3H1KJ

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 20
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1kJ00
1KYOI 3L73J 1L0LJ 1NTKJ 3L74J 1BCCJ 3L75J 3H1KJ 1SQBJ 1P84I 2FYUJ 3BCCJ 1SQPJ 3L70J 3L71J 3H1IJ 3H1HJ 1EZVI 4D6TJ 1KB9I 1PP9J 1BE3J 3L72J 1SQXJ 3H1JJ 1NTZJ 3CXHI 4U3FJ 4PD4I 3CX5I 1BGYJ 3CWBJ 1NU1J 1SQVJ 2BCCJ 1SQQJ 3TGUJ 5KLVJ 1L0NJ 1NTMJ 2IBZI 3H1LJ
chains in the Genus database with same CATH superfamily
3GG2A 3FXDA 4Z1MH 2QM7A 1H0TB 1KQSO 1N7SD 3Q2YA 1JNMA 4OGQB 1YQ4C 5DJUB 4L75A 1NAYA 5AVYB 5AVTB 3A0HE 2WT7B 1M1JA 1SQXD 3MZWB 4N3YB 4GODA 1IFMA 1SQBE 2HPCB 1FZFA 1T2KC 1NYHA 5APVA 5TJHA 3HD7A 4D6TE 3O6QB 1GL2D 1BGYJ 1R8EA 3H1KG 3L71D 2Y9ZA 3D71A 1JMBA 3F89A 1H0TA 2ZJSE 3L74J 3H1JD 4C7NB 1NOHA 1GK4A 3AEFC 3BCCE 2E75C 1VQ6P 1AA0A 1NTZJ 3O8ZA 1L0LG 1SQVJ 3HE5B 5TISE 3H1HD 1H88A 3V2PA 3A3YB 3CWBE 2HPCA 2QG4A 1BE3G 2HLOA 3O6QA 3II6A 1KV4A 2BCCD 4BRYB 1FJKA 2QIWA 2ZAEB 2ZYDA 4KT0J 1JY2O 1JUNA 2FFDC 5KAFE 2JR8A 1LT9C 4C7NA 2E43A 1PZQA 3SWYA 2OARA 1KYOI 1OIPA 1OX3A 2QEXP 1KFMA 2L91A 2R3SA 3AE4C 3NMDA 3MGNA 4JBZA 2H43A 3VOPA 1FZCB 3HE5A 5AW6B 1GZLA 1OMIA 3IF4A 5CJ4A 4U3FJ 3L36A 5AW0B 1YI2P 2O01N 1WRGA 3H1ID 3VMYA 1KILA 3H6PA 4BRYA 2W27A 5C39A 5B66E 4D6TG 1BCCJ 3EQ2A 1LGHB 4RKUJ 1YBKA 2OYIC 4H13C 1OVUA 2IX7C 1SQXK 5APYA 1J2JB 3BCCG 1SQPG 3FGAD 3A0HH 1FZCA 5KLVE 3GW6A 2KS1B 1SLQA 2OYOA 1R5LA 2YO2A 4HYTB 3RBXA 3SWKA 3KDPB 3A0BE 2QVAA 3CWBG 1SQQG 1KB9I 1IK9A 1PGQA 1XTGB 3H1KD 1NWQA 1NU1J 2C0XA 3TGUE 3V2QA 4H44B 1JY3P 3B5NB 1JOCA 3CMAP 4TLFA 1T2KD 2V7QJ 1EZVI 1NVOA 3C1LA 1L0LD 2L5GB 1ZXGA 5TISH 3CXHE 3B4SA 3L75G 4IFDK 4DZOA 3H1LJ 1M56D 1L0NE 1BE3D 4HKZH 4PV1B 2R5DA 1GD2E 1K8AQ 1K9MQ 3B71A 2E75D 1LWUB 5KAFH 2I8DA 3B5NA 3JSVC 2YXQB 4IOIH 2ZVNB 1RF1B 1DEEG 4GOFA 3ITKA 2YXRB 2KZJA 2FXOA 4LLHA 2XDJA 2IZ1A 1L4AD 1S9KE 2YIUC 2A45I 2W6AA 3L72J 1NKZB 4I1LA 1G2CA 1DD3A 5B66H 4UB8E 2A06E 3KQGA 2WSSH 1LWUA 2D2CD 3PRJA 2HODB 1NH4A 2ZFCA 1JTHB 3N7NA 1RF1A 1S5LX 1ZW0A 3BCCD 5AW8B 3V2RA 1SQPD 2ZYGA 4H0LC 2Y0CA 3HUSC 1Q2NA 1FZBA 2WSCH 1Z56A 