3H1KD

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 62
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1kD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1kD02
2MTAC 1MG2D 5DJQC 1CRHA 2N9JA 1SQXD 3SXTA 4FB1A 4YE1A 5B5EV 2B11B 1NIRA 2BGVX 2YIUB 3PTZA 3ZBMA 1R0QA 1GQ1A 1N9CA 2YK3A 1FI3A 1OAEA 2AXTV 1GKSA 3O20A 2GB8B 1IRWA 3CXHD 155CA 2ZOOA 2QJKB 1HH7A 1CYIA 2RMZA 1CC5A 3SJLA 1E8EA 1MZ4A 5E79V 1CCRA 1FI9A 3OA8A 1FCDC 1N15A 1CRJA 2JQRA 1CRGA 5KLVD 1LMSA 1IRVA 1VYDA 5KAFV 1IZL0 2ORLA 2B4ZA 1H32A 2CA4B 3NBTA 3PRJA 1DIQC 5KLIB 3WU2V 1I55A 3H1HD 1H33B 1CHIA 2ZXYA 2Q3EA 1YEAA 1SQQD 4XYDB 3RMZA 1W2LA 1L9JC 5CIFB 3PHLA 2L91A 2N18C 3L72D 3JBTB 1NMLA 2CE1A 1YCCA 4AAMA 1RZ5A 2PCCB 4FANA 1I8OA 3VMAA 1HJ4A 3BCCD 1BCCD 2BCNB 1C6OA 3O5CA 3HQ8A 1EB7A 2GC7D 2DVHA 1YNRA 2N9IA 4L1QA 2N3BA 4FA9A 2JWAA 3RLMA 1RAQA 1H1OA 1M6ZA 3PXWA 5DJQB 2FRCA 3VRDA 1M60A 3GW6A 3CWBD 3DMIA 3PXTA 1CXAA 4RSZA 3ZOXA 3CX5W 2BLFB 1CEDA 1CRYA 4WQAA 1K3HA 2O3JA 1KB0A 4MU8A 1F1FA 1DW1A 2C9XB 1IQCA 2QJYB 2K9JB 1YICA 4GEDB 3O0RC 3ZIYA 3NBSA 1SQPD 4PJ0V 2MHMA 4FA4A 2GIWA 3L4OA 1DW2A 3VNWA 1CTYA 2YCCA 1NNOA 1F1CA 1H9XA 1DVVA 3WFEC 1KYOD 1CIFA 1I6EA 2N3YA 1HZVA 1H32B 4WQ8A 3CX5D 3MK7B 3H1KD 1NMIA 1A2SA 3ZOYA 1GDVA 1U75B 1CXCA 1JDLA 2C1VA 3A9FA 3ZOWA 1SQBD 1C2RA 5CIDB 4H0KA 1PP9D 2RN0A 1CYCA 2C1DA 1CYJA 4WQEA 1C2NA 1QYZA 2L4DA 3C2CA 2GC4D 4AX3A 4EIEA 3A0BV 1C6RA 1I5TA 2IBZD 5AURA 1A8CA 2CA3B 3L73D 2D0WA 1N90A 1CO6A 1CRIA 3RN0A 5CIGB 1AOFA 2B0ZB 1AKKA 3OCDA 1CIEA 3TYIA 4UB6V 3CXHW 1HROA 1S5LV 2B12B 1NTMD 5DFSA 3RN1A 4KMGA 4WQ9A 1DW0A 4WQBA 2A06D 2ZZS1 1AOQA 3OA8B 2DGEA 1I6DA 1CSUA 5B66V 1IO3A 5TISV 1J3SA 1RAPA 1A56A 1FOCA 3SVWA 3GG2A 4H0JA 3ORVA 3MK7C 1LS9A 4FA5A 3CYTI 1FI7A 1S6VB 2V08A 4RJTA 1I8PA 1C7MA 4Y5RA 1B7VA 1H31A 4O1QA 1CHJA 3TGUD 1SQVD 3H1JD 1CSXA 2JTIB 1L0ND 3WFDC 4EIDA 3H1ID 1QN2A 1LC2A 1QL4A 1DVHA 3DR0A 1CCHA 4N0KA 1P84D 4GYDA 1RZ6A 1L9BC 4U3FD 1K3GA 3ITKA 1CIGA 1CTZA 1GIWA 3A0HV 4UB8V 1C6SA 2QJPB 4PWAA 1C75A 4WQDA 4LJIA 1NTKD 4Q5PA 1DIIC 1I54A 1CSWA 1CRCA 2LIRA 4PD4D 2V07A 1WEJF 2QG4A 1YFCA 5EXQA 3L4MA 1YEBA 4J20A 1COTA 5GTIV 1DT1A 1KB9D 1ZZHA 1GU2A 1BL9A 2EXVA 3M97X 2C2CA 5TJHA 2ZBOA 1W5CT 3SLEA 1YIQA 4A7PA 2N9YB 3L74D 4FAVA 2CE0A 2FWLA 4EICA 3O1YA 3CU4A 2C1UA 2KNCB 3WFCC 4AANA 1KIBA 2FYUD 3TDKA 4AALA 5KKZB 3VYMA 2Y0CA 1E29A 2PACA 2HV4A 3WUIA 1KV9A 4DY9A 2BPBB 3HQ9A 2ZONG 3ZCFA 2I8FA 2XTSB 3OCDB 1H33A 2FYNB 351CA 1ETPA 3L70D 3X39A 3PLNA 5CIEB 2C1DB 4WQ7A 3PXSA 1NU1D 1HZUA 4FA1A 1YTCA 1CNOA 3HQ6A 4NFGB 3NWVA 5B6QA 1U74B 4K3IA 1LFMA 5C9MA 5IY51 3L71D 3TF5A 3ZOOA 1H9YA 1QL3A 5CIBB 4EIFA 1DW3A 4XXLA 4PW9B 1KX7A 2D0SA 2Y0DA 2VHDA 4P4QB 1HJ3A 4EDFA 5KAIV 1HRCA 3PH2B 1CHHA 3DP5A 5DF5A 1BE3D 1H31B 3FWLA 5CYTR 1CIHA 1EZVD 2LITA 2AI5A 3KZIV 4IL6V 1HJ5A 4V2KA 2C8SA 2PCBB 1GJQA 1C52A 1N50A 5CIHB 1M70A 2BCCD 4L3HA 5C0ZA 1KX2A 5H2FV 1QKSA 1FHBA 5CICB 4L3GA 451CA 1FJ0A 1NTZD 3H1LD 1KYOW 4AAOA 1AYGA 4WQCA 1HCMA 1LC1A 3WC8A 1OCDA 2B10B 2BH4X 2YQBA 1CORA 1CTJA 3SWSA 1E2RA 1L0LD 4D6TD 2N18B 3CP5A 2OZ1A 3KHUA 3L75D 1ZRTD 3HQ7A 1WVEC 2OZ1B 3WFBC 2BH5X 1BGYD 5GTHV 2Y0EA 2CXBA 1MG3D 4O1WA 4JCGA 2AIUA 2KS1A 4QAOA 1CSVA 1PPJD
chains in the Genus database with same CATH superfamily
2WSFH 5DJQC 1CRHA 1DEBA 1SQXD 3SXTA 3V4QA 3L72J 4H44B 3VMXA 1WT6A 1NIRA 2YIUB 1EXJA 3ZBMA 1YQ4C 2M5AB 4UB6H 1Q90D 3BRVB 1N9CA 1IK9A 1KYOH 1BDCA 3CX5E 1GKSA 2GB8B 5AVQB 4RKUJ 1KFNA 3I5CA 1QL1A 1NTKK 1CYIA 3SJLA 2QJKC 1OVVA 1ZR4A 1E8EA 2OYHB 1CCRA 1FI9A 1FCDC 3H1LJ 5KLVD 1IRVA 5BU5A 5AVRB 1SFCB 1IZL0 1LTTC 5AW9B 3AEFC 4D6TG 2KK7A 5AVUB 2H88C 3NMDA 1VQLP 1NU1J 1KYOE 3PRJA 1SQXK 1VQ9P 1SQPG 2H7HA 2JEEA 4IFDK 3EWKA 1BGYE 2E5TA 1A02J 3PHLA 4OVNF 3L72D 3CCJP 2AEFA 1K8AQ 2AXTE 1RZ5A 1NAYA 1JTHB 1HJ4A 3QWOC 5CBNA 2BCNB 2OTLP 1C6OA 4N78D 1KILC 4QMAA 1YHQP 1USDA 1PPJG 1IK7A 3SFDC 1RAQA 3VMZA 4IFMA 4EOTA 4UB8E 4XA4A 3VRDA 4DJGA 1KQLA 1Q2NA 1DEEG 1CXAA 3O8ZA 4RSZA 1GD2E 1X22A 1CEDA 3BCCG 1CZQA 4N78E 2HODA 1VQ6P 1KQSO 4GOEA 5L8RJ 5TISH 2GA1A 2ZVNB 1LTBC 3A0BE 1DW1A 1SQXG 1R5LA 3P8MC 4M3LA 3O0RC 1FS0E 3CCUP 3ZIYA 1SFCD 3NBSA 1SQPD 1T8ZA 2MHMA 1PL5A 1URQA 1LTAC 3G3ZA 1CTYA 2XV5A 1VQ8P 1NNOA 1F1CA 1DVVA 2WPSA 3WFEC 1KYOD 1BE3G 2WSEH 1VQ4P 5APTA 3QH9A 2FYUK 1RE3A 2YNYA 1M7LA 5EFWB 2FY8A 1N7LA 1USEA 1SVFA 5TISE 1SQVG 5KLVG 1AQ5A 1NMIA 1A2SA 5CJ0A 3G4SP 3HUSC 1CXCA 3A9FA 3ZOWA 4WQEA 2R3SA 2GC4D 4NPDA 5AW3B 5GTHH 4EIEA 1C6RA 1I5TA 3A0HE 1X0TA 2M0BA 2CA3B 4RO0A 3CCEP 4H0LB 1LT9B 1KB9H 1RY3A 5AVWB 1LTSC 2K88A 1CO6A 1KQGB 2JWDA 5CCHA 1K04A 4IOIH 2R3CA 3G9RA 5K5GB 3I56P 1AKKA 2KLVA 3OCDA 1LWUA 3TYIA 3H1HE 3CXHW 1L0NJ 1N8RQ 1LT1A 1S5LV 2ZVOB 5DFSA 1DW0A 2ZZS1 3EFFK 1M1KQ 1U7MA 3L71G 3NTNA 5B66V 3MP7B 1IO3A 3OAKA 1IFPA 2WITA 3A0HH 2YXRB 1A56A 4IFFA 1VQOP 3ORVA 1JY2N 3V2QA 2V08A 4RJTA 3RK2D 1ZR2A 3OA7A 4ZKUA 1ZV8A 3L70G 1E79H 3TGUD 5KJ7A 1IFDA 3WFDC 2IZ1A 2B9BA 1HJ0A 3TYYA 3A2AA 1PIXA 1VDFA 4IL6X 3U1CA 1QL4A 2DW3A 2B87B 1P84D 1L9BC 3RK2C 1KB9I 4BWNA 1K3GA 1GIWA 2QJPB 4LJIA 3FWNA 3V2NA 1CW5A 1CRCA 4U3FG 2HFED 2I1KA 1AVOA 2N1TD 3L4MA 2PFXA 1N7SC 1SQVJ 1FE6A 2IBZG 1COTA 2Z4EA 2P10A 1SQPK 2A06G 2EXVA 1FZBA 2W6BA 4BRYB 3L74D 1T6AA 4EICA 2KNCB 1OXZA 4HJGH 3WFCC 2W6AA 5AW7B 2A06E 4AALA 1OZHA 3L71J 2AEJA 1RE4C 4GDOA 4ASVA 3S1KA 2PACA 2HV4A 3HRNA 4DY9A 2BPBB 