3H1KD

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 62
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1kD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1kD02
3TYIA 2CA4B 4FANA 3ZCFA 1A2SA 3RMZA 3WFEC 1N15A 1H33B 4Y5RA 2KS1A 1CIHA 5AURA 2MTAC 2LIRA 1CRGA 3MK7C 2YIUB 1NMIA 1A8CA 3H1HD 1WVEC 3NBSA 3L4MA 4KMGA 4XXLA 1N9CA 2N18C 4QAOA 4WQEA 2O3JA 5B66V 1RAQA 1CSWA 1S5LV 4WQCA 2QG4A 2BGVX 2BPBB 1CSUA 1PPJD 1CO6A 1W2LA 3L71D 5C9MA 2BCNB 4WQAA 1H9XA 1I6EA 3ITKA 2ORLA 4J20A 1C2RA 2BLFB 4PD4D 1IRVA 1HJ4A 1ETPA 1JDLA 4AX3A 4P4QB 1CYCA 1KV9A 1CORA 1AKKA 4DY9A 1CSXA 2Y0CA 1HJ5A 3JBTB 2JWAA 3DR0A 1RZ5A 2D0WA 2RMZA 3GG2A 3BCCD 5CIDB 1L9BC 3CXHW 1GKSA 2CA3B 1BGYD 4K3IA 1MG2D 3RN1A 2HV4A 2AXTV 1HZVA 4AAOA 3GW6A 1IO3A 3SLEA 4L1QA 2GIWA 1FCDC 4RSZA 3MK7B 2ZZS1 3KZIV 4PW9B 1L0LD 5DF5A 1GJQA 1E29A 2BH5X 5CIEB 1H33A 2N18B 3CX5D 2B10B 1I54A 1R0QA 1GQ1A 4YE1A 1M70A 3A0BV 2N9JA 1DIQC 3O1YA 2B11B 5E79V 1M60A 4IL6V 1IZL0 1CIGA 4FA4A 4FA9A 1YIQA 3O20A 1QL4A 1C75A 3SWSA 3PXWA 1H31B 1SQXD 1DW0A 3PLNA 4GYDA 2N9YB 1QL3A 1YFCA 5CIBB 2B12B 2YCCA 1YEBA 5EXQA 3A9FA 1FJ0A 1NIRA 4D6TD 1QYZA 5CIFB 3FWLA 2A06D 3RN0A 1I5TA 4WQDA 1L9JC 5KAIV 3HQ6A 1CCRA 1I8PA 1OCDA 4EICA 1CHHA 1I8OA 2JTIB 1DVHA 1YCCA 1MZ4A 1CXCA 1CHJA 1IQCA 451CA 2PCBB 4EIEA 1E8EA 3WC8A 2C9XB 1CRHA 3OCDB 2AIUA 1CRIA 1BE3D 3CU4A 3TF5A 4N0KA 155CA 3L72D 1IRWA 4LJIA 5CYTR 1CEDA 1HZUA 1K3HA 1KX2A 3CX5W 3WU2V 2I8FA 3CWBD 1H31A 2C8SA 4L3HA 4UB8V 2L4DA 4PJ0V 4WQBA 1DIIC 2C1VA 3OA8B 3H1JD 4AANA 2FYUD 1DW1A 1E2RA 3CYTI 1MG3D 5GTIV 5H2FV 3PRJA 5DJQC 3ZOOA 1LC2A 2V08A 1U74B 2B0ZB 3HQ8A 2KNCB 3L75D 1CSVA 4WQ7A 3PTZA 1LMSA 1I55A 3KHUA 1S6VB 3TGUD 1OAEA 1CIFA 3X39A 2ZXYA 3O0RC 4L3GA 1AYGA 4O1WA 2N3YA 1FI7A 4PWAA 2DVHA 3ORVA 1KX7A 1NNOA 4XYDB 3SJLA 1NMLA 2XTSB 1FHBA 5KLIB 3O5CA 2Q3EA 2PACA 1P84D 3A0HV 3WFCC 1DT1A 2C1DB 2YK3A 2B4ZA 1FI9A 1VYDA 2GB8B 3NWVA 2C2CA 3H1ID 5CIHB 1COTA 3VMAA 4FAVA 1SQQD 1DVVA 3OCDA 1KYOD 1H9YA 3L70D 1N50A 5IY51 1M6ZA 5CIGB 1C6SA 4GEDB 3ZIYA 4O1QA 3H1KD 4EIFA 4EIDA 3WFBC 2ZBOA 1CCHA 4AAMA 1U75B 5DJQB 351CA 3PH2B 1B7VA 3OA8A 3H1LD 1CNOA 2BCCD 1K3GA 2QJPB 2OZ1B 1NTZD 3RLMA 1FI3A 1N90A 2RN0A 3NBTA 1QKSA 4RJTA 1GIWA 1LFMA 2CE1A 3C2CA 3PXSA 2QJYB 3L73D 4FB1A 1L0ND 4WQ9A 2Y0EA 3SXTA 2FRCA 3DP5A 1CTZA 2N9IA 2GC7D 4H0KA 4H0JA 1DW3A 4FA1A 3ZOWA 3ZOXA 3ZOYA 2EXVA 1EZVD 2CXBA 4MU8A 2DGEA 3PXTA 2FWLA 2YQBA 3DMIA 1CHIA 1PP9D 1NTMD 2C1DA 1WEJF 2FYNB 2C1UA 1CXAA 2IBZD 4UB6V 1CTYA 1HCMA 5CICB 2GC4D 2Y0DA 2VHDA 1H32B 1C52A 3HQ9A 1HJ3A 2CE0A 1C7MA 3PHLA 1LS9A 2BH4X 3L4OA 5B6QA 2MHMA 2QJKB 1KYOW 1J3SA 2PCCB 4U3FD 5C0ZA 3VRDA 1YEAA 3CP5A 5GTHV 2OZ1A 5TJHA 1F1CA 5KLVD 1EB7A 1CRJA 4JCGA 5KAFV 1HH7A 1C6OA 3WUIA 1GU2A 4EDFA 1DW2A 1AOFA 4V2KA 1BCCD 1CRCA 1YTCA 3SVWA 3VYMA 2K9JB 2JQRA 1C6RA 1KB9D 1NTKD 1CYIA 5KKZB 4Q5PA 1HRCA 1KB0A 1FOCA 3WFDC 1RAPA 1C2NA 3VNWA 4A7PA 5DFSA 3ZBMA 1AOQA 3L74D 4FA5A 1W5CT 2ZOOA 1QN2A 1ZZHA 2V07A 1HROA 1KIBA 1H32A 1CRYA 4WQ8A 1SQVD 1F1FA 1CC5A 1CYJA 3CXHD 5B5EV 1GDVA 1BL9A 1SQBD 2L91A 3TDKA 5TISV 4NFGB 2D0SA 1CTJA 2AI5A 1YICA 1RZ6A 4AALA 2ZONG 1CIEA 1A56A 1LC1A 2LITA 2N3BA 3M97X 1I6DA 3HQ7A 1H1OA 1SQPD 1YNRA 1NU1D 1ZRTD
chains in the Genus database with same CATH superfamily
3EWKA 5KLVG 4H44B 5E79E 3WFEC 3VMYA 2OTJP 3L37A 1Y8AA 2E42A 2JJLA 1CRGA 1AA0A 3MK7C 1P84E 2O01J 2C9NY 1EC5A 3NBSA 3L4MA 4W7YA 3MTUE 1RAQA 2KZJA 1URQC 3MUDA 1S5LV 2J58A 4WQCA 2BGVX 2FXMA 5C9MA 3AEBC 2FXOA 1VF5C 4ASWA 2E74D 1NTKK 1KFNA 4PD4D 1IRVA 1HJ4A 2OYOA 4JBZA 3A5TA 1GDTA 2A06E 3I55P 1OFCX 1KV9A 1QL2A 3FX0A 1CORA 3KYQA 4DY9A 1CSXA 2Y0CA 1MKMA 2ZVNB 1JB0J 1J1EB 5CIDB 1VQPP 1GKSA 2CA3B 1WT6A 1MG2D 2HV4A 1HZVA 5AW3B 4YXDC 1SQBK 3SLEA 4L1QA 4H0LD 5AVXB 1S2EA 2FXPA 1L0LD 1JNMA 2XZRA 5CIEB 1NU1G 2N18B 3CX5D 2UWJE 1I54A 1R0QA 4YE1A 1M70A 2AXCA 3R2PA 1M60A 1GL2B 1DD3A 4XA4A 3SFDC 4Y28J 2IBZI 3AE3C 3O20A 5AW6B 1H31B 2IYPA 4H0LB 5CIBB 3CCJP 3CCLP 2YCCA 2H8PD 1YEBA 3H1HJ 1NIRA 4K35A 5CMZA 1YJNP 3VYIA 3KPEA 4H13B 1AFOA 4YPCA 2N1TC 2QIWA 2OQQA 1FBMA 1N86A 1I5TA 2FBWC 3HUSC 5GTHH 1EDJA 2H43A 1FZGA 1FE6A 3MD0A 1I8PA 1OCDA 3V2QA 3UIAA 1YTZT 1YTZI 2Z5IA 2IZ0A 1LT1A 4ZNCA 2P2UA 3Q5PA 1PGOA 3HD7A 5KLIC 1BCCE 3M06A 4PV1D 4EIEA 1E8EA 1NWQA 1YQ4C 3OCDB 1BGYJ 1BE3D 1L0LG 1KYOE 3TF5A 3L70E 3VOPA 4N0KA 2YO2A 3CMAP 1A02J 1JMBA 3L72D 1IRWA 2V7QJ 1SLQA 1CEDA 1LTGC 3WU2V 3LIEA 2NZ2A 2C8SA 4L3HA 2E76B 1KQLA 4WQBA 2C1VA 3OA8B 3HD7D 4AANA 1SFCD 1DW1A 2R5DA 1MG3D 5GTIV 4Y99B 3CXHI 3ZOOA 3N4XA 1U74B 1FC2C 3HQ8A 1PGPA 3AEEC 2A45G 3L75D 1SQXK 3KHUA 2KXPB 3TGUD 3CXHH 1DIPA 2ZYAA 1S4XA 5APYA 3V6IA 3LW5H 2JWDA 3E1IA 2N3YA 3H32B 4CPGA 3H1KJ 4PWAA 1L0NE 1KILD 4RKUJ 1NNOA 4D6TJ 3BRTB 1SFCB 3SJLA 1NMLA 1AQTA 2G3AA 2ZJSE 1FHBA 1L4AA 2FKWB 2PACA 2RKLA 1AVYA 1VQ4P 3HTKA 2QM7A 4LC1A 3SWFA 2C1DB 2LR2A 2B4ZA 4DZOA 1NTME 1VYDA 2OYIA 3NWVA 3AE5C 1SVFA 1Q7YQ 1FAVA 3ZDMA 1YJWP 1H9YA 5B66H 4K3AA 3IF4A 2HYNA 2BEZF 1KILB 3RK3C 1WRGA 4O1QA 1L4AD 3L73J 2ZYGA 1PPJE 1CCHA 2W83C 1BE3G 3VP8A 1U75B 1BSNA 3L72G 4L74A 3I56P 1B7VA 4PD4I 4LLHA 1LTJC 2QVAA 1CNOA 1M8OB 3G71P 1HWTC 1K3GA 1KV4A 2YNYA 5APVA 3RL0g 3CC7P 2KLVA 3OAKA 3AEDC 1ZOYC 3V2PA 2B9BA 2RN0A 3NBTA 5CJ4A 3CWBJ 2D2CD 4WY4C 3HE5B 2M5AB 3L75G 1S1CX 3EFFK 1ZW0A 4FB1A 2FYUJ 1FOSE 3SXTA 1QGKB 3TGUG 4OH8B 1T6AA 3JSVC 3ZOXA 3ZOYA 