3H1KD

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 62
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1kD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1kD02
1KX2A 3KZIV 5E79V 3MK7C 5DJQC 4FANA 1BE3D 5CIFB 3SWSA 2ZONG 2QJKB 4FA1A 2QJPB 1CTYA 1R0QA 4AAOA 1DW1A 1KB0A 2Q3EA 4JCGA 5DF5A 4WQBA 3VRDA 3ZIYA 3TYIA 1I8PA 1NTKD 1YEAA 2OZ1B 2ZXYA 2XTSB 3TGUD 1YNRA 3NBTA 1NMIA 3DP5A 1CCHA 3PXSA 2I8FA 1KYOD 2KS1A 1M70A 1CIEA 4EIDA 1CC5A 3VYMA 3GG2A 1CSUA 1QN2A 1I6EA 1DW3A 1OAEA 3C2CA 1CTZA 1KYOW 4L3GA 4O1WA 1YEBA 1H31A 1LC1A 5GTHV 1KB9D 1HROA 3L75D 1NMLA 5KAIV 3MK7B 5DJQB 4H0JA 2ZOOA 2O3JA 3A9FA 5DFSA 3BCCD 4GYDA 4V2KA 4AALA 2MTAC 3ZOWA 2BCCD 1F1FA 4UB6V 5GTIV 3A0BV 3CXHD 1A56A 3CP5A 1YIQA 2CA4B 1LFMA 3SLEA 2AIUA 3L4OA 4WQ8A 1CTJA 3WFEC 1DVHA 2Y0CA 3H1KD 1H1OA 4A7PA 3RMZA 1CRJA 3NBSA 2PACA 3ZCFA 2RN0A 1RZ5A 3O20A 1I8OA 1IQCA 4AAMA 1BCCD 2YQBA 3NWVA 1N50A 1YTCA 2AI5A 1L9JC 2C1VA 3PLNA 5CIGB 3JBTB 4DY9A 2QJYB 2L4DA 4O1QA 1DW0A 1L9BC 3HQ9A 4RSZA 2B0ZB 3WFCC 1M60A 1S5LV 1FI9A 1DIIC 2PCBB 1HJ5A 1ETPA 3OCDA 4K3IA 1DW2A 1CSVA 1FCDC 4GEDB 2FWLA 1SQBD 1CRYA 1BL9A 4WQEA 1CHHA 1COTA 3ZBMA 2CA3B 3L73D 1H9XA 1U74B 3L70D 2ORLA 3L71D 2CXBA 1U75B 1AOQA 4LJIA 2BPBB 1SQXD 5C0ZA 3ORVA 5B5EV 2N18C 155CA 1NNOA 3DR0A 2CE0A 3CYTI 1I54A 2FYUD 2Y0DA 1NTMD 2N18B 1I55A 3M97X 1QKSA 1EB7A 4N0KA 1E8EA 2OZ1A 1LC2A 1CRHA 1L0ND 2CE1A 5CIEB 2B12B 1MG3D 2ZZS1 1FI7A 1DVVA 3WUIA 2B11B 2C2CA 1EZVD 3ZOYA 1CHIA 4D6TD 2Y0EA 2DVHA 2JWAA 1LMSA 4AX3A 1CIGA 2D0SA 3DMIA 4PW9B 1H33A 1CNOA 1C7MA 3PXWA 1WEJF 5EXQA 1JDLA 4Q5PA 1GDVA 1S6VB 3PH2B 5TISV 1DIQC 2L91A 1N90A 3RN1A 2IBZD 1CO6A 1E29A 1H9YA 4YE1A 1CCRA 4WQ7A 3O1YA 5CIDB 4Y5RA 1CYJA 2C1DB 1C6OA 2DGEA 3ZOOA 1B7VA 3H1ID 5CIBB 4FA4A 2KNCB 1SQPD 1FJ0A 1GU2A 1C6SA 3O5CA 3H1HD 1A8CA 1AKKA 2LITA 3CX5D 3TDKA 2FYNB 3CXHW 2BH5X 1IRWA 5B66V 1HZUA 4FA9A 4UB8V 1CIHA 5CICB 1N9CA 1DT1A 3H1JD 3WC8A 1I6DA 3PHLA 4PD4D 5KAFV 1IZL0 1WVEC 1N15A 3HQ6A 2GC7D 1CXAA 1PP9D 2YCCA 3H1LD 1E2RA 1RAQA 3L4MA 3HQ8A 4NFGB 2BLFB 2YIUB 2C1UA 3PRJA 1CIFA 2BCNB 3L72D 2GB8B 1CORA 1C52A 1YCCA 3GW6A 1HJ3A 1FOCA 1AYGA 1K3GA 1H31B 3O0RC 3OCDB 3RLMA 1F1CA 2GC4D 4RJTA 3OA8A 4J20A 1W5CT 1RAPA 2N9IA 2B10B 3X39A 4XYDB 1CRIA 5C9MA 1ZZHA 5KKZB 3PTZA 1CSXA 4WQDA 2N9YB 4IL6V 1H32B 1FI3A 1CRCA 4U3FD 2V08A 1IRVA 2HV4A 5IY51 4XXLA 1QL4A 1NTZD 2AXTV 4KMGA 3WU2V 2FRCA 2EXVA 1HZVA 1HCMA 1SQQD 1H33B 3CU4A 2JQRA 5CIHB 1RZ6A 2K9JB 2PCCB 2V07A 2VHDA 4PJ0V 5CYTR 1QL3A 4QAOA 3HQ7A 1VYDA 1L0LD 2GIWA 1HRCA 1P84D 1NIRA 2B4ZA 1I5TA 1LS9A 1C75A 2C8SA 4WQCA 2LIRA 4WQAA 2BGVX 4L3HA 1K3HA 3KHUA 4AANA 1OCDA 5KLIB 2N9JA 4FAVA 2C9XB 1KV9A 1W2LA 1CHJA 1M6ZA 2D0WA 1A2SA 1C2RA 1CSWA 5KLVD 1FHBA 4PWAA 1H32A 1GJQA 3VMAA 1C2NA 2A06D 5AURA 1CXCA 2RMZA 1KIBA 2C1DA 1GIWA 1HH7A 5TJHA 1YICA 1J3SA 3SXTA 3FWLA 2N3BA 3CX5W 1C6RA 1CRGA 451CA 1ZRTD 3ZOXA 3SVWA 1YFCA 4P4QB 2N3YA 4EDFA 1SQVD 1CYIA 2JTIB 1CYCA 1AOFA 4FA5A 351CA 1HJ4A 3SJLA 2MHMA 4EIFA 1IO3A 3L74D 4FB1A 3WFDC 1PPJD 1NU1D 1BGYD 2BH4X 1KX7A 1MZ4A 4L1QA 4EICA 1CEDA 4MU8A 3CWBD 5H2FV 2ZBOA 3ITKA 3VNWA 4WQ9A 4EIEA 5B6QA 2YK3A 3WFBC 3TF5A 2QG4A 3RN0A 3OA8B 4H0KA 3A0HV 3PXTA 1QYZA 1GQ1A 1GKSA 1MG2D
chains in the Genus database with same CATH superfamily
4D6TJ 2GUVA 3MK7C 1GU4A 2BCCE 1S1CX 2XNXA 3AE8C 1KB9H 1YBKA 4FA1A 5B66H 1R0QA 2YXQB 3JC22 4Y99C 5KJ7C 3HUSB 1SQVJ 5TISH 2E74B 2WTYA 4PJ0H 1Q82Q 2K1AA 1FZGA 5AW7B 3B5NA 4KT0J 2AEFA 3AE4C 3P8CD 1MKMA 1ZN5A 1BDCA 4ASWA 2I8FA 2OARA 3NMDA 3O6QA 1M70A 2R44A 3WU2E 3OAKA 1CC5A 4OGQC 3VYMA 2N1TD 3GG2A 1HGVA 1I6EA 2HFED 2K9YA 2K37A 1SQQE 1J1DB 2HR3A 2E74D 1SQVE 4L3GA 1YEBA 4IFFA 1ZOYC 2MKVA 5DJQB 4H0JA 3TYYA 3H1JG 2ZT9C 2KIKA 3RL0g 1Q7YQ 1SLQA 2M0BA 1KN7A 4GYDA 5BU8B 2WITA 2BCCD 2QRXA 1KYOI 1A56A 1NGMB 2Z5IA 2ZYAA 1LFMA 3L71E 2BEQD 3L4OA 3PJSK 4WQ8A 1YITP 2ZXEB 1LTJC 1RH5B 2O01H 2RN0A 2CK3H 3O20A 3HRNA 2KYVA 3BATA 5AW2B 1J1EC 2AXCA 1IQCA 1X22A 4WY4D 1VQ6P 1USDA 3PLNA 5AVSB 3Q3DA 5DJUB 5GTHE 4TLFA 5AW3B 4RSZA 2B0ZB 4WWIA 1RE3C 2PCBB 5KLVG 1HJ5A 2WPQA 2YKOA 1NTZG 2H43A 1DW2A 1FCDC 2FWLA 1EXJA 1EDIA 3EFGA 3PH0A 3WUTA 1YQ3C 3L70E 4H0LC 2C0XA 2A45I 2P2UA 4OGQB 1H8AA 3L73D 1ZR4A 4LJIA 2RKLA 1SQXD 5C0ZA 3G4SP 4EI2A 5B5EV 4N78D 2N18C 3CYTI 1G1JA 1NU1J 3A5TA 2N18B 2A06G 1VF5C 3FWNA 3CCLP 2JDIH 3V6IA 2OZ1A 1LC2A 3AECC 2IBZE 2JP3A 3VMXA 3KZIE 2B12B 1KB9I 4W7YA 4Y99B 3L71G 2Y9YA 1URQD 1PP9G 2E74C 3IR9A 3BCCG 1ZMEC 2KSEA 1J1EB 2D0SA 3DMIA 1RQUA 1H33A 3C9IA 1LTBC 1NU1K 1VQPP 1JDLA 2LR2A 3CX5H 3PH2B 3RK2C 2OQQA 2FFDA 1E29A 5CBOA 3WUUA 5CJ0A 4I7ZC 4YE1A 5APYA 1IK9A 5CIDB 1HTLC 2C0WA 2DGEA 1HF9A 2QJPC 3H1ID 3HD7B 3N4XA 4YPCA 1OW6A 1GU2A 1NU1G 2LITA 2K88A 2BH5X 2E5TA 1HZUA 1NAFA 4EOTA 2WSEH 1CIHA 5H2FH 5AVUB 3H1JD 1I6DA 2WT7A 2HODA 5KAFV 2C9LY 2N1TC 1GDTA 2I1JA 2GC7D 2A45H 1E2RA 3A0BH 4NFGB 1GU5A 3W67A 4HJGH 2BCNB 3I56P 4GT1A 1PP9J 1SQXJ 1YCCA 3M0DC 2E75B 2KS1B 3GLMA 1VQ7P 5AW1B 4ZKPA 3A0HE 3OCDB 5KAFE 2GC4D 4WBAA 1H88A 1RAPA 3HUSC 2B10B 1KQLA 4XYDB 4EYYQ 1GZLA 1LTTC 3R2PA 1FZAA 4LC1A 1EZVE 2NPSC 1M8OB 3H1IJ 4H44D 1FAVA 3H1KG 3MD0A 3VTPC 4GKGA 4HH2A 2IFMA 1FJKA 4XXLA 4B86A 1QL4A 3U59A 1NTZD 1PP9E 5CCHA 2YIUC 2FRCA 1NVOA 1M7LA 1SQQD 1H33B 1N2DC 2JQRA 5CIHB 1N73A 1FBMA 1KYOH 2W27A 4I1LA 1J1DC 5KTBA 2VRSA 2KUBA 2V07A 2HPCA 1SQBJ 4U7JA 2YMYA 1VYDA 2WPVB 