3RGUA 1K9MQ 3E1IA 3RK2B 3E1RA 1M1JC 2FYNB 3D6YA 2ZYDA 3WU2E 4W80A 1YJ9P 1KFMA 4GT1A 1NO4A 3PXSA 4JBZA 1L0NE 1HZUA 1N7SD 1NOHA 4YPCA 4PV1B 1L0LG 2XZRA 3MTUE 3B5ND 1S5LH 1Y9BA 2OYOA 5B6QA 1X8YA 2HPCB 4I7ZB 3PJSK 1EZVE 1XTCC 1LFMA 5IY51 1NKNA 3M91A 3OJAB 3TF5A 1M1JB 3C9IA 1EDIA 1YTZT 3GF7A 2Q5UA 2E75C 4I6MC 2PP6A 3CMEP 2D0SA 1GDTA 5AVXB 2OGUA 4P4QB 1DD3A 5KAIV 3PH2B 4N6JA 1CIHA 1EZVD 2LITA 3V2RA 3KZIV 2KIKA 1SQXJ 2KYVA 2C8SA 3IN6A 3HE4B 4K35A 1VPCA 3CI9A 4L3HA 5C0ZA 3JCUE 4O9BA 5H2FV 2P58A 1FHBA 1L4AC 1FJ0A 1LP1B 2A45G 2FFDC 4R4MA 3VYIA 1HCMA 3HUSB 1H8AA 1BE3J 3SWSA 2YQBA 1CTJA 4W7YA 4D6TD 2N18B 2B87A 1N73B 1HGVA 2HG5D 3AE9C 1GW3A 3L75D 1ZRTD 4I1LA 5KLVJ 4ZNCA 3SFEC 1HWTC 1FZGA 4JCGA 2KS1A 1EDJA 3PP5A 4QAOA 3L37A 1CSVA 2RH0A 1JM0A 2H8PD 2MTAC 4DOJA 4FB1A 1VL2A 2O01H 1NTZJ 2B11B 4OGQD 3Q5PA 1M56D 1S5LX 1GQ1A 2YK3A 2K37A 1FI3A 4H13B 3A7OA 3CLQA 1BDDA 2J58A 3L35A 1EZVI 2BASA 2J59M 3CCQP 1X9VA 1HH7A 2RMZA 2KSEA 3NFQA 5E79V 1IFJA 1FOSF 1KMIZ 1CRJA 1LT9A 2JQRA 1CRGA 4KT0J 1LMSA 2E5YA 1HH0A 5B66E 3Q3DA 2CA4B 2WSCJ 3AE4C 3AE3C 3WU2V 1NTMJ 1I55A 3H1HD 1DH3A 1YITP 3UIAA 1JOCA 1YEAA 3V2PA 3KYQA 4XYDB 5CIFB 1S9KE 3GF3A 1CSBA 2H43A 3JBTB 1YCCA 2W6JH 2PCCB 4FANA 1YIJP 1QVGO 1EZVG 3EFGA 3BRTB 2C0WA 3BCCD 3ZDMA 2V7QH 3HQ8A 1MFZA 2C9NY 1EB7A 1SQQE 2FXPA 3LIEA 4HKZH 1LWUC 1HUCA 1H1OA 1UIIA 2R5BA 2QSIA 1RF1B 3JCUH 1M60A 1U7JA 4EI2A 3VMYA 1NU1E 5AVVB 1OW6A 2NRGA 1URQC 2FFDA 2W8ZA 1CRYA 3KQGA 2XU6A 3MUDA 3H1HJ 3U59A 1NTKJ 3CXHI 1EXIA 2B89A 1N86A 2WSSH 2WVRA 1DIPA 1YICA 4GEDB 3CWBE 1VQPP 4PJ0V 2QIWA 3AECC 3L4OA 1AFOA 2FXMA 1W2BO 3F89A 2P67A 1I6EA 2N3YA 1YYCA 3CMAP 1HZVA 1H32B 3CX5H 4RESB 2FYUG 5KLVK 4WQ8A 3LW5H 1JO5A 1HJBA 3H1KD 1NU1G 4LLHA 1HF9A 1SQVK 4U3FE 1GW4A 2HODB 5KAFH 2C1VA 3N4XA 1SQBD 3M0AA 5CIDB 5KJ7D 4H0KA 4EIJA 3C2CA 1SQPJ 2FYUE 5KAIH 3IFMA 3VTPC 4AX3A 4OGQC 1PFIA 3A0BV 2IBZD 1URQD 1L0LK 1FZEA 3L73D 2D0WA 3HE5A 1FU1A 4MN4C 3H1KE 3IAOA 1ZXGA 2Q7CA 2LXCB 1AOFA 1RHZB 2WSEJ 1TU3F 4C46A 5KTBA 1CIEA 1FOSE 2MKVA 4EYYQ 4JPZB 1JUNA 1IFIA 1HROA 1GU4A 4WVZA 5KAFE 4WQ9A 2A06D 1I6DA 3H1IE 3M9BA 3AEEC 4PV1D 2CPSA 3B8EB 2OYHA 1MZ9A 4U3FJ 4H0JA 5AW0B 3USSA 2YKQA 3BCCJ 1VQ5P 1S6VB 4Y5RA 2I8DA 1NYHA 1ZOYC 1CHJA 1LNQA 1NH4A 1WRGA 2ZT9B 4GOFA 2XNXA 2ZXXA 4EIDA 3TNUA 1QEXA 2P2UA 1DD4A 4YXWH 2JP3A 3DR0A 4U7JA 3BASA 5APUA 2FXOA 2E75D 4C7RA 4DCKA 1P84E 2K9JA 3ITKA 1CIGA 5AW2B 4UB8V 2OYIC 3WMM0 4PWAA 3A3YB 2R32A 4H44D 1NTKD 1ZP0C 1CSWA 3AEGC 2V07A 3L4FA 3TGUE 1SQVE 2E74C 3V5BA 2YKOA 3FXEA 4Z1MH 3H1IJ 3D71A 2Q9IA 2Y9ZA 3RK3E 1W5CE 5KLIC 1GU5A 1P84I 1BSNA 1KB9D 3M97X 5TJHA 3AE2C 3VOPA 1S4XA 2ZBOA 3W67A 1NTZE 3IR9A 3O1YA 3JC22 1LT9C 2C1UA 5C39A 1FBMA 1KIBA 2YO2A 3GMAA 1KV9A 1OWAA 1L0NK 3ZCFA 4TT3H 1Q7YQ 2XTSB 1H33A 5M1BA 2NPSB 2C9LY 3P8CD 1RQUA 2HLOA 3L74J 1NU1D 2FYZA 1YJNP 1RH5B 5E79H 1FZAA 1CNOA 2N1TC 2KSJA 4Y28J 3SWYA 2YXQB 1OW7A 1VF5C 3NWVA 1GL2A 1UIXA 5C9MA 2ZFCA 1W2EA 1H9YA 5CIBB 1P84H 3Q5RA 2LXBA 5AVZB 4XXLA 2CPBA 2BEZF 3V6IA 3O6QA 1M90Q 3TK1A 2Y0DA 1YJWP 1HJ3A 2GUSA 5GTHE 2D2CB 1HTLC 1T2KC 1BE3D 2LR2A 3H1JJ 2ITAA 3AE5C 2AI5A 1VQ7P 3H1IG 1KB9E 4IL6V 2WPVB 1IFMA 1JMMA 1OVUA 1NTMK 3L74E 2PCBB 1GJQA 1H0TB 1KILD 1M70A 1J1DB 2H89C 1J2JB 1QKSA 4I2LC 5BVZA 2O01N 4ZMDA 2LKMA 3RBXA 1KYOW 2Q3IA 1AYGA 1NGMB 3HD7C 3WC8A 1L0LE 1J1DC 5B5EE 1CORA 2YKPA 2OZ1A 3KHUA 1OX3A 2IYPA 3WFBC 2QE7H 5CBOA 1NU1K 1M1JA 1GK6A 5H2FE 1MG3D 4O1WA 2AIUA 4JYBA 4JYCA 1MG2D 1CI6B 1L4AA 1J1EC 3ABVC 2OTKE 3B5NA 4YE1A 1VQKP 1AQTA 5B66H 5CCGC 1OIPA 1R0QA 1OMIA 4GKGA 4L73A 2AXTV 3O20A 3CXHD 2ZOOA 1IFNA 5APSA 2QJKB 2Q1KA 1L2PA 5DJTB 3L74G 1CC5A 5KKZC 3AE1C 1MZ4A 4YTPC 3OA8A 3L75J 1H89A 2Q6QA 1KTMA 3KDPB 1VYDA 5KAFV 3R2PA 4GODA 4DZOA 4WWIA 3H32A 4OH8B 2L5GB 1JB0J 2KOGA 3HTKB 1OFCX 1H32A 3AE7C 2MJZA 4BRYA 3NBTA 4W7ZA 1YQ3C 2IZ0A 3CL3D 5AW5B 1KC8Q 1PGOA 3VP8A 1H33B 2JO1A 2ZXYA 1SQQD 4N3YB 1W2LA 1SQQG 1N73C 2L91A 2N18C 4H13D 1YBKA 3H1HG 2ZAEB 1FDMA 4Y99B 1I8OA 3VMAA 2QM7A 4DT0A 2OYIB 2QVAA 3SWFA 1HVVA 5APQA 1RF0A 4PJ0E 3T97B 1BCCD 5AVSB 1EDLA 3MGNA 4WY4C 1Q82Q 1FDOA 3GHGA 2V4HA 2YIUC 1OW8A 1LTJB 3R4YA 2BCCG 1M6ZA 3PXWA 5DJQB 3KXDA 1KQFB 5APYA 2ZT9C 4TLFA 1Q81Q 2D2CD 4LGDE 2SPZA 3CWBD 3DMIA 2WWWA 3FGAD 3H1KJ 2OYHC 3KZIE 2R5DA 2RKLA 2O3JA 1KB0A 1KORA 1AVYA 4AYCA 2HYNA 1NTZG 1F1FA 4KHXA 2C9XB 1KILB 4LC1A 2NPSD 2A45I 2K9JB 1JNMA 4I7ZC 1L4AD 3T97A 3L75G 1DW2A 2CK3H 3M0DA 1IJDB 4KJMA 3AE6C 2PAJA 1Y8AA 1GK4A 3BCCE 2E76C 3CXHH 1FZCA 3KPEA 2KZIA 3L36A 1N2DC 2AEMA 2KB7P 1LTJC 3ZOYA 2OYIA 1T2KD 1GDVA 2O1KA 1N7SB 4WY4B 1JDLA 4PD4H 1C2RA 1PP9D 2RN0A 1CYCA 1CYJA 3TSIA 1AA0A 2E74B 3B5NB 3D6ZA 2QA4P 2QJPC 1N90A 2J5UA 1CRIA 2K3RA 2BEQD 1VQMP 3VP9A 2B0ZB 3LW5J 3CC4P 2M3EA 4UB6V 2B12B 2OARA 4WQBA 1AOQA 4WBAA 3OA8B 1K05A 1CSUA 4OGQB 4JF7A 1Q86Q 4JQ0D 2FKWB 3M9QA 4IL6H 1NJIQ 3KZIH 1FOCA 3SVWA 2KZJA 3GG2A 1RF0C 4NPEA 1KN7A 3S9OA 1GTWA 2E43A 4FA5A 3CYTI 1FI7A 1I8PA 1URQB 1B7VA 1PGPA 5GTIE 4O1QA 2Y9YA 4B86A 3AEBC 3H1KG 1KD1Q 1CSXA 4ZKPA 1G2CB 3FX0A 3LIDA 3H1ID 1QN2A 2IDBA 4UB6E 4YXDC 2PGDA 1DVHA 3H25A 4GYDA 1RZ6A 5AVYB 5CJ4A 4U3FD 3GHGB 5AW1B 4WQDA 2JJLA 2E74D 1DIIC 2VRSA 2YMYA 1L0LJ 1LTGC 1YFCA 5AW6B 1D7MA 3MUDC 1EQ7A 4J20A 5GTIV 1EDKA 5APWA 1RE3C 1ZRTE 3CWBG 1DT1A 3W68A 1GU2A 1BL9A 1LTIC 2C2CA 1LTJA 1W5CT 3SLEA 1IO4A 2M5AA 1X79B 2N9YB 4WB4A 4ASWA 2CE0A 2FWLA 