3CX5I 2E74C 1CHIA 1IC2A 1D7MA 2D2CB 2YXQB 3HE4B 1KB9H 2P67A 3GMAA 1CXAA 4IL6H 4UB6V 2B87B 2AEJA 3CX5H 3MUDC 2GC4D 5B5EE 4RESB 2E5YA 3EQ2A 1H32B 3HQ9A 1AQ5A 5AVZB 5AVWB 4I1LA 1G1IA 1LS9A 2A45I 4IOIH 3L4OA 2MHMA 1IFIA 3SFEC 1S9KD 1J3SA 3V4WA 4L76A 3H1IJ 2W6JH 2WPQA 3AECC 1SQQK 1PGJA 4U3FD 2A45H 1NHLA 2B88A 2ZXEB 3W68A 1M57D 3G3ZA 1NYHA 1EB7A 4HH2A 1RQUA 1NOHA 5KAFV 3S1KA 4KT0J 3Q5SA 3NXSA 5K5GB 3H1LJ 5CCHA 1GU2A 2KS1B 2BCCJ 1NTZK 1DW2A 3CI9A 3E7KA 5AW2B 1GTWA 3SVWA 2K9JB 2JQRA 3H1HE 2XU6A 1CYIA 3RK2D 2MJZA 1URQB 3B71A 2YIUC 3B5NA 2YXRB 1W2BO 3JCUE 2P10A 1USEA 2JR8A 3ZBMA 3L74D 1N73A 3B8EB 1W5CE 2I1JA 1ZZHA 1HROA 1NKZB 3MP7B 4UB8H 1CRYA 4PJ0H 1X0TA 1SQVD 3A2AA 1CC5A 1PP9J 1GDVA 1BL9A 3GHGB 2O1KA 2KNCA 4HKZH 1RF1A 4NFGB 1CTJA 1VQOP 1LTTC 1QEXA 1CI6A 2HPCA 4DT0A 1CIEA 1BGYE 2ZT9D 4PV1C 1SQPD 4U3FG 3TYIA 4FANA 2XV5A 1RQVA 1N15A 1H33B 2KI7B 4GT1A 5AURA 5KLVK 4KJMA 1NMIA 1X8YA 1PL5A 3HD7C 1E79H 2Y9YA 2R3CA 3P8CE 1N9CA 4QAOA 3P8MC 2E75D 5AW1B 1CSUA 1X9VA 1CO6A 1M1JA 2AEMA 1JY3P 3L71D 1OVRA 3D6YA 1H9XA 3H1KE 3ITKA 4OGQB 3B4SA 4D6TE 1ZR2A 1NTKJ 2WPRA 3L74G 2L5GB 2W27A 2XNDH 2N1TB 1RE3A 1AKKA 3P7KA 3CC2P 1HJ5A 2JWAA 1SQVG 2E75B 2WTYA 3RBZA 1L9BC 3CCQP 3CXHW 5KJ7A 2C0WA 2PP6A 2AXTV 2M0BA 4I7ZB 3S4RA 4GOEA 3L73E 2Z4EA 2GIWA 1SQBJ 2XKMA 1FOSF 1L4AC 3GF7A 2K9YA 1GJQA 1SQPG 2BH5X 2R32A 2B10B 1XTGB 3A0BV 3WU2E 1DIQC 3H25A 1GU5A 1LP1B 5KJ7D 2OYIC 3FXEA 1NU1K 1KORA 1HGVA 4FA4A 1YIQA 2K3RA 1QL4A 2PFXA 3PXWA 3PLNA 5GTIE 3CWBE 3IFMA 2N9YB 4H44D 1JM0A 1JY3O 1NKNA 2FYUE 3FWNA 5EXQA 3A9FA 4R4MA 2IDBA 3C9IA 3L71G 2ZFCA 1LTIC 1T3JA 2A06D 3KDPB 5AW7B 1T2KC 1FDIA 4C7NA 3MHVA 3LIDA 1UIXA 4N78E 3T97B 5KLVE 3N7NA 1QLED 5KAIV 3HQ6A 2KUBA 3BRVB 3V5BA 2FFDB 4HYTB 4WB4A 5CCGA 1LT9B 1IJDB 1MZ4A 1CXCA 5CJ0A 1VL2A 3H1IE 3BCCJ 1EQ7A 1GK6A 4KHXA 1IFNA 2HFED 2J5UA 2KP8A 2AIUA 1U7JA 1MUUA 1S3JA 2FY8A 155CA 1GL2A 1Y9BA 1HZUA 3CX5W 5CCGD 1L0LK 1H31A 4GODA 3M0AA 1LWUB 2N9BA 3H1JD 3V2NA 1XTCC 3U1CA 3CYTI 3H1LE 1YITP 5H2FV 1PV3A 1N7SD 5DJQC 2BCCE 4WVZA 2B0ZB 4BWNA 1CSVA 3PTZA 1GL2D 1TU3F 1SQXJ 5TISH 4MN4C 1H0TA 2QJPC 3RK3E 1CIFA 4L3GA 1AYGA 3RK2C 2A06G 2WT7B 1CZQA 3AE1C 1NAFA 1A02F 1NU1E 5EFWB 4Z1MH 1N7SB 5CCHC 4H13D 1FZBA 4UB6E 1EZVE 1QVFO 3WFCC 2WPVB 1PP9E 4AYCA 1COTA 1GW4A 1OXZA 3OCDA 1KYOD 4JF7A 3L70D 1N50A 3B5NC 5CIGB 3ZIYA 3CPWO 3Q5RA 4EIFA 2Q5UA 2VRSA 1N73C 3O6QA 4AAMA 3E1RA 2ZT9C 3PH2B 2IZ1A 3FXDA 3OA8A 3OJAB 1FU1A 3PP5A 1OW8A 5KAFE 1JO5A 1RF1C 3H1JG 4C46A 1IZNB 1EXIA 3AE6C 3II6A 1U57A 3D71A 1CW5A 2CE1A 3C2CA 2E76D 4IL6X 4O9BA 1L0ND 4WQ9A 3H32A 5APTA 2GC7D 1SFCA 1YI2P 3KZIH 1EDIA 3RL0D 1KB9E 1NTKE 3G6EP 2DGEA 1SP4A 1NTMD 2C1DA 1P84I 4N6JA 2FYNB 1Q2NA 5E79H 1JCCA 3CLQA 1OVVA 1HCMA 1BCCG 1M1JC 1C52A 1KILA 4EOTA 1KQSO 3L70G 3RL0B 2QJKB 1SQBE 1J2JB 1SQQJ 2JKVA 3CCSP 1IK7A 3SWYA 1J1DB 1RE3C 1FZCA 3VRDA 1YEAA 3CP5A 5GTHV 2R44A 2WSEH 4B86A 5KJ7C 3TNUB 3HE5A 1R5LA 2QJYC 1C6OA 3G4SP 3CMEP 2WZ7A 1CSBA 1QL1A 3NMDA 1NTZJ 1OW6A 2M3BA 1CRCA 1YTCA 5AVUB 4H44C 1L0NG 1C6RA 1AVOA 4HB1A 5KKZB 2IYOA 1KB0A 1C2NA 3VNWA 4NPDA 4OVNF 2IPPA 1NTMG 1SS1A 2KSJA 1GW3A 1GMJA 3VMZA 1H32A 5DJUB 3I5CA 1FS0E 1E5WA 2YKOA 3VP9A 4PD4H 3TDKA 1Q82Q 1IFJA 4DJGA 2D0SA 2AXTE 2GM4A 1M7LA 4AALA 2ZYDA 3BCCE 4ASVA 2N3BA 3MGNA 1QX8A 1JOCA 2K1AA 2W6AA 1YNRA 3C1LA 2CA4B 3A0BE 3ZCFA 1A2SA 2Q7CA 3RMZA 2R3SA 2BEQD 5CCGC 2KS1A 1CIHA 2MTAC 4I6MC 1H88A 2YMKA 4YTPC 3A0HH 5KLVJ 3HRNA 1OZHA 3H1HD 2K9JA 2WVRA 4XXLA 2N18C 3WUUA 2O3JA 5B66V 1CSWA 2J59M 1SQXE 2QG4A 1KYOI 1X79B 2BPBB 5AVTB 2XDJA 1GL2C 4JPZB 5AVQB 2YKPA 2NPSB 2I8DA 1R5SA 2IX7C 1GU4A 2BCNB 4BRYB 1I6EA 2ORLA 1KYOH 4H0LC 1ETPA 1JDLA 4AX3A 2OTLP 2OYHB 1NAYA 1CYCA 5KAIE 2M8RA 3GHGA 3M91A 5AW4B 1URQD 4H13C 3DR0A 1K05A 1VPCA 2WSFH 5APSA 3GG2A 2H89C 2K37A 2OTKE 1BGYD 1FZFA 4K3IA 1DEBA 2Z5HA 3RN1A 1SQVK 1VF5D 4AAOA 3GW6A 1IO3A 3LW5J 3MK7B 4PW9B 3R4YA 3L36A 5DF5A 1S5LX 1H33A 2V4HA 1Z56A 1M90Q 3O1YA 2B11B 4IL6V 1SQPK 3P8CD 1NU1J 5APXA 4FA9A 2Q1KA 1C75A 1VF5B 3H1HG 5H2FE 5L8RJ 4GOFA 4GYDA 3C8VA 1QL3A 1YFCA 2ZAEB 2E76C 4D6TD 1QYZA 1YYCA 5CIFB 3FWLA 1AJYA 5M1BA 5KTBA 3MIWA 3RN0A 4YXWH 1L9JC 1JMMA 4EIJA 1R8EA 2PGDA 2JEEA 2HR3A 4EICA 2HODB 4OGQD 1CHHA 2KIKA 3Q3DA 2CK3H 2JTIB 1DVHA 1JTHB 1Y47A 1YIJP 1BGYG 3U1AA 1SFCC 4GIFA 3TK1A 2N1TD 3V2RA 3AEAC 1CHJA 451CA 1UIIA 3WC8A 2C9XB 1SQQE 2KB7P 5APQA 1CRHA 1QVGO 1NJIQ 1VQ5P 1CRIA 3CU4A 3S9OA 1LP1A 1VQNP 2K88A 3CCMP 3B5NB 1AV1A 2JP3A 1KX2A 1K3HA 3WUVA 2I8FA 1LGHB 3RGUA 3CWBD 1HGZA 4GKGA 1L0LJ 4UB8V 1OW7A 4DOJA 2L4DA 4PJ0V 3M9HA 1KILC 2Q9IA 2FYUD 3V4QA 4QMAA 5TISE 5B5EH 1NTZE 2KNCB 3HUSB 3H1KG 1RF1B 4WQ7A 2BASA 1S6VB 1ZN5A 1OAEA 4D6TG 1FZCC 2C9LY 3X39A 2KOGA 4O1WA 2P7JA 3T97A 2DVHA 3CC4P 1KX7A 1HH0A 2QEXP 2XTSB 2FFDA 5KLIB 1RH5B 2Q3EA 4W80A 1P84D 1LT9A 3CCRP 2GA1A 2P58A 4OWFA 1FI9A 5CIHB 2C2CA 3H1ID 1KN7A 3VMAA 3L73G 4GDOA 1DVVA 2IBZE 4WBAA 3D0WA 2QM8A 5IY51 1IFMA 1ZP0C 1RF0A 1C6SA 2D2CC 1S5LH 5BU8B 1M1JB 3WFBC 2WWWA 1PFIA 5CBNA 3GLMA 351CA 4NPFX 1LWUA 5GTHE 3JCUH 3H1LD 3CWBG 4IFMA 2BCCD 1BE3J 1X22A 2OZ1B 3M0DA 4JQ0D 3L72J 1LNQA 1VQKP 2OGUA 1N90A 2FYUG 4L75A 1QKSA 4RJTA 2QSIA 1GIWA 3RK3D 1LFMA 2Q3IA 2QJYB 3BASA 1NO4A 2WT7A 4I2LC 2FRCA 3DP5A 1CTZA 2FYZA 4H0JA 4WWIA 1DW3A 4FA1A 4JYBA 3TSIA 3L75J 1N7SA 2EXVA 1GK4A 1EZVD 2Y9ZA 3TGUJ 4MU8A 3PJSK 2V7QH 4EYYQ 2YO3A 3DMIA 1PP9D 