D;  4W7Y A;  4AUW A;  2IBZ I;  2YKO A;  3AEF C;  1NTM J;  2K37 A;  4HJG H;  1BE3 G;  3L73 D;  3O6Q A;  4CPG A;  3MHV A;  2J59 M;  2QJY C;  4K3A A;  3L72 G;  3KQG A;  4AQR D;  4WWI A;  1SQX D;  1PP9 D;  1Y8A A;  2C0W A;  2M0B A;  2WPQ A;  3WUV A;  4B86 A;  3BAS A;  2ZFC A;  3RK3 C;  3CCL P;  1FJK A;  1Y47 A;  3H1L G;  5KLV D;  3FXD A;  1YQ3 C;  4H0L B;  3L73 E;  2FFD A;  1SQV G;  1OW7 A;  5KLI B;  1HJ0 A;  2VRS A;  1GW4 A;  3L75 D;  3L72 D;  1GL2 B;  3B5N A;  3C1L A;  5KAI H;  1E5W A;  2JP3 A;  1USD A;  3S4R A;  3C9I A;  2HOD B;  3RK3 B;  3CMA P;  3Q2Y A;  1YQ4 C;  2ZJS E;  4H44 D;  2FYU K;  2B87 B;  2AXT H;  4O9B A;  4PD4 D;  4U3F J;  3KDP B;  1L4A B;  5AVV B;  3RL0 B;  4I7Z C;  3D6Y A;  3W67 A;  3JC2 2;  2WT7 B;  1BGY J;  1HGZ A;  1JY3 N;  1SQV K;  1BGY G;  3UIA A;  3KZI H;  2KNC B;  3HTK A;  3P8M C;  3MIW A;  1M1J B;  1J1D B;  2ZXE B;  2Y0D A;  1FJP A;  2D2C D;  1M8O B;  1S4X A;  2K88 A;  3AE9 C;  3FX0 A;  1S5L X;  2E43 A;  2QVA A;  4RKU J;  2J58 A;  4AYC A;  3Q5P A;  1G2C B;  4NPD A;  1H88 A;  2O01 N;  1DX7 A;  1OVR A;  2IZ1 A;  2ITA A;  2IYO A;  2G3A A;  3AEG C;  3H1I J;  1U7M A;  3H1L J;  3P7K A;  5AW0 B;  1YJW P;  1R8E A;  2E76 D;  5AW7 B;  2KZJ A;  4C7N A;  1SFC C;  1NTK D;  1N73 B;  2E75 D;  1L0N E;  1KV4 A;  3H1I D;  2OGU A;  2W83 C;  1BE3 J;  3AE5 C;  3AEC C;  4H44 B;  2OYO A;  3JCU H;  1LTJ A;  4U7J A;  5APS A;  3RL0 C;  1L0N G;  1L4A D;  1EZV G;  3CCM P;  1LWU A;  1RF1 A;  1SQV D;  1QL1 A;  4I1L A;  3MTU E;  1NTM D;  5CJ0 A;  1RQU A;  1Q81 Q;  1LTS C;  2HPC A;  2I1K A;  3CWB J;  2O1J A;  4DJG A;  5B5E E;  4H0L D;  4YXW H;  1ZV8 A;  3CXH D;  3Q1M A;  1KYO D;  2N1T B;  4EYY Q;  3JSV C;  4YPC A;  1SQQ D;  2NZ2 A;  3V4W A;  3WU2 H;  2HFE D;  4UB8 H;  5APT A;  1DEE G;  3H25 A;  2I8D A;  4N3Y B;  3RK3 D;  3VMY A;  1ZR4 A;  1DD3 A;  2HLO A;  1IC2 A;  1G1I A;  3L75 J;  4TLF A;  1OXZ A;  1VQL P;  2WPS A;  3LID A;  3M0D A;  1IFM A;  4PV1 B;  1KN7 A;  1KMI Z;  1L0L G;  1FZE A;  1AQ5 A;  3B71 A;  1FZF A;  1PP9 J;  2PP6 A;  4BRY A;  2IDB A;  4GT1 A;  4OH8 B;  2QJK B;  4OGQ C;  3RK2 D;  1NTZ J;  1VDF A;  1FZC C;  4MN4 C;  1MUU A;  3H1I G;  5APQ A;  5AW9 B;  2E5Y A;  4K35 A;  1KIL E;  2N1T C;  2W8Z A;  4I6M C;  5B5E H;  5GTI E;  3WUT A;  1BCC G;  2ZVO B;  2JKV A;  1URQ D;  1AVY A;  2OQQ A;  3VMA A;  5GTH H;  2E76 B;  1HJB A;  5TIS E;  1KYO H;  1HBW A;  2CPS A;  5KLV K;  4DT0 A;  1MFZ A;  1M1J A;  3H6P A;  2IPP A;  1YBK A;  1KIL D;  2YXR B;  3F5H A;  3G9R A;  1P84 D;  2QJP B;  2YIU B;  3CWB D;  3EFG A;  3H1K J;  4H44 C;  4PD4 H;  1PPJ D;  4PJ0 E;  3CPW O;  2K9J B;  1YIJ P;  2GM4 A;  2E76 C;  2RKL A;  4EIJ A;  1SFC D;  2FFD C;  4NPE A;  2AEM