1G1JA 3IFMA 3BRVB 1N7LA 1JY2N 5APQA 1Q86Q 4H13D 3A0BH 2YO3A 3CWBD 3E7KA 1SQQD 2AEJA 3CCVP 4PD4I 4IL6X 1KQGB 1Q81Q 2HODA 4ASVA 2MKVA 3Q3DA 1L0LK 1JTHA 1KYOE 1EXIA 4Y99B 1ZOYC 5EFWB 2KNCB 3L70J 4W7ZA 2Q3EA 2XV5A 3ABVC 4AYCA 3M0DC 2IBZG 3JC22 3CXHH 3PH0A 3L75D 3L73G 3MUDC 3WUVA 3CC7P 3AE7C 3PTZA 3CMEP 1NTKE 2A06G 2WITA 4ZMDA 3M91A 1R5SA 2JEEA 2XNXA 3RK2C 2KNCA 4WY4B 1M7LA 2N1TB 2KI7B 2Z4EA 1MV8A 3FWLA 3P8MC 1ZRTE 2GM4A 1OVRA 1AV1A 2FY8A 3GHGB 3CCQP 1KB9E 3LIDA 2QE7H 2G3AA 2K9JB 1LT1A 4UB8H 5AVRB 4GIFA 4KJMA 2E74D 2Z5IA 2W8ZA 1YTZI 1CI6B 1QLED 1SQPK 3OA7A 2FYNB 1VQMP 3CC2P 1EZVE 5CHXA 1EQ7A 1N7SC 4WY4A 3MTUE 1SQQK 4JF7A 2OYHB 3PLNA 1HWTC 1E79H 3R4YA 4CPGA 4DCKA 1VQKP 2K9JA 3VTPC 5KTBA 1FZGA 4ZNCA 5APTA 1RE4C 1SQXJ 3T97A 1AQTA 1NTKG 3CX5E 4H0LD 4DJGA 1CI6A 1GL2C 5CCHC 1KYOH 2QJPB 3TNUB 1W2EA 2NPSC 2K37A 1PPJE 3L71J 2FYUE 2IBZD 3AEGC 2AEMA 3I56P 2OYHA 3L73D 3H1JJ 3HUSA 1P84D 1KILE 2WMMA 1S2EA 3CCJP 4YPCA 1ZMEC 1DEBA 1EC5A 1AJYA 2R32A 2KP8A 1EXJA 2A06D 3H1HJ 4XE5B 2E76C 3W68A 3Q5RA 3TNUA 2YKPA 2JJLA 3OJAB 5H2FE 3W67A 2BCCJ 1T8ZA 1HGVA 1EZVG 1TU3F 2IFMA 1LTJC 4IFMA 3S4RA 3IN6A 3VN0A 2QSIA 2K3RA 2XNDH 3MUDA 1FDOA 1KB9H 1J1DC 2QJYC 2PGDA 1PGPA 1OVVA 1HVVA 3S9OA 2ZT9C 4PD4E 3RK2D 5AVXB 1MFTA 2KLUA 2P2UA 4W80A 3H1IJ 1ZP0C 3P32A 1FJPA 1SFCD 4HB1A 1M1JB 3G6EP 1LTTC 1VQOP 1PPJG 1JB0J 4WBAA 1BGYE 1RE3A 3L74E 3WU2E 4W7YA 2NRGA 3MIWA 2KUBA 1RF0C 3AE9C 4GDOA 1Q7YQ 3Q1MA 1NTKD 3CX5H 2BEQD 2GUVA 2XU6A 1IFIA 1SQVE 4R4LA 3H1KJ 1N7SA 3G4SP 3GLMA 2A45H 1QVFO 3OAKA 2WSEH 3M06A 5CCHD 3CCSP 3AEDC 1L0LJ 2KSJA 2NPSD 2ZXXA 5AVWB 1DD4A 1RE4A 1URQC 5KKZC 2W83C 1NTMD 2M3EA 5AVZB 1GL2A 1BE3J 5H2FH 5AW4B 1EZVD 2QJKC 4U3FE 1GMJA 5CBNA 3D70A 1M57D 1HUCA 1KILB 2POHA 2E76D 4BWNA 1L4AC 2FBWC 3V4WA 3M9BA 4HJGH 4PD4H 1J1EB 1DH3A 3CD6P 4TT3H 3VMXA 1OZHA 4KHXA 3KYQA 1JY3O 2D2CC 3RK3E 1ZN5A 1X22A 1PGOA 1BDCA 1VQ8P 4AUWA 2ZT9D 3HTKA 1SQBG 1NU1E 3M9HA 4L76A 3G3ZA 3BCCJ 3WU2H 1SQPJ 1JCCA 2YNYA 3R2PA 4GOEA 4K35A 2BEZF 3WMM0 1NHLA 3CWBJ 1SQQJ 1EDLA 2DW3A 5KLIC 3H1LE 3CLQA 2H7HA 