5CMZA 3GF3A 1S5LX 4QMAA 3USSA 2B4ZA 5AVVB 1GL2D 4H13B 1LS9A 1S2EA 2C8SA 1AV1A 2BGVX 2IDBA 1LT9B 3KHUA 2XZRA 1GK4A 1W2LA 2M3BA 1YJ9P 1C2RA 1NU1E 1M1KQ 2OYHB 1CI6A 2W8ZA 1N7SB 2M5AA 2KSJA 1H32A 3VMAA 1C2NA 3BCCE 4U3FG 2BCCJ 5AURA 1FZCC 2PP6A 4W80A 2B87A 1KYOE 1M1JC 4AYCA 1FZCB 1J3SA 3H1LJ 3D71A 3SXTA 2H7HA 2N3BA 1BCCG 1KMIZ 1ZRTD 3S1KA 1A02J 2ZT9D 3CL3D 1K9MQ 3HD7D 2DW3A 1SQBG 2IYPA 3HD7C 1NOHA 1SFCD 1E5WA 1PGQA 3UIAA 1W2EA 2C9NY 1RF0C 4FA5A 1HJ4A 1KQSO 3L74D 2Q9IA 2KK7A 3WFDC 3EQ2A 4MU8A 3AEDC 2Q1KA 2PRRA 3CWBD 2ZBOA 3ITKA 1JO5A 3VNWA 4GIFA 2A06E 3CD6P 1Q86Q 4H0KA 1NHLA 2YKQA 1VDFA 1HH0A 1QLED 1GQ1A 3IFMA 1L0NJ 4U3FJ 1D7MA 2ZONG 3SWYA 1PPJE 1LP1A 2QJKB 4H44B 5E79H 1CTYA 3H1LG 3SSUA 2Q3EA 4JCGA 2QJKC 5DF5A 4WQBA 1LTAC 1FU1A 1EDJA 2KP8A 1I8PA 1JY2O 1NTKD 2AEJA 1BE3G 2E5YA 3BASA 2XTSB 3TGUD 3NBTA 1NMIA 2E76B 1K04A 3AE6C 3CCVP 1OVRA 3RBXA 3PXSA 1OXZA 3H6PA 2FXOA 3RK3B 1CIEA 2QM8A 1S4XA 1SQVG 1DW3A 1IK7A 4YXDC 1CTZA 1KYOW 3H1JE 3CWBE 5CCGD 5GTHV 1KB9D 5KAIV 1G2CA 2ZOOA 2O3JA 2WSCJ 3B4SA 2W6AA 1L0NG 2Z4EA 3BCCD 1IFJA 1CW5A 1OVUA 2B9BA 2MTAC 1G1IA 4UB6V 5GTIV 4PD4H 1DEEG 2WSSH 3D6ZA 1LT1A 2CA4B 2WT7B 3LIDA 1SQBE 3SLEA 1MV8A 3AEEC 1ZP0C 1CTJA 2Y0CA 4A7PA 1CRJA 3ZCFA 3H1JJ 4GOFA 1J2JB 1W2BO 2WVRA 3OA7A 2FXPA 1L0LK 1BCCD 1S9KD 1T6AA 3BRTB 2C1VA 5CIGB 1Q2NA 3JBTB 1EZVI 5AVTB 1PPJG 4DY9A 2QJYB 3B5NC 1NTZE 4O1QA 4JF7A 1DD3A 3HQ9A 3WFCC 1M60A 1PGPA 1KC8Q 1DIIC 1ETPA 3OCDA 4K3IA 1FOSF 3KYQA 1KFNA 1Y9BA 3V5BA 1P84I 4IL6X 1PGJA 3MZWB 3P8CE 3GHGB 1CRYA 1BL9A 1RF0A 3RK3E 5KLVK 3M0AA 1CHHA 1JY3P 1COTA 1Y47A 5AW0B 3C1LA 2JKVA 3II6A 2R5BA 2ORLA 1KQGB 3L4FA 1YJNP 3U1CA 1U75B 1AOQA 2XDJA 4DCKA 3AEAC 3KDPB 1DD4A 1NTZJ 2FYUE 3P7KA 2K9JA 155CA 2OTKE 1NNOA 2CE0A 1M90Q 1W5CE 2Y0DA 1NTMD 2H8PD 2YO3A 2IBZG 1QKSA 1SFCB 1EB7A 1PL5A 1FZCA 4N0KA 3TGUE 1E8EA 1NTZK 1CRHA 1L0ND 3P8MC 1S9KE 5CIEB 1FC2C 4RKUJ 1FS0E 1GD2E 1DVVA 2C2CA 3ZOYA 2V7QH 1SQQG 1CHIA 3SFEC 4D6TD 4H0LB 3CCSP 1RHZB 2FYUJ 3GMAA 3JSVC 1CIGA 1C7MA 3AE9C 5AVWB 1OX3A 1GDVA 1S6VB 3NFQA 4N78E 2ZVNB 3BVHA 5AVRB 5APWA 3RN1A 2IBZD 1H9YA 1T3UA 3H25A 3SFDC 3RK3C 1VF5B 1CCRA 3O1YA 2C1DB 1C6OA 4JPZB 4H13C 1B7VA 1DIPA 5AW5B 3SWKA 2PGDA 1GW4A 1SQPD 1FJ0A 1C6SA 3O5CA 3H1HD 3VOPA 4ZNCA 1A8CA 5KJ7D 2FYNB 3HE5A 1IRWA 1VQ4P 4FA9A 5E79E 3HQ6A 1N73B 4OH8B 2BLFB 5KAIE 1SQQJ 2H88C 3CXHI 1CIFA 2L5GB 5AW6B 1FE6A 1YI2P 3AE7C 5AVYB 3U1AA 1HJ3A 3V4QA 3KQGA 1AYGA 2V7QJ 3CXHH 1F1CA 3M9BA 3M0DA 3BRVB 2N9IA 1SQPJ 1X8YA 1URQA 3V2RA 1TU3F 3O6QB 1NKZB 5CCHD 3CC7P 2QJYC 1YJWP 1Q90D 1H32B 1CRCA 1RE3A 1SQXG 1N8RQ 2D2CC 2WPSA 1LP1B 4KMGA 3WU2V 1HZVA 2JO1A 1PIXA 4CPGA 2IBZI 2M8RA 3FX0A 1KQFB 5AVQB 1RZ6A 3H1IG 2K9JB 1Q81Q 4N3YB 3EWKA 3L72E 1FZEA 1GMJA 5CYTR 2R3CA 1QL3A 2O1KA 2WPRA 1FOSE 3H32A 2NZ2A 2E43A 4L74A 2ZJSE 2CPSA 1ZR2A 1IFDA 1P84D 4GOEA 1LT9C 1I5TA 2W90A 1L4AD 4L3HA 1HBWA 1SQPG 2SPZA 1A02F 2B87B 1JY3N 5CCGA 3CI9A 5KLIB 2C9XB 2WSFJ 2D0WA 4IOIH 3E1RA 1CSWA 4EIJA 2NPSA 4UB8E 1OZHA 3I55P 5B5EH 3N7NA 3CWBJ 2I1KA 2AXTE 4GODA 1CXCA 3G3ZA 1GIWA 1YICA 1WRGA 2FXMA 3FWLA 4DZOA 1CRGA 1S3JA 4UB6H 451CA 3SWFA 1BSHA 2QSIA 1YFCA 4EDFA 1FZBA 1VQ9P 1AQ5A 1CYIA 2JTIB 1VQMP 1AOFA 1LWUB 2MHMA 2B88A 2KXPB 1HWTC 2UWJE 3AE1C 1KORA 1JM0A 2OYHC 3AE2C 4NPEA 4FB1A 3KXDA 1NU1D 2KLVA 1BGYD 2P1JA 3HD7A 4L1QA 3MGNA 3W68A 2XKMA 4ZMDA 3C8VA 4EIEA 5B5EE 1IJDB 1HJ0A 1SS1A 1IFIA 2R32A 2GUSA 1R5SA 1ZRTE 3RK2B 5GTIE 3KZIV 5DJQC 2W6JH 2A45G 1FDMA 3SWSA 1QL1A 1S72P 1SVFA 3LIEA 1EC5A 4O9BA 1DW1A 1KB0A 4XA4A 3RL0C 2OYIB 4C7RA 3ZIYA 1JCCA 2R3SA 1IFMA 3MTUE 3RBZA 2OZ1B 4BRYB 1YNRA 3S9OA 2IFNA 1N7LA 1CCHA 3QH9A 2WWWA 1KYOD 4U3FE 2KS1A 3FXEA 1SQPE 2H89C 4EIDA 3T97A 1M56D 3F89A 3L35A 1NWQA 2OYOA 3HTKA 1R5LA 4JYBA 1OAEA 3L72G 1BE3J 4O1WA 5APQA 1H31A 2E75C 1HROA 3L75D 1RE4C 3Q5PA 3MK7B 2FYZA 2OGUA 1PFIA 4MN4C 3TGUG 1M57D 4RESB 1NYHA 1N7SD 5CCHC 5DFSA 3CCEP 2ZFCA 1LGHB 2IZ1A 3A0BV 3CXHD 1QX8A 2RH0A 1L0NK 2GM4A 4L76A 2W6BA 3WFEC 1H1OA 3HUSA 3RMZA 3A7OA 3A0BE 1NTKK 3CLQA 1IO4A 4NPDA 3A2AA 1HGZA 2YQBA 3NWVA 1LT9A 3B5NB 3L73G 1N50A 2AI5A 1L9JC 2XNDH 1LTSC 4I7ZB 4L73A 2OTLP 1L9BC 1T3JA 1OW8A 1FI9A 3AE3C 5BU5A 2N1TA 1NTKE 2YO2A 1PZQA 3IAOA 4GEDB 2NRGA 1SQBD 3L75E 1IZNB 4WQEA 5L8RJ 3EFFK 4NPFX 4HYTB 2CA3B 1H9XA 3L70D 1Z56A 3L71D 2KNCA 3D6YA 2PAJA 3AEFC 1KFMA 3MUDC 1QL2A 4YXWH 1PV3A 1URQC 3L74J 4DOJA 3DR0A 3ZDMA 1I54A 1JY2P 1Y8AA 1YTZI 1I55A 3M97X 1EQ7A 2FYUK 1IFPA 4PD4E 2JWDA 3IN6A 1KILE 4HKZH 2BASA 2ZZS1 4AQRD 1JEKA 1VF5D 1FI7A 2J5UA 1NTKG 3CX5E 1KILA 3M91A 2DVHA 2JWAA 3Q5RA 4AX3A 2WZ7A 1LTJB 5AW9B 3PXWA 1WEJF 5EXQA 4WB4A 1GTWA 3CC4P 4Q5PA 3D0WA 1BGYJ 3E7KA 4TT3H 3L73E 2L91A 2HLOA 1N90A 2M3EA 4H0LD 2ITAA 3L70J 2MJZA 2JJLA 4LGDE 3H1IE 3TNUA 2WSCH 4WQ7A 3M9HA 1CYJA 1X0TA 1UIXA 2FYUG 4GDOA 4FA4A 3IF4A 3L74G 5EFWB 3R4YA 4IFDK 2O01J 3Q1MA 1AKKA 3TDKA 3CXHW 1VL2A 2HG5D 5B66V 1E79H 3HE4A 4PV1B 1SQVK 1NTMK 4UB8V 1PGOA 5CICB 1N9CA 4IFMA 3WC8A 1MFTA 4PD4D 1IZL0 1N15A 1CXAA 2YCCA 5KAFH 1NTKJ 3Q5SA 1DX7A 3TSIA 3HQ8A 2KZJA 2C1UA 3PRJA 2FKWB 1H89A 1USEA 1LJ2A 2GB8B 1CORA 2XU6A 3KPEA 1FOCA 2ZAEB 1JMBA 1K3GA 1H31B 1VQOP 1YYCA 4RJTA 1YTZT 5GTHH 1W5CT 2QIWA 1HJBA 4XFJA 3X39A 2GA1A 1ZZHA 3PTZA 3VYIA 4IL6V 3A0HH 1FI3A 1HVVA 2J59M 1VQKP 1BDDA 4U3FD 3H1HJ 2HV4A 3QWOC 5IY51 1ZW0A 3B71A 2KI7B 3M06A 1NJIQ 2EXVA 4YTPC 1S5LH 1NKNA 1HCMA 2BEZF 