A;  3H32 B;  1KC8 Q;  4WY4 B;  5C39 A;  3Q5S A;  3CC4 P;  2FYN C;  3M0A A;  3H1K G;  4M3L A;  1VQK P;  2HOD A;  3L70 E;  1FBM A;  1S2E A;  2C0X A;  1BCC D;  3A3Y B;  2JR8 A;  3HE4 A;  3HRN A;  2D2C C;  3L36 A;  3H1H G;  4IOI H;  3V2P A;  4L75 A;  1OW8 A;  2FY8 A;  1URQ B;  3K5B A;  5CCG A;  2OYH A;  2ZT9 D;  2FXM A;  3CCR P;  1Q82 Q;  2WIT A;  2HYN A;  2OYI A;  5TIS H;  3I5C A;  2AXC A;  1NTM G;  1YYC A;  3V4Q A;  5AVZ B;  3TNU A;  1PP9 G;  1PGQ A;  2GUS A;  2WSE H;  2QM8 A;  3A0B E;  2YMY A;  1FZA A;  5CBN A;  1VQO P;  4PD4 E;  3RL0 g;  4GOF A;  1RY3 A;  3H1J D;  4OVN F;  1W2B O;  1BGY E;  3P32 A;  1SLQ A;  4W7Z A;  4C7R A;  1K73 Q;  5AVT B;  2NPS C;  3BRV B;  4I2L C;  1TU3 F;  4HH2 A;  1N73 A;  2WSF H;  3KPE A;  3CX5 D;  3QH9 A;  3H1J G;  1QL2 A;  4H0L C;  4RES B;  1NU1 G;  3VYI A;  2B89 A;  5CCH D;  1FZG A;  1GK6 A;  1JEK A;  1SQP K;  5K5G B;  4HKZ H;  1LTJ C;  4BWN A;  1LTG C;  1CI6 B;  1T2K D;  1EQ7 A;  2CPB A;  1H89 A;  1IFI A;  3CL3 D;  1ZXG A;  1K04 A;  1NU1 J;  3A0H H;  4BXL A;  5H2F H;  3I55 P;  1OWA A;  1JCD A;  2R32 A;  2SPZ A;  1GK4 A;  5AW5 B;  5TJH A;  2W90 A;  2XU6 A;  2POH A;  3A2A A;  2ZT9 C;  5APU A;  3AE2 C;  2IZ0 A;  1N2D C;  2A45 I;  3MZW B;  3WMM 0;  3U1C A;  1VQM P;  3P8C D;  1NTK G;  2B87 A;  3C8V A;  1Q86 Q;  2P2U A;  1M1K Q;  1QGK B;  2Z4E A;  3BVH A;  1VF5 D;  4HYT B;  4RO0 A;  4IL6 H;  3L37 A;  4WY4 A;  3SSU A;  5KTB A;  1H8A A;  3E1I A;  3PLN A;  5CCG C;  2OYH C;  3FWL A;  1YHQ P;  2OTL P;  3CI9 A;  4JYB A;  2KYV A;  1SP4 A;  2QE7 H;  1E79 H;  1JOC A;  3CX5 H;  2BCC E;  1N7S C;  4I7Z B;  5EFW B;  2E42 A;  1OX3 A;  3BCC G;  2Q3E A;  1OMI A;  2M5A B;  2V4H A;  3CXH H;  1S5L H;  1SVF A;  1KQF B;  1KIL C;  1ZLL A;  3PTZ A;  3SFD C;  3L74 D;  1SQB E;  1RE4 C;  4PV1 C;  1BDD A;  4GDO A;  1LTB C;  3PH0 A;  3WUU A;  4R4M A;  2GA1 A;  2P67 A;  1VQ9 P;  1PGP A;  2KS1 A;  1RH5 B;  1SQX K;  2A45 G;  3R4Y A;  3CCQ P;  3AE8 C;  1FAV A;  1NU1 K;  2NRG A;  3M9Q A;  1GD2 E;  1UIX A;  2M5A A;  3S1K A;  4DOJ A;  2E74 B;  2PRR A;  3H1K E;  2Y9Y A;  3TNU B;  5CJ4 A;  1PZQ A;  2YNY A;  5DJU B;  1NGM B;  3NFQ A;  3JCU E;  2H89 C;  3VMZ A;  2KSE A;  1FDM A;  4UB6 E; 
#chains in the Genus database with same CATH homology
 3CXH I;  3TGU J;  3H1I J;  3L75 J;  3L74 J;  3H1L J;  3CX5 I;  4PD4 I;  3H1J J;  1SQQ J;  2BCC J;  3L71 J;  1KB9 I;  3BCC J;  3L73 J;  1BE3 J;  1NTK J;  1PP9 J;  1SQB J;  1L0L J;  5KLV J;  1NTZ J;  4U3F J;  1NU1 J;  1KYO I;  3CWB J;  1SQX J;  1BGY J;  1EZV I;  1SQV J;  3H1H J;  2FYU J;  4D6T J;  3L70 J;  2IBZ I;  1P84 I;  1NTM J;  1L0N J;  3L72 J;  1BCC J;  3H1K J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...