1WEJF 2RH0A 3USSA 4AUWA 4WY4D 2KZIA 3RK3B 2C1UA 3ABVC 2O1JA 5CICB 4C7RA 3RBXA 3H1IG 1FDOA 2VHDA 2H7HA 2B89A 4DCKA 3AE2C 1HJ3A 3A3YB 2CE0A 4AQRD 1C7MA 1LTJB 4EI2A 1G2CB 3CXHE 3WUTA 1KYOW 1NGMB 3AEFC 4TT3H 1HJBA 2PCCB 1H89A 3VTPC 4WY4B 3GHGC 1F1CA 2H88C 4C7NB 5BU5A 3H1LG 2WITA 2E43A 3KXDA 1N2DC 2BCCG 2WPSA 1W2EA 3L35A 1ZRTE 1CRJA 3QWOC 4ZKPA 1JCDA 3BVHA 3WUIA 2IFNA 1ZR4A 1GZLA 4EDFA 2R5BA 2E74B 2ITAA 5B66E 1BCCD 1KC8Q 3M9QA 3OW2O 1KB9D 1DH3A 1NTKD 3JC22 1NH4A 5AVVB 1L0NK 3IN6A 3WFDC 2P1JA 1RAPA 5BVZA 4A7PA 1EZVG 5DFSA 1AOQA 4W7ZA 4NPEA 4FA5A 1PP9G 2ZVOB 2CPBA 3WU2H 1FDMA 1LTBC 1OWAA 3PH0A 1QN2A 2V07A 1KIBA 3L4FA 4PD4E 5AVRB 4BXLA 1F1FA 1NTMK 1BDDA 3H1JE 1SQBD 5GTIH 4OGQC 2WMMA 3P32A 5TISV 2W8ZA 1YICA 1RE4A 2ZONG 1LC1A 3AE9C 1H0TB 2LITA 3M97X 2E75C 3TYYA 1VQ8P 4XE5B 3TNUA 3A0HE 2NRGA 4IL6E 1L0LE 4I7ZC 4Y5RA 4U3FJ 2LXCB 3CX5E 2M3EA 2LIRA 2YIUB 1A8CA 3NFQA 1WVEC 2HLOA 4KMGA 4WQEA 1JY2N 1P84H 1DX7A 5DJTB 1PPJD 1NTKG 3VN0A 3O8ZA 1S72P 1GD2E 3F5HA 1W2LA 3SSUA 4WQAA 3O6QB 4U7JA 4J20A 1C2RA 2BLFB 2QA4P 4P4QB 1KD1Q 1MFTA 4PV1B 3JBTB 3AE8C 1IO4A 1RZ5A 2D0WA 1YHQP 3L74J 1L2PA 2RMZA 3BCCD 1SQBG 2M5AA 2AEFA 2HG5D 2KYVA 1WMKA 5APUA 1SQVJ 1KTMA 3FGAD 1FZAA 1FCDC 4RSZA 2E5TA 1VQMP 4ZMDA 2ZZS1 3KZIV 4IFFA 1FZEA 2FFDC 3HD7B 1E29A 2WSCH 1K8AQ 1GQ1A 1LT9C 2SPZA 1EZVI 2N9JA 1ZLLA 5E79V 1BE3E 3HE4A 1IZL0 4UB8E 2LXBA 4PJ0E 2B87A 1CIGA 1SQPJ 3L72E 4ZKUA 1JY3N 1LTAC 2KLUA 4LGDE 1MV8A 3SWSA 4UB6H 1SQXD 1DW0A 5APWA 4N3YB 1RF0C 2C0XA 1HF9A 2NPSA 1Q81Q 1BDCA 2B12B 4BRYA 1JUNA 1PPJG 1FJ0A 4JYCA 1LWUC 5CHXA 2IFMA 3L75E 4HJGH 1U7MA 2OYHA 3TGUE 3M0DC 1K04A 1FZCB 3BATA 1J1EC 3L71J 4WQDA 3IAOA 2QE7H 2NPSD 1FJKA 1KILE 1CCRA 1L4AB 1RY3A 5KAFH 1I8OA 3BCCG 1M56D 3HTKB 1YCCA 2KSEA 3K5BA 1IFPA 3AEGC 1EDLA 2LKMA 1T2KD 2OYIB 1IQCA 1EDKA 1N7SC 1VQ9P 2PCBB 1KB9I 1URQA 4RO0A 4M3LA 2WQYC 5AVYB 2O01N 4LJIA 5CYTR 1USDA 1N8RQ 1PIXA 1DIIC 4XFJA 3SWKA 2QRXA 1E2RA 1SQXG 1MFZA 3WMM0 3PRJA 5CBOA 1LC2A 2V08A 1OX3A 1LMSA 1I55A 1T3UA 3NTNA 2ZXYA 3O0RC 1VQ6P 1KFMA 1OVUA 5AW5B 1FI7A 5AW0B 1LTSC 2ZXXA 1RHZB 3ORVA 1KZUB 2WSEJ 4XYDB 3O5CA 2HODA 1LJ2A 1KQGB 3A0HV 1JTHA 1DT1A 2YK3A 2GB8B 1VQLP 1S5LE 3AE4C 4FAVA 1SQQD 3CD6P 1HVVA 3CL3D 3F89A 1M6ZA 3CCEP 2WSCJ 4GEDB 2FYNC 3H1KD 2YKQA 3D70A 4EIDA 2ZBOA 4R4LA 3H6PA 1ZMEC 1Q90D 2XNXA 3IR9A 5DJQB 1JY2P 5CCHD 1S9KE 3CCVP 1H8AA 3G9RA 3D6ZA 2PAJA 1T8ZA 4Y99C 2N1TA 3AE7C 4U3FE 2QJPB 3W67A 3RL0C 3A7OA 2QJKC 1NTZD 1MZ9A 3RLMA 3RK2B 1FI3A 3HUSA 3B5ND 1EXJA 1ZV8A 1KMIZ 1RE4C 1J1DC 3PXSA 1JEKA 2FYUK 2O01H 3H1JJ 3L73D 1ZXGA 2Y0EA 2AXTH 1YJ9P 1YBKA 2N9IA 4H0KA 2KK7A 2POHA 2W90A 3ZOWA 1DD4A 2CXBA 1NVOA 2YQBA 3PXTA 2FWLA 1PGQA 3A0BH 1VDFA 3CCUP 2DW3A 3GF3A 3U59A 2IBZD 1CTYA 1N73B 3L74E 1PZQA 5KKZC 2ZT9B 2Y0DA 3EFGA 2W6BA 1SQQG 1SQVE 3PHLA 2BH4X 5B6QA 1DEEG 1BCCJ 2WSSH 2G8YA 1JY2O 2MKVA 1CI6B 1HJ0A 2HPCB 1HTLC 5C0ZA 3L70J 2I1KA 5TJHA 2OZ1A 4N78D 1M1KQ 5KLVD 1N7LA 1K9MQ 1G1JA 3QH9A 1SQPE 1K73Q 1NTZG 4JCGA 1OMIA 2WSFJ 5AW8B 5KAIH 2YMYA 1HH7A 4TLFA 1KQFB 3KQGA 1AOFA 4V2KA 3M9BA 3VYMA 5AVSB 1Q86Q 1HBWA 1BSHA 4L73A 1OIPA 4Q5PA 1HRCA 1VQ7P 1FOCA 1L0NJ 1FJPA 2JO1A 1HUCA 3OA7A 3L71E 1W5CT 2ZOOA 2Q6QA 2CPSA 2GUVA 2IBZG 2JDIH 5AW9B 2NPSC 4WQ8A 1YQ3C 1LTJA 1CYJA 3CXHD 5B5EV 1NTMJ 5C39A 1IK9A 1G2CA 2L91A 2GUSA 5H2FH 2OARA 3VMXA 4IFDK 2AI5A 1RZ6A 3Q1MA 2OYHC 4WY4A 1A56A 1IFDA 2PRRA 3KZIE 1I6DA 3HQ7A 1H1OA 3MZWB 3Q2YA 1NU1D 1ZRTD
chains in the Genus database with same CATH topology
3TYIA 2CA4B 4FANA 3ZCFA 1A2SA 3RMZA 3WFEC 1N15A 1H33B 4Y5RA 2KS1A 1CIHA 5AURA 2MTAC 2LIRA 1CRGA 3MK7C 2YIUB 1NMIA 1A8CA 3H1HD 1WVEC 3NBSA 3L4MA 4KMGA 4XXLA 1N9CA 2N18C 4QAOA 4WQEA 2O3JA 5B66V 1RAQA 1CSWA 1S5LV 4WQCA 2QG4A 2BGVX 2BPBB 1CSUA 1PPJD 1CO6A 1W2LA 3L71D 5C9MA 2BCNB 4WQAA 1H9XA 1I6EA 3ITKA 2ORLA 4J20A 1C2RA 2BLFB 4PD4D 1IRVA 1HJ4A 1ETPA 1JDLA 4AX3A 4P4QB 1CYCA 1KV9A 1CORA 1AKKA 4DY9A 1CSXA 2Y0CA 1HJ5A 3JBTB 2JWAA 3DR0A 1RZ5A 2D0WA 2RMZA 3GG2A 3BCCD 5CIDB 1L9BC 3CXHW 1GKSA 2CA3B 1BGYD 4K3IA 1MG2D 3RN1A 2HV4A 2AXTV 1HZVA 4AAOA 3GW6A 1IO3A 3SLEA 4L1QA 2GIWA 1FCDC 4RSZA 3MK7B 2ZZS1 3KZIV 4PW9B 1L0LD 5DF5A 1GJQA 1E29A 2BH5X 5CIEB 1H33A 2N18B 3CX5D 2B10B 1I54A 1R0QA 1GQ1A 4YE1A 1M70A 3A0BV 2N9JA 1DIQC 3O1YA 2B11B 5E79V 1M60A 4IL6V 1IZL0 1CIGA 4FA4A 4FA9A 1YIQA 3O20A 1QL4A 1C75A 3SWSA 3PXWA 1H31B 1SQXD 1DW0A 3PLNA 4GYDA 2N9YB 1QL3A 1YFCA 5CIBB 2B12B 2YCCA 1YEBA 5EXQA 3A9FA 1FJ0A 1NIRA 4D6TD 1QYZA 5CIFB 3FWLA 2A06D 3RN0A 1I5TA 4WQDA 1L9JC 5KAIV 3HQ6A 1CCRA 1I8PA 1OCDA 4EICA 1CHHA 1I8OA 2JTIB 1DVHA 1YCCA 1MZ4A 1CXCA 1CHJA 1IQCA 451CA 2PCBB 4EIEA 1E8EA 3WC8A 2C9XB 1CRHA 3OCDB 2AIUA 1CRIA 1BE3D 3CU4A 3TF5A 4N0KA 155CA 3L72D 1IRWA 4LJIA 5CYTR 1CEDA 1HZUA 1K3HA 1KX2A 3CX5W 3WU2V 2I8FA 3CWBD 1H31A 2C8SA 4L3HA 4UB8V 2L4DA 4PJ0V 4WQBA 1DIIC 2C1VA 3OA8B 3H1JD 4AANA 2FYUD 1DW1A 1E2RA 3CYTI 1MG3D 5GTIV 5H2FV 3PRJA 5DJQC 3ZOOA 1LC2A 2V08A 1U74B 2B0ZB 3HQ8A 2KNCB 3L75D 1CSVA 4WQ7A 3PTZA 1LMSA 1I55A 3KHUA 1S6VB 3TGUD 1OAEA 1CIFA 3X39A 2ZXYA 3O0RC 4L3GA 1AYGA 4O1WA 2N3YA 1FI7A 4PWAA 2DVHA 3ORVA 1KX7A 1NNOA 4XYDB 3SJLA 1NMLA 2XTSB 1FHBA 5KLIB 3O5CA 2Q3EA 2PACA 1P84D 3A0HV 3WFCC 1DT1A 2C1DB 2YK3A 2B4ZA 1FI9A 1VYDA 2GB8B 3NWVA 2C2CA 3H1ID 5CIHB 1COTA 3VMAA 4FAVA 1SQQD 1DVVA 3OCDA 1KYOD 1H9YA 3L70D 1N50A 5IY51 1M6ZA 5CIGB 1C6SA 4GEDB 3ZIYA 4O1QA 