3H1KD

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 62
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1kD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1kD02
2AXTV 1CCRA 3L75D 4A7PA 1C6RA 4O1QA 1CRIA 5CIGB 5KAFV 1GKSA 3ZIYA 1J3SA 4GYDA 155CA 1LMSA 2GB8B 2RN0A 1CSXA 1NNOA 1HZUA 1FOCA 4IL6V 2YCCA 3TGUD 4UB6V 3WFBC 3L74D 1M60A 1CHHA 1PPJD 1I5TA 1CXAA 4WQDA 4Q5PA 1W5CT 2QG4A 2PACA 1CRYA 1YEBA 2N9YB 4EIDA 4UB8V 1DW0A 2CA3B 1E2RA 1P84D 3CWBD 3ITKA 1AOQA 5E79V 2A06D 1SQBD 1NTZD 1CSVA 3SLEA 2I8FA 4K3IA 4WQAA 1L9JC 3X39A 4WQCA 4WQBA 1GDVA 3DP5A 1IO3A 1CRHA 2BH5X 1CIFA 1S6VB 2BH4X 4L3HA 1YFCA 2Y0DA 1DW3A 2BCNB 1FCDC 2HV4A 1FJ0A 4PD4D 1F1FA 1A56A 1FI7A 2ZOOA 2C1DB 2LIRA 1CYCA 1K3GA 2CE0A 3RN0A 1QL4A 1CNOA 1N9CA 2FYUD 1CYJA 2GC4D 3L4OA 4H0KA 3HQ6A 4FA1A 3CYTI 2B11B 3SWSA 5C9MA 2C8SA 5CYTR 2JTIB 3NBSA 3DR0A 1VYDA 3ZOYA 1SQQD 2JQRA 1KB0A 4KMGA 5KKZB 1CHIA 3MK7B 1LFMA 1A2SA 1NIRA 3TDKA 2JWAA 1FI3A 1COTA 1CRCA 1CTZA 1CTYA 1HJ5A 3O1YA 1IZL0 3FWLA 1N50A 1KB9D 3PLNA 1CXCA 1YTCA 1CIEA 1CSUA 4FA5A 1H31B 1F1CA 5TISV 2PCBB 3RMZA 2N3BA 2OZ1B 1CEDA 1C6SA 3L72D 1DVVA 1H33B 3L4MA 4EICA 2C1DA 1KIBA 2YK3A 2BCCD 5GTHV 3CP5A 1GU2A 2N3YA 5KLIB 3RN1A 5B6QA 4PJ0V 1HZVA 3WC8A 1IRVA 1YICA 3L73D 3PXWA 1L9BC 1WVEC 3HQ8A 4L3GA 1MZ4A 1N90A 1W2LA 4Y5RA 4JCGA 1K3HA 2V07A 1GIWA 2CE1A 1KYOW 1LS9A 1ZZHA 4J20A 4YE1A 1N15A 3SJLA 1HROA 1I54A 4PW9B 1IQCA 1KX2A 2AI5A 5GTIV 1FI9A 1B7VA 2Q3EA 2B10B 4FANA 1AOFA 3HQ9A 4RJTA 2B12B 2V08A 4H0JA 1BE3D 1C7MA 3PH2B 3C2CA 2D0WA 1AYGA 1H9YA 1ZRTD 2N18B 3JBTB 1H31A 2DVHA 2B4ZA 2QJPB 4FB1A 3KHUA 2OZ1A 1IRWA 2YQBA 1LC1A 3CXHW 1WEJF 1H33A 5CIEB 2GC7D 1OCDA 351CA 1H1OA 2C1UA 3O5CA 4V2KA 1I6DA 2O3JA 1HJ3A 1RZ6A 2XTSB 3KZIV 3PXTA 1YNRA 5C0ZA 1NMIA 2CXBA 3MK7C 3O0RC 5DF5A 1C6OA 3RLMA 2K9JB 1E29A 4AAMA 1NU1D 5CIHB 3HQ7A 3CXHD 1CIHA 1DIIC 3VNWA 3ZOXA 1DIQC 3H1KD 1YCCA 3NWVA 1CIGA 4U3FD 1LC2A 4DY9A 1H32B 5DFSA 2ORLA 3GW6A 2QJYB 1BCCD 1L0LD 2FRCA 4XXLA 4WQ7A 5CICB 1QN2A 3VYMA 2YIUB 1NMLA 3ZBMA 3CX5W 2IBZD 2GIWA 2MHMA 4AANA 1CRJA 3WU2V 1HCMA 3ZCFA 1U74B 2MTAC 1RAPA 1KX7A 1I8OA 5KLVD 4O1WA 1NTMD 3H1LD 2ZZS1 3TYIA 4WQ9A 1HJ4A 3ZOOA 2L91A 5B66V 1HH7A 3PXSA 3CX5D 3O20A 1CC5A 4GEDB 5H2FV 3A0HV 4EIEA 4LJIA 1OAEA 1QL3A 4FA9A 1SQVD 2N18C 4EDFA 1YEAA 1CO6A 1A8CA 1AKKA 1CSWA 3VRDA 1BGYD 2BGVX 3SVWA 1C2NA 1H32A 5CIDB 5DJQC 3OA8B 1MG3D 3ORVA 5CIFB 2PCCB 1C75A 2QJKB 1EZVD 2VHDA 1DVHA 4XYDB 1CHJA 3PRJA 5TJHA 1DT1A 2Y0CA 2D0SA 2CA4B 4NFGB 2AIUA 1L0ND 1QYZA 2L4DA 5B5EV 2KS1A 3NBTA 1SQPD 3TF5A 1I6EA 5IY51 1S5LV 2N9JA 1C52A 1KYOD 4EIFA 1CCHA 1I55A 2ZONG 2C1VA 1CRGA 3M97X 2N9IA 3OCDA 1ETPA 2FWLA 1R0QA 3CU4A 5DJQB 2B0ZB 2RMZA 1E8EA 3H1HD 2BLFB 1MG2D 4QAOA 2Y0EA 3PHLA 3A9FA 1GJQA 1RAQA 2EXVA 1BL9A 2DGEA 1C2RA 3ZOWA 2ZXYA 3OA8A 3WFCC 3A0BV 5KAIV 2ZBOA 5EXQA 2C9XB 3L71D 3H1JD 3VMAA 3WFEC 2KNCB 1KV9A 1FHBA 1CYIA 1NTKD 1HRCA 3BCCD 3L70D 1U75B 2BPBB 1DW2A 1CTJA 1I8PA 3H1ID 4FA4A 4FAVA 1GQ1A 1M70A 4MU8A 2FYNB 1M6ZA 3SXTA 4P4QB 1CORA 3PTZA 4PWAA 1EB7A 2LITA 4WQEA 4D6TD 4N0KA 4WQ8A 3DMIA 1DW1A 3GG2A 1H9XA 4AALA 1SQXD 1JDLA 451CA 3OCDB 5AURA 4AX3A 1RZ5A 4RSZA 1QKSA 4AAOA 2C2CA 1YIQA 3WUIA 4L1QA 3WFDC 5CIBB 1PP9D
chains in the Genus database with same CATH superfamily
1RF1A 1LP1A 2OYHB 3L75D 5CIGB 2AXTH 2Q9IA 5TISH 3L74G 155CA 2GB8B 1CSXA 1KMIZ 3CC2P 1ZP0C 1SFCD 3TGUD 1RE3C 3CD6P 3CC7P 1CHHA 1DX7A 2BCCE 1I5TA 1ZR2A 4H13D 1FOSE 3L36A 2FYUJ 3H1KJ 4I7ZB 2CA3B 1QVGO 3GHGC 5AW1B 2A06D 3AE7C 1N7SD 3M91A 4IFFA 2M8RA 4WQAA 2OTKE 2OYOA 1BSNA 2QRXA 4WQCA 1BDDA 1GDVA 1PGJA 1YYCA 2XKMA 1NTZE 4H44D 5APTA 4OWFA 2ZYDA 3H1IG 5AW9B 1USEA 2E75C 4R4LA 3CCLP 2HV4A 1F1FA 2ZT9B 4AYCA 3CC4P 2C1DB 1FE6A 1JY3P 2E74C 2OYIC 4H0KA 1SQXG 1GDTA 2C8SA 2LR2A 2YO3A 4H0LD 3AECC 2JTIB 2KSEA 3AE2C 1VQOP 3DR0A 1NKZB 1DD3A 3AE4C 5AW7B 1LTGC 4NPFX 1FDOA 1PP9G 3M0AA 3MK7B 1LFMA 3L37A 4OGQC 2BASA 1FJPA 2QEXP 1FI3A 1X22A 3FWLA 2XU6A 1KZUB 2O1KA 2R5DA 4FA5A 1H31B 1IC2A 1RF0A 2B87A 2E43A 1VQNP 1YQ3C 1GTWA 1W2EA 2H7HA 1H33B 3L4MA 2BCCD 1PPJG 1FU1A 2N3YA 5B6QA 2FY8A 1N7LA 2WQYC 4WY4A 4C7NB 1IFDA 1KQLA 4PJ0H 3L72E 3PXWA 2NPSA 1FS0E 3VOPA 1W2LA 1VPCA 5APSA 3CWBG 4OGQB 2V07A 1SQVE 3B5ND 2YKQA 2CE1A 2ZYAA 1LS9A 1ZZHA 4J20A 1KILE 4M3LA 3L73E 2M0BA 4U3FJ 3FWNA 3CCRP 3SJLA 1U7MA 2JDIH 4PW9B 4RESB 1B7VA 4RJTA 3GLMA 2WZ7A 4I6MC 5B5EH 3CCSP 1S1CX 2H43A 4B86A 1AYGA 1H9YA 1M7LA 1AQ5A 3A0BE 3T97B 5AW0B 3JBTB 1FZCA 3M06A 4L76A 1VQLP 3KHUA 1IRWA 5KJ7C 3D6ZA 5KLVJ 1VQ8P 1NTMJ 351CA 1H1OA 3HD7D 1KYOE 1ZRTE 3NMDA 1HJ3A 2XTSB 3KZIV 4C7RA 3PXTA 1YNRA 1HUCA 2KP8A 1AFOA 2FYUG 3K5BA 3H1KG 3RBZA 1OVVA 3HQ7A 3CXHD 4GIFA 2A45G 1SFCC 1GK4A 5CCHA 1H32B 2YXQB 5DFSA 1L4AB 5AVWB 1KQFB 3KQGA 1BCCD 1EDIA 1NU1E 1KC8Q 4XXLA 2R3SA 5B66E 1HWTC 1QN2A 1AQTA 2HODB 1J1DC 4EI2A 1LTIC 3AE9C 2MHMA 1EXIA 3SWYA 4WVZA 3BASA 3HE4B 1CRJA 1GW4A 3OAKA 1N7SC 1T6AA 1KX7A 2FXOA 2IBZE 3H1LD 3QWOC 3TYIA 4MN4C 1HJ4A 5KAFE 3RK2D 1HH7A 1R8EA 3WUUA 1KQSO 3H25A 1CC5A 3RL0B 4GEDB 1KTMA 4H44C 1NJIQ 4ZNCA 3TNUA 3BVHA 2R3CA 4FA9A 1SQVD 4WWIA 3LW5H 4NPEA 4EDFA 2PGDA 1YEAA 2DW3A 3F5HA 3IFMA 1CSWA 3VRDA 1BGYD 1H8AA 2KZJA 5CIDB 5DJQC 1OIPA 3ORVA 4UB8E 1C75A 3PRJA 3H1JJ 4XA4A 1DD4A 1LWUC 5E79E 3TK1A 2E5YA 1IK7A 2M5AA 1BDCA 3P32A 4DT0A 3L70J 1T3JA 1YIJP 1UIIA 1Q90D 2QM8A 4H0LC 4HH2A 1LT9B 1L0NE 1KYOD 