1LTBC 3A7OA 2WZ7A 2K88A 2WSFJ 1NTMK 3UIAA 3FWNA 1S4XA 4O9BA 3U1CA 3L75J 3KXDA 3D6YA 2ZVOB 5CCGC 3PJSK 2E75B 2M5AB 5CJ0A 1IFDA 2JKVA 3L72E 2P58A 2ZYAA 1UIXA 3PP5A 1SP4A 2JP3A 1URQD 1G2CB 3P8CE 1JCDA 1K04A 3AE3C 2WQYC 1M8OB 5AW9B 2FFDB 1KTMA 3CX5I 1USEA 1LT9B 3USSA 2E74C 1OXZA 2M5AA 1SS1A 3RL0B 3VYIA 1FE6A 2KIKA 3BRTB 3VMAA 3H32A 3AE6C 5KLVG 3TYYA 2GA1A 2XZRA 1SQBD 2CK3H 1Y9BA 2N1TC 3RL0g 4D6TD 1L4AA 1N73C 2FFDA 5B5EE 4C7RA 2V7QH 3EWKA 3AE8C 1LT9A 3L70E 3TGUG 2OYIB 4EDFA 4N6JA 4IL6E 3CL3D 1MUUA 3MHVA 2Y9YA 2YKOA 1VQ5P 3RK3B 3M9QA 2C9LY 5KJ7C 4ZKPA 2OTJP 2FYZA 4QMAA 1L0NG 2AEFA 2Q9IA 2IYOA 1QGKB 2H89C 4PJ0E 1JY3N 2I1KA 2KXPB 3L73J 3P7KA 2OYIA 1FS0E 3GF7A 1EDKA 1FU1A 5DJTB 1USDA 1U7MA 1YQ3C 3L37A 3I55P 4C46A 1K05A 4JQ0D 2QJPC 1CZQA 1VF5B 2AXCA 1IFPA 1IO4A 3AEBC 2NZ2A 4JYBA 5L8RJ 5CCGD 2CPBA 1YYCA 1EDIA 2M0BA 2HYNA 1QVGO 1N86A 1SQBK 2PFXA 3KZIE 1KC8Q 1QEXA 3LIEA 5KLVD 2YIUB 1SFCC 2OGUA 3SFEC 3LW5J 1SQXE 3GF3A 1M90Q 3T97B 2AXTE 1YJWP 3EFFK 5B5EH 2FKWB 1SVFA 3TGUD 1NAFA 2R3CA 1VPCA 2WVRA 4IL6H 1FDIA 3C8VA 2N1TD 2OTLP 3GMAA 3HUSB 1LTIC 1NTKJ 3CXHD 1S3JA 4I7ZC 2E5YA 2O01H 5GTHE 2ITAA 1M1JC 1L0ND 1G1IA 1FC2C 3H1HE 3HE4B 1LTAC 1KZUB 4PJ0H 4XA4A 1OWAA 3HD7C 3ZDMA 2BCCE 1N73A 1AQ5A 1NGMB 3M0AA 1IZNB 3E1RA 5KJ7D 5APUA 1GU5A 3I5CA 2BASA 1OW8A 1FZEA 3TF5A 1PP9E 4OGQC 1S9KD 1WMKA 1LJ2A 5APXA 1FDMA 1NTMJ 1RH5B 3AEAC 1JMMA 2O1KA 3HE4A 2P10A 4I2LC 4B86A 2JWDA 3E1IA 3H1IE 4IFFA 3RGUA 3U59A 5KLVK 3RK2B 2KK7A 3KZIH 1YTZT 3M0DA 2Y0DA 3VP9A 2J58A 2Q6QA 1YHQP 2RMZA 1PV3A 2IZ0A 2QA4P 3CCLP 5AW7B 2QRXA 2AXTH 4RO0A 1FZAA 4YXDC 2CPSA 3H1KE 2WTYA 3K5BA 1KYOD 1N7SB 4NPFX 4WWIA 1L0NK 2FYUG 2WWWA 2PP6A 3SWFA 2J5UA 1KFNA 4U7JA 2A45G 1GTWA 1PP9G 5GTHH 1L0LE 1FZCC 1SFCA 1N8RQ 1FOSF 2Q1KA 1HJ0A 4LC1A 2G8YA 1ZR4A 3HRNA 1PFIA 1BE3E 1NTZE 1IC2A 1GL2B 3TDKA 1GK6A 1T3UA 2LXCB 3S1KA 2NPSB 4A7PA 1D7MA 2IDBA 2LR2A 3L4FA 1DIPA 1OW7A 4L74A 3Q5PA 2HR3A 2E42A 2KSEA 1ZRTD 3HD7D 3PHLA 2IBZI 3RBZA 1KB9D 3V5BA 2RN0A 4EOTA 2B87B 1P84I 1VDFA 2Q7CA 4AQRD 1NJIQ 3FXEA 2P1JA 4YTPC 1QL1A 1RY3A 