2FY8A 4RO0A 3MHVA 1EXIA 1ZXGA 3G6EP 1MZ9A 1OIPA 1ZLLA 1NTMG 2IZ0A 3CX5I 4QAOA 4N6JA 5TISE 2KOGA 4I2LC 1HRCA 1RF1B 1CSBA 2J58A 2P67A 2Q6QA 2E42A 4UB6E 1CI6B 5APVA 1GK6A 2LIRA 1LWUA 1RY3A 1JNMA 3HE4B 3V2NA 4AANA 3NTNA 3WU2H 2N9JA 5KJ7A 1GL2A 2WSEJ 1XTGB 1CHJA 1M6ZA 4OVNF 1A2SA 1FHBA 1R8EA 4K35A 1S5LE 1GJQA 1BE3E 3GHGC 3V4WA 1SQQK 2N1TB 2A06D 2RMZA 1KIBA 3S4RA 2CPBA 1EDLA 2IX7C 2FYNC 2HYNA 1SQPK 1C6RA 1X79B 1LTJA 3ZOXA 3H1KE 1GW3A 1NTMJ 3MP7B 3P32A 1SQVD 2AEMA 2E75D 3CWBG 1OFCX 1CYCA 2QVAA 2QEXP 2HODB 1YIJP 351CA 1HUCA 1JCDA 5CJ4A 2IYOA 3CCJP 1SFCA 5APSA 4DJGA 1KX7A 1MZ4A 1CEDA 3JCUH 3G9RA 4WVZA 5KLIC 1N7SA 3T97B 1L0LG 5B6QA 1N7SC 1KILD 2K3RA 2QE7H 2QM7A 2E76C 4WY4B 1QVFO 2QG4A 2B89A 2Q5UA 2P7JA 3A0HV 1NO4A 4BWNA 3O8ZA 1QYZA 2ZYGA 1P84E 1AA0A 1GKSA 1MG2D 1LTIC 1KX2A 5E79V 4LLHA 4FANA 1H0TB 1BE3D 5CIFB 1KV4A 2QJPB 1OVVA 3D70A 4AAOA 2YXRB 5AW4B 1T2KC 1U57A 1CZQA 3VRDA 2P10A 3TYIA 1L4AB 1JUNA 4R4MA 2JEEA 1YEAA 2ZXYA 1OMIA 1GL2B 4JYCA 3L74E 3AEBC 3DP5A 4C7NB 1KILB 2P58A 1VQLP 1BCCE 1VQ5P 2NPSD 3KZIH 1CSUA 1QN2A 1RF1A 1KB9E 1U7MA 3C2CA 4UB8H 3CCMP 3A3YB 1L0LJ 1DH3A 1P84H 1LC1A 1OW7A 1NMLA 1M1JA 1ZV8A 2FBWC 3VP9A 1YHQP 1K73Q 1JTHA 3A9FA 4H13D 4H44C 2M5AB 4V2KA 2W83C 4AALA 3HE5B 3ZOWA 1BGYE 3RK3D 1F1FA 2IPPA 3CMEP 1VQ8P 3CP5A 2G3AA 1YIQA 3L72J 4WY4C 5GTIH 2AIUA 1DVHA 3H1KD 5KLVJ 3NBSA 2PACA 3LW5J 1RZ5A 1AVOA 3TGUJ 3H32B 2V4HA 2N9BA 4JQ0D 1JY2N 1I8OA 4AAMA 3L75G 1YTCA 4M3LA 5M1BA 3RGUA 5H2FE 3HTKB 3CXHE 3WMM0 2L4DA 1DW0A 4C46A 5APTA 2YKPA 1S5LV 2Z5HA 1JMMA 4D6TE 1SFCC 1CSVA 2OYIA 1N73C 3L73J 2FFDB 4KHXA 2POHA 5CHXA 4R4LA 1UIIA 3ZBMA 2YMKA 3CCQP 1U74B 2CXBA 5C39A 1LNQA 2BPBB 1AVYA 4I6MC 1MUUA 3ORVA 3CMAP 1NTME 1LTGC 1SQXK 4IL6H 3L71J 2ZVOB 5APXA 1AJYA 1JOCA 2FYUD 1K8AQ 3BCCJ 3F5HA 5AVXB 3RL0D 2OYHA 2LXBA 1FZFA 3L75J 3V2PA 1IC2A 2CE1A 3I5CA 3H1LE 1MG3D 4Y28J 1KD1Q 5B66E 3WUIA 2B11B 1EZVD 1RQVA 3B8EB 4BRYA 1GL2C 3G71P 1L0LE 2Y0EA 1LMSA 2O1JA 3AEGC 2E76D 4KJMA 4PJ0E 1LWUC 4PW9B 5DJTB 1CNOA 1IFNA 1QGKB 3CPWO 1L2PA 2KB7P 5TISV 1DIQC 1JY3O 1SQBK 1CO6A 1G2CB 2Q3IA 2OTJP 4Y5RA 3GF7A 2NPSB 3ZOOA 5KLVE 2LKMA 3H1HE 5CIBB 1URQB 2KNCB 1JTHB 2D2CD 1FDIA 5CCGC 2FFDC 1QEXA 3CX5D 1BGYG 5KAIH 1L0NE 1AFOA 3L70G 3MIWA 1DT1A 1EZVG 3PHLA 2I8DA 4OGQD 2ZT9B 3PP5A 1QVGO 3RL0B 3JCUE 3Q2YA 1WVEC 2O01N 1PP9D 3H1LD 1RAQA 3L4MA 2YIUB 3ABVC 3L72D 2JR8A 3H1KJ 2HPCB 1C52A 3L36A 3GW6A 1L4AA 3O0RC 3OW2O 3RLMA 3OA8A 4J20A 2R5DA 5KKZC 3NXSA 3E1IA 1FDOA 2G8YA 3CC2P 1CRIA 5C9MA 3VN0A 3GHGA 4PV1C 5KKZB 3L37A 4WY4A 1CSXA 4BXLA 4WQDA 2N9YB 1NAYA 3WUVA 2V08A 1H0TA 1IRVA 3TK1A 1WT6A 3LW5H 2QA4P 1WMKA 1KZUB 2AXTV 2Y9ZA 1VPCA 3CU4A 4AUWA 4PD4I 5BVZA 1U7JA 3VP8A 2PCCB 1RF1C 1KTMA 2VHDA 4PJ0V 3FXDA 3H1HG 3HQ7A 1YQ4C 1L0LD 4C7NA 1BSNA 2GIWA 3VMZA 1SQXE 1NIRA 2ZYDA 2PFXA 1C75A 2BCCG 4WQCA 1L4AC 3AE5C 1DEBA 4WQAA 1K3HA 4PV1D 1RE4A 2OYIC 1NH4A 1OCDA 2XV5A 4FAVA 4XE5B 1BCCJ 3M9QA 1KV9A 2ZXXA 5AVZB 2Q7CA 2D2CB 4ASVA 1KILC 4K3AA 3RK2D 5KLVD 4PWAA 1OWAA 1MFZA 2WMMA 2YNYA 5AW8B 4D6TG 4ZKUA 1SP4A 2C1DA 2KZIA 1T8ZA 2WSFH 1HH7A 5TJHA 4Z1MH 3B5ND 3CX5W 3FGAD 1AQTA 1T2KD 3MUDA 4JBZA 5APUA 1M1JB 1K05A 3SVWA 2AXTH 4P4QB 2N3YA 3CCRP 1X9VA 4IL6E 3OJAB 2WQYC 1XTCC 3SJLA 4L75A 4EIFA 3CCUP 2KLUA 1IO3A 4DT0A 2LXCB 1JB0J 1PPJD 2BH4X 4EICA 5CBNA 4HB1A 4OWFA 1VQNP 5H2FV 4W7ZA 3K5BA 3TNUB 1EDKA 4WQ9A 2YK3A 3WFBC 3TF5A 3RN0A 3V2QA 3OA8B 5K5GB 3PXTA 1FJPA 1N86A 3VMYA
chains in the Genus database with same CATH topology
1KX2A 3KZIV 5E79V 3MK7C 5DJQC 4FANA 1BE3D 5CIFB 3SWSA 2ZONG 2QJKB 4FA1A 2QJPB 1CTYA 1R0QA 4AAOA 1DW1A 1KB0A 2Q3EA 4JCGA 5DF5A 4WQBA 3VRDA 3ZIYA 3TYIA 1I8PA 1NTKD 1YEAA 2OZ1B 2ZXYA 2XTSB 3TGUD 1YNRA 3NBTA 1NMIA 3DP5A 1CCHA 3PXSA 2I8FA 1KYOD 2KS1A 1M70A 1CIEA 4EIDA 1CC5A 3VYMA 3GG2A 1CSUA 1QN2A 1I6EA 1DW3A 1OAEA 3C2CA 1CTZA 1KYOW 4L3GA 4O1WA 1YEBA 1H31A 1LC1A 5GTHV 1KB9D 1HROA 3L75D 1NMLA 5KAIV 3MK7B 5DJQB 4H0JA 2ZOOA 2O3JA 3A9FA 5DFSA 3BCCD 4GYDA 4V2KA 4AALA 2MTAC 3ZOWA 2BCCD 1F1FA 4UB6V 5GTIV 3A0BV 3CXHD 1A56A 3CP5A 1YIQA 2CA4B 1LFMA 3SLEA 2AIUA 3L4OA 4WQ8A 1CTJA 3WFEC 1DVHA 2Y0CA 3H1KD 1H1OA 4A7PA 3RMZA 1CRJA 3NBSA 2PACA 3ZCFA 2RN0A 1RZ5A 3O20A 1I8OA 1IQCA 4AAMA 1BCCD 2YQBA 3NWVA 1N50A 1YTCA 2AI5A 1L9JC 2C1VA 3PLNA 5CIGB 3JBTB 4DY9A 2QJYB 2L4DA 4O1QA 1DW0A 1L9BC 3HQ9A 4RSZA 2B0ZB 3WFCC 1M60A 1S5LV 1FI9A 1DIIC 2PCBB 1HJ5A 1ETPA 3OCDA 4K3IA 1DW2A 1CSVA 1FCDC 4GEDB 2FWLA 1SQBD 1CRYA 1BL9A 4WQEA 1CHHA 1COTA 3ZBMA 2CA3B 3L73D 1H9XA 1U74B 3L70D 2ORLA 3L71D 2CXBA 1U75B 1AOQA 4LJIA 2BPBB 1SQXD 5C0ZA 3ORVA 5B5EV 2N18C 155CA 1NNOA 3DR0A 2CE0A 3CYTI 1I54A 2FYUD 2Y0DA 1NTMD 2N18B 1I55A 3M97X 1QKSA 1EB7A 4N0KA 1E8EA 2OZ1A 1LC2A 1CRHA 1L0ND 2CE1A 5CIEB 2B12B 1MG3D 2ZZS1 1FI7A 1DVVA 3WUIA 2B11B 2C2CA 1EZVD 3ZOYA 1CHIA 4D6TD 2Y0EA 2DVHA 2JWAA 1LMSA 4AX3A 1CIGA 2D0SA 3DMIA 4PW9B 1H33A 1CNOA 1C7MA 3PXWA 1WEJF 5EXQA 1JDLA 4Q5PA 1GDVA 1S6VB 3PH2B 5TISV 1DIQC 2L91A 1N90A 3RN1A 2IBZD 1CO6A 1E29A 1H9YA 4YE1A 1CCRA 4WQ7A 3O1YA 5CIDB 4Y5RA 1CYJA 2C1DB 1C6OA 2DGEA 3ZOOA 1B7VA 3H1ID 5CIBB 4FA4A 2KNCB 1SQPD 1FJ0A 1GU2A 1C6SA 3O5CA 3H1HD 1A8CA 1AKKA 2LITA 3CX5D 3TDKA 2FYNB 3CXHW 2BH5X 1IRWA 5B66V 1HZUA 4FA9A 4UB8V 1CIHA 5CICB 1N9CA 1DT1A 3H1JD 3WC8A 1I6DA 3PHLA 4PD4D 5KAFV 1IZL0 1WVEC 1N15A 3HQ6A 2GC7D 1CXAA 1PP9D 2YCCA 3H1LD 1E2RA 1RAQA 3L4MA 3HQ8A 4NFGB 