3H1KD 4EIFA 4EIDA 3WFBC 2ZBOA 1CCHA 4AAMA 1U75B 5DJQB 351CA 3PH2B 1B7VA 3OA8A 3H1LD 1CNOA 2BCCD 1K3GA 2QJPB 2OZ1B 1NTZD 3RLMA 1FI3A 1N90A 2RN0A 3NBTA 1QKSA 4RJTA 1GIWA 1LFMA 2CE1A 3C2CA 3PXSA 2QJYB 3L73D 4FB1A 1L0ND 4WQ9A 2Y0EA 3SXTA 2FRCA 3DP5A 1CTZA 2N9IA 2GC7D 4H0KA 4H0JA 1DW3A 4FA1A 3ZOWA 3ZOXA 3ZOYA 2EXVA 1EZVD 2CXBA 4MU8A 2DGEA 3PXTA 2FWLA 2YQBA 3DMIA 1CHIA 1PP9D 1NTMD 2C1DA 1WEJF 2FYNB 2C1UA 1CXAA 2IBZD 4UB6V 1CTYA 1HCMA 5CICB 2GC4D 2Y0DA 2VHDA 1H32B 1C52A 3HQ9A 1HJ3A 2CE0A 1C7MA 3PHLA 1LS9A 2BH4X 3L4OA 5B6QA 2MHMA 2QJKB 1KYOW 1J3SA 2PCCB 4U3FD 5C0ZA 3VRDA 1YEAA 3CP5A 5GTHV 2OZ1A 5TJHA 1F1CA 5KLVD 1EB7A 1CRJA 4JCGA 5KAFV 1HH7A 1C6OA 3WUIA 1GU2A 4EDFA 1DW2A 1AOFA 4V2KA 1BCCD 1CRCA 1YTCA 3SVWA 3VYMA 2K9JB 2JQRA 1C6RA 1KB9D 1NTKD 1CYIA 5KKZB 4Q5PA 1HRCA 1KB0A 1FOCA 3WFDC 1RAPA 1C2NA 3VNWA 4A7PA 5DFSA 3ZBMA 1AOQA 3L74D 4FA5A 1W5CT 2ZOOA 1QN2A 1ZZHA 2V07A 1HROA 1KIBA 1H32A 1CRYA 4WQ8A 1SQVD 1F1FA 1CC5A 1CYJA 3CXHD 5B5EV 1GDVA 1BL9A 1SQBD 2L91A 3TDKA 5TISV 4NFGB 2D0SA 1CTJA 2AI5A 1YICA 1RZ6A 4AALA 2ZONG 1CIEA 1A56A 1LC1A 2LITA 2N3BA 3M97X 1I6DA 3HQ7A 1H1OA 1SQPD 1YNRA 1NU1D 1ZRTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYI A;  2CA4 B;  4FAN A;  3ZCF A;  1A2S A;  3RMZ A;  3WFE C;  1N15 A;  1H33 B;  4Y5R A;  2KS1 A;  1CIH A;  5AUR A;  2MTA C;  2LIR A;  1CRG A;  3MK7 C;  2YIU B;  1NMI A;  1A8C A;  3H1H D;  1WVE C;  3NBS A;  3L4M A;  4KMG A;  4XXL A;  1N9C A;  2N18 C;  4QAO A;  4WQE A;  2O3J A;  5B66 V;  1RAQ A;  1CSW A;  1S5L V;  4WQC A;  2QG4 A;  2BGV X;  2BPB B;  1CSU A;  1PPJ D;  1CO6 A;  1W2L A;  3L71 D;  5C9M A;  2BCN B;  4WQA A;  1H9X A;  1I6E A;  3ITK A;  2ORL A;  4J20 A;  1C2R A;  2BLF B;  4PD4 D;  1IRV A;  1HJ4 A;  1ETP A;  1JDL A;  4AX3 A;  4P4Q B;  1CYC A;  1KV9 A;  1COR A;  1AKK A;  4DY9 A;  1CSX A;  2Y0C A;  1HJ5 A;  3JBT B;  2JWA A;  3DR0 A;  1RZ5 A;  2D0W A;  2RMZ A;  3GG2 A;  3BCC D;  5CID B;  1L9B C;  3CXH W;  1GKS A;  2CA3 B;  1BGY D;  4K3I A;  1MG2 D;  3RN1 A;  2HV4 A;  2AXT V;  1HZV A;  4AAO A;  3GW6 A;  1IO3 A;  3SLE A;  4L1Q A;  2GIW A;  1FCD C;  4RSZ A;  3MK7 B;  2ZZS 1;  3KZI V;  4PW9 B;  1L0L D;  5DF5 A;  1GJQ A;  1E29 A;  2BH5 X;  5CIE B;  1H33 A;  2N18 B;  3CX5 D;  2B10 B;  1I54 A;  1R0Q A;  1GQ1 A;  4YE1 A;  1M70 A;  3A0B V;  2N9J A;  1DIQ C;  3O1Y A;  2B11 B;  5E79 V;  1M60 A;  4IL6 V;  1IZL 0;  1CIG A;  4FA4 A;  4FA9 A;  1YIQ A;  3O20 A;  1QL4 A;  1C75 A;  3SWS A;  3PXW A;  1H31 B;  1SQX D;  1DW0 A;  3PLN A;  4GYD A;  2N9Y B;  1QL3 A;  1YFC A;  5CIB B;  2B12 B;  2YCC A;  1YEB A;  5EXQ A;  3A9F A;  1FJ0 A;  1NIR A;  4D6T D;  1QYZ A;  5CIF B;  3FWL A;  2A06 D;  3RN0 A;  1I5T A;  4WQD A;  1L9J C;  5KAI V;  3HQ6 A;  1CCR A;  1I8P A;  1OCD A;  4EIC A;  1CHH A;  1I8O A;  2JTI B;  1DVH A;  1YCC A;  1MZ4 A;  1CXC A;  1CHJ A;  1IQC A;  451C A;  2PCB B;  4EIE A;  1E8E A;  3WC8 A;  2C9X B;  1CRH A;  3OCD B;  2AIU A;  1CRI A;  1BE3 D;  3CU4 A;  3TF5 A;  4N0K A;  155C A;  3L72 D;  1IRW A;  4LJI A;  5CYT R;  1CED A;  1HZU A;  1K3H A;  1KX2 A;  3CX5 W;  3WU2 V;  2I8F A;  3CWB D;  1H31 A;  2C8S A;  4L3H A;  4UB8 V;  2L4D A;  4PJ0 V;  4WQB A;  1DII C;  2C1V A;  3OA8 B;  3H1J D;  4AAN A;  2FYU D;  1DW1 A;  1E2R A;  3CYT I;  1MG3 D;  5GTI V;  5H2F V;  3PRJ A;  5DJQ C;  3ZOO A;  1LC2 A;  2V08 A;  1U74 B;  2B0Z B;  3HQ8 A;  2KNC B;  3L75 D;  1CSV A;  4WQ7 A;  3PTZ A;  1LMS A;  1I55 A;  3KHU A;  1S6V B;  3TGU D;  1OAE A;  1CIF A;  3X39 A;  2ZXY A;  3O0R C;  4L3G A;  1AYG A;  4O1W A;  2N3Y A;  1FI7 A;  4PWA A;  2DVH A;  3ORV A;  1KX7 A;  1NNO A;  4XYD B;  3SJL A;  1NML A;  2XTS B;  1FHB A;  5KLI B;  3O5C A;  2Q3E A;  2PAC A;  1P84 D;  3A0H V;  3WFC C;  1DT1 A;  2C1D B;  2YK3 A;  2B4Z A;  1FI9 A;  1VYD A;  2GB8 B;  3NWV A;  2C2C A;  3H1I D;  5CIH B;  1COT A;  3VMA A;  4FAV A;  1SQQ D;  1DVV A;  3OCD A;  1KYO D;  1H9Y A;  3L70 D;  1N50 A;  5IY5 1;  1M6Z A;  5CIG B;  1C6S A;  4GED B;  3ZIY A;  4O1Q A;  3H1K D;  4EIF A;  4EID A;  3WFB C;  2ZBO A;  1CCH A;  4AAM A;  1U75 B;  5DJQ B;  351C A;  3PH2 B;  1B7V A;  3OA8 A;  3H1L D;  1CNO A;  2BCC D;  1K3G A;  2QJP B;  2OZ1 B;  1NTZ D;  3RLM A;  1FI3 A;  1N90 A;  2RN0 A;  3NBT A;  1QKS A;  4RJT A;  1GIW A;  1LFM A;  2CE1 A;  3C2C A;  3PXS A;  2QJY B;  3L73 D;  4FB1 A;  1L0N D;  4WQ9 A;  2Y0E A;  3SXT A;  2FRC A;  3DP5 A;  1CTZ A;  2N9I A;  2GC7 D;  4H0K A;  4H0J A;  1DW3 A;  4FA1 A;  3ZOW A;  3ZOX A;  3ZOY A;  2EXV A;  1EZV D;  2CXB A;  4MU8 A;  2DGE A;  3PXT A;  2FWL A;  2YQB A;  3DMI A;  1CHI A;  1PP9 D;  1NTM D;  2C1D A;  1WEJ F;  2FYN B;  2C1U A;  1CXA A;  2IBZ D;  4UB6 V;  1CTY A;  1HCM A;  5CIC B;  2GC4 D;  2Y0D A;  2VHD A;  1H32 B;  1C52 A;  3HQ9 A;  1HJ3 A;  2CE0 A;  1C7M A;  3PHL A;  1LS9 A;  2BH4 X;  3L4O A;  5B6Q A;  2MHM A;  2QJK B;  1KYO W;  1J3S A;  2PCC B;  4U3F D;  5C0Z A;  3VRD A;  1YEA A;  3CP5 A;  5GTH V;  2OZ1 A;  5TJH A;  1F1C A;  5KLV D;  1EB7 A;  1CRJ A;  4JCG A;  5KAF V;  1HH7 A;  1C6O A;  3WUI A;  1GU2 A;  4EDF A;  1DW2 A;  1AOF A;  4V2K A;  1BCC D;  1CRC A;  1YTC A;  3SVW A;  3VYM A;  2K9J B;  2JQR A;  1C6R A;  1KB9 D;  1NTK D;  1CYI A;  5KKZ B;  4Q5P A;  1HRC A;  1KB0 A;  1FOC A;  3WFD C;  1RAP A;  1C2N A;  3VNW A;  4A7P A;  5DFS A;  3ZBM A;  1AOQ A;  3L74 D;  4FA5 A;  1W5C T;  2ZOO A;  1QN2 A;  1ZZH A;  2V07 A;  1HRO A;  1KIB A;  1H32 A;  1CRY A;  4WQ8 A;  1SQV D;  1F1F A;  1CC5 A;  1CYJ A;  3CXH D;  5B5E V;  1GDV A;  1BL9 A;  1SQB D;  2L91 A;  3TDK A;  5TIS V;  4NFG B;  2D0S A;  1CTJ A;  2AI5 A;  1YIC A;  1RZ6 A;  4AAL A;  2ZON G;  1CIE A;  1A56 A;  1LC1 A;  2LIT A;  2N3B A;  3M97 X;  1I6D A;  3HQ7 A;  1H1O A;  1SQP D;  1YNR A;  1NU1 D;  1ZRT D; 