3V4QA 2E76B 5CCHA 4OGQD 1QL2A 4LGDE 4UB6E 4N78E 2NPSA 4H44C 3B5NC 3HTKB 5AW3B 1LTJB 1BCCE 1SQPE 1BGYG 3SSUA 5E79E 1J1DB 3AE5C 2QJYB 1HTLC 2WT7A 2B87A 2JDIH 3L74G 2C9NY 2YKQA 2ZT9B 5APWA 1SQQE 2QM8A 5AVVB 1JO5A 4PV1C 3CX5D 4WB4A 1SQBJ 5CBOA 1NTZG 3AECC 1LWUC 1SQVG 4D6TJ 3NXSA 3D6ZA 1HH0A 1PPJD 2FYUD 1RF1C 1LTJA 5AW5B 2WPVB 2LKMA 2XKMA 1PP9D 1OW6A 1KILD 1NTKK 3RL0C 1JEKA 3L75E 3V2NA 2MJZA 2K1AA 5AW1B 4GKGA 4DT0A 1X8YA 1CW5A 2V4HA 5M1BA 3QH9A 4ZKUA 2R44A 1Y47A 3CCUP 1ZR2A 2Y0EA 1M1KQ 4U3FG 1KORA 2WPQA 2UWJE 4I6MC 1BCCG 4GT1A 3RK3C 4EIJA 1PGJA 1H8AA 4PD4D 2P67A 1RF0A 3BVHA 3NTNA 4RJTA 1MFZA 1URQB 1JY2P 5KKZB 2B88A 2P7JA 4K3AA 4R4MA 4RESB 4UB6H 1X79B 1BDDA 1IK7A 4OVNF 1KQFB 2QJKB 3H32B 4Y99C 1XTCC 4M3LA 1BGYD 3SFDC 1UIIA 4MN4C 4HH2A 5E79H 1NU1G 3MD0A 3G71P 1L4AB 3L74D 2KS1A 1ZV8A 2R5BA 1VF5C 3F5HA 1KD1Q 5KLVJ 4H44D 3B5ND 1OFCX 3AE1C 1H89A 2WSCJ 1URQA 2B9BA 1KQLA 2J59M 2FYUK 1U57A 1NTZD 2C0WA 1SQVD 1U7JA 2D2CB 5BVZA 1E5WA 1RQVA 1S5LE 1YJ9P 2W6JH 3H1LG 2WSFH 3TGUJ 1Q82Q 4WY4C 2KZIA 1GDTA 2IBZE 4PV1D 1PIXA 1FAVA 3OW2O 3L73E 3L35A 1P84E 2JWAA 5APSA 5KAIE 2Q3IA 3GHGC 1VQ4P 5BU5A 2OQQA 1YIJP 4H13B 3EFGA 2Q5UA 1NKNA 1L0NJ 3RL0D 2HFED 4N78D 2FYNC 5KLIB 4U3FD 1RHZB 3L72G 1AVYA 3CI9A 1LTSC 3NFQA 1WT6A 2H88C 1BCCD 1S1CX 3KPEA 2OYHC 1MKMA 3A2AA 2M8RA 5AVQB 2B89A 1N2DC 1S72P 1IFNA 3H25A 3IAOA 1KMIZ 1EDJA 2Z5HA 3RK3D 1VQNP 4JYCA 2LXBA 4XFJA 1HF9A 3TSIA 4ASWA 1Q90D 1GW3A 1NU1D 2KB7P 2KLVA 1HJBA 1L2PA 1K73Q 1FBMA 1BSHA 4EYYQ 1NTZK 3VP8A 1SQVK 2IPPA 4OH8B 1GW4A 2ZXEB 2M3BA 1AVOA 3L70G 3CCRP 2YMKA 5CCGA 2O01J 2E74B 2K9YA 1S5LH 2H8PD 1VQPP 3H1LD 1A02F 1VF5D 1HGZA 2N9BA 3CPWO 3Q5SA 1IFJA 4YXWH 3TK1A 1P84H 1RE3C 3BATA 5KAIH 1N73B 3N4XA 3L71E 1HBWA 3A5TA 1A02J 2W90A 3CCMP 5AVSB 2RKLA 4WY4D 3H1JE 1IJDB 3JCUE 1NTME 4H0LB 3L72D 1Y8AA 3WUTA 2N9YB 4L73A 5GTIE 5BU8B 2N1TA 5CMZA 3P8CD 3AEEC 2GUSA 5AW2B 4BXLA 1W2BO 2HG5D 4Y28J 4WVZA 1VL2A 3GHGA 1NO4A 2IFNA 1VQLP 1VQ7P 1LTGC 1KN7A 1DX7A 3MP7B 2O3JA 3AE2C 1NU1K 3LW5H 1GU4A 4JPZB 1X0TA 2WPRA 4NPDA 2RH0A 5KJ7A 1W5CE 