4EYYQ 3M0DA 1FZGA 2ZONG 5CJ0A 2N9IA 1SQPE 2FWLA 5DJQB 1PGPA 4D6TJ 5AVSB 2YIUC 1NU1K 4QAOA 2Y0EA 2AEFA 4N78D 1FZFA 2PFXA 4U3FG 2ZXYA 2O01J 5KAIV 1JY3N 2XNDH 1CSBA 1KORA 2K88A 3C1LA 2WSFH 2YMKA 3VMYA 1SQQK 1SVFA 1VL2A 1Q86Q 1FHBA 3QH9A 1K9MQ 5CCGA 3I56P 3G3ZA 1N73C 5AW3B 1DW2A 3B5NC 1KYOH 3H1ID 2FFDB 4FAVA 1EQ7A 2WT7A 4MU8A 1M6ZA 5KLVG 1CI6A 3W68A 1NTMG 1XTGB 1NTKE 2ZT9D 2QJKC 1NVOA 4K35A 1VQ5P 5TISE 4N0KA 3DMIA 5L8RJ 1PZQA 1DW1A 2JR8A 4HYTB 1H9XA 1G2CA 4AALA 1SQXD 1VQ7P 2Q6QA 4AX3A 3O6QB 1SQBJ 4RSZA 1QKSA 3HD7C 3CPWO 2GUVA 3B5NB 5CIBB 1PP9D 3USSA 4BRYA 2OGUA 1AV1A 1HJ0A 1CCRA 1MZ9A 1L0NK 1C6RA 3C9IA 1CRIA 3CCQP 1J3SA 1LMSA 1SQPK 5GTIE 1NNOA 3IN6A 3AE3C 4IL6V 3L75E 1EDLA 2YCCA 4UB6V 3AEBC 2I1KA 1QL2A 3AE8C 1PPJD 2W90A 1NU1J 1T3UA 5KJ7A 3TGUE 1S72P 4EIDA 1DW0A 1P84D 3VYIA 1PGQA 3CWBD 5APYA 2I8FA 5APWA 4OH8B 5E79H 4GT1A 1SQQJ 3FX0A 3SSUA 3RK2C 2IFNA 1L9JC 3AEFC 2GA1A 3DP5A 2A06E 1SFCA 3H1JG 1CRHA 2KYVA 1BE3E 5AW6B 1YTZT 3L70G 1NAYA 1H88A 1KYOI 3II6A 1SP4A 4PD4D 1A56A 2LIRA 2JWDA 2OARA 1EDKA 1HGVA 4GODA 1N7SA 1KD1Q 1P84H 1CNOA 1N9CA 4D6TG 2OYHC 1TU3F 4WY4B 2FYUD 1LJ2A 2KOGA 1CYJA 2GC4D 2WITA 3HTKA 2NPSB 3HQ6A 4FA1A 1J1EB 3RK3B 3SWSA 5C9MA 5CYTR 1HGZA 5KLIC 3NBSA 3NTNA 1JEKA 1VYDA 3A0HE 3CMAP 1L4AD 1X9VA 5EFWB 3KXDA 5KKZB 4PJ0E 2JP3A 3AEAC 1YI2P 1GMJA 3G71P 2W6BA 2JWAA 1CZQA 1CRCA 1CTZA 3OA7A 3O1YA 1VF5B 4I7ZC 1H89A 3A5TA 2IBZI 2W6JH 1YTCA 1CIEA 4PD4H 4JPZB 1FZCB 2N3BA 1OVUA 1IFNA 2HPCA 2P67A 1IFMA 1KIBA 2YK3A 5GTHV 1GU2A 1OVRA 5KLIB 3RN1A 5B5EE 2IDBA 4EOTA 1IRVA 4JBZA 3WUVA 3RL0D 2XNXA 2A45H 1WVEC 4L3GA 1N90A 1QGKB 3EFGA 2GM4A 3B4SA 1JO5A 1SQBG 1KYOW 3E1IA 4YE1A 1MFTA 1SS1A 4KJMA 4YPCA 2H8PD 2ZT9C 2AI5A 1HJBA 1L0LJ 3BCCJ 4ASWA 4FANA 1RQUA 1MKMA 2V7QH 3HQ9A 1QL1A 1YQ4C 1BE3D 5GTIH 3H32A 2ITAA 1YBKA 3PH2B 1FOSF 2D0WA 1IJDB 4FB1A 2IFMA 2RH0A 1ZR4A 3HRNA 1LTJB 2P1JA 1GD2E 1LC1A 1WEJF 4DOJA 1JTHA 1GL2A 2C1UA 3MTUE 1NU1G 3EFFK 5C0ZA 1P84I 1NMIA 2CXBA 3MK7C 2WPVB 1C6OA 3RLMA 1GZLA 1YITP 3MUDA 3TNUB 5CIHB 1CIHA 4RKUJ 2IYOA 3VNWA 3ZOXA 2YKPA 1S9KD 3NWVA 4U3FD 5KAIH 1LC2A 4AUWA 1SQQG 4L74A 1VQ6P 3CLQA 2QJYB 2E5TA 3CXHE 2OTJP 4L73A 1NMLA 2GIWA 3HD7A 3TGUJ 1M57D 1A02F 5AVTB 2M5AB 3F89A 2WSSH 1BCCE 4AANA 3MP7B 4PD4I 3WU2V 1HCMA 3CL3D 1RAPA 1USDA 1I8OA 5KLVD 4O1WA 1NTMD 3Q3DA 2ZZS1 4WQ9A 1SLQA 2L91A 3VP9A 5B66V 1VQMP 5APVA 3CX5D 1E79H 1MV8A 2W6AA 1URQB 1RE4A 5H2FV 3H1HJ 3H1LE 2A45I 2K3RA 4LJIA 1NGMB 3KDPB 3A0HH 1GW3A 3EQ2A 2V4HA 2BGVX 3LIEA 1YJWP 2JKVA 1EZVD 4XYDB 1NTZK 5TJHA 5AW2B 3HUSA 3L71J 2PP6A 1BGYE 3LIDA 1YJNP 4NFGB 3Q5SA 2YMYA 1QYZA 2WSCH 4UB6H 1PV3A 1I6EA 3ZDMA 2JO1A 1S5LV 1C52A 3V2NA 4EIFA 1S3JA 5AVXB 3L74E 1L4AC 1J2JB 1KILA 2ZXXA 1CRGA 3M97X 3OCDA 1QVFO 1ETPA 4CPGA 1AA0A 2RMZA 1E8EA 4RO0A 3RL0g 2ZJSE 2W27A 3AEGC 1AVOA 1X8YA 1CW5A 2C0WA 1S5LX 1EC5A 3PHLA 2N1TB 2Y9YA 1T2KD 3PH0A 3WUTA 5BVZA 3V2QA 1L0LG 2ZBOA 3BCCG 1UIXA 2C9XB 3C8VA 4N78E 4XE5B 3H1JD 3VMAA 1KV9A 2AEJA 1MUUA 1CYIA 2P7JA 3RL0C 1DEBA 1OZHA 1IK9A 3L70D 1U75B 2BCCJ 2NRGA 4FA4A 3S1KA 2FKWB 2FYNB 3SXTA 3P7KA 2Q7CA 1CORA 2KS1B 3PTZA 1DIPA 1EB7A 3H1IE 3IR9A 5AVUB 4D6TD 4WQEA 3V2PA 1ZOYC 4TLFA 4WQ8A 2K1AA 1FAVA 4WY4D 1SQVK 2NPSD 3RK3D 1RE3A 4ASVA 1NTZJ 3CXHH 1LT9C 1M1JB 2LXBA 2WMMA 3R2PA 3Q5RA 3PJSK 2J58A 2B88A 1SQXE 4ZMDA 1U57A 2AXTV 3CMEP 2KNCA 4A7PA 3TGUG 3GHGA 1GKSA 3ZIYA 4GYDA 1VF5D 1PP9E 1EDJA 2IZ0A 1HZUA 1LTTC 3SWFA 3OW2O 1VQKP 1A02J 2ZVOB 3L74D 1M60A 1IZNB 1CXAA 4WQDA 4Q5PA 3AE5C 1RF1C 2PACA 1CRYA 3H1HG 1N2DC 1PIXA 1E2RA 3LW5J 3HTKB 1PPJE 3ITKA 1AOQA 3CCUP 3P8CD 1SQBD 1EZVI 2FFDC 3SLEA 4PV1D 2HR3A 3HE5A 1P84E 1HVVA 1JY2O 3CWBE 2OYIA 2MJZA 2WPSA 3L71G 3VMXA 3MGNA 3D70A 4TT3H 1CIFA 3H1LJ 3VN0A 4Y99B 1YFCA 1RF1B 2C9LY 1LP1B 2WSEJ 1EXJA 1DW3A 2BCNB 1FCDC 4HKZH 5APXA 2HPCB 3L72J 1ZV8A 1FI7A 2ZOOA 1CYCA 2R5BA 2CE0A 1QL4A 1SQVJ 4I2LC 1JNMA 3L73J 4PD4E 3L4OA 1SQXK 2Q1KA 2ZAEB 1VQPP 2PAJA 1MFZA 2CPBA 1N86A 5AVRB 3U1AA 3CXHI 4NPDA 1AJYA 2FYUE 1Q7YQ 3H1KE 1Y9BA 3ZOYA 1SQQD 2WSFJ 3T97A 3MHVA 1CHIA 1H0TA 1NIRA 2O01N 3AEEC 4DCKA 1NO4A 1HJ5A 3E7KA 1IZL0 1N50A 1KB9D 1OW7A 3PLNA 1CSUA 2BCCG 1Q81Q 1T2KC 4XFJA 3FXEA 1YJ9P 1CEDA 1C6SA 1DVVA 5APUA 1JTHB 3D71A 1NYHA 4GKGA 3GMAA 4PJ0V 1D7MA 4N3YB 5H2FH 3WC8A 5BU8B 1URQD 2IYPA 3RBXA 1L9BC 1L2PA 2IX7C 3HQ8A 1S4XA 1L4AA 2IZ1A 4JCGA 1GIWA 2JEEA 2CK3H 1NTZG 1RF0C 1N15A 2HODA 5K5GB 1LT1A 1HROA 1I54A 4IL6X 1KX2A 2UWJE 2Q3EA 2B10B 5AVQB 4AQRD 4HJGH 2B12B 2V08A 1KB9H 1C7MA 4YXWH 4WY4C 1K73Q 2POHA 1NOHA 2N18B 2NPSC 5CCGD 5KAIE 2DVHA 2B4ZA 1S5LH 1J1EC 2QJPB 1OXZA 3RK3C 2QE7H 2OZ1A 1NTKK 1YTZI 3CXHW 2XV5A 5CIEB 1K05A 2GC7D 4JF7A 3O5CA 4V2KA 2GUSA 1U7JA 2OTLP 4WBAA 3G9RA 5KKZC 2B87B 2LXCB 3O0RC 2FYUK 2KK7A 2HYNA 3MZWB 3KZIH 3CI9A 3M9QA 1VF5C 1JM0A 1DIIC 1T8ZA 2P58A 2N1TD 2HG5D 1FZCC 3H1KD 1YCCA 1CIGA 4DY9A 2NZ2A 3U1CA 3GW6A 5AW4B 2W83C 1L0LD 1OWAA 2P2UA 2FRCA 5C39A 3KPEA 4WQ7A 5CICB 3HUSB 1LT9A 1NHLA 1S9KE 3VYMA 4U3FE 4IFMA 2KXPB 1L0NJ 1IFIA 3H1LG 3ZCFA 3D6YA 2J5UA 1SQPJ 3H6PA 1K8AQ 4PV1C 2BEZF 2H88C 1HTLC 1GU4A 3N7NA 3L72G 5CCHC 3ZOOA 2KIKA 2C0XA 1DEEG 1QEXA 1SQVG 4Y28J 1LWUA 1JMMA 3Q1MA 1LTBC 2D2CC 4JYBA 1M8OB 3L73G 5KLVE 2K9JA 5CJ4A 1Q2NA 1NTME 2C9NY 4UB6E 2RKLA 3AE1C 3VP8A 1OAEA 4KHXA 1FZBA 2E76B 2R32A 3W67A 3CX5E 1G1IA 3B8EB 1LTSC 1AKKA 3SVWA 1LTJC 1MG3D 3L35A 1ZW0A 1M1KQ 3MIWA 2LKMA 