3S4RA 5E79E 2NZ2A 2AXCA 3TDKA 1XTGB 5KKZB 3VYMA 2A45H 1E29A 1FJPA 3P7KA 1ZLLA 3WUIA 2ZONG 2QM8A 1Y47A 1LGHB 3OCDB 3L70D 3X39A 3GLMA 4WQ7A 5AVTB 3G71P 1YTCA 2XNDH 3CD6P 3HQ6A 4HYTB 1FZCB 1U74B 3RK3D 4H0LC 2E42A 2YMKA 2WPRA 2NPSC 3L70E 3N7NA 1PGQA 4EIFA 1DW3A 1S9KD 2BCCJ 3HTKA 4PW9B 2QRXA 1CI6A 1L4AB 3M06A 4H44C 4PD4I 2VHDA 5CMZA 1DX7A 3BVHA 5KJ7C 5CCGD 3RL0g 1HRCA 1BCCG 5B5EH 3B71A 1LP1A 3DP5A 5DF5A 1S2EA 1H31B 3HD7A 3FWLA 5CYTR 1GL2C 3L71E 1U57A 3II6A 2IYOA 1HJ5A 2R44A 2W90A 2B88A 5AW8B 1C52A 2WSFJ 1KYOI 1KX2A 2IBZI 2AXTH 1H88A 2IFMA 5KAIE 4L3GA 4AAOA 1G2CA 2K9YA 4XE5B 5CCGA 1LC1A 2XDJA 2BH4X 3O6QB 1L0LD 3CP5A 2YO3A 3A0BH 3HQ7A 3G6EP 2N1TB 1IZNB 1BGYD 3TNUB 2ZYAA 1ZW0A 2CXBA 4PV1C 1BSHA 5KLVE 3L72E 1PPJD 1KILE 1T3UA 2N9JA 1PPJE 1WMKA 3E7KA 5B5EV 2BGVX 2FYNC 3PTZA 3MIWA 2QJYC 2KI7B 3L73G 3VN0A 3P32A 1QL2A 3MHVA 3C8VA 1SQQJ 1R5SA 1QGKB 2XKMA 1OAEA 3AEDC 1A02F 4AUWA 1IRWA 155CA 3L75E 2GM4A 2OQQA 2WZ7A 1SQXE 2W83C 1BGYG 1KZUB 2JDIH 1N15A 2E76D 3B5NC 4R4LA 1SS1A 3WUTA 2ORLA 3Q5SA 3L73E 3M0DC 1BCCJ 3RL0C 1M8OB 1S1CX 2IX7C 2B4ZA 2M3BA 1SLQA 3RL0B 1PGJA 1DIQC 1KILA 5KLIB 3CC2P 1BCCE 4XFJA 4AQRD 1LJ2A 3L72G 1AV1A 1CHIA 2Q3EA 2WT7B 1QVFO 2WPQA 3RMZA 1L9JC 2O01J 3OW2O 5APXA 3EQ2A 2BCCE 1SQQK 3HD7D 2G8YA 3CCSP 1NHLA 1NMLA 2CE1A 4AAMA 5BU8B 1QX8A 2N1TA 3A5TA 4L76A 1ZN5A 2E75B 1OVRA 1L0NG 3O5CA 2ZT9D 1JY3P 5CCHC 3H1LG 2GC7D 2DVHA 2Z5HA 1YNRA 2N9IA 1S3JA 4L1QA 2N3BA 4FA9A 2JWAA 2C0XA 3RLMA 1SQBE 1JY3N 2IFNA 3I55P 1SQPE 3WUUA 1AJYA 2FRCA 1N73A 1RF1A 1SQBJ 3GW6A 3PXTA 2QEXP 3ZOXA 3CX5W 2BLFB 1JY3O 4WQAA 1K3HA 3CXHE 3L73J 4MU8A 2KXPB 1IQCA 1NTMG 2M8RA 2QJYB 1NTKE 4C7NA 2GUVA 1BGYJ 4FA4A 1J1EB 2IBZE 3F5HA 2GIWA 2IPPA 3CWBJ 3VNWA 2YCCA 1JTHA 2V7QJ 1MV8A 1H9XA 1MFTA 1JMBA 1S5LE 1KV4A 3CCLP 3SSUA 3V4WA 1CIFA 3IF4A 3M9HA 4K3AA 3CX5D 3MK7B 1Z56A 1SQBK 1LWUB 1U75B 2C1DA 1C2NA 1NKZB 3SWKA 3B4SA 1QYZA 2L4DA 3FXDA 1IC2A 4Y99C 3H1LE 5AURA 1A8CA 1S72P 2W27A 3CCRP 2PRRA 1FC2C 1FZCC 1G1IA 2FBWC 4WY4A 3RN0A 5CIGB 1FAVA 2WQYC 1NTKG 1NAFA 5H2FH 1NTME 3K5BA 2D2CC 1M57D 1NTMD 3TGUJ 3MZWB 3RN1A 4KMGA 1PP9J 2DGEA 2UWJE 3U1AA 2JKVA 1E5WA 5TISV 1J3SA 2KLUA 2WTYA 1FJKA 1RAPA 4WY4D 3D70A 3MK7C 1LS9A 1C7MA 1SQBG 1NWQA 4L74A 1H31A 3HD7B 4H13C 2JR8A 1SQVD 3H1JD 1EC5A 1RF1C 1HBWA 3H1JE 2JTIB 1L0ND 1JCDA 1LC2A 2FYUJ 2WSCH 2KS1B 2Z5IA 1CCHA 4N0KA 2OTJP 3RBZA 2ZYGA 1CTZA 3A0HV 1C6SA 1GL2B 3P8CE 1PP9E 1C75A 3HUSA 3CCMP 4PD4E 4Q5PA 1I54A 1MUUA 2POHA 2LIRA 1SFCA 4PD4D 1WEJF 5APVA 4CPGA 2QG4A 4BXLA 1BE3E 3PH0A 2FFDB 5DJUB 1GMJA 5EXQA 3CPWO 4NPFX 1YEBA 3L70J 4PJ0H 2HPCA 3H1JG 1ZZHA 2K1AA 1VF5B 3AEAC 3HE5B 1YIQA 2ZXEB 4A7PA 3CCVP 4FAVA 1R8EA 2N9BA 3CU4A 1FZFA 4AANA 2FYUD 2WT7A 2KP8A 1QLED 1VQNP 2Y0CA 3D0WA 5CCHD 1N7SA 3HQ9A 2O1JA 1GZLA 3CC7P 1NTZK 1YI2P 1JY2P 2I8FA 2I1JA 2NPSA 4HH2A 3TGUG 1NVOA 1G1JA 1PP9G 351CA 1RQVA 1ETPA 1SP4A 3PLNA 5CIEB 3AE8C 2E76B 2C1DB 4FA1A 4L75A 3H32B 1RE4A 5CHXA 2WMMA 4NFGB 1JCCA 3RL0D 4OWFA 4K3IA 1K73Q 1GL2D 3L71D 3NXSA 3ZOOA 1QL3A 3WU2H 1KX7A 4HB1A 5GTIH 3RK3C 2P7JA 1PV3A 1JEKA 4D6TJ 1YTZI 3WUVA 1PZQA 4EDFA 3MD0A 1MKMA 1CHHA 1JY2O 4D6TE 3Q1MA 3HE4A 4C7NB 2KUBA 5AW4B 4H0LD 3H6PA 3GHGC 1VF5D 2P1JA 4V2KA 1ZMEC 3JSVC 2G3AA 1N50A 5CIHB 2BCCD 3BATA 5CICB 3RK3B 451CA 3Q2YA 3C1LA 2KNCA 1NTZD 1SFCC 3H1LD 1HGZA 4WQCA 1FDIA 1OCDA 2B10B 4IL6E 1E2RA 3CX5I 4GIFA 1WVEC 2OZ1B 1H0TA 2BH5X 2HR3A 5GTHV 2Y0EA 2ZJSE 4UB8H 1T3JA
chains in the Genus database with same CATH topology
2MTAC 1MG2D 5DJQC 1CRHA 2N9JA 1SQXD 3SXTA 4FB1A 4YE1A 5B5EV 2B11B 1NIRA 2BGVX 2YIUB 3PTZA 3ZBMA 1R0QA 1GQ1A 1N9CA 2YK3A 1FI3A 1OAEA 2AXTV 1GKSA 3O20A 2GB8B 1IRWA 3CXHD 155CA 2ZOOA 2QJKB 1HH7A 1CYIA 2RMZA 1CC5A 3SJLA 1E8EA 1MZ4A 5E79V 1CCRA 1FI9A 3OA8A 1FCDC 1N15A 1CRJA 2JQRA 1CRGA 5KLVD 1LMSA 1IRVA 1VYDA 5KAFV 1IZL0 2ORLA 2B4ZA 1H32A 2CA4B 3NBTA 3PRJA 1DIQC 5KLIB 3WU2V 1I55A 3H1HD 1H33B 1CHIA 2ZXYA 2Q3EA 1YEAA 1SQQD 4XYDB 3RMZA 1W2LA 1L9JC 5CIFB 3PHLA 2L91A 2N18C 3L72D 3JBTB 1NMLA 2CE1A 1YCCA 4AAMA 1RZ5A 2PCCB 4FANA 1I8OA 3VMAA 1HJ4A 3BCCD 1BCCD 2BCNB 1C6OA 3O5CA 3HQ8A 1EB7A 2GC7D 2DVHA 1YNRA 2N9IA 4L1QA 2N3BA 4FA9A 2JWAA 3RLMA 1RAQA 1H1OA 1M6ZA 3PXWA 5DJQB 2FRCA 3VRDA 1M60A 3GW6A 3CWBD 3DMIA 3PXTA 1CXAA 4RSZA 3ZOXA 3CX5W 2BLFB 1CEDA 1CRYA 4WQAA 1K3HA 2O3JA 1KB0A 4MU8A 1F1FA 1DW1A 2C9XB 1IQCA 2QJYB 2K9JB 1YICA 4GEDB 3O0RC 3ZIYA 3NBSA 1SQPD 4PJ0V 2MHMA 4FA4A 2GIWA 3L4OA 1DW2A 3VNWA 1CTYA 2YCCA 1NNOA 1F1CA 1H9XA 1DVVA 3WFEC 1KYOD 1CIFA 1I6EA 2N3YA 1HZVA 1H32B 4WQ8A 3CX5D 3MK7B 3H1KD 1NMIA 1A2SA 3ZOYA 1GDVA 1U75B 1CXCA 1JDLA 2C1VA 3A9FA 3ZOWA 1SQBD 1C2RA 5CIDB 4H0KA 1PP9D 2RN0A 1CYCA 2C1DA 1CYJA 4WQEA 1C2NA 1QYZA 2L4DA 3C2CA 2GC4D 4AX3A 4EIEA 3A0BV 1C6RA 1I5TA 2IBZD 5AURA 1A8CA 2CA3B 3L73D 2D0WA 1N90A 1CO6A 1CRIA 3RN0A 5CIGB 1AOFA 2B0ZB 1AKKA 3OCDA 1CIEA 3TYIA 4UB6V 3CXHW 1HROA 1S5LV 2B12B 1NTMD 5DFSA 3RN1A 4KMGA 4WQ9A 1DW0A 4WQBA 2A06D 2ZZS1 1AOQA 3OA8B 2DGEA 1I6DA 1CSUA 5B66V 1IO3A 5TISV 1J3SA 1RAPA 1A56A 1FOCA 3SVWA 3GG2A 4H0JA 3ORVA 3MK7C 1LS9A 4FA5A 3CYTI 1FI7A 1S6VB 2V08A 4RJTA 1I8PA 1C7MA 4Y5RA 1B7VA 1H31A 4O1QA 1CHJA 3TGUD 1SQVD 3H1JD 1CSXA 2JTIB 1L0ND 3WFDC 4EIDA 3H1ID 1QN2A 1LC2A 1QL4A 1DVHA 3DR0A 1CCHA 4N0KA 1P84D 4GYDA 1RZ6A 1L9BC 4U3FD 1K3GA 3ITKA 1CIGA 1CTZA 1GIWA 3A0HV 4UB8V 1C6SA 2QJPB 4PWAA 1C75A 4WQDA 4LJIA 1NTKD 