#chains in the Genus database with same CATH topology
 3EWK A;  5KLV G;  4H44 B;  5E79 E;  3WFE C;  3VMY A;  2OTJ P;  3L37 A;  1Y8A A;  2E42 A;  2JJL A;  1CRG A;  1AA0 A;  3MK7 C;  1P84 E;  2O01 J;  2C9N Y;  1EC5 A;  3NBS A;  3L4M A;  4W7Y A;  3MTU E;  1RAQ A;  2KZJ A;  1URQ C;  3MUD A;  1S5L V;  2J58 A;  4WQC A;  2BGV X;  2FXM A;  5C9M A;  3AEB C;  2FXO A;  1VF5 C;  4ASW A;  2E74 D;  1NTK K;  1KFN A;  4PD4 D;  1IRV A;  1HJ4 A;  2OYO A;  4JBZ A;  3A5T A;  1GDT A;  2A06 E;  3I55 P;  1OFC X;  1KV9 A;  1QL2 A;  3FX0 A;  1COR A;  3KYQ A;  4DY9 A;  1CSX A;  2Y0C A;  1MKM A;  2ZVN B;  1JB0 J;  1J1E B;  5CID B;  1VQP P;  1GKS A;  2CA3 B;  1WT6 A;  1MG2 D;  2HV4 A;  1HZV A;  5AW3 B;  4YXD C;  1SQB K;  3SLE A;  4L1Q A;  4H0L D;  5AVX B;  1S2E A;  2FXP A;  1L0L D;  1JNM A;  2XZR A;  5CIE B;  1NU1 G;  2N18 B;  3CX5 D;  2UWJ E;  1I54 A;  1R0Q A;  4YE1 A;  1M70 A;  2AXC A;  3R2P A;  1M60 A;  1GL2 B;  1DD3 A;  4XA4 A;  3SFD C;  4Y28 J;  2IBZ I;  3AE3 C;  3O20 A;  5AW6 B;  1H31 B;  2IYP A;  4H0L B;  5CIB B;  3CCJ P;  3CCL P;  2YCC A;  2H8P D;  1YEB A;  3H1H J;  1NIR A;  4K35 A;  5CMZ A;  1YJN P;  3VYI A;  3KPE A;  4H13 B;  1AFO A;  4YPC A;  2N1T C;  2QIW A;  2OQQ A;  1FBM A;  1N86 A;  1I5T A;  2FBW C;  3HUS C;  5GTH H;  1EDJ A;  2H43 A;  1FZG A;  1FE6 A;  3MD0 A;  1I8P A;  1OCD A;  3V2Q A;  3UIA A;  1YTZ T;  1YTZ I;  2Z5I A;  2IZ0 A;  1LT1 A;  4ZNC A;  2P2U A;  3Q5P A;  1PGO A;  3HD7 A;  5KLI C;  1BCC E;  3M06 A;  4PV1 D;  4EIE A;  1E8E A;  1NWQ A;  1YQ4 C;  3OCD B;  1BGY J;  1BE3 D;  1L0L G;  1KYO E;  3TF5 A;  3L70 E;  3VOP A;  4N0K A;  2YO2 A;  3CMA P;  1A02 J;  1JMB A;  3L72 D;  1IRW A;  2V7Q J;  1SLQ A;  1CED A;  1LTG C;  3WU2 V;  3LIE A;  2NZ2 A;  2C8S A;  4L3H A;  2E76 B;  1KQL A;  4WQB A;  2C1V A;  3OA8 B;  3HD7 D;  4AAN A;  1SFC D;  1DW1 A;  2R5D A;  1MG3 D;  5GTI V;  4Y99 B;  3CXH I;  3ZOO A;  3N4X A;  1U74 B;  1FC2 C;  3HQ8 A;  1PGP A;  3AEE C;  2A45 G;  3L75 D;  1SQX K;  3KHU A;  2KXP B;  3TGU D;  3CXH H;  1DIP A;  2ZYA A;  1S4X A;  5APY A;  3V6I A;  3LW5 H;  2JWD A;  3E1I A;  2N3Y A;  3H32 B;  4CPG A;  3H1K J;  4PWA A;  1L0N E;  1KIL D;  4RKU J;  1NNO A;  4D6T J;  3BRT B;  1SFC B;  3SJL A;  1NML A;  1AQT A;  2G3A A;  2ZJS E;  1FHB A;  1L4A A;  2FKW B;  2PAC A;  2RKL A;  1AVY A;  1VQ4 P;  3HTK A;  2QM7 A;  4LC1 A;  3SWF A;  2C1D B;  2LR2 A;  2B4Z A;  4DZO A;  1NTM E;  1VYD A;  2OYI A;  3NWV A;  3AE5 C;  1SVF A;  1Q7Y Q;  1FAV A;  3ZDM A;  1YJW P;  1H9Y A;  5B66 H;  4K3A A;  3IF4 A;  2HYN A;  2BEZ F;  1KIL B;  3RK3 C;  1WRG A;  4O1Q A;  1L4A D;  3L73 J;  2ZYG A;  1PPJ E;  1CCH A;  2W83 C;  1BE3 G;  3VP8 A;  1U75 B;  1BSN A;  3L72 G;  4L74 A;  3I56 P;  1B7V A;  4PD4 I;  4LLH A;  1LTJ C;  2QVA A;  1CNO A;  1M8O B;  3G71 P;  1HWT C;  1K3G A;  1KV4 A;  2YNY A;  5APV A;  3RL0 g;  3CC7 P;  2KLV A;  3OAK A;  3AED C;  1ZOY C;  3V2P A;  2B9B A;  2RN0 A;  3NBT A;  5CJ4 A;  3CWB J;  2D2C D;  4WY4 C;  3HE5 B;  2M5A B;  3L75 G;  1S1C X;  3EFF K;  1ZW0 A;  4FB1 A;  2FYU J;  1FOS E;  3SXT A;  1QGK B;  3TGU G;  4OH8 B;  1T6A A;  3JSV C;  3ZOX A;  3ZOY A;  3CX5 I;  2E74 C;  1CHI A;  1IC2 A;  1D7M A;  2D2C B;  2YXQ B;  3HE4 B;  1KB9 H;  2P67 A;  3GMA A;  1CXA A;  4IL6 H;  4UB6 V;  2B87 B;  2AEJ A;  3CX5 H;  3MUD C;  2GC4 D;  5B5E E;  4RES B;  2E5Y A;  3EQ2 A;  1H32 B;  3HQ9 A;  1AQ5 A;  5AVZ B;  5AVW B;  4I1L A;  1G1I A;  1LS9 A;  2A45 I;  4IOI H;  3L4O A;  2MHM A;  1IFI A;  3SFE C;  1S9K D;  1J3S A;  3V4W A;  4L76 A;  3H1I J;  2W6J H;  2WPQ A;  3AEC C;  1SQQ K;  1PGJ A;  4U3F D;  2A45 H;  1NHL A;  2B88 A;  2ZXE B;  3W68 A;  1M57 D;  3G3Z A;  1NYH A;  1EB7 A;  4HH2 A;  1RQU A;  1NOH A;  5KAF V;  3S1K A;  4KT0 J;  3Q5S A;  3NXS A;  5K5G B;  3H1L J;  5CCH A;  1GU2 A;  2KS1 B;  2BCC J;  1NTZ K;  1DW2 A;  3CI9 A;  3E7K A;  5AW2 B;  1GTW A;  3SVW A;  2K9J B;  2JQR A;  3H1H E;  2XU6 A;  1CYI A;  3RK2 D;  2MJZ A;  1URQ B;  3B71 A;  2YIU C;  3B5N A;  2YXR B;  1W2B O;  3JCU E;  2P10 A;  1USE A;  2JR8 A;  3ZBM A;  3L74 D;  1N73 A;  3B8E B;  1W5C E;  2I1J A;  1ZZH A;  1HRO A;  1NKZ B;  3MP7 B;  4UB8 H;  1CRY A;  4PJ0 H;  1X0T A;  1SQV D;  3A2A A;  1CC5 A;  1PP9 J;  1GDV A;  1BL9 A;  3GHG B;  2O1K A;  2KNC A;  4HKZ H;  1RF1 A;  4NFG B;  1CTJ A;  1VQO P;  1LTT C;  1QEX A;  1CI6 A;  2HPC A;  4DT0 A;  1CIE A;  1BGY E;  2ZT9 D;  4PV1 C;  1SQP D;  4U3F G;  3TYI A;  4FAN A;  2XV5 A;  1RQV A;  1N15 A;  1H33 B;  2KI7 B;  4GT1 A;  5AUR A;  5KLV K;  4KJM A;  1NMI A;  1X8Y A;  1PL5 A;  3HD7 C;  1E79 H;  2Y9Y A;  2R3C A;  3P8C E;  1N9C A;  4QAO A;  3P8M C;  2E75 D;  5AW1 B;  1CSU A;  1X9V A;  1CO6 A;  1M1J A;  2AEM A;  1JY3 P;  3L71 D;  1OVR A;  3D6Y A;  1H9X A;  3H1K E;  3ITK A;  4OGQ B;  3B4S A;  4D6T E;  1ZR2 A;  1NTK J;  2WPR A;  3L74 G;  2L5G B;  2W27 A;  2XND H;  2N1T B;  1RE3 A;  1AKK A;  3P7K A;  3CC2 P;  1HJ5 A;  2JWA A;  1SQV G;  2E75 B;  2WTY A;  3RBZ A;  1L9B C;  3CCQ P;  3CXH W;  5KJ7 A;  2C0W A;  2PP6 A;  2AXT V;  2M0B A;  4I7Z B;  3S4R A;  4GOE A;  3L73 E;  2Z4E A;  2GIW A;  1SQB J;  2XKM A;  1FOS F;  1L4A C;  3GF7 A;  2K9Y A;  1GJQ A;  1SQP G;  2BH5 X;  2R32 A;  2B10 B;  1XTG B;  3A0B V;  3WU2 E;  1DIQ C;  3H25 A;  1GU5 A;  1LP1 B;  5KJ7 D;  2OYI C;  3FXE A;  1NU1 K;  1KOR A;  1HGV A;  4FA4 A;  1YIQ A;  2K3R A;  1QL4 A;  2PFX A;  3PXW A;  3PLN A;  5GTI E;  3CWB E;  3IFM A;  2N9Y B;  4H44 D;  1JM0 A;  1JY3 O;  1NKN A;  2FYU E;  3FWN A;  5EXQ A;  3A9F A;  4R4M A;  2IDB A;  3C9I A;  3L71 G;  2ZFC A;  1LTI C;  1T3J A;  2A06 D;  3KDP B;  5AW7 B;  1T2K C;  1FDI A;  4C7N A;  3MHV A;  3LID A;  1UIX A;  4N78 E;  3T97 B;  5KLV E;  3N7N A;  1QLE D;  5KAI V;  3HQ6 A;  2KUB A;  3BRV B;  3V5B A;  2FFD B;  4HYT B;  4WB4 A;  5CCG A;  1LT9 B;  1IJD B;  1MZ4 A;  1CXC A;  5CJ0 A;  1VL2 A;  3H1I E;  3BCC J;  1EQ7 A;  1GK6 A;  4KHX A;  1IFN A;  2HFE D;  2J5U A;  2KP8 A;  2AIU A;  1U7J A;  1MUU A;  1S3J A;  2FY8 A;  155C A;  1GL2 A;  1Y9B A;  1HZU A;  3CX5 W;  5CCG D;  1L0L K;  1H31 A;  4GOD A;  3M0A A;  1LWU B;  2N9B A;  3H1J D;  3V2N A;  1XTC C;  3U1C A;  3CYT I;  3H1L E;  1YIT P;  5H2F V;  1PV3 A;  1N7S D;  5DJQ C;  2BCC E;  4WVZ A;  2B0Z B;  4BWN A;  1CSV A;  3PTZ A;  1GL2 D;  1TU3 F;  1SQX J;  5TIS H;  4MN4 C;  1H0T A;  2QJP C;  3RK3 E;  1CIF A;  4L3G A;  1AYG A;  3RK2 C;  2A06 G;  2WT7 B;  1CZQ A;  3AE1 C;  1NAF A;  1A02 F;  1NU1 E;  5EFW B;  4Z1M H;  1N7S B;  5CCH C;  4H13 D;  1FZB A;  4UB6 E;  1EZV E;  1QVF O;  3WFC C;  2WPV B;  1PP9 E;  4AYC A;  1COT A;  1GW4 A;  1OXZ A;  3OCD A;  1KYO D;  4JF7 A;  3L70 D;  1N50 A;  3B5N C;  5CIG B;  3ZIY A;  3CPW O;  3Q5R A;  4EIF A;  2Q5U A;  2VRS A;  1N73 C;  3O6Q A;  4AAM A;  3E1R A;  2ZT9 C;  3PH2 B;  2IZ1 A;  3FXD A;  3OA8 A;  3OJA B;  1FU1 A;  3PP5 A;  1OW8 A;  5KAF E;  1JO5 A;  1RF1 C;  3H1J G;  4C46 A;  1IZN B;  1EXI A;  3AE6 C;  3II6 A;  1U57 A;  3D71 A;  1CW5 A;  2CE1 A;  3C2C A;  2E76 D;  4IL6 X;  4O9B A;  1L0N D;  4WQ9 A;  3H32 A;  5APT A;  2GC7 D;  1SFC A;  1YI2 P;  3KZI H;  1EDI A;  3RL0 D;  1KB9 E;  1NTK E;  3G6E P;  2DGE A;  1SP4 A;  1NTM D;  2C1D A;  1P84 I;  4N6J A;  2FYN B;  1Q2N A;  5E79 H;  1JCC A;  3CLQ A;  1OVV A;  1HCM A;  1BCC G;  1M1J C;  1C52 A;  1KIL A;  4EOT A;  1KQS O;  3L70 G;  3RL0 B;  2QJK B;  1SQB E;  1J2J B;  1SQQ J;  2JKV A;  3CCS P;  1IK7 A;  3SWY A;  1J1D B;  1RE3 C;  1FZC A;  3VRD A;  1YEA A;  3CP5 A;  5GTH V;  2R44 A;  2WSE H;  4B86 A;  5KJ7 C;  3TNU B;  3HE5 A;  1R5L A;  2QJY C;  1C6O A;  3G4S P;  3CME P;  2WZ7 A;  1CSB A;  1QL1 A;  3NMD A;  1NTZ J;  1OW6 A;  2M3B A;  1CRC A;  1YTC A;  5AVU B;  4H44 C;  1L0N G;  1C6R A;  1AVO A;  4HB1 A;  5KKZ B;  2IYO A;  1KB0 A;  1C2N A;  3VNW A;  4NPD A;  4OVN F;  2IPP A;  1NTM G;  1SS1 A;  2KSJ A;  1GW3 A;  1GMJ A;  3VMZ A;  1H32 A;  5DJU B;  3I5C A;  1FS0 E;  1E5W A;  2YKO A;  3VP9 A;  4PD4 H;  3TDK A;  1Q82 Q;  1IFJ A;  4DJG A;  2D0S A;  2AXT E;  2GM4 A;  1M7L A;  4AAL A;  2ZYD A;  3BCC E;  4ASV A;  2N3B A;  3MGN A;  1QX8 A;  1JOC A;  2K1A A;  2W6A A;  1YNR A;  3C1L A;  2CA4 B;  3A0B E;  3ZCF A;  1A2S A;  2Q7C A;  3RMZ A;  2R3S A;  2BEQ D;  5CCG C;  2KS1 A;  1CIH A;  2MTA C;  4I6M C;  1H88 A;  2YMK A;  4YTP C;  3A0H H;  5KLV J;  3HRN A;  1OZH A;  3H1H D;  2K9J A;  2WVR A;  4XXL A;  2N18 C;  3WUU A;  2O3J A;  5B66 V;  1CSW A;  2J59 M;  1SQX E;  2QG4 A;  1KYO I;  1X79 B;  2BPB B;  5AVT B;  2XDJ A;  1GL2 C;  4JPZ B;  5AVQ B;  2YKP A;  2NPS B;  2I8D A;  1R5S A;  2IX7 C;  1GU4 A;  2BCN B;  4BRY B;  1I6E A;  2ORL A;  1KYO H;  4H0L C;  1ETP A;  1JDL A;  4AX3 A;  2OTL P;  2OYH B;  1NAY A;  1CYC A;  5KAI E;  2M8R A;  3GHG A;  3M91 A;  5AW4 B;  1URQ D;  4H13 C;  3DR0 A;  1K05 A;  1VPC A;  2WSF H;  5APS A;  3GG2 A;  2H89 C;  2K37 A;  2OTK E;  1BGY D;  1FZF A;  4K3I A;  1DEB A;  2Z5H A;  3RN1 A;  1SQV K;  1VF5 D;  4AAO A;  3GW6 A;  1IO3 A;  3LW5 J;  3MK7 B;  4PW9 B;  3R4Y A;  3L36 A;  5DF5 A;  1S5L X;  1H33 A;  2V4H A;  1Z56 A;  1M90 Q;  3O1Y A;  2B11 B;  4IL6 V;  1SQP K;  3P8C D;  1NU1 J;  5APX A;  4FA9 A;  2Q1K A;  1C75 A;  1VF5 B;  3H1H G;  5H2F E;  5L8R J;  4GOF A;  4GYD A;  3C8V A;  1QL3 A;  1YFC A;  2ZAE B;  2E76 C;  4D6T D;  1QYZ A;  1YYC A;  5CIF B;  3FWL A;  1AJY A;  5M1B A;  5KTB A;  3MIW A;  3RN0 A;  4YXW H;  1L9J C;  1JMM A;  4EIJ A;  1R8E A;  2PGD A;  2JEE A;  2HR3 A;  4EIC A;  2HOD B;  4OGQ D;  1CHH A;  2KIK A;  3Q3D A;  2CK3 H;  2JTI B;  1DVH A;  1JTH B;  1Y47 A;  1YIJ P;  1BGY G;  3U1A A;  1SFC C;  4GIF A;  3TK1 A;  2N1T D;  3V2R A;  3AEA C;  1CHJ A;  451C A;  1UII A;  3WC8 A;  2C9X B;  1SQQ E;  2KB7 P;  5APQ A;  1CRH A;  1QVG O;  1NJI Q;  1VQ5 P;  1CRI A;  3CU4 A;  3S9O A;  1LP1 A;  1VQN P;  2K88 A;  3CCM P;  3B5N B;  1AV1 A;  2JP3 A;  1KX2 A;  1K3H A;  3WUV A;  2I8F A;  1LGH B;  3RGU A;  3CWB D;  1HGZ A;  4GKG A;  1L0L J;  4UB8 V;  1OW7 A;  4DOJ A;  2L4D A;  4PJ0 V;  3M9H A;  1KIL C;  2Q9I A;  2FYU D;  3V4Q A;  4QMA A;  5TIS E;  5B5E H;  1NTZ E;  2KNC B;  3HUS B;  3H1K G;  1RF1 B;  4WQ7 A;  2BAS A;  1S6V B;  1ZN5 A;  1OAE A;  4D6T G;  1FZC C;  2C9L Y;  3X39 A;  2KOG A;  4O1W A;  2P7J A;  3T97 A;  2DVH A;  3CC4 P;  1KX7 A;  1HH0 A;  2QEX P;  2XTS B;  2FFD