1DVHA 1CHJA 4PV1B 1JY2P 3CCEP 2E42A 2Y0CA 2FFDA 1KB9I 3WMM0 2AIUA 4GOFA 4U7JA 1NTKJ 5BU5A 2L4DA 4DJGA 2R44A 1EZVE 3I5CA 1WT6A 1FC2C 4C46A 2D2CB 3V4WA 5IY51 3V6IA 1VQ4P 1CCHA 4OVNF 1OW8A 5KTBA 2QJYC 4IOIH 2C1VA 1QX8A 3A3YB 1R0QA 3O6QA 3N4XA 3B71A 3H1HD 2BLFB 1N73A 3B5NA 3A9FA 1GJQA 1RAQA 3CCVP 1DH3A 2EXVA 2DGEA 1C2RA 3ZOWA 3OA8A 3WFCC 5CBNA 3A0BV 3M0DC 2V7QJ 2I1JA 3L71D 3FGAD 3WFEC 1X79B 2KNCB 3L75J 1FZAA 1URQC 1RY3A 2HLOA 2IBZG 2ZFCA 5AVYB 3GHGB 1Y8AA 2BPBB 3G6EP 2HFED 1CTJA 3H1JE 5KLVK 2XDJA 1GQ1A 1FDIA 1M70A 1NTMK 3Q2YA 1HF9A 1N8RQ 4JYCA 2KUBA 2SPZA 2Q5UA 3L70E 4K3AA 1KFMA 4PWAA 1W2BO 2QIWA 3L4FA 1LTAC 4R4MA 3GG2A 2M3EA 4KT0J 1Z56A 5CCGC 1GK6A 451CA 3OJAB 5GTHE 3RGUA 2E75B 4D6TE 4AAOA 1Q82Q 2M3BA 1OMIA 1BE3J 3WUIA 1FJKA 2MKVA 3HE5B 2Q3IA 2E74B 2OYIB 3RK3E 1JCDA 4DZOA 4O1QA 1L0NG 4W80A 5KAFV 1AVYA 4W7YA 3SFEC 2YKOA 2RN0A 2I8DA 4LC1A 1SQPG 2CPSA 2N1TC 1FOCA 1KQGB 2Z5HA 3WFBC 1X0TA 2Z4EA 4IL6H 1BSHA 1GL2D 1W5CT 2QG4A 2WT7B 3CX5H 1CI6B 1YEBA 2N9YB 3A2AA 4UB8V 3VMZA 4YTPC 3Q5PA 5E79V 1NTZD 3JSVC 1CSVA 2FYNC 3JC22 4K3IA 1G2CB 3P8MC 3X39A 4WQBA 2P10A 3P8CE 2OYHA 3V4QA 1SQBE 4JQ0D 1H0TB 2PRRA 1ZLLA 1IO3A 2Y9ZA 2BH5X 1NTKG 2VRSA 2WSCJ 1S6VB 4L3HA 2BH4X 3U59A 4BRYB 1JMBA 2QA4P 5AVVB 2Y0DA 2AXCA 4LLHA 3TYYA 1KN7A 1M1JC 1FJ0A 2FYZA 1QLED 1K3GA 3RN0A 3D0WA 3WU2E 1OX3A 2B89A 1FBMA 1VQ9P 1S2EA 4GDOA 2AEMA 3CYTI 2B11B 2XZRA 1ZN5A 2FBWC 4H13C 4BWNA 2WWWA 5H2FE 1VDFA 2JQRA 1KB0A 4KMGA 1A2SA 1JOCA 3L75G 3TDKA 3UIAA 1LTJA 4YXDC 1PGOA 1COTA 1SQQE 1CTYA 3BRTB 1CXCA 4GOEA 5TISV 1F1CA 1SFCB 2PCBB 3RMZA 3EWKA 2OZ1B 3L72D 4EICA 2C1DA 1KB9E 1NAFA 1JY2N 5APQA 3CP5A 2B9BA 1M90Q 2N9BA 1HZVA 4H13B 3V2RA 1KILD 1YICA 5GTHH 1NWQA 3L73D 1J1DB 3CX5I 1S5LE 3M9BA 1MZ4A 3AEDC 4Y5RA 1RH5B 1K3HA 4Y99C 1SQBK 5CHXA 1N7SB 3JCUE 5AW5B 2E76D 2A06G 2ZYGA 1BE3G 1IQCA 3NFQA 5GTIV 1FI9A 1BCCJ 3AE6C 4ZKUA 2O01H 3KZIE 1AOFA 4H0JA 2YXRB 2ZVNB 4H44B 5CCHD 3C2CA 2WSEH 2J59M 4QMAA 1IFPA 3S4RA 4BXLA 1ZRTD 3M9HA 2KLUA 1H31A 4I1LA 3V5BA 2D2CD 1URQA 2YQBA 2KZIA 1H33A 1LNQA 4W7ZA 1OCDA 2KI7B 1I6DA 2O3JA 1RZ6A 4C7NA 1LWUB 5DF5A 3FXDA 2K9JB 1RHZB 1E29A 4AAMA 1NU1D 4H0LB 1JCCA 1HH0A 1DIQC 3A0BH 1BGYJ 4LGDE 2ZXEB 3SFDC 2ORLA 2QSIA 5CMZA 4WB4A 1GL2C 1JB0J 2W8ZA 1OFCX 2YIUB 1K04A 1YHQP 5DJUB 3ZBMA 3CX5W 2IBZD 1M56D 3GF7A 1LGHB 3L74J 1JUNA 1L0LE 3BCCE 5DJTB 3MUDC 1U74B 2MTAC 3R4YA 3SWKA 5AW8B 2AXTE 1Y47A 3H32B 3WU2H 3BATA 2L5GB 1JY3O 2IPPA 3PP5A 1IO4A 2QM7A 3NXSA 3PXSA 2N1TA 2G8YA 3O20A 5B66H 3VTPC 3A0HV 3S9OA 4EIEA 1GL2B 1N73B 1QL3A 3GF3A 2N18C 3MD0A 1EZVG 1CO6A 2QJPC 1A8CA 1FZEA 2JJLA 1C2NA 1H32A 2E75D 2BEQD 1W5CE 2WPQA 3OA8B 3A7OA 2Z5IA 2KB7P 5CIFB 2PCCB 2QJKB 2VHDA 1RQVA 3E1RA 3IF4A 1DT1A 3ABVC 2D0SA 2CA4B 5KAFH 2E74D 2H89C 1FDMA 3I55P 3G4SP 1L0ND 1GU5A 1RE4C 2WTYA 5B5EV 3HE4A 5AVZB 2KS1A 3NBTA 1SQPD 3IAOA 3TF5A 3H1IJ 1IFJA 2YNYA 2N9JA 3HD7B 1R5LA 4Z1MH 2WPRA 2YO2A 1I55A 1HBWA 4IFDK 1WRGA 1WMKA 4L75A 1KV4A 1ZXGA 1PFIA 4UB8H 3CU4A 3HUSC 2B0ZB 4OGQD 3JCUH 1M1JA 2O1JA 3KYQA 1E5WA 1MG2D 2KSJA 1SQXJ 3CCJP 5M1BA 1BL9A 3H1HE 1L0LK 4EIJA 1BCCG 3O8ZA 5EXQA 1PP9J 1NH4A 1KILC 5CBOA 2G3AA 4N6JA 2K9YA 2WVRA 1OW6A 1NTKD 1HRCA 2OQQA 3BCCD 3BRVB 1R5SA 3L71E 2E76C 1I8PA 1PL5A 1XTCC 2QVAA 4P4QB 1ZMEC 3RK2B 4HB1A 2KLVA 3TSIA 4ZKPA 4O9BA 1NKNA 2FXMA 2LITA 3CCMP 1G1JA 1KILB 1JDLA 3CWBJ 2FXPA 3OCDB 5AURA 1RZ5A 1BGYG 1KFNA 4IL6E 5KJ7D 2C2CA 1YIQA 2K37A 4L1QA 3WFDC
chains in the Genus database with same CATH topology
2AXTV 1CCRA 3L75D 4A7PA 1C6RA 4O1QA 1CRIA 5CIGB 5KAFV 1GKSA 3ZIYA 1J3SA 4GYDA 155CA 1LMSA 2GB8B 2RN0A 1CSXA 1NNOA 1HZUA 1FOCA 4IL6V 2YCCA 3TGUD 4UB6V 3WFBC 3L74D 1M60A 1CHHA 1PPJD 1I5TA 1CXAA 4WQDA 4Q5PA 1W5CT 2QG4A 2PACA 1CRYA 1YEBA 2N9YB 4EIDA 4UB8V 1DW0A 2CA3B 1E2RA 1P84D 3CWBD 3ITKA 1AOQA 5E79V 2A06D 1SQBD 1NTZD 1CSVA 3SLEA 2I8FA 4K3IA 4WQAA 1L9JC 3X39A 4WQCA 4WQBA 1GDVA 3DP5A 1IO3A 1CRHA 2BH5X 1CIFA 1S6VB 2BH4X 4L3HA 1YFCA 2Y0DA 1DW3A 2BCNB 1FCDC 2HV4A 1FJ0A 4PD4D 1F1FA 1A56A 1FI7A 2ZOOA 2C1DB 2LIRA 1CYCA 1K3GA 2CE0A 3RN0A 1QL4A 1CNOA 1N9CA 2FYUD 1CYJA 2GC4D 3L4OA 4H0KA 3HQ6A 4FA1A 3CYTI 2B11B 3SWSA 5C9MA 2C8SA 5CYTR 2JTIB 3NBSA 3DR0A 1VYDA 3ZOYA 1SQQD 2JQRA 1KB0A 4KMGA 5KKZB 1CHIA 3MK7B 1LFMA 1A2SA 1NIRA 3TDKA 2JWAA 1FI3A 1COTA 1CRCA 1CTZA 1CTYA 1HJ5A 3O1YA 1IZL0 3FWLA 1N50A 1KB9D 3PLNA 1CXCA 1YTCA 1CIEA 1CSUA 4FA5A 1H31B 1F1CA 5TISV 2PCBB 3RMZA 2N3BA 2OZ1B 1CEDA 1C6SA 3L72D 1DVVA 1H33B 3L4MA 4EICA 2C1DA 1KIBA 2YK3A 2BCCD 5GTHV 3CP5A 1GU2A 2N3YA 5KLIB 3RN1A 5B6QA 4PJ0V 1HZVA 3WC8A 1IRVA 1YICA 3L73D 3PXWA 1L9BC 1WVEC 3HQ8A 4L3GA 1MZ4A 1N90A 1W2LA 4Y5RA 4JCGA 1K3HA 2V07A 1GIWA 2CE1A 1KYOW 1LS9A 1ZZHA 4J20A 4YE1A 1N15A 3SJLA 1HROA 1I54A 4PW9B 1IQCA 1KX2A 2AI5A 5GTIV 1FI9A 1B7VA 2Q3EA 2B10B 4FANA 1AOFA 3HQ9A 4RJTA 2B12B 2V08A 4H0JA 1BE3D 1C7MA 3PH2B 3C2CA 2D0WA 1AYGA 1H9YA 1ZRTD 2N18B 3JBTB 1H31A 2DVHA 2B4ZA 2QJPB 4FB1A 3KHUA 2OZ1A 1IRWA 2YQBA 1LC1A 3CXHW 1WEJF 1H33A 5CIEB 2GC7D 1OCDA 351CA 1H1OA 2C1UA 3O5CA 4V2KA 1I6DA 2O3JA 1HJ3A 1RZ6A 2XTSB 3KZIV 3PXTA 1YNRA 5C0ZA 1NMIA 2CXBA 3MK7C 3O0RC 5DF5A 1C6OA 3RLMA 2K9JB 1E29A 4AAMA 1NU1D 5CIHB 3HQ7A 3CXHD 1CIHA 1DIIC 3VNWA 3ZOXA 1DIQC 3H1KD 1YCCA 3NWVA 1CIGA 4U3FD 1LC2A 4DY9A 1H32B 5DFSA 2ORLA 3GW6A 2QJYB 1BCCD 1L0LD 2FRCA 4XXLA 4WQ7A 5CICB 1QN2A 3VYMA 2YIUB 1NMLA 3ZBMA 3CX5W 2IBZD 