2BLFB 2YIUB 2C1UA 3PRJA 1CIFA 2BCNB 3L72D 2GB8B 1CORA 1C52A 1YCCA 3GW6A 1HJ3A 1FOCA 1AYGA 1K3GA 1H31B 3O0RC 3OCDB 3RLMA 1F1CA 2GC4D 4RJTA 3OA8A 4J20A 1W5CT 1RAPA 2N9IA 2B10B 3X39A 4XYDB 1CRIA 5C9MA 1ZZHA 5KKZB 3PTZA 1CSXA 4WQDA 2N9YB 4IL6V 1H32B 1FI3A 1CRCA 4U3FD 2V08A 1IRVA 2HV4A 5IY51 4XXLA 1QL4A 1NTZD 2AXTV 4KMGA 3WU2V 2FRCA 2EXVA 1HZVA 1HCMA 1SQQD 1H33B 3CU4A 2JQRA 5CIHB 1RZ6A 2K9JB 2PCCB 2V07A 2VHDA 4PJ0V 5CYTR 1QL3A 4QAOA 3HQ7A 1VYDA 1L0LD 2GIWA 1HRCA 1P84D 1NIRA 2B4ZA 1I5TA 1LS9A 1C75A 2C8SA 4WQCA 2LIRA 4WQAA 2BGVX 4L3HA 1K3HA 3KHUA 4AANA 1OCDA 5KLIB 2N9JA 4FAVA 2C9XB 1KV9A 1W2LA 1CHJA 1M6ZA 2D0WA 1A2SA 1C2RA 1CSWA 5KLVD 1FHBA 4PWAA 1H32A 1GJQA 3VMAA 1C2NA 2A06D 5AURA 1CXCA 2RMZA 1KIBA 2C1DA 1GIWA 1HH7A 5TJHA 1YICA 1J3SA 3SXTA 3FWLA 2N3BA 3CX5W 1C6RA 1CRGA 451CA 1ZRTD 3ZOXA 3SVWA 1YFCA 4P4QB 2N3YA 4EDFA 1SQVD 1CYIA 2JTIB 1CYCA 1AOFA 4FA5A 351CA 1HJ4A 3SJLA 2MHMA 4EIFA 1IO3A 3L74D 4FB1A 3WFDC 1PPJD 1NU1D 1BGYD 2BH4X 1KX7A 1MZ4A 4L1QA 4EICA 1CEDA 4MU8A 3CWBD 5H2FV 2ZBOA 3ITKA 3VNWA 4WQ9A 4EIEA 5B6QA 2YK3A 3WFBC 3TF5A 2QG4A 3RN0A 3OA8B 4H0KA 3A0HV 3PXTA 1QYZA 1GQ1A 1GKSA 1MG2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX2 A;  3KZI V;  5E79 V;  3MK7 C;  5DJQ C;  4FAN A;  1BE3 D;  5CIF B;  3SWS A;  2ZON G;  2QJK B;  4FA1 A;  2QJP B;  1CTY A;  1R0Q A;  4AAO A;  1DW1 A;  1KB0 A;  2Q3E A;  4JCG A;  5DF5 A;  4WQB A;  3VRD A;  3ZIY A;  3TYI A;  1I8P A;  1NTK D;  1YEA A;  2OZ1 B;  2ZXY A;  2XTS B;  3TGU D;  1YNR A;  3NBT A;  1NMI A;  3DP5 A;  1CCH A;  3PXS A;  2I8F A;  1KYO D;  2KS1 A;  1M70 A;  1CIE A;  4EID A;  1CC5 A;  3VYM A;  3GG2 A;  1CSU A;  1QN2 A;  1I6E A;  1DW3 A;  1OAE A;  3C2C A;  1CTZ A;  1KYO W;  4L3G A;  4O1W A;  1YEB A;  1H31 A;  1LC1 A;  5GTH V;  1KB9 D;  1HRO A;  3L75 D;  1NML A;  5KAI V;  3MK7 B;  5DJQ B;  4H0J A;  2ZOO A;  2O3J A;  3A9F A;  5DFS A;  3BCC D;  4GYD A;  4V2K A;  4AAL A;  2MTA C;  3ZOW A;  2BCC D;  1F1F A;  4UB6 V;  5GTI V;  3A0B V;  3CXH D;  1A56 A;  3CP5 A;  1YIQ A;  2CA4 B;  1LFM A;  3SLE A;  2AIU A;  3L4O A;  4WQ8 A;  1CTJ A;  3WFE C;  1DVH A;  2Y0C A;  3H1K D;  1H1O A;  4A7P A;  3RMZ A;  1CRJ A;  3NBS A;  2PAC A;  3ZCF A;  2RN0 A;  1RZ5 A;  3O20 A;  1I8O A;  1IQC A;  4AAM A;  1BCC D;  2YQB A;  3NWV A;  1N50 A;  1YTC A;  2AI5 A;  1L9J C;  2C1V A;  3PLN A;  5CIG B;  3JBT B;  4DY9 A;  2QJY B;  2L4D A;  4O1Q A;  1DW0 A;  1L9B C;  3HQ9 A;  4RSZ A;  2B0Z B;  3WFC C;  1M60 A;  1S5L V;  1FI9 A;  1DII C;  2PCB B;  1HJ5 A;  1ETP A;  3OCD A;  4K3I A;  1DW2 A;  1CSV A;  1FCD C;  4GED B;  2FWL A;  1SQB D;  1CRY A;  1BL9 A;  4WQE A;  1CHH A;  1COT A;  3ZBM A;  2CA3 B;  3L73 D;  1H9X A;  1U74 B;  3L70 D;  2ORL A;  3L71 D;  2CXB A;  1U75 B;  1AOQ A;  4LJI A;  2BPB B;  1SQX D;  5C0Z A;  3ORV A;  5B5E V;  2N18 C;  155C A;  1NNO A;  3DR0 A;  2CE0 A;  3CYT I;  1I54 A;  2FYU D;  2Y0D A;  1NTM D;  2N18 B;  1I55 A;  3M97 X;  1QKS A;  1EB7 A;  4N0K A;  1E8E A;  2OZ1 A;  1LC2 A;  1CRH A;  1L0N D;  2CE1 A;  5CIE B;  2B12 B;  1MG3 D;  2ZZS 1;  1FI7 A;  1DVV A;  3WUI A;  2B11 B;  2C2C A;  1EZV D;  3ZOY A;  1CHI A;  4D6T D;  2Y0E A;  2DVH A;  2JWA A;  1LMS A;  4AX3 A;  1CIG A;  2D0S A;  3DMI A;  4PW9 B;  1H33 A;  1CNO A;  1C7M A;  3PXW A;  1WEJ F;  5EXQ A;  1JDL A;  4Q5P A;  1GDV A;  1S6V B;  3PH2 B;  5TIS V;  1DIQ C;  2L91 A;  1N90 A;  3RN1 A;  2IBZ D;  1CO6 A;  1E29 A;  1H9Y A;  4YE1 A;  1CCR A;  4WQ7 A;  3O1Y A;  5CID B;  4Y5R A;  1CYJ A;  2C1D B;  1C6O A;  2DGE A;  3ZOO A;  1B7V A;  3H1I D;  5CIB B;  4FA4 A;  2KNC B;  1SQP D;  1FJ0 A;  1GU2 A;  1C6S A;  3O5C A;  3H1H D;  1A8C A;  1AKK A;  2LIT A;  3CX5 D;  3TDK A;  2FYN B;  3CXH W;  2BH5 X;  1IRW A;  5B66 V;  1HZU A;  4FA9 A;  4UB8 V;  1CIH A;  5CIC B;  1N9C A;  1DT1 A;  3H1J D;  3WC8 A;  1I6D A;  3PHL A;  4PD4 D;  5KAF V;  1IZL 0;  1WVE C;  1N15 A;  3HQ6 A;  2GC7 D;  1CXA A;  1PP9 D;  2YCC A;  3H1L D;  1E2R A;  1RAQ A;  3L4M A;  3HQ8 A;  4NFG B;  2BLF B;  2YIU B;  2C1U A;  3PRJ A;  1CIF A;  2BCN B;  3L72 D;  2GB8 B;  1COR A;  1C52 A;  1YCC A;  3GW6 A;  1HJ3 A;  1FOC A;  1AYG A;  1K3G A;  1H31 B;  3O0R C;  3OCD B;  3RLM A;  1F1C A;  2GC4 D;  4RJT A;  3OA8 A;  4J20 A;  1W5C T;  1RAP A;  2N9I A;  2B10 B;  3X39 A;  4XYD B;  1CRI A;  5C9M A;  1ZZH A;  5KKZ B;  3PTZ A;  1CSX A;  4WQD A;  2N9Y B;  4IL6 V;  1H32 B;  1FI3 A;  1CRC A;  4U3F D;  2V08 A;  1IRV A;  2HV4 A;  5IY5 1;  4XXL A;  1QL4 A;  1NTZ D;  2AXT V;  4KMG A;  3WU2 V;  2FRC A;  2EXV A;  1HZV A;  1HCM A;  1SQQ D;  1H33 B;  3CU4 A;  2JQR A;  5CIH B;  1RZ6 A;  2K9J B;  2PCC B;  2V07 A;  2VHD A;  4PJ0 V;  5CYT R;  1QL3 A;  4QAO A;  3HQ7 A;  1VYD A;  1L0L D;  2GIW A;  1HRC A;  1P84 D;  1NIR A;  2B4Z A;  1I5T A;  1LS9 A;  1C75 A;  2C8S A;  4WQC A;  2LIR A;  4WQA A;  2BGV X;  4L3H A;  1K3H A;  3KHU A;  4AAN A;  1OCD A;  5KLI B;  2N9J A;  4FAV A;  2C9X B;  1KV9 A;  1W2L A;  1CHJ A;  1M6Z A;  2D0W A;  1A2S A;  1C2R A;  1CSW A;  5KLV D;  1FHB A;  4PWA A;  1H32 A;  1GJQ A;  3VMA A;  1C2N A;  2A06 D;  5AUR A;  1CXC A;  2RMZ A;  1KIB A;  2C1D A;  1GIW A;  1HH7 A;  5TJH A;  1YIC A;  1J3S A;  3SXT A;  3FWL A;  2N3B A;  3CX5 W;  1C6R A;  1CRG A;  451C A;  1ZRT D;  3ZOX A;  3SVW A;  1YFC A;  4P4Q B;  2N3Y A;  4EDF A;  1SQV D;  1CYI A;  2JTI B;  1CYC A;  1AOF A;  4FA5 A;  351C A;  1HJ4 A;  3SJL A;  2MHM A;  4EIF A;  1IO3 A;  3L74 D;  4FB1 A;  3WFD C;  1PPJ D;  1NU1 D;  1BGY D;  2BH4 X;  1KX7 A;  1MZ4 A;  4L1Q A;  4EIC A;  1CED A;  4MU8 A;  3CWB D;  5H2F V;  2ZBO A;  3ITK A;  3VNW A;  4WQ9 A;  4EIE A;  5B6Q A;  2YK3 A;  3WFB C;  3TF5 A;  2QG4 A;  3RN0 A;  3OA8 B;  4H0K A;  3A0H V;  3PXT A;  1QYZ A;  1GQ1 A;  1GKS A;  1MG2 D; 