A;  5KLI B;  1RH5 B;  2Q3E A;  4W80 A;  1P84 D;  1LT9 A;  3CCR P;  2GA1 A;  2P58 A;  4OWF A;  1FI9 A;  5CIH B;  2C2C A;  3H1I D;  1KN7 A;  3VMA A;  3L73 G;  4GDO A;  1DVV A;  2IBZ E;  4WBA A;  3D0W A;  2QM8 A;  5IY5 1;  1IFM A;  1ZP0 C;  1RF0 A;  1C6S A;  2D2C C;  1S5L H;  5BU8 B;  1M1J B;  3WFB C;  2WWW A;  1PFI A;  5CBN A;  3GLM A;  351C A;  4NPF X;  1LWU A;  5GTH E;  3JCU H;  3H1L D;  3CWB G;  4IFM A;  2BCC D;  1BE3 J;  1X22 A;  2OZ1 B;  3M0D A;  4JQ0 D;  3L72 J;  1LNQ A;  1VQK P;  2OGU A;  1N90 A;  2FYU G;  4L75 A;  1QKS A;  4RJT A;  2QSI A;  1GIW A;  3RK3 D;  1LFM A;  2Q3I A;  2QJY B;  3BAS A;  1NO4 A;  2WT7 A;  4I2L C;  2FRC A;  3DP5 A;  1CTZ A;  2FYZ A;  4H0J A;  4WWI A;  1DW3 A;  4FA1 A;  4JYB A;  3TSI A;  3L75 J;  1N7S A;  2EXV A;  1GK4 A;  1EZV D;  2Y9Z A;  3TGU J;  4MU8 A;  3PJS K;  2V7Q H;  4EYY Q;  2YO3 A;  3DMI A;  1PP9 D;  1WEJ F;  2RH0 A;  3USS A;  4AUW A;  4WY4 D;  2KZI A;  3RK3 B;  2C1U A;  3ABV C;  2O1J A;  5CIC B;  4C7R A;  3RBX A;  3H1I G;  1FDO A;  2VHD A;  2H7H A;  2B89 A;  4DCK A;  3AE2 C;  1HJ3 A;  3A3Y B;  2CE0 A;  4AQR D;  1C7M A;  1LTJ B;  4EI2 A;  1G2C B;  3CXH E;  3WUT A;  1KYO W;  1NGM B;  3AEF C;  4TT3 H;  1HJB A;  2PCC B;  1H89 A;  3VTP C;  4WY4 B;  3GHG C;  1F1C A;  2H88 C;  4C7N B;  5BU5 A;  3H1L G;  2WIT A;  2E43 A;  3KXD A;  1N2D C;  2BCC G;  2WPS A;  1W2E A;  3L35 A;  1ZRT E;  1CRJ A;  3QWO C;  4ZKP A;  1JCD A;  3BVH A;  3WUI A;  2IFN A;  1ZR4 A;  1GZL A;  4EDF A;  2R5B A;  2E74 B;  2ITA A;  5B66 E;  1BCC D;  1KC8 Q;  3M9Q A;  3OW2 O;  1KB9 D;  1DH3 A;  1NTK D;  3JC2 2;  1NH4 A;  5AVV B;  1L0N K;  3IN6 A;  3WFD C;  2P1J A;  1RAP A;  5BVZ A;  4A7P A;  1EZV G;  5DFS A;  1AOQ A;  4W7Z A;  4NPE A;  4FA5 A;  1PP9 G;  2ZVO B;  2CPB A;  3WU2 H;  1FDM A;  1LTB C;  1OWA A;  3PH0 A;  1QN2 A;  2V07 A;  1KIB A;  3L4F A;  4PD4 E;  5AVR B;  4BXL A;  1F1F A;  1NTM K;  1BDD A;  3H1J E;  1SQB D;  5GTI H;  4OGQ C;  2WMM A;  3P32 A;  5TIS V;  2W8Z A;  1YIC A;  1RE4 A;  2ZON G;  1LC1 A;  3AE9 C;  1H0T B;  2LIT A;  3M97 X;  2E75 C;  3TYY A;  1VQ8 P;  4XE5 B;  3TNU A;  3A0H E;  2NRG A;  4IL6 E;  1L0L E;  4I7Z C;  4Y5R A;  4U3F J;  2LXC B;  3CX5 E;  2M3E A;  2LIR A;  2YIU B;  1A8C A;  3NFQ A;  1WVE C;  2HLO A;  4KMG A;  4WQE A;  1JY2 N;  1P84 H;  1DX7 A;  5DJT B;  1PPJ D;  1NTK G;  3VN0 A;  3O8Z A;  1S72 P;  1GD2 E;  3F5H A;  1W2L A;  3SSU A;  4WQA A;  3O6Q B;  4U7J A;  4J20 A;  1C2R A;  2BLF B;  2QA4 P;  4P4Q B;  1KD1 Q;  1MFT A;  4PV1 B;  3JBT B;  3AE8 C;  1IO4 A;  1RZ5 A;  2D0W A;  1YHQ P;  3L74 J;  1L2P A;  2RMZ A;  3BCC D;  1SQB G;  2M5A A;  2AEF A;  2HG5 D;  2KYV A;  1WMK A;  5APU A;  1SQV J;  1KTM A;  3FGA D;  1FZA A;  1FCD C;  4RSZ A;  2E5T A;  1VQM P;  4ZMD A;  2ZZS 1;  3KZI V;  4IFF A;  1FZE A;  2FFD C;  3HD7 B;  1E29 A;  2WSC H;  1K8A Q;  1GQ1 A;  1LT9 C;  2SPZ A;  1EZV I;  2N9J A;  1ZLL A;  5E79 V;  1BE3 E;  3HE4 A;  1IZL 0;  4UB8 E;  2LXB A;  4PJ0 E;  2B87 A;  1CIG A;  1SQP J;  3L72 E;  4ZKU A;  1JY3 N;  1LTA C;  2KLU A;  4LGD E;  1MV8 A;  3SWS A;  4UB6 H;  1SQX D;  1DW0 A;  5APW A;  4N3Y B;  1RF0 C;  2C0X A;  1HF9 A;  2NPS A;  1Q81 Q;  1BDC A;  2B12 B;  4BRY A;  1JUN A;  1PPJ G;  1FJ0 A;  4JYC A;  1LWU C;  5CHX A;  2IFM A;  3L75 E;  4HJG H;  1U7M A;  2OYH A;  3TGU E;  3M0D C;  1K04 A;  1FZC B;  3BAT A;  1J1E C;  3L71 J;  4WQD A;  3IAO A;  2QE7 H;  2NPS D;  1FJK A;  1KIL E;  1CCR A;  1L4A B;  1RY3 A;  5KAF H;  1I8O A;  3BCC G;  1M56 D;  3HTK B;  1YCC A;  2KSE A;  3K5B A;  1IFP A;  3AEG C;  1EDL A;  2LKM A;  1T2K D;  2OYI B;  1IQC A;  1EDK A;  1N7S C;  1VQ9 P;  2PCB B;  1KB9 I;  1URQ A;  4RO0 A;  4M3L A;  2WQY C;  5AVY B;  2O01 N;  4LJI A;  5CYT R;  1USD A;  1N8R Q;  1PIX A;  1DII C;  4XFJ A;  3SWK A;  2QRX A;  1E2R A;  1SQX G;  1MFZ A;  3WMM 0;  3PRJ A;  5CBO A;  1LC2 A;  2V08 A;  1OX3 A;  1LMS A;  1I55 A;  1T3U A;  3NTN A;  2ZXY A;  3O0R C;  1VQ6 P;  1KFM A;  1OVU A;  5AW5 B;  1FI7 A;  5AW0 B;  1LTS C;  2ZXX A;  1RHZ B;  3ORV A;  1KZU B;  2WSE J;  4XYD B;  3O5C A;  2HOD A;  1LJ2 A;  1KQG B;  3A0H V;  1JTH A;  1DT1 A;  2YK3 A;  2GB8 B;  1VQL P;  1S5L E;  3AE4 C;  4FAV A;  1SQQ D;  3CD6 P;  1HVV A;  3CL3 D;  3F89 A;  1M6Z A;  3CCE P;  2WSC J;  4GED B;  2FYN C;  3H1K D;  2YKQ A;  3D70 A;  4EID A;  2ZBO A;  4R4L A;  3H6P A;  1ZME C;  1Q90 D;  2XNX A;  3IR9 A;  5DJQ B;  1JY2 P;  5CCH D;  1S9K E;  3CCV P;  1H8A A;  3G9R A;  3D6Z A;  2PAJ A;  1T8Z A;  4Y99 C;  2N1T A;  3AE7 C;  4U3F E;  2QJP B;  3W67 A;  3RL0 C;  3A7O A;  2QJK C;  1NTZ D;  1MZ9 A;  3RLM A;  3RK2 B;  1FI3 A;  3HUS A;  3B5N D;  1EXJ A;  1ZV8 A;  1KMI Z;  1RE4 C;  1J1D C;  3PXS A;  1JEK A;  2FYU K;  2O01 H;  3H1J J;  3L73 D;  1ZXG A;  2Y0E A;  2AXT H;  1YJ9 P;  1YBK A;  2N9I A;  4H0K A;  2KK7 A;  2POH A;  2W90 A;  3ZOW A;  1DD4 A;  2CXB A;  1NVO A;  2YQB A;  3PXT A;  2FWL A;  1PGQ A;  3A0B H;  1VDF A;  3CCU P;  2DW3 A;  3GF3 A;  3U59 A;  2IBZ D;  1CTY A;  1N73 B;  3L74 E;  1PZQ A;  5KKZ C;  2ZT9 B;  2Y0D A;  3EFG A;  2W6B A;  1SQQ G;  1SQV E;  3PHL A;  2BH4 X;  5B6Q A;  1DEE G;  1BCC J;  2WSS H;  2G8Y A;  1JY2 O;  2MKV A;  1CI6 B;  1HJ0 A;  2HPC B;  1HTL C;  5C0Z A;  3L70 J;  2I1K A;  5TJH A;  2OZ1 A;  4N78 D;  1M1K Q;  5KLV D;  1N7L A;  1K9M Q;  1G1J A;  3QH9 A;  1SQP E;  1K73 Q;  1NTZ G;  4JCG A;  1OMI A;  2WSF J;  5AW8 B;  5KAI H;  2YMY A;  1HH7 A;  4TLF A;  1KQF B;  3KQG A;  1AOF A;  4V2K A;  3M9B A;  3VYM A;  5AVS B;  1Q86 Q;  1HBW A;  1BSH A;  4L73 A;  1OIP A;  4Q5P A;  1HRC A;  1VQ7 P;  1FOC A;  1L0N J;  1FJP A;  2JO1 A;  1HUC A;  3OA7 A;  3L71 E;  1W5C T;  2ZOO A;  2Q6Q A;  2CPS A;  2GUV A;  2IBZ G;  2JDI H;  5AW9 B;  2NPS C;  4WQ8 A;  1YQ3 C;  1LTJ A;  1CYJ A;  3CXH D;  5B5E V;  1NTM J;  5C39 A;  1IK9 A;  1G2C A;  2L91 A;  2GUS A;  5H2F H;  2OAR A;  3VMX A;  4IFD K;  2AI5 A;  1RZ6 A;  3Q1M A;  2OYH C;  4WY4 A;  1A56 A;  1IFD A;  2PRR A;  3KZI E;  1I6D A;  3HQ7 A;  1H1O A;  3MZW B;  3Q2Y A;  1NU1 D;  1ZRT D; 