2GIWA 2MHMA 4AANA 1CRJA 3WU2V 1HCMA 3ZCFA 1U74B 2MTAC 1RAPA 1KX7A 1I8OA 5KLVD 4O1WA 1NTMD 3H1LD 2ZZS1 3TYIA 4WQ9A 1HJ4A 3ZOOA 2L91A 5B66V 1HH7A 3PXSA 3CX5D 3O20A 1CC5A 4GEDB 5H2FV 3A0HV 4EIEA 4LJIA 1OAEA 1QL3A 4FA9A 1SQVD 2N18C 4EDFA 1YEAA 1CO6A 1A8CA 1AKKA 1CSWA 3VRDA 1BGYD 2BGVX 3SVWA 1C2NA 1H32A 5CIDB 5DJQC 3OA8B 1MG3D 3ORVA 5CIFB 2PCCB 1C75A 2QJKB 1EZVD 2VHDA 1DVHA 4XYDB 1CHJA 3PRJA 5TJHA 1DT1A 2Y0CA 2D0SA 2CA4B 4NFGB 2AIUA 1L0ND 1QYZA 2L4DA 5B5EV 2KS1A 3NBTA 1SQPD 3TF5A 1I6EA 5IY51 1S5LV 2N9JA 1C52A 1KYOD 4EIFA 1CCHA 1I55A 2ZONG 2C1VA 1CRGA 3M97X 2N9IA 3OCDA 1ETPA 2FWLA 1R0QA 3CU4A 5DJQB 2B0ZB 2RMZA 1E8EA 3H1HD 2BLFB 1MG2D 4QAOA 2Y0EA 3PHLA 3A9FA 1GJQA 1RAQA 2EXVA 1BL9A 2DGEA 1C2RA 3ZOWA 2ZXYA 3OA8A 3WFCC 3A0BV 5KAIV 2ZBOA 5EXQA 2C9XB 3L71D 3H1JD 3VMAA 3WFEC 2KNCB 1KV9A 1FHBA 1CYIA 1NTKD 1HRCA 3BCCD 3L70D 1U75B 2BPBB 1DW2A 1CTJA 1I8PA 3H1ID 4FA4A 4FAVA 1GQ1A 1M70A 4MU8A 2FYNB 1M6ZA 3SXTA 4P4QB 1CORA 3PTZA 4PWAA 1EB7A 2LITA 4WQEA 4D6TD 4N0KA 4WQ8A 3DMIA 1DW1A 3GG2A 1H9XA 4AALA 1SQXD 1JDLA 451CA 3OCDB 5AURA 4AX3A 1RZ5A 4RSZA 1QKSA 4AAOA 2C2CA 1YIQA 3WUIA 4L1QA 3WFDC 5CIBB 1PP9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT V;  1CCR A;  3L75 D;  4A7P A;  1C6R A;  4O1Q A;  1CRI A;  5CIG B;  5KAF V;  1GKS A;  3ZIY A;  1J3S A;  4GYD A;  155C A;  1LMS A;  2GB8 B;  2RN0 A;  1CSX A;  1NNO A;  1HZU A;  1FOC A;  4IL6 V;  2YCC A;  3TGU D;  4UB6 V;  3WFB C;  3L74 D;  1M60 A;  1CHH A;  1PPJ D;  1I5T A;  1CXA A;  4WQD A;  4Q5P A;  1W5C T;  2QG4 A;  2PAC A;  1CRY A;  1YEB A;  2N9Y B;  4EID A;  4UB8 V;  1DW0 A;  2CA3 B;  1E2R A;  1P84 D;  3CWB D;  3ITK A;  1AOQ A;  5E79 V;  2A06 D;  1SQB D;  1NTZ D;  1CSV A;  3SLE A;  2I8F A;  4K3I A;  4WQA A;  1L9J C;  3X39 A;  4WQC A;  4WQB A;  1GDV A;  3DP5 A;  1IO3 A;  1CRH A;  2BH5 X;  1CIF A;  1S6V B;  2BH4 X;  4L3H A;  1YFC A;  2Y0D A;  1DW3 A;  2BCN B;  1FCD C;  2HV4 A;  1FJ0 A;  4PD4 D;  1F1F A;  1A56 A;  1FI7 A;  2ZOO A;  2C1D B;  2LIR A;  1CYC A;  1K3G A;  2CE0 A;  3RN0 A;  1QL4 A;  1CNO A;  1N9C A;  2FYU D;  1CYJ A;  2GC4 D;  3L4O A;  4H0K A;  3HQ6 A;  4FA1 A;  3CYT I;  2B11 B;  3SWS A;  5C9M A;  2C8S A;  5CYT R;  2JTI B;  3NBS A;  3DR0 A;  1VYD A;  3ZOY A;  1SQQ D;  2JQR A;  1KB0 A;  4KMG A;  5KKZ B;  1CHI A;  3MK7 B;  1LFM A;  1A2S A;  1NIR A;  3TDK A;  2JWA A;  1FI3 A;  1COT A;  1CRC A;  1CTZ A;  1CTY A;  1HJ5 A;  3O1Y A;  1IZL 0;  3FWL A;  1N50 A;  1KB9 D;  3PLN A;  1CXC A;  1YTC A;  1CIE A;  1CSU A;  4FA5 A;  1H31 B;  1F1C A;  5TIS V;  2PCB B;  3RMZ A;  2N3B A;  2OZ1 B;  1CED A;  1C6S A;  3L72 D;  1DVV A;  1H33 B;  3L4M A;  4EIC A;  2C1D A;  1KIB A;  2YK3 A;  2BCC D;  5GTH V;  3CP5 A;  1GU2 A;  2N3Y A;  5KLI B;  3RN1 A;  5B6Q A;  4PJ0 V;  1HZV A;  3WC8 A;  1IRV A;  1YIC A;  3L73 D;  3PXW A;  1L9B C;  1WVE C;  3HQ8 A;  4L3G A;  1MZ4 A;  1N90 A;  1W2L A;  4Y5R A;  4JCG A;  1K3H A;  2V07 A;  1GIW A;  2CE1 A;  1KYO W;  1LS9 A;  1ZZH A;  4J20 A;  4YE1 A;  1N15 A;  3SJL A;  1HRO A;  1I54 A;  4PW9 B;  1IQC A;  1KX2 A;  2AI5 A;  5GTI V;  1FI9 A;  1B7V A;  2Q3E A;  2B10 B;  4FAN A;  1AOF A;  3HQ9 A;  4RJT A;  2B12 B;  2V08 A;  4H0J A;  1BE3 D;  1C7M A;  3PH2 B;  3C2C A;  2D0W A;  1AYG A;  1H9Y A;  1ZRT D;  2N18 B;  3JBT B;  1H31 A;  2DVH A;  2B4Z A;  2QJP B;  4FB1 A;  3KHU A;  2OZ1 A;  1IRW A;  2YQB A;  1LC1 A;  3CXH W;  1WEJ F;  1H33 A;  5CIE B;  2GC7 D;  1OCD A;  351C A;  1H1O A;  2C1U A;  3O5C A;  4V2K A;  1I6D A;  2O3J A;  1HJ3 A;  1RZ6 A;  2XTS B;  3KZI V;  3PXT A;  1YNR A;  5C0Z A;  1NMI A;  2CXB A;  3MK7 C;  3O0R C;  5DF5 A;  1C6O A;  3RLM A;  2K9J B;  1E29 A;  4AAM A;  1NU1 D;  5CIH B;  3HQ7 A;  3CXH D;  1CIH A;  1DII C;  3VNW A;  3ZOX A;  1DIQ C;  3H1K D;  1YCC A;  3NWV A;  1CIG A;  4U3F D;  1LC2 A;  4DY9 A;  1H32 B;  5DFS A;  2ORL A;  3GW6 A;  2QJY B;  1BCC D;  1L0L D;  2FRC A;  4XXL A;  4WQ7 A;  5CIC B;  1QN2 A;  3VYM A;  2YIU B;  1NML A;  3ZBM A;  3CX5 W;  2IBZ D;  2GIW A;  2MHM A;  4AAN A;  1CRJ A;  3WU2 V;  1HCM A;  3ZCF A;  1U74 B;  2MTA C;  1RAP A;  1KX7 A;  1I8O A;  5KLV D;  4O1W A;  1NTM D;  3H1L D;  2ZZS 1;  3TYI A;  4WQ9 A;  1HJ4 A;  3ZOO A;  2L91 A;  5B66 V;  1HH7 A;  3PXS A;  3CX5 D;  3O20 A;  1CC5 A;  4GED B;  5H2F V;  3A0H V;  4EIE A;  4LJI A;  1OAE A;  1QL3 A;  4FA9 A;  1SQV D;  2N18 C;  4EDF A;  1YEA A;  1CO6 A;  1A8C A;  1AKK A;  1CSW A;  3VRD A;  1BGY D;  2BGV X;  3SVW A;  1C2N A;  1H32 A;  5CID B;  5DJQ C;  3OA8 B;  1MG3 D;  3ORV A;  5CIF B;  2PCC B;  1C75 A;  2QJK B;  1EZV D;  2VHD A;  1DVH A;  4XYD B;  1CHJ A;  3PRJ A;  5TJH A;  1DT1 A;  2Y0C A;  2D0S A;  2CA4 B;  4NFG B;  2AIU A;  1L0N D;  1QYZ A;  2L4D A;  5B5E V;  2KS1 A;  3NBT A;  1SQP D;  3TF5 A;  1I6E A;  5IY5 1;  1S5L V;  2N9J A;  1C52 A;  1KYO D;  4EIF A;  1CCH A;  1I55 A;  2ZON G;  2C1V A;  1CRG A;  3M97 X;  2N9I A;  3OCD A;  1ETP A;  2FWL A;  1R0Q A;  3CU4 A;  5DJQ B;  2B0Z B;  2RMZ A;  1E8E A;  3H1H D;  2BLF B;  1MG2 D;  4QAO A;  2Y0E A;  3PHL A;  3A9F A;  1GJQ A;  1RAQ A;  2EXV A;  1BL9 A;  2DGE A;  1C2R A;  3ZOW A;  2ZXY A;  3OA8 A;  3WFC C;  3A0B V;  5KAI V;  2ZBO A;  5EXQ A;  2C9X B;  3L71 D;  3H1J D;  3VMA A;  3WFE C;  2KNC B;  1KV9 A;  1FHB A;  1CYI A;  1NTK D;  1HRC A;  3BCC D;  3L70 D;  1U75 B;  2BPB B;  1DW2 A;  1CTJ A;  1I8P A;  3H1I D;  4FA4 A;  4FAV A;  1GQ1 A;  1M70 A;  4MU8 A;  2FYN B;  1M6Z A;  3SXT A;  4P4Q B;  1COR A;  3PTZ A;  4PWA A;  1EB7 A;  2LIT A;  4WQE A;  4D6T D;  4N0K A;  4WQ8 A;  3DMI A;  1DW1 A;  3GG2 A;  1H9X A;  4AAL A;  1SQX D;  1JDL A;  451C A;  3OCD B;  5AUR A;  4AX3 A;  1RZ5 A;  4RSZ A;  1QKS A;  4AAO A;  2C2C A;  1YIQ A;  3WUI A;  4L1Q A;  3WFD C;  5CIB B;  1PP9 D; 