#chains in the Genus database with same CATH topology
 4D6T J;  2GUV A;  3MK7 C;  1GU4 A;  2BCC E;  1S1C X;  2XNX A;  3AE8 C;  1KB9 H;  1YBK A;  4FA1 A;  5B66 H;  1R0Q A;  2YXQ B;  3JC2 2;  4Y99 C;  5KJ7 C;  3HUS B;  1SQV J;  5TIS H;  2E74 B;  2WTY A;  4PJ0 H;  1Q82 Q;  2K1A A;  1FZG A;  5AW7 B;  3B5N A;  4KT0 J;  2AEF A;  3AE4 C;  3P8C D;  1MKM A;  1ZN5 A;  1BDC A;  4ASW A;  2I8F A;  2OAR A;  3NMD A;  3O6Q A;  1M70 A;  2R44 A;  3WU2 E;  3OAK A;  1CC5 A;  4OGQ C;  3VYM A;  2N1T D;  3GG2 A;  1HGV A;  1I6E A;  2HFE D;  2K9Y A;  2K37 A;  1SQQ E;  1J1D B;  2HR3 A;  2E74 D;  1SQV E;  4L3G A;  1YEB A;  4IFF A;  1ZOY C;  2MKV A;  5DJQ B;  4H0J A;  3TYY A;  3H1J G;  2ZT9 C;  2KIK A;  3RL0 g;  1Q7Y Q;  1SLQ A;  2M0B A;  1KN7 A;  4GYD A;  5BU8 B;  2WIT A;  2BCC D;  2QRX A;  1KYO I;  1A56 A;  1NGM B;  2Z5I A;  2ZYA A;  1LFM A;  3L71 E;  2BEQ D;  3L4O A;  3PJS K;  4WQ8 A;  1YIT P;  2ZXE B;  1LTJ C;  1RH5 B;  2O01 H;  2RN0 A;  2CK3 H;  3O20 A;  3HRN A;  2KYV A;  3BAT A;  5AW2 B;  1J1E C;  2AXC A;  1IQC A;  1X22 A;  4WY4 D;  1VQ6 P;  1USD A;  3PLN A;  5AVS B;  3Q3D A;  5DJU B;  5GTH E;  4TLF A;  5AW3 B;  4RSZ A;  2B0Z B;  4WWI A;  1RE3 C;  2PCB B;  5KLV G;  1HJ5 A;  2WPQ A;  2YKO A;  1NTZ G;  2H43 A;  1DW2 A;  1FCD C;  2FWL A;  1EXJ A;  1EDI A;  3EFG A;  3PH0 A;  3WUT A;  1YQ3 C;  3L70 E;  4H0L C;  2C0X A;  2A45 I;  2P2U A;  4OGQ B;  1H8A A;  3L73 D;  1ZR4 A;  4LJI A;  2RKL A;  1SQX D;  5C0Z A;  3G4S P;  4EI2 A;  5B5E V;  4N78 D;  2N18 C;  3CYT I;  1G1J A;  1NU1 J;  3A5T A;  2N18 B;  2A06 G;  1VF5 C;  3FWN A;  3CCL P;  2JDI H;  3V6I A;  2OZ1 A;  1LC2 A;  3AEC C;  2IBZ E;  2JP3 A;  3VMX A;  3KZI E;  2B12 B;  1KB9 I;  4W7Y A;  4Y99 B;  3L71 G;  2Y9Y A;  1URQ D;  1PP9 G;  2E74 C;  3IR9 A;  3BCC G;  1ZME C;  2KSE A;  1J1E B;  2D0S A;  3DMI A;  1RQU A;  1H33 A;  3C9I A;  1LTB C;  1NU1 K;  1VQP P;  1JDL A;  2LR2 A;  3CX5 H;  3PH2 B;  3RK2 C;  2OQQ A;  2FFD A;  1E29 A;  5CBO A;  3WUU A;  5CJ0 A;  4I7Z C;  4YE1 A;  5APY A;  1IK9 A;  5CID B;  1HTL C;  2C0W A;  2DGE A;  1HF9 A;  2QJP C;  3H1I D;  3HD7 B;  3N4X A;  4YPC A;  1OW6 A;  1GU2 A;  1NU1 G;  2LIT A;  2K88 A;  2BH5 X;  2E5T A;  1HZU A;  1NAF A;  4EOT A;  2WSE H;  1CIH A;  5H2F H;  5AVU B;  3H1J D;  1I6D A;  2WT7 A;  2HOD A;  5KAF V;  2C9L Y;  2N1T C;  1GDT A;  2I1J A;  2GC7 D;  2A45 H;  1E2R A;  3A0B H;  4NFG B;  1GU5 A;  3W67 A;  4HJG H;  2BCN B;  3I56 P;  4GT1 A;  1PP9 J;  1SQX J;  1YCC A;  3M0D C;  2E75 B;  2KS1 B;  3GLM A;  1VQ7 P;  5AW1 B;  4ZKP A;  3A0H E;  3OCD B;  5KAF E;  2GC4 D;  4WBA A;  1H88 A;  1RAP A;  3HUS C;  2B10 B;  1KQL A;  4XYD B;  4EYY Q;  1GZL A;  1LTT C;  3R2P A;  1FZA A;  4LC1 A;  1EZV E;  2NPS C;  1M8O B;  3H1I J;  4H44 D;  1FAV A;  3H1K G;  3MD0 A;  3VTP C;  4GKG A;  4HH2 A;  2IFM A;  1FJK A;  4XXL A;  4B86 A;  1QL4 A;  3U59 A;  1NTZ D;  1PP9 E;  5CCH A;  2YIU C;  2FRC A;  1NVO A;  1M7L A;  1SQQ D;  1H33 B;  1N2D C;  2JQR A;  5CIH B;  1N73 A;  1FBM A;  1KYO H;  2W27 A;  4I1L A;  1J1D C;  5KTB A;  2VRS A;  2KUB A;  2V07 A;  2HPC A;  1SQB J;  4U7J A;  2YMY A;  1VYD A;  2WPV B;  5CMZ A;  3GF3 A;  1S5L X;  4QMA A;  3USS A;  2B4Z A;  5AVV B;  1GL2 D;  4H13 B;  1LS9 A;  1S2E A;  2C8S A;  1AV1 A;  2BGV X;  2IDB A;  1LT9 B;  3KHU A;  2XZR A;  1GK4 A;  1W2L A;  2M3B A;  1YJ9 P;  1C2R A;  1NU1 E;  1M1K Q;  2OYH B;  1CI6 A;  2W8Z A;  1N7S B;  2M5A A;  2KSJ A;  1H32 A;  3VMA A;  1C2N A;  3BCC E;  4U3F G;  2BCC J;  5AUR A;  1FZC C;  2PP6 A;  4W80 A;  2B87 A;  1KYO E;  1M1J C;  4AYC A;  1FZC B;  1J3S A;  3H1L J;  3D71 A;  3SXT A;  2H7H A;  2N3B A;  1BCC G;  1KMI Z;  1ZRT D;  3S1K A;  1A02 J;  2ZT9 D;  3CL3 D;  1K9M Q;  3HD7 D;  2DW3 A;  1SQB G;  2IYP A;  3HD7 C;  1NOH A;  1SFC D;  1E5W A;  1PGQ A;  3UIA A;  1W2E A;  2C9N Y;  1RF0 C;  4FA5 A;  1HJ4 A;  1KQS O;  3L74 D;  2Q9I A;  2KK7 A;  3WFD C;  3EQ2 A;  4MU8 A;  3AED C;  2Q1K A;  2PRR A;  3CWB D;  2ZBO A;  3ITK A;  1JO5 A;  3VNW A;  4GIF A;  2A06 E;  3CD6 P;  1Q86 Q;  4H0K A;  1NHL A;  2YKQ A;  1VDF A;  1HH0 A;  1QLE D;  1GQ1 A;  3IFM A;  1L0N J;  4U3F J;  1D7M A;  2ZON G;  3SWY A;  1PPJ E;  1LP1 A;  2QJK B;  4H44 B;  5E79 H;  1CTY A;  3H1L G;  3SSU A;  2Q3E A;  4JCG A;  2QJK C;  5DF5 A;  4WQB A;  1LTA C;  1FU1 A;  1EDJ A;  2KP8 A;  1I8P A;  1JY2 O;  1NTK D;  2AEJ A;  1BE3 G;  2E5Y A;  3BAS A;  2XTS B;  3TGU D;  3NBT A;  1NMI A;  2E76 B;  1K04 A;  3AE6 C;  3CCV P;  1OVR A;  3RBX A;  3PXS A;  1OXZ A;  3H6P A;  2FXO A;  3RK3 B;  1CIE A;  2QM8 A;  1S4X A;  1SQV G;  1DW3 A;  1IK7 A;  4YXD C;  1CTZ A;  1KYO W;  3H1J E;  3CWB E;  5CCG D;  5GTH V;  1KB9 D;  5KAI V;  1G2C A;  2ZOO A;  2O3J A;  2WSC J;  3B4S A;  2W6A A;  1L0N G;  2Z4E A;  3BCC D;  1IFJ A;  1CW5 A;  1OVU A;  2B9B A;  2MTA C;  1G1I A;  4UB6 V;  5GTI V;  4PD4 H;  1DEE G;  2WSS H;  3D6Z A;  1LT1 A;  2CA4 B;  2WT7 B;  3LID A;  1SQB E;  3SLE A;  1MV8 A;  3AEE C;  1ZP0 C;  1CTJ A;  2Y0C A;  4A7P A;  1CRJ A;  3ZCF A;  3H1J J;  4GOF A;  1J2J B;  1W2B O;  2WVR A;  3OA7 A;  2FXP A;  1L0L K;  1BCC D;  1S9K D;  1T6A A;  3BRT B;  2C1V A;  5CIG B;  1Q2N A;  3JBT B;  1EZV I;  5AVT B;  1PPJ G;  4DY9 A;  2QJY B;  3B5N C;  1NTZ E;  4O1Q A;  4JF7 A;  1DD3 A;  3HQ9 A;  3WFC C;  1M60 A;  1PGP A;  1KC8 Q;  1DII C;  1ETP A;  3OCD A;  4K3I A;  1FOS F;  3KYQ A;  1KFN A;  1Y9B A;  3V5B A;  1P84 I;  4IL6 X;  1PGJ A;  3MZW B;  3P8C E;  3GHG B;  1CRY A;  1BL9 A;  1RF0 A;  3RK3 E;  5KLV K;  3M0A A;  1CHH A;  1JY3 P;  1COT A;  1Y47 A;  5AW0 B;  3C1L A;  2JKV A;  3II6 A;  2R5B A;  2ORL A;  1KQG B;  3L4F A;  1YJN P;  3U1C A;  1U75 B;  1AOQ A;  2XDJ A;  4DCK A;  3AEA C;  3KDP B;  1DD4 A;  1NTZ J;  2FYU E;  3P7K A;  2K9J A;  155C A;  2OTK E;  1NNO A;  2CE0 A;  1M90 Q;  1W5C E;  2Y0D A;  1NTM D;  2H8P D;  2YO3 A;  2IBZ G;  1QKS A;  1SFC B;  1EB7 A;  1PL5 A;  1FZC A;  4N0K A;  3TGU E;  1E8E A;  1NTZ K;  1CRH A;  1L0N D;  3P8M C;  1S9K E;  5CIE B;  1FC2 C;  4RKU J;  1FS0 E;  1GD2 E;  1DVV A;  2C2C A;  3ZOY A;  2V7Q H;  1SQQ G;  1CHI A;  3SFE C;  4D6T D;  4H0L B;  3CCS P;  1RHZ B;  2FYU J;  3GMA A;  3JSV C;  1CIG A;  1C7M A;  3AE9 C;  5AVW B;  1OX3 A;  1GDV A;  1S6V B;  3NFQ A;  4N78 E;  2ZVN B;  3BVH A;  5AVR B;  5APW A;  3RN1 A;  2IBZ D;  1H9Y A;  1T3U A;  3H25 A;  3SFD C;  3RK3 C;  1VF5 B;  1CCR A;  3O1Y A;  2C1D B;  1C6O A;  4JPZ B;  4H13 C;  1B7V A;  1DIP A;  5AW5 B;  3SWK A;  2PGD A;  1GW4 A;  1SQP D;  1FJ0 A;  1C6S A;  3O5C A;  3H1H D;  3VOP A;  4ZNC A;  1A8C A;  5KJ7 D;  2FYN B;  3HE5 A;  1IRW A;  1VQ4 P;  4FA9 A;  5E79 E;  3HQ6 A;  1N73 B;  4OH8 B;  2BLF B;  5KAI E;  1SQQ J;  2H88 C;  3CXH I;  1CIF A;  2L5G B;  5AW6 B;  1FE6 A;  1YI2 P;  3AE7 C;  5AVY B;  3U1A A;  1HJ3 A;  3V4Q A;  3KQG A;  1AYG A;  2V7Q J;  3CXH H;  1F1C A;  3M9B A;  3M0D A;  3BRV B;  2N9I A;  1SQP J;  1X8Y A;  1URQ A;  3V2R A;  1TU3 F;  3O6Q B;  1NKZ B;  5CCH D;  3CC7 P;  2QJY C;  1YJW P;  1Q90 D;  1H32 B;  1CRC A;  1RE3 A;  1SQX G;  1N8R Q;  2D2C C;  2WPS A;  1LP1 B;  4KMG A;  3WU2 V;  1HZV A;  2JO1 A;  1PIX A;  4CPG A;  2IBZ I;  2M8R A;  3FX0 A;  1KQF B;  5AVQ B;  1RZ6 A;  3H1I G;  2K9J B;  1Q81 Q;  4N3Y B;  3EWK A;  3L72 E;  1FZE A;  1GMJ A;  5CYT R;  2R3C A;  1QL3 A;  2O1K A;  2WPR A;  1FOS E;  3H32 A;  2NZ2 A;  2E43 A;  4L74 A;  2ZJS E;  2CPS A;  1ZR2 A;  1IFD A;  1P84 D;  4GOE A;  1LT9 C;  1I5T A;  2W90 A;  1L4A D;  4L3H A;  1HBW A;  1SQP G;  2SPZ A;  1A02 F;  2B87 B;  1JY3 N;  5CCG A;  3CI9 A;  5KLI B;  2C9X B;  2WSF J;  2D0W A;  4IOI H;  3E1R A;  1CSW A;  4EIJ A;  2NPS A;  4UB8 E;  1OZH A;  3I55 P;  5B5E H;  3N7N A;  3CWB J;  2I1K A;  2AXT E;  4GOD A;  1CXC A;  3G3Z A;  1GIW A;  1YIC A;  1WRG A;  2FXM A;  3FWL A;  4DZO A;  1CRG A;  1S3J A;  4UB6 H;  451C A;  3SWF A;  1BSH A;  2QSI A;  1YFC A;  4EDF A;  1FZB A;  1VQ9 P;  1AQ5 A;  1CYI A;  2JTI B;  1VQM P;  1AOF A;  1LWU B;  2MHM A;  2B88 A;  2KXP B;  1HWT C;  2UWJ E;  3AE1 C;  1KOR A;  1JM0 A;  2OYH C;  3AE2 C;  4NPE A;  4FB1 A;  3KXD A;  1NU1 D;  2KLV A;  1BGY D;  2P1J A;  3HD7 A;  4L1Q A;  3MGN A;  3W68 A;  2XKM A;  4ZMD A;  3C8V A;  4EIE A;  5B5E E;  1IJD B;  1HJ0 A;  1SS1 A;  1IFI A;  2R32 A;  2GUS A;  1R5S A;  1ZRT E;  3RK2 B;  5GTI E;  3KZI V;  5DJQ C;  2W6J H;  2A45 G;  1FDM A;  3SWS A;  1QL1 A;  1S72 P;  1SVF A;  3LIE A;  1EC5 A;  4O9B A;  1DW1 A;  1KB0 A;  4XA4 A;  3RL0 C;  2OYI B;  4C7R A;  3ZIY A;  1JCC A;  2R3S A;  1IFM A;  3MTU E;  3RBZ A;  2OZ1 B;  4BRY B;  1YNR A;  3S9O A;  2IFN A;  1N7L A;  1CCH A;  3QH9 A;  2WWW A;  1KYO D;  4U3F E;  2KS1 A;  3FXE A;  1SQP E;  2H89 C;  4EID A;  3T97 A;  1M56 D;  3F89 A;  3L35 A;  1NWQ A;  2OYO A;  3HTK A;  1R5L A;  4JYB A;  1OAE A;  3L72 G;  1BE3 J;  4O1W A;  5APQ A;  1H31 A;  2E75 C;  1HRO A;  3L75 D;  1RE4 C;  3Q5P A;  3MK7 B;  2FYZ A;  2OGU A;  1PFI A;  4MN4 C;  3TGU G;  1M57 D;  4RES B;  1NYH A;  1N7S D;  5CCH C;  5DFS A;  3CCE P;  2ZFC A;  1LGH B;  2IZ1 A;  3A0B V;  3CXH D;  1QX8 A;  2RH0 A;  1L0N K;  2GM4 A;  4L76 A;  2W6B A;  3WFE C;  1H1O A;  3HUS A;  3RMZ A;  3A7O A;  3A0B E;  1NTK K;  3CLQ A;  1IO4 A;  4NPD A;  3A2A A;  1HGZ A;  2YQB A;  3NWV A;  1LT9 A;  3B5N B;  3L73 G;  1N50 A;  2AI5 A;  1L9J C;  2XND H;  1LTS C;  4I7Z B;  4L73 A;  2OTL P;  1L9B C;  1T3J A;  1OW8 A;  1FI9 A;  3AE3 C;  5BU5 A;  2N1T A;  1NTK E;  2YO2 A;  1PZQ A;  3IAO A;  4GED B;  2NRG A;  1SQB D;  3L75 E;  1IZN B;  4WQE A;  5L8R J;  3EFF K;  4NPF X;  4HYT B;  2CA3 B;  1H9X A;  3L70 D;  1Z56 A;  3L71 D;  2KNC A;  3D6Y A;  2PAJ A;  3AEF C;  1KFM A;  3MUD C;  1QL2 A;  4YXW H;  1PV3 A;  1URQ C;  3L74 J;  4DOJ A;  3DR0 A;  3ZDM A;  1I54 A;  1JY2 P;  1Y8A A;  1YTZ I;  1I55 A;  3M97 X;  1EQ7 A;  2FYU K;  1IFP A;  4PD4 E;  2JWD A;  3IN6 A;  1KIL E;  4HKZ H;  2BAS A;  2ZZS 1;  4AQR D;  1JEK A;  1VF5 D;  1FI7 A;  2J5U A;  1NTK G;  3CX5 E;  1KIL A;  3M91 A;  2DVH A;  2JWA A;  3Q5R A;  4AX3 A;  2WZ7 A;  1LTJ B;  5AW9 B;  3PXW A;  1WEJ F;  5EXQ A;  4WB4 A;  1GTW A;  3CC4 P;  4Q5P A;  3D0W A;  1BGY J;  3E7K A;  4TT3 H;  3L73 E;  2L91 A;  2HLO A;  1N90 A;  2M3E A;  4H0L D;  2ITA A;  3L70 J;  2MJZ A;  2JJL A;  4LGD E;  3H1I E;  3TNU A;  2WSC H;  4WQ7 A;  3M9H A;  1CYJ A;  1X0T A;  1UIX A;  2FYU G;  4GDO A;  4FA4 A;  3IF4 A;  3L74 G;  5EFW B;  3R4Y A;  4IFD K;  2O01 J;  3Q1M A;  1AKK A;  3TDK A;  3CXH W;  1VL2 A;  2HG5 D;  5B66 V;  1E79 H;  3HE4 A;  4PV1 B;  1SQV K;  1NTM K;  4UB8 V;  1PGO A;  5CIC B;  1N9C A;  4IFM A;  3WC8 A;  1MFT A;  4PD4 D;  1IZL 0;  1N15 A;  1CXA A;  2YCC A;  5KAF H;  1NTK J;  3Q5S A;  1DX7 A;  3TSI A;  3HQ8 A;  2KZJ A;  2C1U A;  3PRJ A;  2FKW B;  1H89 A;  1USE A;  1LJ2 A;  2GB8 B;  1COR A;  2XU6 A;  3KPE A;  1FOC A;  2ZAE B;  1JMB A;  1K3G A;  1H31 B;  1VQO P;  1YYC A;  4RJT A;  1YTZ T;  5GTH H;  1W5C T;  2QIW A;  1HJB A;  4XFJ A;  3X39 A;  2GA1 A;  1ZZH A;  3PTZ A;  3VYI A;  4IL6 V;  3A0H H;  1FI3 A;  1HVV A;  2J59 M;  1VQK P;  1BDD A;  4U3F D;  3H1H J;  2HV4 A;  3QWO C;  5IY5 1;  1ZW0 A;  3B71 A;  2KI7 B;  3M06 A;  1NJI Q;  2EXV A;  4YTP C;  1S5L H;  1NKN A;  1HCM A;  2BEZ F;  2FY8 A;  4RO0 A;  3MHV A;  1EXI A;  1ZXG A;  3G6E P;  1MZ9 A;  1OIP A;  1ZLL A;  1NTM G;  2IZ0 A;  3CX5 I;  4QAO A;  4N6J A;  5TIS E;  2KOG A;  4I2L C;  1HRC A;  1RF1 B;  1CSB A;  2J58 A;  2P67 A;  2Q6Q A;  2E42 A;  4UB6 E;  1CI6 B;  5APV A;  1GK6 A;  2LIR A;  1LWU A;  1RY3 A;  1JNM A;  3HE4 B;  3V2N A;  4AAN A;  3NTN A;  3WU2 H;  2N9J A;  5KJ7 A;  1GL2 A;  2WSE J;  1XTG B;  1CHJ A;  1M6Z A;  4OVN F;  1A2S A;  1FHB A;  1R8E A;  4K35 A;  1S5L E;  1GJQ A;  1BE3 E;  3GHG C;  3V4W A;  1SQQ K;  2N1T B;  2A06 D;  2RMZ A;  1KIB A;  3S4R A;  2CPB A;  1EDL A;  2IX7 C;  2FYN C;  2HYN A;  1SQP K;  1C6R A;  1X79 B;  1LTJ A;  3ZOX A;  3H1K E;  1GW3 A;  1NTM J;  3MP7 B;  3P32 A;  1SQV D;  2AEM A;  2E75 D;  3CWB G;  1OFC X;  1CYC A;  2QVA A;  2QEX P;  2HOD B;  1YIJ P;  351C A;  1HUC A;  1JCD A;  5CJ4 A;  2IYO A;  3CCJ P;  1SFC A;  5APS A;  4DJG A;  1KX7 A;  1MZ4 A;  1CED A;  3JCU H;  3G9R A;  4WVZ A;  5KLI C;  1N7S A;  3T97 B;  1L0L G;  5B6Q A;  1N7S C;  1KIL D;  2K3R A;  2QE7 H;  2QM7 A;  2E76 C;  4WY4 B;  1QVF O;  2QG4 A;  2B89 A;  2Q5U A;  2P7J A;  3A0H V;  1NO4 A;  4BWN A;  3O8Z A;  1QYZ A;  2ZYG A;  1P84 E;  1AA0 A;  1GKS A;  1MG2 D;  1LTI C;  1KX2 A;  5E79 V;  4LLH A;  4FAN A;  1H0T B;  1BE3 D;  5CIF B;  1KV4 A;  2QJP B;  1OVV A;  3D70 A;  4AAO A;  2YXR B;  5AW4 B;  1T2K C;  1U57 A;  1CZQ A;  3VRD A;  2P10 A;  3TYI A;  1L4A B;  1JUN A;  4R4M A;  2JEE A;  1YEA A;  2ZXY A;  1OMI A;  1GL2 B;  4JYC A;  3L74 E;  3AEB C;  3DP5 A;  4C7N B;  1KIL B;  2P58 A;  1VQL P;  1BCC E;  1VQ5 P;  2NPS D;  3KZI H;  1CSU A;  1QN2 A;  1RF1 A;  1KB9 E;  1U7M A;  3C2C A;  4UB8 H;  3CCM P;  3A3Y B;  1L0L J;  1DH3 A;  1P84 H;  1LC1 A;  1OW7 A;  1NML A;  1M1J A;  1ZV8 A;  2FBW C;  3VP9 A;  1YHQ P;  1K73 Q;  1JTH A;  3A9F A;  4H13 D;  4H44 C;  2M5A B;  4V2K A;  2W83 C;  4AAL A;  3HE5 B;  3ZOW A;  1BGY E;  3RK3 D;  1F1F A;  2IPP A;  3CME P;  1VQ8 P;  3CP5 A;  2G3A A;  1YIQ A;  3L72 J;  4WY4 C;  5GTI H;  2AIU A;  1DVH A;  3H1K D;  5KLV J;  3NBS A;  2PAC A;  3LW5 J;  1RZ5 A;  1AVO A;  3TGU J;  3H32 B;  2V4H A;  2N9B A;  4JQ0 D;  1JY2 N;  1I8O A;  4AAM A;  3L75 G;  1YTC A;  4M3L A;  5M1B A;  3RGU A;  5H2F E;  3HTK B;  3CXH E;  3WMM 0;  2L4D A;  1DW0 A;  4C46 A;  5APT A;  2YKP A;  1S5L V;  2Z5H A;  1JMM A;  4D6T E;  1SFC C;  1CSV A;  2OYI A;  1N73 C;  3L73 J;  2FFD B;  4KHX A;  2POH A;  5CHX A;  4R4L A;  1UII A;  3ZBM A;  2YMK A;  3CCQ P;  1U74 B;  2CXB A;  5C39 A;  1LNQ A;  2BPB B;  1AVY A;  4I6M C;  1MUU A;  3ORV A;  3CMA P;  1NTM E;  1LTG C;  1SQX K;  4IL6 H;  3L71 J;  2ZVO B;  5APX A;  1AJY A;  1JOC A;  2FYU D;  1K8A Q;  3BCC J;  3F5H A;  5AVX B;  3RL0 D;  2OYH A;  2LXB A;  1FZF A;  3L75 J;  3V2P A;  1IC2 A;  2CE1 A;  3I5C A;  3H1L E;  1MG3 D;  4Y28 J;  1KD1 Q;  5B66 E;  3WUI A;  2B11 B;  1EZV D;  1RQV A;  3B8E B;  4BRY A;  1GL2 C;  3G71 P;  1L0L E;  2Y0E A;  1LMS A;  2O1J A;  3AEG C;  2E76 D;  4KJM A;  4PJ0 E;  1LWU C;  4PW9 B;  5DJT B;  1CNO A;  1IFN A;  1QGK B;  3CPW O;  1L2P A;  2KB7 P;  5TIS V;  1DIQ C;  1JY3 O;  1SQB K;  1CO6 A;  1G2C B;  2Q3I A;  2OTJ P;  4Y5R A;  3GF7 A;  2NPS B;  3ZOO A;  5KLV E;  2LKM A;  3H1H E;  5CIB B;  1URQ B;  2KNC B;  1JTH B;  2D2C D;  1FDI A;  5CCG C;  2FFD C;  1QEX A;  3CX5 D;  1BGY G;  5KAI H;  1L0N E;  1AFO A;  3L70 G;  3MIW A;  1DT1 A;  1EZV G;  3PHL A;  2I8D A;  4OGQ D;  2ZT9 B;  3PP5 A;  1QVG O;  3RL0 B;  3JCU E;  3Q2Y A;  1WVE C;  2O01 N;  1PP9 D;  3H1L D;  1RAQ A;  3L4M A;  2YIU B;  3ABV C;  3L72 D;  2JR8 A;  3H1K J;  2HPC B;  1C52 A;  3L36 A;  3GW6 A;  1L4A A;  3O0R C;  3OW2 O;  3RLM A;  3OA8 A;  4J20 A;  2R5D A;  5KKZ C;  3NXS A;  3E1I A;  1FDO A;  2G8Y A;  3CC2 P;  1CRI A;  5C9M A;  3VN0 A;  3GHG A;  4PV1 C;  5KKZ B;  3L37 A;  4WY4 A;  1CSX A;  4BXL A;  4WQD A;  2N9Y B;  1NAY A;  3WUV A;  2V08 A;  1H0T A;  1IRV A;  3TK1 A;  1WT6 A;  3LW5 H;  2QA4 P;  1WMK A;  1KZU B;  2AXT V;  2Y9Z A;  1VPC A;  3CU4 A;  4AUW A;  4PD4 I;  5BVZ A;  1U7J A;  3VP8 A;  2PCC B;  1RF1 C;  1KTM A;  2VHD A;  4PJ0 V;  3FXD A;  3H1H G;  3HQ7 A;  1YQ4 C;  1L0L D;  4C7N A;  1BSN A;  2GIW A;  3VMZ A;  1SQX E;  1NIR A;  2ZYD A;  2PFX A;  1C75 A;  2BCC G;  4WQC A;  1L4A C;  3AE5 C;  1DEB A;  4WQA A;  1K3H A;  4PV1 D;  1RE4 A;  2OYI C;  1NH4 A;  1OCD A;  2XV5 A;  4FAV A;  4XE5 B;  1BCC J;  3M9Q A;  1KV9 A;  2ZXX A;  5AVZ B;  2Q7C A;  2D2C B;  4ASV A;  1KIL C;  4K3A A;  3RK2 D;  5KLV D;  4PWA A;  1OWA A;  1MFZ A;  2WMM A;  2YNY A;  5AW8 B;  4D6T G;  4ZKU A;  1SP4 A;  2C1D A;  2KZI A;  1T8Z A;  2WSF H;  1HH7 A;  5TJH A;  4Z1M H;  3B5N D;  3CX5 W;  3FGA D;  1AQT A;  1T2K D;  3MUD A;  4JBZ A;  5APU A;  1M1J B;  1K05 A;  3SVW A;  2AXT H;  4P4Q B;  2N3Y A;  3CCR P;  1X9V A;  4IL6 E;  3OJA B;  2WQY C;  1XTC C;  3SJL A;  4L75 A;  4EIF A;  3CCU P;  2KLU A;  1IO3 A;  4DT0 A;  2LXC B;  1JB0 J;  1PPJ D;  2BH4 X;  4EIC A;  5CBN A;  4HB1 A;  4OWF A;  1VQN P;  5H2F V;  4W7Z A;  3K5B A;  3TNU B;  1EDK A;  4WQ9 A;  2YK3 A;  3WFB C;  3TF5 A;  3RN0 A;  3V2Q A;  3OA8 B;  5K5G B;  3PXT A;  1FJP A;  1N86 A;  3VMY A; 