4Q5PA 1DIIC 1I54A 1CSWA 1CRCA 2LIRA 4PD4D 2V07A 1WEJF 2QG4A 1YFCA 5EXQA 3L4MA 1YEBA 4J20A 1COTA 5GTIV 1DT1A 1KB9D 1ZZHA 1GU2A 1BL9A 2EXVA 3M97X 2C2CA 5TJHA 2ZBOA 1W5CT 3SLEA 1YIQA 4A7PA 2N9YB 3L74D 4FAVA 2CE0A 2FWLA 4EICA 3O1YA 3CU4A 2C1UA 2KNCB 3WFCC 4AANA 1KIBA 2FYUD 3TDKA 4AALA 5KKZB 3VYMA 2Y0CA 1E29A 2PACA 2HV4A 3WUIA 1KV9A 4DY9A 2BPBB 3HQ9A 2ZONG 3ZCFA 2I8FA 2XTSB 3OCDB 1H33A 2FYNB 351CA 1ETPA 3L70D 3X39A 3PLNA 5CIEB 2C1DB 4WQ7A 3PXSA 1NU1D 1HZUA 4FA1A 1YTCA 1CNOA 3HQ6A 4NFGB 3NWVA 5B6QA 1U74B 4K3IA 1LFMA 5C9MA 5IY51 3L71D 3TF5A 3ZOOA 1H9YA 1QL3A 5CIBB 4EIFA 1DW3A 4XXLA 4PW9B 1KX7A 2D0SA 2Y0DA 2VHDA 4P4QB 1HJ3A 4EDFA 5KAIV 1HRCA 3PH2B 1CHHA 3DP5A 5DF5A 1BE3D 1H31B 3FWLA 5CYTR 1CIHA 1EZVD 2LITA 2AI5A 3KZIV 4IL6V 1HJ5A 4V2KA 2C8SA 2PCBB 1GJQA 1C52A 1N50A 5CIHB 1M70A 2BCCD 4L3HA 5C0ZA 1KX2A 5H2FV 1QKSA 1FHBA 5CICB 4L3GA 451CA 1FJ0A 1NTZD 3H1LD 1KYOW 4AAOA 1AYGA 4WQCA 1HCMA 1LC1A 3WC8A 1OCDA 2B10B 2BH4X 2YQBA 1CORA 1CTJA 3SWSA 1E2RA 1L0LD 4D6TD 2N18B 3CP5A 2OZ1A 3KHUA 3L75D 1ZRTD 3HQ7A 1WVEC 2OZ1B 3WFBC 2BH5X 1BGYD 5GTHV 2Y0EA 2CXBA 1MG3D 4O1WA 4JCGA 2AIUA 2KS1A 4QAOA 1CSVA 1PPJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTA C;  1MG2 D;  5DJQ C;  1CRH A;  2N9J A;  1SQX D;  3SXT A;  4FB1 A;  4YE1 A;  5B5E V;  2B11 B;  1NIR A;  2BGV X;  2YIU B;  3PTZ A;  3ZBM A;  1R0Q A;  1GQ1 A;  1N9C A;  2YK3 A;  1FI3 A;  1OAE A;  2AXT V;  1GKS A;  3O20 A;  2GB8 B;  1IRW A;  3CXH D;  155C A;  2ZOO A;  2QJK B;  1HH7 A;  1CYI A;  2RMZ A;  1CC5 A;  3SJL A;  1E8E A;  1MZ4 A;  5E79 V;  1CCR A;  1FI9 A;  3OA8 A;  1FCD C;  1N15 A;  1CRJ A;  2JQR A;  1CRG A;  5KLV D;  1LMS A;  1IRV A;  1VYD A;  5KAF V;  1IZL 0;  2ORL A;  2B4Z A;  1H32 A;  2CA4 B;  3NBT A;  3PRJ A;  1DIQ C;  5KLI B;  3WU2 V;  1I55 A;  3H1H D;  1H33 B;  1CHI A;  2ZXY A;  2Q3E A;  1YEA A;  1SQQ D;  4XYD B;  3RMZ A;  1W2L A;  1L9J C;  5CIF B;  3PHL A;  2L91 A;  2N18 C;  3L72 D;  3JBT B;  1NML A;  2CE1 A;  1YCC A;  4AAM A;  1RZ5 A;  2PCC B;  4FAN A;  1I8O A;  3VMA A;  1HJ4 A;  3BCC D;  1BCC D;  2BCN B;  1C6O A;  3O5C A;  3HQ8 A;  1EB7 A;  2GC7 D;  2DVH A;  1YNR A;  2N9I A;  4L1Q A;  2N3B A;  4FA9 A;  2JWA A;  3RLM A;  1RAQ A;  1H1O A;  1M6Z A;  3PXW A;  5DJQ B;  2FRC A;  3VRD A;  1M60 A;  3GW6 A;  3CWB D;  3DMI A;  3PXT A;  1CXA A;  4RSZ A;  3ZOX A;  3CX5 W;  2BLF B;  1CED A;  1CRY A;  4WQA A;  1K3H A;  2O3J A;  1KB0 A;  4MU8 A;  1F1F A;  1DW1 A;  2C9X B;  1IQC A;  2QJY B;  2K9J B;  1YIC A;  4GED B;  3O0R C;  3ZIY A;  3NBS A;  1SQP D;  4PJ0 V;  2MHM A;  4FA4 A;  2GIW A;  3L4O A;  1DW2 A;  3VNW A;  1CTY A;  2YCC A;  1NNO A;  1F1C A;  1H9X A;  1DVV A;  3WFE C;  1KYO D;  1CIF A;  1I6E A;  2N3Y A;  1HZV A;  1H32 B;  4WQ8 A;  3CX5 D;  3MK7 B;  3H1K D;  1NMI A;  1A2S A;  3ZOY A;  1GDV A;  1U75 B;  1CXC A;  1JDL A;  2C1V A;  3A9F A;  3ZOW A;  1SQB D;  1C2R A;  5CID B;  4H0K A;  1PP9 D;  2RN0 A;  1CYC A;  2C1D A;  1CYJ A;  4WQE A;  1C2N A;  1QYZ A;  2L4D A;  3C2C A;  2GC4 D;  4AX3 A;  4EIE A;  3A0B V;  1C6R A;  1I5T A;  2IBZ D;  5AUR A;  1A8C A;  2CA3 B;  3L73 D;  2D0W A;  1N90 A;  1CO6 A;  1CRI A;  3RN0 A;  5CIG B;  1AOF A;  2B0Z B;  1AKK A;  3OCD A;  1CIE A;  3TYI A;  4UB6 V;  3CXH W;  1HRO A;  1S5L V;  2B12 B;  1NTM D;  5DFS A;  3RN1 A;  4KMG A;  4WQ9 A;  1DW0 A;  4WQB A;  2A06 D;  2ZZS 1;  1AOQ A;  3OA8 B;  2DGE A;  1I6D A;  1CSU A;  5B66 V;  1IO3 A;  5TIS V;  1J3S A;  1RAP A;  1A56 A;  1FOC A;  3SVW A;  3GG2 A;  4H0J A;  3ORV A;  3MK7 C;  1LS9 A;  4FA5 A;  3CYT I;  1FI7 A;  1S6V B;  2V08 A;  4RJT A;  1I8P A;  1C7M A;  4Y5R A;  1B7V A;  1H31 A;  4O1Q A;  1CHJ A;  3TGU D;  1SQV D;  3H1J D;  1CSX A;  2JTI B;  1L0N D;  3WFD C;  4EID A;  3H1I D;  1QN2 A;  1LC2 A;  1QL4 A;  1DVH A;  3DR0 A;  1CCH A;  4N0K A;  1P84 D;  4GYD A;  1RZ6 A;  1L9B C;  4U3F D;  1K3G A;  3ITK A;  1CIG A;  1CTZ A;  1GIW A;  3A0H V;  4UB8 V;  1C6S A;  2QJP B;  4PWA A;  1C75 A;  4WQD A;  4LJI A;  1NTK D;  4Q5P A;  1DII C;  1I54 A;  1CSW A;  1CRC A;  2LIR A;  4PD4 D;  2V07 A;  1WEJ F;  2QG4 A;  1YFC A;  5EXQ A;  3L4M A;  1YEB A;  4J20 A;  1COT A;  5GTI V;  1DT1 A;  1KB9 D;  1ZZH A;  1GU2 A;  1BL9 A;  2EXV A;  3M97 X;  2C2C A;  5TJH A;  2ZBO A;  1W5C T;  3SLE A;  1YIQ A;  4A7P A;  2N9Y B;  3L74 D;  4FAV A;  2CE0 A;  2FWL A;  4EIC A;  3O1Y A;  3CU4 A;  2C1U A;  2KNC B;  3WFC C;  4AAN A;  1KIB A;  2FYU D;  3TDK A;  4AAL A;  5KKZ B;  3VYM A;  2Y0C A;  1E29 A;  2PAC A;  2HV4 A;  3WUI A;  1KV9 A;  4DY9 A;  2BPB B;  3HQ9 A;  2ZON G;  3ZCF A;  2I8F A;  2XTS B;  3OCD B;  1H33 A;  2FYN B;  351C A;  1ETP A;  3L70 D;  3X39 A;  3PLN A;  5CIE B;  2C1D B;  4WQ7 A;  3PXS A;  1NU1 D;  1HZU A;  4FA1 A;  1YTC A;  1CNO A;  3HQ6 A;  4NFG B;  3NWV A;  5B6Q A;  1U74 B;  4K3I A;  1LFM A;  5C9M A;  5IY5 1;  3L71 D;  3TF5 A;  3ZOO A;  1H9Y A;  1QL3 A;  5CIB B;  4EIF A;  1DW3 A;  4XXL A;  4PW9 B;  1KX7 A;  2D0S A;  2Y0D A;  2VHD A;  4P4Q B;  1HJ3 A;  4EDF A;  5KAI V;  1HRC A;  3PH2 B;  1CHH A;  3DP5 A;  5DF5 A;  1BE3 D;  1H31 B;  3FWL A;  5CYT R;  1CIH A;  1EZV D;  2LIT A;  2AI5 A;  3KZI V;  4IL6 V;  1HJ5 A;  4V2K A;  2C8S A;  2PCB B;  1GJQ A;  1C52 A;  1N50 A;  5CIH B;  1M70 A;  2BCC D;  4L3H A;  5C0Z A;  1KX2 A;  5H2F V;  1QKS A;  1FHB A;  5CIC B;  4L3G A;  451C A;  1FJ0 A;  1NTZ D;  3H1L D;  1KYO W;  4AAO A;  1AYG A;  4WQC A;  1HCM A;  1LC1 A;  3WC8 A;  1OCD A;  2B10 B;  2BH4 X;  2YQB A;  1COR A;  1CTJ A;  3SWS A;  1E2R A;  1L0L D;  4D6T D;  2N18 B;  3CP5 A;  2OZ1 A;  3KHU A;  3L75 D;  1ZRT D;  3HQ7 A;  1WVE C;  2OZ1 B;  3WFB C;  2BH5 X;  1BGY D;  5GTH V;  2Y0E A;  2CXB A;  1MG3 D;  4O1W A;  4JCG A;  2AIU A;  2KS1 A;  4QAO A;  1CSV A;  1PPJ D; 