#chains in the Genus database with same CATH topology
 1RF1 A;  1LP1 A;  2OYH B;  3L75 D;  5CIG B;  2AXT H;  2Q9I A;  5TIS H;  3L74 G;  155C A;  2GB8 B;  1CSX A;  1KMI Z;  3CC2 P;  1ZP0 C;  1SFC D;  3TGU D;  1RE3 C;  3CD6 P;  3CC7 P;  1CHH A;  1DX7 A;  2BCC E;  1I5T A;  1ZR2 A;  4H13 D;  1FOS E;  3L36 A;  2FYU J;  3H1K J;  4I7Z B;  2CA3 B;  1QVG O;  3GHG C;  5AW1 B;  2A06 D;  3AE7 C;  1N7S D;  3M91 A;  4IFF A;  2M8R A;  4WQA A;  2OTK E;  2OYO A;  1BSN A;  2QRX A;  4WQC A;  1BDD A;  1GDV A;  1PGJ A;  1YYC A;  2XKM A;  1NTZ E;  4H44 D;  5APT A;  4OWF A;  2ZYD A;  3H1I G;  5AW9 B;  1USE A;  2E75 C;  4R4L A;  3CCL P;  2HV4 A;  1F1F A;  2ZT9 B;  4AYC A;  3CC4 P;  2C1D B;  1FE6 A;  1JY3 P;  2E74 C;  2OYI C;  4H0K A;  1SQX G;  1GDT A;  2C8S A;  2LR2 A;  2YO3 A;  4H0L D;  3AEC C;  2JTI B;  2KSE A;  3AE2 C;  1VQO P;  3DR0 A;  1NKZ B;  1DD3 A;  3AE4 C;  5AW7 B;  1LTG C;  4NPF X;  1FDO A;  1PP9 G;  3M0A A;  3MK7 B;  1LFM A;  3L37 A;  4OGQ C;  2BAS A;  1FJP A;  2QEX P;  1FI3 A;  1X22 A;  3FWL A;  2XU6 A;  1KZU B;  2O1K A;  2R5D A;  4FA5 A;  1H31 B;  1IC2 A;  1RF0 A;  2B87 A;  2E43 A;  1VQN P;  1YQ3 C;  1GTW A;  1W2E A;  2H7H A;  1H33 B;  3L4M A;  2BCC D;  1PPJ G;  1FU1 A;  2N3Y A;  5B6Q A;  2FY8 A;  1N7L A;  2WQY C;  4WY4 A;  4C7N B;  1IFD A;  1KQL A;  4PJ0 H;  3L72 E;  3PXW A;  2NPS A;  1FS0 E;  3VOP A;  1W2L A;  1VPC A;  5APS A;  3CWB G;  4OGQ B;  2V07 A;  1SQV E;  3B5N D;  2YKQ A;  2CE1 A;  2ZYA A;  1LS9 A;  1ZZH A;  4J20 A;  1KIL E;  4M3L A;  3L73 E;  2M0B A;  4U3F J;  3FWN A;  3CCR P;  3SJL A;  1U7M A;  2JDI H;  4PW9 B;  4RES B;  1B7V A;  4RJT A;  3GLM A;  2WZ7 A;  4I6M C;  5B5E H;  3CCS P;  1S1C X;  2H43 A;  4B86 A;  1AYG A;  1H9Y A;  1M7L A;  1AQ5 A;  3A0B E;  3T97 B;  5AW0 B;  3JBT B;  1FZC A;  3M06 A;  4L76 A;  1VQL P;  3KHU A;  1IRW A;  5KJ7 C;  3D6Z A;  5KLV J;  1VQ8 P;  1NTM J;  351C A;  1H1O A;  3HD7 D;  1KYO E;  1ZRT E;  3NMD A;  1HJ3 A;  2XTS B;  3KZI V;  4C7R A;  3PXT A;  1YNR A;  1HUC A;  2KP8 A;  1AFO A;  2FYU G;  3K5B A;  3H1K G;  3RBZ A;  1OVV A;  3HQ7 A;  3CXH D;  4GIF A;  2A45 G;  1SFC C;  1GK4 A;  5CCH A;  1H32 B;  2YXQ B;  5DFS A;  1L4A B;  5AVW B;  1KQF B;  3KQG A;  1BCC D;  1EDI A;  1NU1 E;  1KC8 Q;  4XXL A;  2R3S A;  5B66 E;  1HWT C;  1QN2 A;  1AQT A;  2HOD B;  1J1D C;  4EI2 A;  1LTI C;  3AE9 C;  2MHM A;  1EXI A;  3SWY A;  4WVZ A;  3BAS A;  3HE4 B;  1CRJ A;  1GW4 A;  3OAK A;  1N7S C;  1T6A A;  1KX7 A;  2FXO A;  2IBZ E;  3H1L D;  3QWO C;  3TYI A;  4MN4 C;  1HJ4 A;  5KAF E;  3RK2 D;  1HH7 A;  1R8E A;  3WUU A;  1KQS O;  3H25 A;  1CC5 A;  3RL0 B;  4GED B;  1KTM A;  4H44 C;  1NJI Q;  4ZNC A;  3TNU A;  3BVH A;  2R3C A;  4FA9 A;  1SQV D;  4WWI A;  3LW5 H;  4NPE A;  4EDF A;  2PGD A;  1YEA A;  2DW3 A;  3F5H A;  3IFM A;  1CSW A;  3VRD A;  1BGY D;  1H8A A;  2KZJ A;  5CID B;  5DJQ C;  1OIP A;  3ORV A;  4UB8 E;  1C75 A;  3PRJ A;  3H1J J;  4XA4 A;  1DD4 A;  1LWU C;  5E79 E;  3TK1 A;  2E5Y A;  1IK7 A;  2M5A A;  1BDC A;  3P32 A;  4DT0 A;  3L70 J;  1T3J A;  1YIJ P;  1UII A;  1Q90 D;  2QM8 A;  4H0L C;  4HH2 A;  1LT9 B;  1L0N E;  1KYO D;  4EYY Q;  3M0D A;  1FZG A;  2ZON G;  5CJ0 A;  2N9I A;  1SQP E;  2FWL A;  5DJQ B;  1PGP A;  4D6T J;  5AVS B;  2YIU C;  1NU1 K;  4QAO A;  2Y0E A;  2AEF A;  4N78 D;  1FZF A;  2PFX A;  4U3F G;  2ZXY A;  2O01 J;  5KAI V;  1JY3 N;  2XND H;  1CSB A;  1KOR A;  2K88 A;  3C1L A;  2WSF H;  2YMK A;  3VMY A;  1SQQ K;  1SVF A;  1VL2 A;  1Q86 Q;  1FHB A;  3QH9 A;  1K9M Q;  5CCG A;  3I56 P;  3G3Z A;  1N73 C;  5AW3 B;  1DW2 A;  3B5N C;  1KYO H;  3H1I D;  2FFD B;  4FAV A;  1EQ7 A;  2WT7 A;  4MU8 A;  1M6Z A;  5KLV G;  1CI6 A;  3W68 A;  1NTM G;  1XTG B;  1NTK E;  2ZT9 D;  2QJK C;  1NVO A;  4K35 A;  1VQ5 P;  5TIS E;  4N0K A;  3DMI A;  5L8R J;  1PZQ A;  1DW1 A;  2JR8 A;  4HYT B;  1H9X A;  1G2C A;  4AAL A;  1SQX D;  1VQ7 P;  2Q6Q A;  4AX3 A;  3O6Q B;  1SQB J;  4RSZ A;  1QKS A;  3HD7 C;  3CPW O;  2GUV A;  3B5N B;  5CIB B;  1PP9 D;  3USS A;  4BRY A;  2OGU A;  1AV1 A;  1HJ0 A;  1CCR A;  1MZ9 A;  1L0N K;  1C6R A;  3C9I A;  1CRI A;  3CCQ P;  1J3S A;  1LMS A;  1SQP K;  5GTI E;  1NNO A;  3IN6 A;  3AE3 C;  4IL6 V;  3L75 E;  1EDL A;  2YCC A;  4UB6 V;  3AEB C;  2I1K A;  1QL2 A;  3AE8 C;  1PPJ D;  2W90 A;  1NU1 J;  1T3U A;  5KJ7 A;  3TGU E;  1S72 P;  4EID A;  1DW0 A;  1P84 D;  3VYI A;  1PGQ A;  3CWB D;  5APY A;  2I8F A;  5APW A;  4OH8 B;  5E79 H;  4GT1 A;  1SQQ J;  3FX0 A;  3SSU A;  3RK2 C;  2IFN A;  1L9J C;  3AEF C;  2GA1 A;  3DP5 A;  2A06 E;  1SFC A;  3H1J G;  1CRH A;  2KYV A;  1BE3 E;  5AW6 B;  1YTZ T;  3L70 G;  1NAY A;  1H88 A;  1KYO I;  3II6 A;  1SP4 A;  4PD4 D;  1A56 A;  2LIR A;  2JWD A;  2OAR A;  1EDK A;  1HGV A;  4GOD A;  1N7S A;  1KD1 Q;  1P84 H;  1CNO A;  1N9C A;  4D6T G;  2OYH C;  1TU3 F;  4WY4 B;  2FYU D;  1LJ2 A;  2KOG A;  1CYJ A;  2GC4 D;  2WIT A;  3HTK A;  2NPS B;  3HQ6 