2KOGA 4EI2A 1SQXG 2YMYA 5K5GB 1BSNA 2W6BA 1ZLLA 1MZ9A 3WUUA 3L70D 1LP1B 3C9IA 3L71G 4OWFA 1CSBA 3H1JG 1VQ9P 3CCEP 1LNQA 1NTMG 1T6AA 5AVUB 1SFCB 2FXMA 2E5TA 3U1AA 3V6IA 3IR9A 3BASA 3KHUA 3H1HG 3FX0A 2FYUJ 1KILC 1T3JA 1RQUA 3QWOC 1X9VA 2BCCG 2OTKE 1LP1A 1FOSE 1PP9J 1YITP 4DOJA 1J1EC 3B8EB 2PAJA 2KYVA 2WSEJ 1AFOA 3VMZA 1JM0A 3JCUH 2WPSA 2FXPA 1PL5A 2SPZA 1QX8A 2O1JA 2VRSA 4I7ZB 2I1JA 1YJNP 5GTIH 3G9RA 2JO1A 3CXHI 3CC4P 4NPEA 2PRRA 2IYPA 3H1IG 3HD7B
chains in the Genus database with same CATH topology
1KYOI 3L73J 1L0LJ 1NTKJ 3L74J 1BCCJ 3L75J 3H1KJ 1SQBJ 1P84I 2FYUJ 3BCCJ 1SQPJ 3L70J 3L71J 3H1IJ 3H1HJ 1EZVI 4D6TJ 1KB9I 1PP9J 1BE3J 3L72J 1SQXJ 3H1JJ 1NTZJ 3CXHI 4U3FJ 4PD4I 3CX5I 1BGYJ 3CWBJ 1NU1J 1SQVJ 2BCCJ 1SQQJ 3TGUJ 5KLVJ 1L0NJ 1NTMJ 2IBZI 3H1LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  3L73 J;  1L0L J;  1NTK J;  3L74 J;  1BCC J;  3L75 J;  3H1K J;  1SQB J;  1P84 I;  2FYU J;  3BCC J;  1SQP J;  3L70 J;  3L71 J;  3H1I J;  3H1H J;  1EZV I;  4D6T J;  1KB9 I;  1PP9 J;  1BE3 J;  3L72 J;  1SQX J;  3H1J J;  1NTZ J;  3CXH I;  4U3F J;  4PD4 I;  3CX5 I;  1BGY J;  3CWB J;  1NU1 J;  1SQV J;  2BCC J;  1SQQ J;  3TGU J;  5KLV J;  1L0N J;  1NTM J;  2IBZ I;  3H1L J; 
#chains in the Genus database with same CATH topology
 3GG2 A;  3FXD A;  4Z1M H;  2QM7 A;  1H0T B;  1KQS O;  1N7S D;  3Q2Y A;  1JNM A;  4OGQ B;  1YQ4 C;  5DJU B;  4L75 A;  1NAY A;  5AVY B;  5AVT B;  3A0H E;  2WT7 B;  1M1J A;  1SQX D;  3MZW B;  4N3Y B;  4GOD A;  1IFM A;  1SQB E;  2HPC B;  1FZF A;  1T2K C;  1NYH A;  5APV A;  5TJH A;  3HD7 A;  4D6T E;  3O6Q B;  1GL2 D;  1BGY J;  1R8E A;  3H1K G;  3L71 D;  2Y9Z A;  3D71 A;  1JMB A;  3F89 A;  1H0T A;  2ZJS E;  3L74 J;  3H1J D;  4C7N B;  1NOH A;  1GK4 A;  3AEF C;  3BCC E;  2E75 C;  1VQ6 P;  1AA0 A;  1NTZ J;  3O8Z A;  1L0L G;  1SQV J;  3HE5 B;  5TIS E;  3H1H D;  1H88 A;  3V2P A;  3A3Y B;  3CWB E;  2HPC A;  2QG4 A;  1BE3 G;  2HLO A;  3O6Q A;  3II6 A;  1KV4 A;  2BCC D;  4BRY B;  1FJK A;  2QIW A;  2ZAE B;  2ZYD A;  4KT0 J;  1JY2 O;  1JUN A;  