#chains in the Genus database with same CATH topology
 2WSF H;  5DJQ C;  1CRH A;  1DEB A;  1SQX D;  3SXT A;  3V4Q A;  3L72 J;  4H44 B;  3VMX A;  1WT6 A;  1NIR A;  2YIU B;  1EXJ A;  3ZBM A;  1YQ4 C;  2M5A B;  4UB6 H;  1Q90 D;  3BRV B;  1N9C A;  1IK9 A;  1KYO H;  1BDC A;  3CX5 E;  1GKS A;  2GB8 B;  5AVQ B;  4RKU J;  1KFN A;  3I5C A;  1QL1 A;  1NTK K;  1CYI A;  3SJL A;  2QJK C;  1OVV A;  1ZR4 A;  1E8E A;  2OYH B;  1CCR A;  1FI9 A;  1FCD C;  3H1L J;  5KLV D;  1IRV A;  5BU5 A;  5AVR B;  1SFC B;  1IZL 0;  1LTT C;  5AW9 B;  3AEF C;  4D6T G;  2KK7 A;  5AVU B;  2H88 C;  3NMD A;  1VQL P;  1NU1 J;  1KYO E;  3PRJ A;  1SQX K;  1VQ9 P;  1SQP G;  2H7H A;  2JEE A;  4IFD K;  3EWK A;  1BGY E;  2E5T A;  1A02 J;  3PHL A;  4OVN F;  3L72 D;  3CCJ P;  2AEF A;  1K8A Q;  2AXT E;  1RZ5 A;  1NAY A;  1JTH B;  1HJ4 A;  3QWO C;  5CBN A;  2BCN B;  2OTL P;  1C6O A;  4N78 D;  1KIL C;  4QMA A;  1YHQ P;  1USD A;  1PPJ G;  1IK7 A;  3SFD C;  1RAQ A;  3VMZ A;  4IFM A;  4EOT A;  4UB8 E;  4XA4 A;  3VRD A;  4DJG A;  1KQL A;  1Q2N A;  1DEE G;  1CXA A;  3O8Z A;  4RSZ A;  1GD2 E;  1X22 A;  1CED A;  3BCC G;  1CZQ A;  4N78 E;  2HOD A;  1VQ6 P;  1KQS O;  4GOE A;  5L8R J;  5TIS H;  2GA1 A;  2ZVN B;  1LTB C;  3A0B E;  1DW1 A;  1SQX G;  1R5L A;  3P8M C;  4M3L A;  3O0R C;  1FS0 E;  3CCU P;  3ZIY A;  1SFC D;  3NBS A;  1SQP D;  1T8Z A;  2MHM A;  1PL5 A;  1URQ A;  1LTA C;  3G3Z A;  1CTY A;  2XV5 A;  1VQ8 P;  1NNO A;  1F1C A;  1DVV A;  2WPS A;  3WFE C;  1KYO D;  1BE3 G;  2WSE H;  1VQ4 P;  5APT A;  3QH9 A;  2FYU K;  1RE3 A;  2YNY A;  1M7L A;  5EFW B;  2FY8 A;  1N7L A;  1USE A;  1SVF A;  5TIS E;  1SQV G;  5KLV G;  1AQ5 A;  1NMI A;  1A2S A;  5CJ0 A;  3G4S P;  3HUS C;  1CXC A;  3A9F A;  3ZOW A;  4WQE A;  2R3S A;  2GC4 D;  4NPD A;  5AW3 B;  5GTH H;  4EIE A;  1C6R A;  1I5T A;  3A0H E;  1X0T A;  2M0B A;  2CA3 B;  4RO0 A;  3CCE P;  4H0L B;  1LT9 B;  1KB9 H;  1RY3 A;  5AVW B;  1LTS C;  2K88 A;  1CO6 A;  1KQG B;  2JWD A;  5CCH A;  1K04 A;  4IOI H;  2R3C A;  3G9R A;  5K5G B;  3I56 P;  1AKK A;  2KLV A;  3OCD A;  1LWU A;  3TYI A;  3H1H E;  3CXH W;  1L0N J;  1N8R Q;  1LT1 A;  1S5L V;  2ZVO B;  5DFS A;  1DW0 A;  2ZZS 1;  3EFF K;  1M1K Q;  1U7M A;  3L71 G;  3NTN A;  5B66 V;  3MP7 B;  1IO3 A;  3OAK A;  1IFP A;  2WIT A;  3A0H H;  2YXR B;  1A56 A;  4IFF A;  1VQO P;  3ORV A;  1JY2 N;  3V2Q A;  2V08 A;  4RJT A;  3RK2 D;  1ZR2 A;  3OA7 A;  4ZKU A;  1ZV8 A;  3L70 G;  1E79 H;  3TGU D;  5KJ7 A;  1IFD A;  3WFD C;  2IZ1 A;  2B9B A;  1HJ0 A;  3TYY A;  3A2A A;  1PIX A;  1VDF A;  4IL6 X;  3U1C A;  1QL4 A;  2DW3 A;  2B87 B;  1P84 D;  1L9B C;  3RK2 C;  1KB9 I;  4BWN A;  1K3G A;  1GIW A;  2QJP B;  4LJI A;  3FWN A;  3V2N A;  1CW5 A;  1CRC A;  4U3F G;  2HFE D;  2I1K A;  1AVO A;  2N1T D;  3L4M A;  2PFX A;  1N7S C;  1SQV J;  1FE6 A;  2IBZ G;  1COT A;  2Z4E A;  2P10 A;  1SQP K;  2A06 G;  2EXV A;  1FZB A;  2W6B A;  4BRY B;  3L74 D;  1T6A A;  4EIC A;  2KNC B;  1OXZ A;  4HJG H;  3WFC C;  2W6A A;  5AW7 B;  2A06 E;  4AAL A;  1OZH A;  3L71 J;  2AEJ A;  1RE4 C;  4GDO A;  4ASV A;  3S1K A;  2PAC A;  2HV4 A;  3HRN A;  4DY9 A;  2BPB B;  3RGU A;  1K9M Q;  3E1I A;  3RK2 B;  3E1R A;  1M1J C;  2FYN B;  3D6Y A;  2ZYD A;  3WU2 E;  4W80 A;  1YJ9 P;  1KFM A;  4GT1 A;  1NO4 A;  3PXS A;  4JBZ A;  1L0N E;  1HZU A;  1N7S D;  1NOH A;  4YPC A;  4PV1 B;  1L0L G;  2XZR A;  3MTU E;  3B5N D;  1S5L H;  1Y9B A;  2OYO A;  5B6Q A;  1X8Y A;  2HPC B;  4I7Z B;  3PJS K;  1EZV E;  1XTC C;  1LFM A;  5IY5 1;  1NKN A;  3M91 A;  3OJA B;  3TF5 A;  1M1J B;  3C9I A;  1EDI A;  1YTZ T;  3GF7 A;  2Q5U A;  2E75 C;  4I6M C;  2PP6 A;  3CME P;  2D0S A;  1GDT A;  5AVX B;  2OGU A;  4P4Q B;  1DD3 A;  5KAI V;  3PH2 B;  4N6J A;  1CIH A;  1EZV D;  2LIT A;  3V2R A;  3KZI V;  2KIK A;  1SQX J;  2KYV A;  2C8S A;  3IN6 A;  3HE4 B;  4K35 A;  1VPC A;  3CI9 A;  4L3H A;  5C0Z A;  3JCU E;  4O9B A;  5H2F V;  2P58 A;  1FHB A;  1L4A C;  1FJ0 A;  1LP1 B;  2A45 G;  2FFD C;  4R4M A;  3VYI A;  1HCM A;  3HUS B;  1H8A A;  1BE3 J;  3SWS A;  2YQB A;  1CTJ A;  4W7Y A;  4D6T D;  2N18 B;  2B87 A;  1N73 B;  1HGV A;  2HG5 D;  3AE9 C;  1GW3 A;  3L75 D;  1ZRT D;  4I1L A;  5KLV J;  4ZNC A;  3SFE C;  1HWT C;  1FZG A;  4JCG A;  2KS1 A;  1EDJ A;  3PP5 A;  4QAO A;  3L37 A;  1CSV A;  2RH0 A;  1JM0 A;  2H8P D;  2MTA C;  4DOJ A;  4FB1 A;  1VL2 A;  2O01 H;  1NTZ J;  2B11 B;  4OGQ D;  3Q5P A;  1M56 D;  1S5L X;  1GQ1 A;  2YK3 A;  2K37 A;  1FI3 A;  4H13 B;  3A7O A;  3CLQ A;  1BDD A;  2J58 A;  3L35 A;  1EZV I;  2BAS A;  2J59 M;  3CCQ P;  1X9V A;  1HH7 A;  2RMZ A;  2KSE A;  3NFQ A;  5E79 V;  1IFJ A;  1FOS F;  1KMI Z;  1CRJ A;  1LT9 A;  2JQR A;  1CRG A;  4KT0 J;  1LMS A;  2E5Y A;  1HH0 A;  5B66 E;  3Q3D A;  2CA4 B;  2WSC J;  3AE4 C;  3AE3 C;  3WU2 V;  1NTM J;  1I55 A;  3H1H D;  1DH3 A;  1YIT P;  3UIA A;  1JOC A;  1YEA A;  3V2P A;  3KYQ A;  4XYD B;  5CIF B;  1S9K E;  3GF3 