#chains in the Genus database with same CATH homology
 3TYI A;  2CA4 B;  4FAN A;  3ZCF A;  1A2S A;  3RMZ A;  3WFE C;  1N15 A;  1H33 B;  4Y5R A;  2KS1 A;  1CIH A;  5AUR A;  2MTA C;  2LIR A;  1CRG A;  3MK7 C;  2YIU B;  1NMI A;  1A8C A;  3H1H D;  1WVE C;  3NBS A;  3L4M A;  4KMG A;  4XXL A;  1N9C A;  2N18 C;  4QAO A;  4WQE A;  2O3J A;  5B66 V;  1RAQ A;  1CSW A;  1S5L V;  4WQC A;  2QG4 A;  2BGV X;  2BPB B;  1CSU A;  1PPJ D;  1CO6 A;  1W2L A;  3L71 D;  5C9M A;  2BCN B;  4WQA A;  1H9X A;  1I6E A;  3ITK A;  2ORL A;  4J20 A;  1C2R A;  2BLF B;  4PD4 D;  1IRV A;  1HJ4 A;  1ETP A;  1JDL A;  4AX3 A;  4P4Q B;  1CYC A;  1KV9 A;  1COR A;  1AKK A;  4DY9 A;  1CSX A;  2Y0C A;  1HJ5 A;  3JBT B;  2JWA A;  3DR0 A;  1RZ5 A;  2D0W A;  2RMZ A;  3GG2 A;  3BCC D;  5CID B;  1L9B C;  3CXH W;  1GKS A;  2CA3 B;  1BGY D;  4K3I A;  1MG2 D;  3RN1 A;  2HV4 A;  2AXT V;  1HZV A;  4AAO A;  3GW6 A;  1IO3 A;  3SLE A;  4L1Q A;  2GIW A;  1FCD C;  4RSZ A;  3MK7 B;  2ZZS 1;  3KZI V;  4PW9 B;  1L0L D;  5DF5 A;  1GJQ A;  1E29 A;  2BH5 X;  5CIE B;  1H33 A;  2N18 B;  3CX5 D;  2B10 B;  1I54 A;  1R0Q A;  1GQ1 A;  4YE1 A;  1M70 A;  3A0B V;  2N9J A;  1DIQ C;  3O1Y A;  2B11 B;  5E79 V;  1M60 A;  4IL6 V;  1IZL 0;  1CIG A;  4FA4 A;  4FA9 A;  1YIQ A;  3O20 A;  1QL4 A;  1C75 A;  3SWS A;  3PXW A;  1H31 B;  1SQX D;  1DW0 A;  3PLN A;  4GYD A;  2N9Y B;  1QL3 A;  1YFC A;  5CIB B;  2B12 B;  2YCC A;  1YEB A;  5EXQ A;  3A9F A;  1FJ0 A;  1NIR A;  4D6T D;  1QYZ A;  5CIF B;  3FWL A;  2A06 D;  3RN0 A;  1I5T A;  4WQD A;  1L9J C;  5KAI V;  3HQ6 A;  1CCR A;  1I8P A;  1OCD A;  4EIC A;  1CHH A;  1I8O A;  2JTI B;  1DVH A;  1YCC A;  1MZ4 A;  1CXC A;  1CHJ A;  1IQC A;  451C A;  2PCB B;  4EIE A;  1E8E A;  3WC8 A;  2C9X B;  1CRH A;  3OCD B;  2AIU A;  1CRI A;  1BE3 D;  3CU4 A;  3TF5 A;  4N0K A;  155C A;  3L72 D;  1IRW A;  4LJI A;  5CYT R;  1CED A;  1HZU A;  1K3H A;  1KX2 A;  3CX5 W;  3WU2 V;  2I8F A;  3CWB D;  1H31 A;  2C8S A;  4L3H A;  4UB8 V;  2L4D A;  4PJ0 V;  4WQB A;  1DII C;  2C1V A;  3OA8 B;  3H1J D;  4AAN A;  2FYU D;  1DW1 A;  1E2R A;  3CYT I;  1MG3 D;  5GTI V;  5H2F V;  3PRJ A;  5DJQ C;  3ZOO A;  1LC2 A;  2V08 A;  1U74 B;  2B0Z B;  3HQ8 A;  2KNC B;  3L75 D;  1CSV A;  4WQ7 A;  3PTZ A;  1LMS A;  1I55 A;  3KHU A;  1S6V B;  3TGU D;  1OAE A;  1CIF A;  3X39 A;  2ZXY A;  3O0R C;  4L3G A;  1AYG A;  4O1W A;  2N3Y A;  1FI7 A;  4PWA A;  2DVH A;  3ORV A;  1KX7 A;  1NNO A;  4XYD B;  3SJL A;  1NML A;  2XTS B;  1FHB A;  5KLI B;  3O5C A;  2Q3E A;  2PAC A;  1P84 D;  3A0H V;  3WFC C;  1DT1 A;  2C1D B;  2YK3 A;  2B4Z A;  1FI9 A;  1VYD A;  2GB8 B;  3NWV A;  2C2C A;  3H1I D;  5CIH B;  1COT A;  3VMA A;  4FAV A;  1SQQ D;  1DVV A;  3OCD A;  1KYO D;  1H9Y A;  3L70 D;  1N50 A;  5IY5 1;  1M6Z A;  5CIG B;  1C6S A;  4GED B;  3ZIY A;  4O1Q A;  3H1K D;  4EIF A;  4EID A;  3WFB C;  2ZBO A;  1CCH A;  4AAM A;  1U75 B;  5DJQ B;  351C A;  3PH2 B;  1B7V A;  3OA8 A;  3H1L D;  1CNO A;  2BCC D;  1K3G A;  2QJP B;  2OZ1 B;  1NTZ D;  3RLM A;  1FI3 A;  1N90 A;  2RN0 A;  3NBT A;  1QKS A;  4RJT A;  1GIW A;  1LFM A;  2CE1 A;  3C2C A;  3PXS A;  2QJY B;  3L73 D;  4FB1 A;  1L0N D;  4WQ9 A;  2Y0E A;  3SXT A;  2FRC A;  3DP5 A;  1CTZ A;  2N9I A;  2GC7 D;  4H0K A;  4H0J A;  1DW3 A;  4FA1 A;  3ZOW A;  3ZOX A;  3ZOY A;  2EXV A;  1EZV D;  2CXB A;  4MU8 A;  2DGE A;  3PXT A;  2FWL A;  2YQB A;  3DMI A;  1CHI A;  1PP9 D;  1NTM D;  2C1D A;  1WEJ F;  2FYN B;  2C1U A;  1CXA A;  2IBZ D;  4UB6 V;  1CTY A;  1HCM A;  5CIC B;  2GC4 D;  2Y0D A;  2VHD A;  1H32 B;  1C52 A;  3HQ9 A;  1HJ3 A;  2CE0 A;  1C7M A;  3PHL A;  1LS9 A;  2BH4 X;  3L4O A;  5B6Q A;  2MHM A;  2QJK B;  1KYO W;  1J3S A;  2PCC B;  4U3F D;  5C0Z A;  3VRD A;  1YEA A;  3CP5 A;  5GTH V;  2OZ1 A;  5TJH A;  1F1C A;  5KLV D;  1EB7 A;  1CRJ A;  4JCG A;  5KAF V;  1HH7 A;  1C6O A;  3WUI A;  1GU2 A;  4EDF A;  1DW2 A;  1AOF A;  4V2K A;  1BCC D;  1CRC A;  1YTC A;  3SVW A;  3VYM A;  2K9J B;  2JQR A;  1C6R A;  1KB9 D;  1NTK D;  1CYI A;  5KKZ B;  4Q5P A;  1HRC A;  1KB0 A;  1FOC A;  3WFD C;  1RAP A;  1C2N A;  3VNW A;  4A7P A;  5DFS A;  3ZBM A;  1AOQ A;  3L74 D;  4FA5 A;  1W5C T;  2ZOO A;  1QN2 A;  1ZZH A;  2V07 A;  1HRO A;  1KIB A;  1H32 A;  1CRY A;  4WQ8 A;  1SQV D;  1F1F A;  1CC5 A;  1CYJ A;  3CXH D;  5B5E V;  1GDV A;  1BL9 A;  1SQB D;  2L91 A;  3TDK A;  5TIS V;  4NFG B;  2D0S A;  1CTJ A;  2AI5 A;  1YIC A;  1RZ6 A;  4AAL A;  2ZON G;  1CIE A;  1A56 A;  1LC1 A;  2LIT A;  2N3B A;  3M97 X;  1I6D A;  3HQ7 A;  1H1O A;  1SQP D;  1YNR A;  1NU1 D;  1ZRT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...