2FFD C;  5KAF E;  2JR8 A;  1LT9 C;  4C7N A;  2E43 A;  1PZQ A;  3SWY A;  2OAR A;  1KYO I;  1OIP A;  1OX3 A;  2QEX P;  1KFM A;  2L91 A;  2R3S A;  3AE4 C;  3NMD A;  3MGN A;  4JBZ A;  2H43 A;  3VOP A;  1FZC B;  3HE5 A;  5AW6 B;  1GZL A;  1OMI A;  3IF4 A;  5CJ4 A;  4U3F J;  3L36 A;  5AW0 B;  1YI2 P;  2O01 N;  1WRG A;  3H1I D;  3VMY A;  1KIL A;  3H6P A;  4BRY A;  2W27 A;  5C39 A;  5B66 E;  4D6T G;  1BCC J;  3EQ2 A;  1LGH B;  4RKU J;  1YBK A;  2OYI C;  4H13 C;  1OVU A;  2IX7 C;  1SQX K;  5APY A;  1J2J B;  3BCC G;  1SQP G;  3FGA D;  3A0H H;  1FZC A;  5KLV E;  3GW6 A;  2KS1 B;  1SLQ A;  2OYO A;  1R5L A;  2YO2 A;  4HYT B;  3RBX A;  3SWK A;  3KDP B;  3A0B E;  2QVA A;  3CWB G;  1SQQ G;  1KB9 I;  1IK9 A;  1PGQ A;  1XTG B;  3H1K D;  1NWQ A;  1NU1 J;  2C0X A;  3TGU E;  3V2Q A;  4H44 B;  1JY3 P;  3B5N B;  1JOC A;  3CMA P;  4TLF A;  1T2K D;  2V7Q J;  1EZV I;  1NVO A;  3C1L A;  1L0L D;  2L5G B;  1ZXG A;  5TIS H;  3CXH E;  3B4S A;  3L75 G;  4IFD K;  4DZO A;  3H1L J;  1M56 D;  1L0N E;  1BE3 D;  4HKZ H;  4PV1 B;  2R5D A;  1GD2 E;  1K8A Q;  1K9M Q;  3B71 A;  2E75 D;  1LWU B;  5KAF H;  2I8D A;  3B5N A;  3JSV C;  2YXQ B;  4IOI H;  2ZVN B;  1RF1 B;  1DEE G;  4GOF A;  3ITK A;  2YXR B;  2KZJ A;  2FXO A;  4LLH A;  2XDJ A;  2IZ1 A;  1L4A D;  1S9K E;  2YIU C;  2A45 I;  2W6A A;  3L72 J;  1NKZ B;  4I1L A;  1G2C A;  1DD3 A;  5B66 H;  4UB8 E;  2A06 E;  3KQG A;  2WSS H;  1LWU A;  2D2C D;  3PRJ A;  2HOD B;  1NH4 A;  2ZFC A;  1JTH B;  3N7N A;  1RF1 A;  1S5L X;  1ZW0 A;  3BCC D;  5AW8 B;  3V2R A;  1SQP D;  2ZYG A;  4H0L C;  2Y0C A;  3HUS C;  1Q2N A;  1FZB A;  2WSC H;  1Z56 A;  1G1J A;  3IFM A;  3BRV B;  1N7L A;  1JY2 N;  5APQ A;  1Q86 Q;  4H13 D;  3A0B H;  2YO3 A;  3CWB D;  3E7K A;  1SQQ D;  2AEJ A;  3CCV P;  4PD4 I;  4IL6 X;  1KQG B;  1Q81 Q;  2HOD A;  4ASV A;  2MKV A;  3Q3D A;  1L0L K;  1JTH A;  1KYO E;  1EXI A;  4Y99 B;  1ZOY C;  5EFW B;  2KNC B;  3L70 J;  4W7Z A;  2Q3E A;  2XV5 A;  3ABV C;  4AYC A;  3M0D C;  2IBZ G;  3JC2 2;  3CXH H;  3PH0 A;  3L75 D;  3L73 G;  