A;  4FA1 A;  1J1E B;  3RK3 B;  3SWS A;  5C9M A;  5CYT R;  1HGZ A;  5KLI C;  3NBS A;  3NTN A;  1JEK A;  1VYD A;  3A0H E;  3CMA P;  1L4A D;  1X9V A;  5EFW B;  3KXD A;  5KKZ B;  4PJ0 E;  2JP3 A;  3AEA C;  1YI2 P;  1GMJ A;  3G71 P;  2W6B A;  2JWA A;  1CZQ A;  1CRC A;  1CTZ A;  3OA7 A;  3O1Y A;  1VF5 B;  4I7Z C;  1H89 A;  3A5T A;  2IBZ I;  2W6J H;  1YTC A;  1CIE A;  4PD4 H;  4JPZ B;  1FZC B;  2N3B A;  1OVU A;  1IFN A;  2HPC A;  2P67 A;  1IFM A;  1KIB A;  2YK3 A;  5GTH V;  1GU2 A;  1OVR A;  5KLI B;  3RN1 A;  5B5E E;  2IDB A;  4EOT A;  1IRV A;  4JBZ A;  3WUV A;  3RL0 D;  2XNX A;  2A45 H;  1WVE C;  4L3G A;  1N90 A;  1QGK B;  3EFG A;  2GM4 A;  3B4S A;  1JO5 A;  1SQB G;  1KYO W;  3E1I A;  4YE1 A;  1MFT A;  1SS1 A;  4KJM A;  4YPC A;  2H8P D;  2ZT9 C;  2AI5 A;  1HJB A;  1L0L J;  3BCC J;  4ASW A;  4FAN A;  1RQU A;  1MKM A;  2V7Q H;  3HQ9 A;  1QL1 A;  1YQ4 C;  1BE3 D;  5GTI H;  3H32 A;  2ITA A;  1YBK A;  3PH2 B;  1FOS F;  2D0W A;  1IJD B;  4FB1 A;  2IFM A;  2RH0 A;  1ZR4 A;  3HRN A;  1LTJ B;  2P1J A;  1GD2 E;  1LC1 A;  1WEJ F;  4DOJ A;  1JTH A;  1GL2 A;  2C1U A;  3MTU E;  1NU1 G;  3EFF K;  5C0Z A;  1P84 I;  1NMI A;  2CXB A;  3MK7 C;  2WPV B;  1C6O A;  3RLM A;  1GZL A;  1YIT P;  3MUD A;  3TNU B;  5CIH B;  1CIH A;  4RKU J;  2IYO A;  3VNW A;  3ZOX A;  2YKP A;  1S9K D;  3NWV A;  4U3F D;  5KAI H;  1LC2 A;  4AUW A;  1SQQ G;  4L74 A;  1VQ6 P;  3CLQ A;  2QJY B;  2E5T A;  3CXH E;  2OTJ P;  4L73 A;  1NML A;  2GIW A;  3HD7 A;  3TGU J;  1M57 D;  1A02 F;  5AVT B;  2M5A B;  3F89 A;  2WSS H;  1BCC E;  4AAN A;  3MP7 B;  4PD4 I;  3WU2 V;  1HCM A;  3CL3 D;  1RAP A;  1USD A;  1I8O A;  5KLV D;  4O1W A;  1NTM D;  3Q3D A;  2ZZS 1;  4WQ9 A;  1SLQ A;  2L91 A;  3VP9 A;  5B66 V;  1VQM P;  5APV A;  3CX5 D;  1E79 H;  1MV8 A;  2W6A A;  1URQ B;  1RE4 A;  5H2F V;  3H1H J;  3H1L E;  2A45 I;  2K3R A;  4LJI A;  1NGM B;  3KDP B;  3A0H H;  1GW3 A;  3EQ2 A;  2V4H A;  2BGV X;  3LIE A;  1YJW P;  2JKV A;  1EZV D;  4XYD B;  1NTZ K;  5TJH A;  5AW2 B;  3HUS A;  3L71 J;  2PP6 A;  1BGY E;  3LID A;  1YJN P;  4NFG B;  3Q5S A;  2YMY A;  1QYZ A;  2WSC H;  4UB6 H;  1PV3 A;  1I6E A;  3ZDM A;  2JO1 A;  1S5L V;  1C52 A;  3V2N A;  4EIF A;  1S3J A;  5AVX B;  3L74 E;  1L4A C;  1J2J B;  1KIL A;  2ZXX A;  1CRG A;  3M97 X;  3OCD A;  1QVF O;  1ETP A;  4CPG A;  1AA0 A;  2RMZ A;  1E8E A;  4RO0 A;  3RL0 g;  2ZJS E;  2W27 A;  3AEG C;  1AVO A;  1X8Y A;  1CW5 A;  2C0W A;  1S5L X;  1EC5 A;  3PHL A;  2N1T B;  2Y9Y A;  1T2K D;  3PH0 A;  3WUT A;  5BVZ A;  3V2Q A;  1L0L G;  2ZBO A;  3BCC G;  1UIX A;  2C9X B;  3C8V A;  4N78 E;  4XE5 B;  3H1J D;  3VMA A;  1KV9 A;  2AEJ A;  1MUU A;  1CYI A;  2P7J A;  3RL0 C;  1DEB A;  1OZH A;  1IK9 A;  3L70 D;  1U75 B;  2BCC J;  2NRG A;  4FA4 A;  3S1K A;  2FKW B;  2FYN B;  3SXT A;  3P7K A;  2Q7C A;  1COR A;  2KS1 B;  3PTZ A;  1DIP A;  1EB7 A;  3H1I E;  3IR9 A;  5AVU B;  4D6T D;  4WQE A;  3V2P A;  1ZOY C;  4TLF A;  4WQ8 A;  2K1A A;  1FAV A;  4WY4 D;  1SQV K;  2NPS D;  3RK3 D;  1RE3 A;  4ASV A;  1NTZ J;  3CXH H;  1LT9 C;  1M1J B;  2LXB A;  2WMM A;  3R2P A;  3Q5R A;  3PJS K;  2J58 A;  2B88 A;  1SQX E;  4ZMD A;  1U57 A;  2AXT V;  3CME P;  2KNC A;  4A7P A;  3TGU G;  3GHG A;  1GKS A;  3ZIY A;  4GYD A;  1VF5 D;  1PP9 E;  1EDJ A;  2IZ0 A;  1HZU A;  1LTT C;  3SWF A;  3OW2 O;  1VQK P;  1A02 J;  2ZVO B;  3L74 D;  1M60 A;  1IZN B;  1CXA A;  4WQD A;  4Q5P A;  3AE5 C;  1RF1 C;  2PAC A;  1CRY A;  3H1H G;  1N2D C;  1PIX A;  1E2R A;  3LW5 J;  3HTK B;  1PPJ E;  3ITK A;  1AOQ A;  3CCU P;  3P8C D;  1SQB D;  1EZV I;  2FFD C;  3SLE A;  4PV1 D;  2HR3 A;  3HE5 A;  1P84 E;  1HVV A;  1JY2 O;  3CWB E;  2OYI A;  2MJZ A;  2WPS A;  3L71 G;  3VMX A;  3MGN A;  3D70 A;  4TT3 H;  1CIF A;  3H1L J;  3VN0 A;  4Y99 B;  1YFC A;  1RF1 B;  2C9L Y;  1LP1 B;  2WSE J;  1EXJ A;  1DW3 A;  2BCN B;  1FCD C;  4HKZ H;  5APX A;  2HPC B;  3L72 J;  1ZV8 A;  1FI7 A;  2ZOO A;  1CYC A;  2R5B A;  2CE0 A;  1QL4 A;  1SQV J;  4I2L C;  1JNM A;  3L73 J;  4PD4 E;  3L4O A;  1SQX K;  2Q1K A;  2ZAE B;  1VQP P;  2PAJ A;  1MFZ A;  2CPB A;  1N86 A;  5AVR B;  3U1A A;  3CXH I;  4NPD A;  1AJY A;  2FYU E;  1Q7Y Q;  3H1K E;  1Y9B A;  3ZOY A;  1SQQ D;  2WSF J;  3T97 A;  3MHV A;  1CHI A;  1H0T A;  1NIR A;  2O01 N;  3AEE C;  4DCK A;  1NO4 A;  1HJ5 A;  3E7K A;  1IZL 0;  1N50 A;  1KB9 D;  1OW7 A;  3PLN A;  1CSU A;  2BCC G;  1Q81 Q;  1T2K C;  4XFJ A;  3FXE A;  1YJ9 P;  1CED A;  1C6S A;  1DVV A;  5APU A;  1JTH B;  3D71 A;  1NYH A;  4GKG A;  3GMA A;  4PJ0 V;  1D7M A;  4N3Y B;  5H2F H;  3WC8 A;  5BU8 B;  1URQ D;  2IYP A;  3RBX A;  1L9B C;  1L2P A;  2IX7 C;  3HQ8 A;  1S4X A;  1L4A A;  2IZ1 A;  4JCG A;  1GIW A;  2JEE A;  2CK3 H;  1NTZ G;  1RF0 C;  1N15 A;  2HOD A;  5K5G B;  1LT1 A;  1HRO A;  1I54 A;  4IL6 X;  1KX2 A;  2UWJ E;  2Q3E A;  2B10 B;  5AVQ B;  4AQR D;  4HJG H;  2B12 B;  2V08 A;  1KB9 H;  1C7M A;  4YXW H;  4WY4 C;  1K73 Q;  2POH A;  1NOH A;  2N18 B;  2NPS C;  5CCG D;  5KAI E;  2DVH A;  2B4Z A;  1S5L H;  1J1E C;  2QJP B;  1OXZ A;  3RK3 C;  2QE7 H;  2OZ1 A;  1NTK K;  1YTZ I;  3CXH W;  2XV5 A;  5CIE B;  1K05 A;  2GC7 D;  4JF7 A;  3O5C A;  4V2K A;  2GUS A;  1U7J A;  2OTL P;  4WBA A;  3G9R A;  5KKZ C;  2B87 B;  2LXC B;  3O0R C;  2FYU K;  2KK7 A;  2HYN A;  3MZW B;  3KZI H;  3CI9 A;  3M9Q