A;  1CSB A;  2H43 A;  3JBT B;  1YCC A;  2W6J H;  2PCC B;  4FAN A;  1YIJ P;  1QVG O;  1EZV G;  3EFG A;  3BRT B;  2C0W A;  3BCC D;  3ZDM A;  2V7Q H;  3HQ8 A;  1MFZ A;  2C9N Y;  1EB7 A;  1SQQ E;  2FXP A;  3LIE A;  4HKZ H;  1LWU C;  1HUC A;  1H1O A;  1UII A;  2R5B A;  2QSI A;  1RF1 B;  3JCU H;  1M60 A;  1U7J A;  4EI2 A;  3VMY A;  1NU1 E;  5AVV B;  1OW6 A;  2NRG A;  1URQ C;  2FFD A;  2W8Z A;  1CRY A;  3KQG A;  2XU6 A;  3MUD A;  3H1H J;  3U59 A;  1NTK J;  3CXH I;  1EXI A;  2B89 A;  1N86 A;  2WSS H;  2WVR A;  1DIP A;  1YIC A;  4GED B;  3CWB E;  1VQP P;  4PJ0 V;  2QIW A;  3AEC C;  3L4O A;  1AFO A;  2FXM A;  1W2B O;  3F89 A;  2P67 A;  1I6E A;  2N3Y A;  1YYC A;  3CMA P;  1HZV A;  1H32 B;  3CX5 H;  4RES B;  2FYU G;  5KLV K;  4WQ8 A;  3LW5 H;  1JO5 A;  1HJB A;  3H1K D;  1NU1 G;  4LLH A;  1HF9 A;  1SQV K;  4U3F E;  1GW4 A;  2HOD B;  5KAF H;  2C1V A;  3N4X A;  1SQB D;  3M0A A;  5CID B;  5KJ7 D;  4H0K A;  4EIJ A;  3C2C A;  1SQP J;  2FYU E;  5KAI H;  3IFM A;  3VTP C;  4AX3 A;  4OGQ C;  1PFI A;  3A0B V;  2IBZ D;  1URQ D;  1L0L K;  1FZE A;  3L73 D;  2D0W A;  3HE5 A;  1FU1 A;  4MN4 C;  3H1K E;  3IAO A;  1ZXG A;  2Q7C A;  2LXC B;  1AOF A;  1RHZ B;  2WSE J;  1TU3 F;  4C46 A;  5KTB A;  1CIE A;  1FOS E;  2MKV A;  4EYY Q;  4JPZ B;  1JUN A;  1IFI A;  1HRO A;  1GU4 A;  4WVZ A;  5KAF E;  4WQ9 A;  2A06 D;  1I6D A;  3H1I E;  3M9B A;  3AEE C;  4PV1 D;  2CPS A;  3B8E B;  2OYH A;  1MZ9 A;  4U3F J;  4H0J A;  5AW0 B;  3USS A;  2YKQ A;  3BCC J;  1VQ5 P;  1S6V B;  4Y5R A;  2I8D A;  1NYH A;  1ZOY C;  1CHJ A;  1LNQ A;  1NH4 A;  1WRG A;  2ZT9 B;  4GOF A;  2XNX A;  2ZXX A;  4EID A;  3TNU A;  1QEX A;  2P2U A;  1DD4 A;  4YXW H;  2JP3 A;  3DR0 A;  4U7J A;  3BAS A;  5APU A;  2FXO A;  2E75 D;  4C7R A;  4DCK A;  1P84 E;  2K9J A;  3ITK A;  1CIG A;  5AW2 B;  4UB8 V;  2OYI C;  3WMM 0;  4PWA A;  3A3Y B;  2R32 A;  4H44 D;  1NTK D;  1ZP0 C;  1CSW A;  3AEG C;  2V07 A;  3L4F A;  3TGU E;  1SQV E;  2E74 C;  3V5B A;  2YKO A;  3FXE A;  4Z1M H;  3H1I J;  3D71 A;  2Q9I A;  2Y9Z A;  3RK3 E;  1W5C E;  5KLI C;  1GU5 A;  1P84 I;  1BSN A;  1KB9 D;  3M97 X;  5TJH A;  3AE2 C;  3VOP A;  1S4X A;  2ZBO A;  3W67 A;  1NTZ E;  3IR9 A;  3O1Y A;  3JC2 2;  1LT9 C;  2C1U A;  5C39 A;  1FBM A;  1KIB A;  2YO2 A;  3GMA A;  1KV9 A;  1OWA A;  1L0N K;  3ZCF A;  4TT3 H;  1Q7Y Q;  2XTS B;  1H33 A;  5M1B A;  2NPS B;  2C9L Y;  3P8C D;  1RQU A;  2HLO A;  3L74 J;  1NU1 D;  2FYZ A;  1YJN P;  1RH5 B;  5E79 H;  1FZA A;  1CNO A;  2N1T C;  2KSJ A;  4Y28 J;  3SWY A;  2YXQ B;  1OW7 A;  1VF5 C;  3NWV A;  1GL2 A;  1UIX A;  5C9M A;  2ZFC A;  1W2E A;  1H9Y A;  5CIB B;  1P84 H;  3Q5R A;  2LXB A;  5AVZ B;  4XXL A;  2CPB A;  2BEZ F;  3V6I A;  3O6Q A;  1M90 Q;  3TK1 A;  2Y0D A;  1YJW P;  1HJ3 A;  2GUS A;  5GTH E;  2D2C B;  1HTL C;  1T2K C;  1BE3 D;  2LR2 A;  3H1J J;  2ITA A;  3AE5 C;  2AI5 A;  1VQ7 P;  3H1I G;  1KB9 E;  4IL6 V;  2WPV B;  1IFM A;  1JMM A;  1OVU A;  1NTM K;  3L74 E;  2PCB B;  1GJQ A;  1H0T B;  1KIL D;  1M70 A;  1J1D B;  2H89 C;  1J2J B;  1QKS A;  4I2L C;  5BVZ A;  2O01 N;  4ZMD A;  2LKM A;  3RBX A;  1KYO W;  2Q3I A;  1AYG A;  1NGM B;  3HD7 C;  3WC8 A;  1L0L E;  1J1D C;  5B5E E;  1COR A;  2YKP A;  2OZ1 A;  3KHU A;  1OX3 A;  2IYP A;  3WFB C;  2QE7 H;  5CBO A;  1NU1 K;  1M1J A;  1GK6 A;  5H2F E;  1MG3 D;  4O1W A;  2AIU A;  4JYB A;  4JYC A;  1MG2 D;  1CI6 B;  1L4A A;  1J1E C;  3ABV C;  2OTK E;  3B5N A;  4YE1 A;  1VQK P;  1AQT A;  5B66 H;  5CCG C;  1OIP A;  1R0Q A;  1OMI A;  4GKG A;  4L73 A;  2AXT V;  3O20 A;  3CXH D;  2ZOO A;  1IFN A;  5APS A;  2QJK B;  2Q1K A;  1L2P A;  5DJT B;  3L74 G;  1CC5 A;  5KKZ C;  3AE1 C;  1MZ4 A;  4YTP C;  3OA8 A;  3L75 J;  1H89 A;  2Q6Q A;  1KTM A;  3KDP B;  1VYD A;  5KAF V;  3R2P A;  4GOD A;  4DZO A;  4WWI A;  3H32 A;  4OH8 B;  2L5G B;  1JB0 J;  2KOG A;  3HTK B;  1OFC X;  1H32 A;  3AE7 C;  2MJZ A;  4BRY A;  3NBT A;  4W7Z A;  1YQ3 C;  2IZ0 A;  3CL3 D;  5AW5 B;  1KC8 Q;  1PGO A;  3VP8 A;  1H33 B;  2JO1 A;  2ZXY A;  1SQQ D;  4N3Y B;  1W2L A;  1SQQ G;  1N73 C;  2L91 A;  2N18 C;  4H13 D;  1YBK A;  3H1H G;  2ZAE B;  1FDM A;  4Y99 B;  1I8O A;  3VMA A;  2QM7 A;  4DT0 A;  2OYI B;  2QVA A;  3SWF A;  1HVV A;  5APQ A;  1RF0 A;  4PJ0 E;  3T97 B;  1BCC D;  5AVS B;  1EDL A;  3MGN A;  4WY4 C;  1Q82 Q;  1FDO A;  3GHG A;  2V4H A;  2YIU C;  1OW8 A;  1LTJ B;  3R4Y A;  2BCC G;  1M6Z A;  3PXW A;  5DJQ B;  3KXD A;  1KQF B;  5APY A;  2ZT9 C;  4TLF A;  1Q81 Q;  2D2C D;  4LGD E;  2SPZ A;  3CWB D;  3DMI A;  2WWW A;  3FGA D;  3H1K J;  2OYH C;  3KZI E;  2R5D A;  2RKL A;  2O3J A;  1KB0 A;  1KOR A;  1AVY A;  4AYC A;  2HYN A;  1NTZ G;  1F1F A;  4KHX A;  2C9X B;  1KIL B;  4LC1 A;  2NPS D;  2A45 I;  2K9J B;  1JNM A;  4I7Z C;  1L4A D;  3T97 A;  3L75 G;  1DW2 A;  2CK3 H;  3M0D A;  1IJD B;  4KJM A;  3AE6 C;  2PAJ A;  1Y8A A;  1GK4 A;  3BCC E;  2E76 C;  3CXH H;  1FZC A;  3KPE A;  2KZI A;  3L36 A;  1N2D C;  2AEM A;  2KB7 P;  1LTJ C;  3ZOY A;  2OYI A;  1T2K D;  1GDV A;  2O1K A;  1N7S B;  4WY4 B;  1JDL A;  4PD4 H;  1C2R A;  1PP9 D;  2RN0 A;  1CYC A;  1CYJ A;  3TSI A;  1AA0 A;  2E74 B;  3B5N B;  3D6Z A;  2QA4 P;  2QJP C;  1N90 A;  2J5U A;  1CRI A;  2K3R A;  2BEQ D;  1VQM P;  3VP9 A;  2B0Z B;  3LW5 J;  3CC4 P;  2M3E A;  4UB6 V;  2B12 B;  2OAR A;  4WQB A;  1AOQ A;  4WBA A;  3OA8 B;  1K05 A;  1CSU A;  4OGQ B;  4JF7 A;  1Q86 Q;  4JQ0 D;  2FKW B;  3M9Q A;  4IL6 H;  1NJI Q;  3KZI H;  1FOC A;  3SVW A;  2KZJ A;  3GG2 A;  1RF0 C;  4NPE A;  1KN7 A;  3S9O A;  1GTW A;  2E43 A;  4FA5 A;  3CYT I;  1FI7 A;  1I8P A;  1URQ B;  1B7V A;  1PGP A;  5GTI E;  4O1Q A;  2Y9Y A;  4B86 A;  3AEB C;  3H1K G;  1KD1 Q;  1CSX A;  4ZKP A;  1G2C B;  3FX0 A;  3LID A;  3H1I D;  1QN2 A;  2IDB A;  4UB6 E;  4YXD C;  2PGD A;  1DVH A;  3H25 A;  4GYD A;  1RZ6 A;  5AVY B;  5CJ4 A;  4U3F D;  3GHG B;  5AW1 B;  4WQD A;  2JJL A;  2E74 D;  1DII C;  2VRS A;  2YMY A;  1L0L J;  1LTG C;  1YFC A;  5AW6 B;  1D7M A;  3MUD C;  1EQ7 A;  4J20 A;  5GTI V;  1EDK A;  5APW A;  1RE3 C;  1ZRT E;  3CWB G;  1DT1 A;  3W68 A;  1GU2 A;  1BL9 A;  1LTI C;  2C2C A;  1LTJ A;  1W5C T;  3SLE A;  1IO4 A;  2M5A A;  1X79 B;  2N9Y B;  4WB4 A;  4ASW A;  2CE0 A;  2FWL A;  3S4R A;  5E79 E;  2NZ2 A;  2AXC A;  3TDK A;  1XTG B;  5KKZ B;  3VYM A;  2A45 H;  1E29 A;  1FJP A;  3P7K A;  1ZLL A;  3WUI A;  2ZON G;  2QM8 A;  1Y47 A;  1LGH B;  3OCD B;  3L70 D;  3X39 A;  3GLM A;  4WQ7 A;  5AVT B;  3G71 P;  1YTC A;  2XND H;  3CD6 P;  3HQ6 A;  4HYT B;  1FZC B;  1U74 B;  3RK3 D;  4H0L C;  2E42 A;  2YMK A;  2WPR A;  2NPS C;  3L70 E;  3N7N A;  1PGQ A;  4EIF A;  1DW3 A;  1S9K D;  2BCC J;  3HTK A;  4PW9 B;  2QRX A;  1CI6 A;  1L4A B;  3M06 A;  4H44 C;  4PD4 I;  2VHD A;  5CMZ A;  1DX7 A;  3BVH A;  5KJ7 C;  5CCG D;  3RL0 g;  1HRC A;  1BCC G;  5B5E H;  3B71 A;  1LP1 A;  3DP5 A;  5DF5 A;  1S2E A;  1H31 B;  3HD7 A;  3FWL A;  5CYT R;  1GL2 C;  3L71 E;  1U57 A;  3II6 A;  2IYO A;  1HJ5 A;  2R44 A;  2W90 A;  2B88 A;  5AW8 B;  1C52 A;  2WSF J;  1KYO I;  1KX2 A;  2IBZ I;  2AXT H;  1H88 A;  2IFM A;  5KAI E;  4L3G A;  4AAO A;  1G2C A;  2K9Y A;  4XE5 B;  5CCG A;  1LC1 A;  2XDJ A;  2BH4 X;  3O6Q B;  1L0L D;  3CP5 A;  2YO3 A;  3A0B H;  3HQ7 A;  3G6E P;  2N1T B;  1IZN B;  1BGY D;  3TNU B;  2ZYA A;  1ZW0 A;  2CXB A;  4PV1 C;  1BSH A;  5KLV E;  3L72 E;  1PPJ D;  1KIL E;  1T3U A;  2N9J A;  1PPJ E;  1WMK A;  3E7K A;  5B5E V;  2BGV X;  2FYN C;  3PTZ A;  3MIW A;  2QJY C;  2KI7 B;  3L73 G;  3VN0 A;  3P32 A;  1QL2 A;  3MHV A;  3C8V A;  1SQQ J;  1R5S A;  1QGK B;  2XKM A;  1OAE A;  3AED C;  1A02 F;  4AUW A;  1IRW A;  155C A;  3L75 E;  2GM4 A;  2OQQ A;  2WZ7 A;  1SQX E;  2W83 C;  1BGY G;  1KZU B;  2JDI H;  1N15 A;  2E76 D;  3B5N C;  4R4L A;  1SS1 A;  3WUT A;  2ORL A;  3Q5S A;  3L73 E;  3M0D C;  1BCC J;  3RL0 C;  1M8O B;  1S1C X;  2IX7 C;  2B4Z A;  2M3B A;  1SLQ A;  3RL0 B;  1PGJ A;  1DIQ C;  1KIL A;  5KLI B;  3CC2 P;  1BCC E;  4XFJ A;  4AQR D;  1LJ2 A;  3L72 G;  1AV1 A;  1CHI A;  2Q3E A;  2WT7 B;  1QVF O;  2WPQ A;  3RMZ A;  1L9J C;  2O01 J;  3OW2 O;  5APX A;  3EQ2 A;  2BCC E;  1SQQ K;  3HD7 D;  2G8Y A;  3CCS P;  1NHL A;  1NML A;  2CE1 A;  4AAM A;  5BU8 B;  1QX8 A;  2N1T A;  3A5T A;  4L76 A;  1ZN5 A;  2E75 B;  1OVR A;  1L0N G;  3O5C A;  2ZT9 D;  1JY3 P;  5CCH C;  3H1L G;  2GC7 D;  2DVH A;  2Z5H A;  1YNR A;  2N9I A;  1S3J A;  4L1Q A;  2N3B A;  4FA9 A;  2JWA A;  2C0X A;  3RLM A;  1SQB E;  1JY3 N;  2IFN A;  3I55 P;  1SQP E;  3WUU A;  1AJY A;  2FRC A;  1N73 A;  1RF1 A;  1SQB J;  3GW6 A;  3PXT A;  2QEX P;  3ZOX A;  3CX5 W;  2BLF B;  1JY3 O;  4WQA A;  1K3H A;  3CXH E;  3L73 J;  4MU8 A;  2KXP B;  1IQC A;  1NTM G;  2M8R A;  2QJY B;  1NTK E;  4C7N A;  2GUV A;  1BGY J;  4FA4 A;  1J1E B;  2IBZ E;  3F5H A;  2GIW A;  2IPP A;  3CWB J;  3VNW A;  2YCC A;  1JTH A;  2V7Q J;  1MV8 A;  1H9X A;  1MFT A;  1JMB A;  1S5L E;  1KV4 A;  3CCL P;  3SSU A;  3V4W A;  1CIF A;  3IF4 A;  3M9H A;  4K3A A;  3CX5 D;  3MK7 B;  1Z56 A;  1SQB K;  1LWU B;  1U75 B;  2C1D A;  1C2N A;  1NKZ B;  3SWK A;  3B4S A;  1QYZ A;  2L4D A;  3FXD A;  1IC2 A;  4Y99 C;  3H1L E;  5AUR A;  1A8C A;  1S72 P;  2W27 A;  3CCR P;  2PRR A;  1FC2 C;  1FZC C;  1G1I A;  2FBW C;  4WY4 A;  3RN0 A;  5CIG B;  1FAV A;  2WQY C;  1NTK G;  1NAF A;  5H2F H;  1NTM E;  3K5B A;  2D2C C;  1M57 D;  1NTM D;  3TGU J;  3MZW B;  3RN1 A;  4KMG A;  1PP9 J;  2DGE A;  2UWJ E;  3U1A A;  2JKV A;  1E5W A;  5TIS V;  1J3S A;  2KLU A;  2WTY A;  1FJK A;  1RAP A;  4WY4 D;  3D70 A;  3MK7 C;  1LS9 A;  1C7M A;  1SQB G;  1NWQ A;  4L74 A;  1H31 A;  3HD7 B;  4H13 C;  2JR8 A;  1SQV D;  3H1J D;  1EC5 A;  1RF1 C;  1HBW A;  3H1J E;  2JTI B;  1L0N D;  1JCD A;  1LC2 A;  2FYU J;  2WSC H;  2KS1 B;  2Z5I A;  1CCH A;  4N0K A;  2OTJ P;  3RBZ A;  2ZYG A;  1CTZ A;  3A0H V;  1C6S A;  1GL2 B;  3P8C E;  1PP9 E;  1C75 A;  3HUS A;  3CCM P;  4PD4 E;  4Q5P A;  1I54 A;  1MUU A;  2POH A;  2LIR A;  1SFC A;  4PD4 D;  1WEJ F;  5APV A;  4CPG A;  2QG4 A;  4BXL A;  1BE3 E;  3PH0 A;  2FFD B;  5DJU B;  1GMJ A;  5EXQ A;  3CPW O;  4NPF X;  1YEB A;  3L70 J;  4PJ0 H;  2HPC A;  3H1J G;  1ZZH A;  2K1A A;  1VF5 B;  3AEA C;  3HE5 B;  1YIQ A;  2ZXE B;  4A7P A;  3CCV P;  4FAV A;  1R8E A;  2N9B A;  3CU4 A;  1FZF A;  4AAN A;  2FYU D;  2WT7 A;  2KP8 A;  1QLE D;  1VQN P;  2Y0C A;  3D0W A;  5CCH D;  1N7S A;  3HQ9 A;  2O1J A;  1GZL A;  3CC7 P;  1NTZ K;  1YI2 P;  1JY2 P;  2I8F A;  2I1J A;  2NPS A;  4HH2 A;  3TGU G;  1NVO A;  1G1J A;  1PP9 G;  351C A;  1RQV A;  1ETP A;  1SP4 A;  3PLN A;  5CIE B;  3AE8 C;  2E76 B;  2C1D B;  4FA1 A;  4L75 A;  3H32 B;  1RE4 A;  5CHX A;  2WMM A;  4NFG B;  1JCC A;  3RL0 D;  4OWF A;  4K3I A;  1K73 Q;  1GL2 D;  3L71 D;  3NXS A;  3ZOO A;  1QL3 A;  3WU2 H;  1KX7 A;  4HB1 A;  5GTI H;  3RK3 C;  2P7J A;  1PV3 A;  1JEK A;  4D6T J;  1YTZ I;  3WUV A;  1PZQ A;  4EDF A;  3MD0 A;  1MKM A;  1CHH A;  1JY2 O;  4D6T E;  3Q1M A;  3HE4 A;  4C7N B;  2KUB A;  5AW4 B;  4H0L D;  3H6P A;  3GHG C;  1VF5 D;  2P1J A;  4V2K A;  1ZME C;  3JSV C;  2G3A A;  1N50 A;  5CIH B;  2BCC D;  3BAT A;  5CIC B;  3RK3 B;  451C A;  3Q2Y A;  3C1L A;  2KNC A;  1NTZ D;  1SFC C;  3H1L D;  1HGZ A;  4WQC A;  1FDI A;  1OCD A;  2B10 B;  4IL6 E;  1E2R A;  3CX5 I;  4GIF A;  1WVE C;  2OZ1 B;  1H0T A;  2BH5 X;  2HR3 A;  5GTH V;  2Y0E A;  2ZJS E;  4UB8 H;  1T3J A; 