3MUD C;  3WUV A;  3CC7 P;  3AE7 C;  3PTZ A;  3CME P;  1NTK E;  2A06 G;  2WIT A;  4ZMD A;  3M91 A;  1R5S A;  2JEE A;  2XNX A;  3RK2 C;  2KNC A;  4WY4 B;  1M7L A;  2N1T B;  2KI7 B;  2Z4E A;  1MV8 A;  3FWL A;  3P8M C;  1ZRT E;  2GM4 A;  1OVR A;  1AV1 A;  2FY8 A;  3GHG B;  3CCQ P;  1KB9 E;  3LID A;  2QE7 H;  2G3A A;  2K9J B;  1LT1 A;  4UB8 H;  5AVR B;  4GIF A;  4KJM A;  2E74 D;  2Z5I A;  2W8Z A;  1YTZ I;  1CI6 B;  1QLE D;  1SQP K;  3OA7 A;  2FYN B;  1VQM P;  3CC2 P;  1EZV E;  5CHX A;  1EQ7 A;  1N7S C;  4WY4 A;  3MTU E;  1SQQ K;  4JF7 A;  2OYH B;  3PLN A;  1HWT C;  1E79 H;  3R4Y A;  4CPG A;  4DCK A;  1VQK P;  2K9J A;  3VTP C;  5KTB A;  1FZG A;  4ZNC A;  5APT A;  1RE4 C;  1SQX J;  3T97 A;  1AQT A;  1NTK G;  3CX5 E;  4H0L D;  4DJG A;  1CI6 A;  1GL2 C;  5CCH C;  1KYO H;  2QJP B;  3TNU B;  1W2E A;  2NPS C;  2K37 A;  1PPJ E;  3L71 J;  2FYU E;  2IBZ D;  3AEG C;  2AEM A;  3I56 P;  2OYH A;  3L73 D;  3H1J J;  3HUS A;  1P84 D;  1KIL E;  2WMM A;  1S2E A;  3CCJ P;  4YPC A;  1ZME C;  1DEB A;  1EC5 A;  1AJY A;  2R32 A;  2KP8 A;  1EXJ A;  2A06 D;  3H1H J;  4XE5 B;  2E76 C;  3W68 A;  3Q5R A;  3TNU A;  2YKP A;  2JJL A;  3OJA B;  5H2F E;  3W67 A;  2BCC J;  1T8Z A;  1HGV A;  1EZV G;  1TU3 F;  2IFM A;  1LTJ C;  4IFM A;  3S4R A;  3IN6 A;  3VN0 A;  2QSI A;  2K3R A;  2XND H;  3MUD A;  1FDO A;  1KB9 H;  1J1D C;  2QJY C;  2PGD A;  1PGP A;  1OVV A;  1HVV A;  3S9O A;  2ZT9 C;  4PD4 E;  3RK2 D;  5AVX B;  1MFT A;  2KLU A;  2P2U A;  4W80 A;  3H1I J;  1ZP0 C;  3P32 A;  1FJP A;  1SFC D;  4HB1 A;  1M1J B;  3G6E P;  1LTT C;  1VQO P;  1PPJ G;  1JB0 J;  4WBA A;  1BGY E;  1RE3 A;  3L74 E;  3WU2 E;  4W7Y A;  2NRG A;  3MIW A;  2KUB A;  1RF0 C;  3AE9 C;  4GDO A;  1Q7Y Q;  3Q1M A;  1NTK D;  3CX5 H;  2BEQ D;  2GUV A;  2XU6 A;  1IFI A;  1SQV E;  4R4L A;  3H1K J;  1N7S A;  3G4S P;  3GLM A;  2A45 H;  1QVF O;  3OAK A;  2WSE H;  3M06 A;  5CCH D;  3CCS P;  3AED C;  1L0L J;  2KSJ A;  2NPS D;  2ZXX A;  5AVW B;  1DD4 A;  1RE4 A;  1URQ C;  5KKZ C;  2W83 C;  1NTM D;  2M3E A;  5AVZ B;  1GL2 