A;  1VF5 C;  1JM0 A;  1DII C;  1T8Z A;  2P58 A;  2N1T D;  2HG5 D;  1FZC C;  3H1K D;  1YCC A;  1CIG A;  4DY9 A;  2NZ2 A;  3U1C A;  3GW6 A;  5AW4 B;  2W83 C;  1L0L D;  1OWA A;  2P2U A;  2FRC A;  5C39 A;  3KPE A;  4WQ7 A;  5CIC B;  3HUS B;  1LT9 A;  1NHL A;  1S9K E;  3VYM A;  4U3F E;  4IFM A;  2KXP B;  1L0N J;  1IFI A;  3H1L G;  3ZCF A;  3D6Y A;  2J5U A;  1SQP J;  3H6P A;  1K8A Q;  4PV1 C;  2BEZ F;  2H88 C;  1HTL C;  1GU4 A;  3N7N A;  3L72 G;  5CCH C;  3ZOO A;  2KIK A;  2C0X A;  1DEE G;  1QEX A;  1SQV G;  4Y28 J;  1LWU A;  1JMM A;  3Q1M A;  1LTB C;  2D2C C;  4JYB A;  1M8O B;  3L73 G;  5KLV E;  2K9J A;  5CJ4 A;  1Q2N A;  1NTM E;  2C9N Y;  4UB6 E;  2RKL A;  3AE1 C;  3VP8 A;  1OAE A;  4KHX A;  1FZB A;  2E76 B;  2R32 A;  3W67 A;  3CX5 E;  1G1I A;  3B8E B;  1LTS C;  1AKK A;  3SVW A;  1LTJ C;  1MG3 D;  3L35 A;  1ZW0 A;  1M1K Q;  3MIW A;  2LKM A;  1DVH A;  1CHJ A;  4PV1 B;  1JY2 P;  3CCE P;  2E42 A;  2Y0C A;  2FFD A;  1KB9 I;  3WMM 0;  2AIU A;  4GOF A;  4U7J A;  1NTK J;  5BU5 A;  2L4D A;  4DJG A;  2R44 A;  1EZV E;  3I5C A;  1WT6 A;  1FC2 C;  4C46 A;  2D2C B;  3V4W A;  5IY5 1;  3V6I A;  1VQ4 P;  1CCH A;  4OVN F;  1OW8 A;  5KTB A;  2QJY C;  4IOI H;  2C1V A;  1QX8 A;  3A3Y B;  1R0Q A;  3O6Q A;  3N4X A;  3B71 A;  3H1H D;  2BLF B;  1N73 A;  3B5N A;  3A9F A;  1GJQ A;  1RAQ A;  3CCV P;  1DH3 A;  2EXV A;  2DGE A;  1C2R A;  3ZOW A;  3OA8 A;  3WFC C;  5CBN A;  3A0B V;  3M0D C;  2V7Q J;  2I1J A;  3L71 D;  3FGA D;  3WFE C;  1X79 B;  2KNC B;  3L75 J;  1FZA A;  1URQ C;  1RY3 A;  2HLO A;  2IBZ G;  2ZFC A;  5AVY B;  3GHG B;  1Y8A A;  2BPB B;  3G6E P;  2HFE D;  1CTJ A;  3H1J E;  5KLV K;  2XDJ A;  1GQ1 A;  1FDI A;  1M70 A;  1NTM K;  3Q2Y A;  1HF9 A;  1N8R Q;  4JYC A;  2KUB A;  2SPZ A;  2Q5U A;  3L70 E;  4K3A A;  1KFM A;  4PWA A;  1W2B O;  2QIW A;  3L4F A;  1LTA C;  4R4M A;  3GG2 A;  2M3E A;  4KT0 J;  1Z56 A;  5CCG C;  1GK6 A;  451C A;  3OJA B;  5GTH E;  3RGU A;  2E75 B;  4D6T E;  4AAO A;  1Q82 Q;  2M3B A;  1OMI A;  1BE3 J;  3WUI A;  1FJK A;  2MKV A;  3HE5 B;  2Q3I A;  2E74 B;  2OYI B;  3RK3 E;  1JCD A;  4DZO A;  4O1Q A;  1L0N G;  4W80 A;  5KAF V;  1AVY A;  4W7Y A;  3SFE C;  2YKO A;  2RN0 A;  2I8D A;  4LC1 A;  1SQP G;  2CPS A;  2N1T C;  1FOC A;  1KQG B;  2Z5H A;  3WFB C;  1X0T A;  2Z4E A;  4IL6 H;  1BSH A;  1GL2 D;  1W5C T;  2QG4 A;  2WT7 B;  3CX5 H;  1CI6 B;  1YEB A;  2N9Y B;  3A2A A;  4UB8 V;  3VMZ A;  4YTP C;  3Q5P A;  5E79 V;  1NTZ D;  3JSV C;  1CSV A;  2FYN C;  3JC2 2;  4K3I A;  1G2C B;  3P8M C;  3X39 A;  4WQB A;  2P10 A;  3P8C E;  2OYH A;  3V4Q A;  1SQB E;  4JQ0 D;  1H0T B;  2PRR A;  1ZLL A;  1IO3 A;  2Y9Z A;  2BH5 X;  1NTK G;  2VRS A;  2WSC J;  1S6V B;  4L3H A;  2BH4 X;  3U59 A;  4BRY B;  1JMB A;  2QA4 P;  5AVV B;  2Y0D A;  2AXC A;  4LLH A;  3TYY A;  1KN7 A;  1M1J C;  1FJ0 A;  2FYZ A;  1QLE D;  1K3G A;  3RN0 A;  3D0W A;  3WU2 E;  1OX3 A;  2B89 A;  1FBM A;  1VQ9 P;  1S2E A;  4GDO A;  2AEM A;  3CYT I;  2B11 B;  2XZR A;  1ZN5 A;  2FBW C;  4H13 C;  4BWN A;  2WWW A;  5H2F E;  1VDF A;  2JQR A;  1KB0 A;  4KMG A;  1A2S A;  1JOC A;  3L75 G;  3TDK A;  3UIA A;  1LTJ A;  4YXD C;  1PGO A;  1COT A;  1SQQ E;  1CTY A;  3BRT B;  1CXC A;  4GOE A;  5TIS V;  1F1C A;  1SFC B;  2PCB B;  3RMZ A;  3EWK A;  2OZ1 B;  3L72 D;  4EIC A;  2C1D A;  1KB9 E;  1NAF A;  1JY2 N;  5APQ A;  3CP5 A;  2B9B A;  1M90 Q;  2N9B A;  1HZV A;  4H13 B;  3V2R A;  1KIL D;  1YIC A;  5GTH H;  1NWQ A;  3L73 D;  1J1D B;  3CX5 I;  1S5L E;  3M9B A;  1MZ4 A;  3AED C;  4Y5R A;  1RH5 B;  1K3H A;  4Y99 C;  1SQB K;  5CHX A;  1N7S B;  3JCU E;  5AW5 B;  2E76 D;  2A06 G;  2ZYG A;  1BE3 G;  1IQC A;  3NFQ A;  5GTI V;  1FI9 A;  1BCC J;  3AE6 C;  4ZKU A;  2O01 H;  3KZI E;  1AOF A;  4H0J A;  2YXR B;  2ZVN B;  4H44 B;  5CCH D;  3C2C A;  2WSE H;  2J59 M;  4QMA A;  1IFP A;  3S4R A;  4BXL A;  1ZRT D;  3M9H A;  2KLU A;  1H31 A;  4I1L A;  3V5B A;  2D2C D;  1URQ A;  2YQB A;  2KZI A;  1H33 A;  1LNQ A;  4W7Z A;  1OCD A;  2KI7 B;  1I6D A;  2O3J A;  1RZ6 A;  4C7N A;  1LWU B;  5DF5 A;  3FXD A;  2K9J B;  1RHZ B;  1E29 A;  4AAM A;  1NU1 D;  4H0L B;  1JCC A;  1HH0 A;  1DIQ C;  3A0B H;  1BGY J;  4LGD E;  2ZXE B;  3SFD C;  2ORL A;  2QSI A;  5CMZ A;  4WB4 A;  1GL2 C;  1JB0 J;  2W8Z A;  1OFC X;  2YIU B;  1K04 A;  1YHQ P;  5DJU B;  3ZBM A;  3CX5 W;  2IBZ D;  1M56 D;  3GF7 A;  1LGH B;  3L74 J;  1JUN A;  1L0L E;  3BCC E;  5DJT B;  3MUD C;  1U74 B;  2MTA C;  3R4Y A;  3SWK A;  5AW8 B;  2AXT E;  1Y47 A;  3H32 B;  3WU2 H;  3BAT A;  2L5G B;  1JY3 O;  2IPP A;  3PP5 A;  1IO4 A;  2QM7 A;  3NXS A;  3PXS A;  2N1T A;  2G8Y A;  3O20 A;  5B66 H;  3VTP C;  3A0H V;  3S9O A;  4EIE A;  1GL2 B;  1N73 B;  1QL3 A;  3GF3 A;  2N18 C;  3MD0 A;  1EZV G;  1CO6 A;  2QJP C;  1A8C A;  1FZE A;  2JJL A;  1C2N A;  1H32 A;  2E75 D;  2BEQ D;  1W5C E;  2WPQ A;  3OA8 B;  3A7O A;  2Z5I A;  2KB7 P;  5CIF B;  2PCC B;  2QJK B;  2VHD A;  1RQV A;  3E1R A;  3IF4 A;  1DT1 A;  3ABV C;  2D0S A;  2CA4 B;  5KAF H;  2E74 D;  2H89 C;  1FDM A;  3I55 P;  3G4S P;  1L0N D;  1GU5 A;  1RE4 C;  2WTY A;  5B5E V;  3HE4 A;  5AVZ B;  2KS1 A;  3NBT A;  1SQP D;  3IAO A;  3TF5 A;  3H1I J;  1IFJ A;  2YNY A;  2N9J A;  3HD7 B;  1R5L A;  4Z1M H;  2WPR A;  2YO2 A;  1I55 A;  1HBW A;  4IFD K;  1WRG A;  1WMK A;  4L75 A;  1KV4 A;  1ZXG A;  1PFI A;  4UB8 H;  3CU4 A;  3HUS C;  2B0Z B;  4OGQ D;  3JCU H;  1M1J A;  2O1J A;  3KYQ A;  1E5W A;  1MG2 D;  2KSJ A;  1SQX J;  3CCJ P;  5M1B A;  1BL9 A;  3H1H E;  1L0L K;  4EIJ A;  1BCC G;  3O8Z A;  5EXQ A;  1PP9 J;  1NH4 A;  1KIL C;  5CBO A;  2G3A A;  4N6J A;  2K9Y A;  2WVR A;  1OW6 A;  1NTK D;  1HRC A;  2OQQ A;  3BCC D;  3BRV B;  1R5S A;  3L71 E;  2E76 C;  1I8P A;  1PL5 A;  1XTC C;  2QVA A;  4P4Q B;  1ZME C;  3RK2 B;  4HB1 A;  2KLV A;  3TSI A;  4ZKP A;  4O9B A;  1NKN A;  2FXM A;  2LIT A;  3CCM P;  1G1J A;  1KIL B;  1JDL A;  3CWB J;  2FXP A;  3OCD B;  5AUR A;  1RZ5 A;  1BGY G;  1KFN A;  4IL6 E;  5KJ7 D;  2C2C A;  1YIQ A;  2K37 A;  4L1Q A;  3WFD C; 