#chains in the Genus database with same CATH homology
 2MTA C;  1MG2 D;  5DJQ C;  1CRH A;  2N9J A;  1SQX D;  3SXT A;  4FB1 A;  4YE1 A;  5B5E V;  2B11 B;  1NIR A;  2BGV X;  2YIU B;  3PTZ A;  3ZBM A;  1R0Q A;  1GQ1 A;  1N9C A;  2YK3 A;  1FI3 A;  1OAE A;  2AXT V;  1GKS A;  3O20 A;  2GB8 B;  1IRW A;  3CXH D;  155C A;  2ZOO A;  2QJK B;  1HH7 A;  1CYI A;  2RMZ A;  1CC5 A;  3SJL A;  1E8E A;  1MZ4 A;  5E79 V;  1CCR A;  1FI9 A;  3OA8 A;  1FCD C;  1N15 A;  1CRJ A;  2JQR A;  1CRG A;  5KLV D;  1LMS A;  1IRV A;  1VYD A;  5KAF V;  1IZL 0;  2ORL A;  2B4Z A;  1H32 A;  2CA4 B;  3NBT A;  3PRJ A;  1DIQ C;  5KLI B;  3WU2 V;  1I55 A;  3H1H D;  1H33 B;  1CHI A;  2ZXY A;  2Q3E A;  1YEA A;  1SQQ D;  4XYD B;  3RMZ A;  1W2L A;  1L9J C;  5CIF B;  3PHL A;  2L91 A;  2N18 C;  3L72 D;  3JBT B;  1NML A;  2CE1 A;  1YCC A;  4AAM A;  1RZ5 A;  2PCC B;  4FAN A;  1I8O A;  3VMA A;  1HJ4 A;  3BCC D;  1BCC D;  2BCN B;  1C6O A;  3O5C A;  3HQ8 A;  1EB7 A;  2GC7 D;  2DVH A;  1YNR A;  2N9I A;  4L1Q A;  2N3B A;  4FA9 A;  2JWA A;  3RLM A;  1RAQ A;  1H1O A;  1M6Z A;  3PXW A;  5DJQ B;  2FRC A;  3VRD A;  1M60 A;  3GW6 A;  3CWB D;  3DMI A;  3PXT A;  1CXA A;  4RSZ A;  3ZOX A;  3CX5 W;  2BLF B;  1CED A;  1CRY A;  4WQA A;  1K3H A;  2O3J A;  1KB0 A;  4MU8 A;  1F1F A;  1DW1 A;  2C9X B;  1IQC A;  2QJY B;  2K9J B;  1YIC A;  4GED B;  3O0R C;  3ZIY A;  3NBS A;  1SQP D;  4PJ0 V;  2MHM A;  4FA4 A;  2GIW A;  3L4O A;  1DW2 A;  3VNW A;  1CTY A;  2YCC A;  1NNO A;  1F1C A;  1H9X A;  1DVV A;  3WFE C;  1KYO D;  1CIF A;  1I6E A;  2N3Y A;  1HZV A;  1H32 B;  4WQ8 A;  3CX5 D;  3MK7 B;  3H1K D;  1NMI A;  1A2S A;  3ZOY A;  1GDV A;  1U75 B;  1CXC A;  1JDL A;  2C1V A;  3A9F A;  3ZOW A;  1SQB D;  1C2R A;  5CID B;  4H0K A;  1PP9 D;  2RN0 A;  1CYC A;  2C1D A;  1CYJ A;  4WQE A;  1C2N A;  1QYZ A;  2L4D A;  3C2C A;  2GC4 D;  4AX3 A;  4EIE A;  3A0B V;  1C6R A;  1I5T A;  2IBZ D;  5AUR A;  1A8C A;  2CA3 B;  3L73 D;  2D0W A;  1N90 A;  1CO6 A;  1CRI A;  3RN0 A;  5CIG B;  1AOF A;  2B0Z B;  1AKK A;  3OCD A;  1CIE A;  3TYI A;  4UB6 V;  3CXH W;  1HRO A;  1S5L V;  2B12 B;  1NTM D;  5DFS A;  3RN1 A;  4KMG A;  4WQ9 A;  1DW0 A;  4WQB A;  2A06 D;  2ZZS 1;  1AOQ A;  3OA8 B;  2DGE A;  1I6D A;  1CSU A;  5B66 V;  1IO3 A;  5TIS V;  1J3S A;  1RAP A;  1A56 A;  1FOC A;  3SVW A;  3GG2 A;  4H0J A;  3ORV A;  3MK7 C;  1LS9 A;  4FA5 A;  3CYT I;  1FI7 A;  1S6V B;  2V08 A;  4RJT A;  1I8P A;  1C7M A;  4Y5R A;  1B7V A;  1H31 A;  4O1Q A;  1CHJ A;  3TGU D;  1SQV D;  3H1J D;  1CSX A;  2JTI B;  1L0N D;  3WFD C;  4EID A;  3H1I D;  1QN2 A;  1LC2 A;  1QL4 A;  1DVH A;  3DR0 A;  1CCH A;  4N0K A;  1P84 D;  4GYD A;  1RZ6 A;  1L9B C;  4U3F D;  1K3G A;  3ITK A;  1CIG A;  1CTZ A;  1GIW A;  3A0H V;  4UB8 V;  1C6S A;  2QJP B;  4PWA A;  1C75 A;  4WQD A;  4LJI A;  1NTK D;  4Q5P A;  1DII C;  1I54 A;  1CSW A;  1CRC A;  2LIR A;  4PD4 D;  2V07 A;  1WEJ F;  2QG4 A;  1YFC A;  5EXQ A;  3L4M A;  1YEB A;  4J20 A;  1COT A;  5GTI V;  1DT1 A;  1KB9 D;  1ZZH A;  1GU2 A;  1BL9 A;  2EXV A;  3M97 X;  2C2C A;  5TJH A;  2ZBO A;  1W5C T;  3SLE A;  1YIQ A;  4A7P A;  2N9Y B;  3L74 D;  4FAV A;  2CE0 A;  2FWL A;  4EIC A;  3O1Y A;  3CU4 A;  2C1U A;  2KNC B;  3WFC C;  4AAN A;  1KIB A;  2FYU D;  3TDK A;  4AAL A;  5KKZ B;  3VYM A;  2Y0C A;  1E29 A;  2PAC A;  2HV4 A;  3WUI A;  1KV9 A;  4DY9 A;  2BPB B;  3HQ9 A;  2ZON G;  3ZCF A;  2I8F A;  2XTS B;  3OCD B;  1H33 A;  2FYN B;  351C A;  1ETP A;  3L70 D;  3X39 A;  3PLN A;  5CIE B;  2C1D B;  4WQ7 A;  3PXS A;  1NU1 D;  1HZU A;  4FA1 A;  1YTC A;  1CNO A;  3HQ6 A;  4NFG B;  3NWV A;  5B6Q A;  1U74 B;  4K3I A;  1LFM A;  5C9M A;  5IY5 1;  3L71 D;  3TF5 A;  3ZOO A;  1H9Y A;  1QL3 A;  5CIB B;  4EIF A;  1DW3 A;  4XXL A;  4PW9 B;  1KX7 A;  2D0S A;  2Y0D A;  2VHD A;  4P4Q B;  1HJ3 A;  4EDF A;  5KAI V;  1HRC A;  3PH2 B;  1CHH A;  3DP5 A;  5DF5 A;  1BE3 D;  1H31 B;  3FWL A;  5CYT R;  1CIH A;  1EZV D;  2LIT A;  2AI5 A;  3KZI V;  4IL6 V;  1HJ5 A;  4V2K A;  2C8S A;  2PCB B;  1GJQ A;  1C52 A;  1N50 A;  5CIH B;  1M70 A;  2BCC D;  4L3H A;  5C0Z A;  1KX2 A;  5H2F V;  1QKS A;  1FHB A;  5CIC B;  4L3G A;  451C A;  1FJ0 A;  1NTZ D;  3H1L D;  1KYO W;  4AAO A;  1AYG A;  4WQC A;  1HCM A;  1LC1 A;  3WC8 A;  1OCD A;  2B10 B;  2BH4 X;  2YQB A;  1COR A;  1CTJ A;  3SWS A;  1E2R A;  1L0L D;  4D6T D;  2N18 B;  3CP5 A;  2OZ1 A;  3KHU A;  3L75 D;  1ZRT D;  3HQ7 A;  1WVE C;  2OZ1 B;  3WFB C;  2BH5 X;  1BGY D;  5GTH V;  2Y0E A;  2CXB A;  1MG3 D;  4O1W A;  4JCG A;  2AIU A;  2KS1 A;  4QAO A;  1CSV A;  1PPJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...