#chains in the Genus database with same CATH homology
 1KX2 A;  3KZI V;  5E79 V;  3MK7 C;  5DJQ C;  4FAN A;  1BE3 D;  5CIF B;  3SWS A;  2ZON G;  2QJK B;  4FA1 A;  2QJP B;  1CTY A;  1R0Q A;  4AAO A;  1DW1 A;  1KB0 A;  2Q3E A;  4JCG A;  5DF5 A;  4WQB A;  3VRD A;  3ZIY A;  3TYI A;  1I8P A;  1NTK D;  1YEA A;  2OZ1 B;  2ZXY A;  2XTS B;  3TGU D;  1YNR A;  3NBT A;  1NMI A;  3DP5 A;  1CCH A;  3PXS A;  2I8F A;  1KYO D;  2KS1 A;  1M70 A;  1CIE A;  4EID A;  1CC5 A;  3VYM A;  3GG2 A;  1CSU A;  1QN2 A;  1I6E A;  1DW3 A;  1OAE A;  3C2C A;  1CTZ A;  1KYO W;  4L3G A;  4O1W A;  1YEB A;  1H31 A;  1LC1 A;  5GTH V;  1KB9 D;  1HRO A;  3L75 D;  1NML A;  5KAI V;  3MK7 B;  5DJQ B;  4H0J A;  2ZOO A;  2O3J A;  3A9F A;  5DFS A;  3BCC D;  4GYD A;  4V2K A;  4AAL A;  2MTA C;  3ZOW A;  2BCC D;  1F1F A;  4UB6 V;  5GTI V;  3A0B V;  3CXH D;  1A56 A;  3CP5 A;  1YIQ A;  2CA4 B;  1LFM A;  3SLE A;  2AIU A;  3L4O A;  4WQ8 A;  1CTJ A;  3WFE C;  1DVH A;  2Y0C A;  3H1K D;  1H1O A;  4A7P A;  3RMZ A;  1CRJ A;  3NBS A;  2PAC A;  3ZCF A;  2RN0 A;  1RZ5 A;  3O20 A;  1I8O A;  1IQC A;  4AAM A;  1BCC D;  2YQB A;  3NWV A;  1N50 A;  1YTC A;  2AI5 A;  1L9J C;  2C1V A;  3PLN A;  5CIG B;  3JBT B;  4DY9 A;  2QJY B;  2L4D A;  4O1Q A;  1DW0 A;  1L9B C;  3HQ9 A;  4RSZ A;  2B0Z B;  3WFC C;  1M60 A;  1S5L V;  1FI9 A;  1DII C;  2PCB B;  1HJ5 A;  1ETP A;  3OCD A;  4K3I A;  1DW2 A;  1CSV A;  1FCD C;  4GED B;  2FWL A;  1SQB D;  1CRY A;  1BL9 A;  4WQE A;  1CHH A;  1COT A;  3ZBM A;  2CA3 B;  3L73 D;  1H9X A;  1U74 B;  3L70 D;  2ORL A;  3L71 D;  2CXB A;  1U75 B;  1AOQ A;  4LJI A;  2BPB B;  1SQX D;  5C0Z A;  3ORV A;  5B5E V;  2N18 C;  155C A;  1NNO A;  3DR0 A;  2CE0 A;  3CYT I;  1I54 A;  2FYU D;  2Y0D A;  1NTM D;  2N18 B;  1I55 A;  3M97 X;  1QKS A;  1EB7 A;  4N0K A;  1E8E A;  2OZ1 A;  1LC2 A;  1CRH A;  1L0N D;  2CE1 A;  5CIE B;  2B12 B;  1MG3 D;  2ZZS 1;  1FI7 A;  1DVV A;  3WUI A;  2B11 B;  2C2C A;  1EZV D;  3ZOY A;  1CHI A;  4D6T D;  2Y0E A;  2DVH A;  2JWA A;  1LMS A;  4AX3 A;  1CIG A;  2D0S A;  3DMI A;  4PW9 B;  1H33 A;  1CNO A;  1C7M A;  3PXW A;  1WEJ F;  5EXQ A;  1JDL A;  4Q5P A;  1GDV A;  1S6V B;  3PH2 B;  5TIS V;  1DIQ C;  2L91 A;  1N90 A;  3RN1 A;  2IBZ D;  1CO6 A;  1E29 A;  1H9Y A;  4YE1 A;  1CCR A;  4WQ7 A;  3O1Y A;  5CID B;  4Y5R A;  1CYJ A;  2C1D B;  1C6O A;  2DGE A;  3ZOO A;  1B7V A;  3H1I D;  5CIB B;  4FA4 A;  2KNC B;  1SQP D;  1FJ0 A;  1GU2 A;  1C6S A;  3O5C A;  3H1H D;  1A8C A;  1AKK A;  2LIT A;  3CX5 D;  3TDK A;  2FYN B;  3CXH W;  2BH5 X;  1IRW A;  5B66 V;  1HZU A;  4FA9 A;  4UB8 V;  1CIH A;  5CIC B;  1N9C A;  1DT1 A;  3H1J D;  3WC8 A;  1I6D A;  3PHL A;  4PD4 D;  5KAF V;  1IZL 0;  1WVE C;  1N15 A;  3HQ6 A;  2GC7 D;  1CXA A;  1PP9 D;  2YCC A;  3H1L D;  1E2R A;  1RAQ A;  3L4M A;  3HQ8 A;  4NFG B;  2BLF B;  2YIU B;  2C1U A;  3PRJ A;  1CIF A;  2BCN B;  3L72 D;  2GB8 B;  1COR A;  1C52 A;  1YCC A;  3GW6 A;  1HJ3 A;  1FOC A;  1AYG A;  1K3G A;  1H31 B;  3O0R C;  3OCD B;  3RLM A;  1F1C A;  2GC4 D;  4RJT A;  3OA8 A;  4J20 A;  1W5C T;  1RAP A;  2N9I A;  2B10 B;  3X39 A;  4XYD B;  1CRI A;  5C9M A;  1ZZH A;  5KKZ B;  3PTZ A;  1CSX A;  4WQD A;  2N9Y B;  4IL6 V;  1H32 B;  1FI3 A;  1CRC A;  4U3F D;  2V08 A;  1IRV A;  2HV4 A;  5IY5 1;  4XXL A;  1QL4 A;  1NTZ D;  2AXT V;  4KMG A;  3WU2 V;  2FRC A;  2EXV A;  1HZV A;  1HCM A;  1SQQ D;  1H33 B;  3CU4 A;  2JQR A;  5CIH B;  1RZ6 A;  2K9J B;  2PCC B;  2V07 A;  2VHD A;  4PJ0 V;  5CYT R;  1QL3 A;  4QAO A;  3HQ7 A;  1VYD A;  1L0L D;  2GIW A;  1HRC A;  1P84 D;  1NIR A;  2B4Z A;  1I5T A;  1LS9 A;  1C75 A;  2C8S A;  4WQC A;  2LIR A;  4WQA A;  2BGV X;  4L3H A;  1K3H A;  3KHU A;  4AAN A;  1OCD A;  5KLI B;  2N9J A;  4FAV A;  2C9X B;  1KV9 A;  1W2L A;  1CHJ A;  1M6Z A;  2D0W A;  1A2S A;  1C2R A;  1CSW A;  5KLV D;  1FHB A;  4PWA A;  1H32 A;  1GJQ A;  3VMA A;  1C2N A;  2A06 D;  5AUR A;  1CXC A;  2RMZ A;  1KIB A;  2C1D A;  1GIW A;  1HH7 A;  5TJH A;  1YIC A;  1J3S A;  3SXT A;  3FWL A;  2N3B A;  3CX5 W;  1C6R A;  1CRG A;  451C A;  1ZRT D;  3ZOX A;  3SVW A;  1YFC A;  4P4Q B;  2N3Y A;  4EDF A;  1SQV D;  1CYI A;  2JTI B;  1CYC A;  1AOF A;  4FA5 A;  351C A;  1HJ4 A;  3SJL A;  2MHM A;  4EIF A;  1IO3 A;  3L74 D;  4FB1 A;  3WFD C;  1PPJ D;  1NU1 D;  1BGY D;  2BH4 X;  1KX7 A;  1MZ4 A;  4L1Q A;  4EIC A;  1CED A;  4MU8 A;  3CWB D;  5H2F V;  2ZBO A;  3ITK A;  3VNW A;  4WQ9 A;  4EIE A;  5B6Q A;  2YK3 A;  3WFB C;  3TF5 A;  2QG4 A;  3RN0 A;  3OA8 B;  4H0K A;  3A0H V;  3PXT A;  1QYZ A;  1GQ1 A;  1GKS A;  1MG2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...