#chains in the Genus database with same CATH homology
 2AXT V;  1CCR A;  3L75 D;  4A7P A;  1C6R A;  4O1Q A;  1CRI A;  5CIG B;  5KAF V;  1GKS A;  3ZIY A;  1J3S A;  4GYD A;  155C A;  1LMS A;  2GB8 B;  2RN0 A;  1CSX A;  1NNO A;  1HZU A;  1FOC A;  4IL6 V;  2YCC A;  3TGU D;  4UB6 V;  3WFB C;  3L74 D;  1M60 A;  1CHH A;  1PPJ D;  1I5T A;  1CXA A;  4WQD A;  4Q5P A;  1W5C T;  2QG4 A;  2PAC A;  1CRY A;  1YEB A;  2N9Y B;  4EID A;  4UB8 V;  1DW0 A;  2CA3 B;  1E2R A;  1P84 D;  3CWB D;  3ITK A;  1AOQ A;  5E79 V;  2A06 D;  1SQB D;  1NTZ D;  1CSV A;  3SLE A;  2I8F A;  4K3I A;  4WQA A;  1L9J C;  3X39 A;  4WQC A;  4WQB A;  1GDV A;  3DP5 A;  1IO3 A;  1CRH A;  2BH5 X;  1CIF A;  1S6V B;  2BH4 X;  4L3H A;  1YFC A;  2Y0D A;  1DW3 A;  2BCN B;  1FCD C;  2HV4 A;  1FJ0 A;  4PD4 D;  1F1F A;  1A56 A;  1FI7 A;  2ZOO A;  2C1D B;  2LIR A;  1CYC A;  1K3G A;  2CE0 A;  3RN0 A;  1QL4 A;  1CNO A;  1N9C A;  2FYU D;  1CYJ A;  2GC4 D;  3L4O A;  4H0K A;  3HQ6 A;  4FA1 A;  3CYT I;  2B11 B;  3SWS A;  5C9M A;  2C8S A;  5CYT R;  2JTI B;  3NBS A;  3DR0 A;  1VYD A;  3ZOY A;  1SQQ D;  2JQR A;  1KB0 A;  4KMG A;  5KKZ B;  1CHI A;  3MK7 B;  1LFM A;  1A2S A;  1NIR A;  3TDK A;  2JWA A;  1FI3 A;  1COT A;  1CRC A;  1CTZ A;  1CTY A;  1HJ5 A;  3O1Y A;  1IZL 0;  3FWL A;  1N50 A;  1KB9 D;  3PLN A;  1CXC A;  1YTC A;  1CIE A;  1CSU A;  4FA5 A;  1H31 B;  1F1C A;  5TIS V;  2PCB B;  3RMZ A;  2N3B A;  2OZ1 B;  1CED A;  1C6S A;  3L72 D;  1DVV A;  1H33 B;  3L4M A;  4EIC A;  2C1D A;  1KIB A;  2YK3 A;  2BCC D;  5GTH V;  3CP5 A;  1GU2 A;  2N3Y A;  5KLI B;  3RN1 A;  5B6Q A;  4PJ0 V;  1HZV A;  3WC8 A;  1IRV A;  1YIC A;  3L73 D;  3PXW A;  1L9B C;  1WVE C;  3HQ8 A;  4L3G A;  1MZ4 A;  1N90 A;  1W2L A;  4Y5R A;  4JCG A;  1K3H A;  2V07 A;  1GIW A;  2CE1 A;  1KYO W;  1LS9 A;  1ZZH A;  4J20 A;  4YE1 A;  1N15 A;  3SJL A;  1HRO A;  1I54 A;  4PW9 B;  1IQC A;  1KX2 A;  2AI5 A;  5GTI V;  1FI9 A;  1B7V A;  2Q3E A;  2B10 B;  4FAN A;  1AOF A;  3HQ9 A;  4RJT A;  2B12 B;  2V08 A;  4H0J A;  1BE3 D;  1C7M A;  3PH2 B;  3C2C A;  2D0W A;  1AYG A;  1H9Y A;  1ZRT D;  2N18 B;  3JBT B;  1H31 A;  2DVH A;  2B4Z A;  2QJP B;  4FB1 A;  3KHU A;  2OZ1 A;  1IRW A;  2YQB A;  1LC1 A;  3CXH W;  1WEJ F;  1H33 A;  5CIE B;  2GC7 D;  1OCD A;  351C A;  1H1O A;  2C1U A;  3O5C A;  4V2K A;  1I6D A;  2O3J A;  1HJ3 A;  1RZ6 A;  2XTS B;  3KZI V;  3PXT A;  1YNR A;  5C0Z A;  1NMI A;  2CXB A;  3MK7 C;  3O0R C;  5DF5 A;  1C6O A;  3RLM A;  2K9J B;  1E29 A;  4AAM A;  1NU1 D;  5CIH B;  3HQ7 A;  3CXH D;  1CIH A;  1DII C;  3VNW A;  3ZOX A;  1DIQ C;  3H1K D;  1YCC A;  3NWV A;  1CIG A;  4U3F D;  1LC2 A;  4DY9 A;  1H32 B;  5DFS A;  2ORL A;  3GW6 A;  2QJY B;  1BCC D;  1L0L D;  2FRC A;  4XXL A;  4WQ7 A;  5CIC B;  1QN2 A;  3VYM A;  2YIU B;  1NML A;  3ZBM A;  3CX5 W;  2IBZ D;  2GIW A;  2MHM A;  4AAN A;  1CRJ A;  3WU2 V;  1HCM A;  3ZCF A;  1U74 B;  2MTA C;  1RAP A;  1KX7 A;  1I8O A;  5KLV D;  4O1W A;  1NTM D;  3H1L D;  2ZZS 1;  3TYI A;  4WQ9 A;  1HJ4 A;  3ZOO A;  2L91 A;  5B66 V;  1HH7 A;  3PXS A;  3CX5 D;  3O20 A;  1CC5 A;  4GED B;  5H2F V;  3A0H V;  4EIE A;  4LJI A;  1OAE A;  1QL3 A;  4FA9 A;  1SQV D;  2N18 C;  4EDF A;  1YEA A;  1CO6 A;  1A8C A;  1AKK A;  1CSW A;  3VRD A;  1BGY D;  2BGV X;  3SVW A;  1C2N A;  1H32 A;  5CID B;  5DJQ C;  3OA8 B;  1MG3 D;  3ORV A;  5CIF B;  2PCC B;  1C75 A;  2QJK B;  1EZV D;  2VHD A;  1DVH A;  4XYD B;  1CHJ A;  3PRJ A;  5TJH A;  1DT1 A;  2Y0C A;  2D0S A;  2CA4 B;  4NFG B;  2AIU A;  1L0N D;  1QYZ A;  2L4D A;  5B5E V;  2KS1 A;  3NBT A;  1SQP D;  3TF5 A;  1I6E A;  5IY5 1;  1S5L V;  2N9J A;  1C52 A;  1KYO D;  4EIF A;  1CCH A;  1I55 A;  2ZON G;  2C1V A;  1CRG A;  3M97 X;  2N9I A;  3OCD A;  1ETP A;  2FWL A;  1R0Q A;  3CU4 A;  5DJQ B;  2B0Z B;  2RMZ A;  1E8E A;  3H1H D;  2BLF B;  1MG2 D;  4QAO A;  2Y0E A;  3PHL A;  3A9F A;  1GJQ A;  1RAQ A;  2EXV A;  1BL9 A;  2DGE A;  1C2R A;  3ZOW A;  2ZXY A;  3OA8 A;  3WFC C;  3A0B V;  5KAI V;  2ZBO A;  5EXQ A;  2C9X B;  3L71 D;  3H1J D;  3VMA A;  3WFE C;  2KNC B;  1KV9 A;  1FHB A;  1CYI A;  1NTK D;  1HRC A;  3BCC D;  3L70 D;  1U75 B;  2BPB B;  1DW2 A;  1CTJ A;  1I8P A;  3H1I D;  4FA4 A;  4FAV A;  1GQ1 A;  1M70 A;  4MU8 A;  2FYN B;  1M6Z A;  3SXT A;  4P4Q B;  1COR A;  3PTZ A;  4PWA A;  1EB7 A;  2LIT A;  4WQE A;  4D6T D;  4N0K A;  4WQ8 A;  3DMI A;  1DW1 A;  3GG2 A;  1H9X A;  4AAL A;  1SQX D;  1JDL A;  451C A;  3OCD B;  5AUR A;  4AX3 A;  1RZ5 A;  4RSZ A;  1QKS A;  4AAO A;  2C2C A;  1YIQ A;  3WUI A;  4L1Q A;  3WFD C;  5CIB B;  1PP9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...