A;  1BE3 J;  5H2F H;  5AW4 B;  1EZV D;  2QJK C;  4U3F E;  1GMJ A;  5CBN A;  3D70 A;  1M57 D;  1HUC A;  1KIL B;  2POH A;  2E76 D;  4BWN A;  1L4A C;  2FBW C;  3V4W A;  3M9B A;  4HJG H;  4PD4 H;  1J1E B;  1DH3 A;  3CD6 P;  4TT3 H;  3VMX A;  1OZH A;  4KHX A;  3KYQ A;  1JY3 O;  2D2C C;  3RK3 E;  1ZN5 A;  1X22 A;  1PGO A;  1BDC A;  1VQ8 P;  4AUW A;  2ZT9 D;  3HTK A;  1SQB G;  1NU1 E;  3M9H A;  4L76 A;  3G3Z A;  3BCC J;  3WU2 H;  1SQP J;  1JCC A;  2YNY A;  3R2P A;  4GOE A;  4K35 A;  2BEZ F;  3WMM 0;  1NHL A;  3CWB J;  1SQQ J;  1EDL A;  2DW3 A;  5KLI C;  3H1L E;  3CLQ A;  2H7H A;  1LTB C;  3A7O A;  2WZ7 A;  2K88 A;  2WSF J;  1NTM K;  3UIA A;  3FWN A;  1S4X A;  4O9B A;  3U1C A;  3L75 J;  3KXD A;  3D6Y A;  2ZVO B;  5CCG C;  3PJS K;  2E75 B;  2M5A B;  5CJ0 A;  1IFD A;  2JKV A;  3L72 E;  2P58 A;  2ZYA A;  1UIX A;  3PP5 A;  1SP4 A;  2JP3 A;  1URQ D;  1G2C B;  3P8C E;  1JCD A;  1K04 A;  3AE3 C;  2WQY C;  1M8O B;  5AW9 B;  2FFD B;  1KTM A;  3CX5 I;  1USE A;  1LT9 B;  3USS A;  2E74 C;  1OXZ A;  2M5A A;  1SS1 A;  3RL0 B;  3VYI A;  1FE6 A;  2KIK A;  3BRT B;  3VMA A;  3H32 A;  3AE6 C;  5KLV G;  3TYY A;  2GA1 A;  2XZR A;  1SQB D;  2CK3 H;  1Y9B A;  2N1T C;  3RL0 g;  4D6T D;  1L4A A;  1N73 C;  2FFD A;  5B5E E;  4C7R A;  2V7Q H;  3EWK A;  3AE8 C;  1LT9 A;  3L70 E;  3TGU G;  2OYI B;  4EDF A;  4N6J A;  4IL6 E;  3CL3 D;  1MUU A;  3MHV A;  2Y9Y A;  2YKO A;  1VQ5 P;  3RK3 B;  3M9Q A;  2C9L Y;  5KJ7 C;  4ZKP A;  2OTJ P;  2FYZ A;  4QMA A;  1L0N G;  2AEF A;  2Q9I A;  2IYO A;  1QGK B;  2H89 C;  4PJ0 E;  1JY3 N;  2I1K A;  2KXP B;  3L73 J;  3P7K A;  2OYI A;  1FS0 E;  3GF7 A;  1EDK A;  1FU1 A;  5DJT B;  1USD A;  1U7M A;  1YQ3 C;  3L37 A;  3I55 P;  4C46 A;  1K05 A;  4JQ0 D;  2QJP C;  1CZQ A;  1VF5 B;  2AXC A;  1IFP A;  1IO4 A;  3AEB C;  2NZ2 A;  4JYB A;  5L8R J;  5CCG D;  2CPB A;  1YYC A;  1EDI A;  2M0B A;  2HYN A;  1QVG O;  1N86 A;  1SQB K;  2PFX A;  3KZI E;  1KC8 Q;  1QEX A;  3LIE A;  5KLV D;  2YIU B;  1SFC C;  2OGU A;  3SFE C;  3LW5 J;  1SQX E;  3GF3 A;  1M90 Q;  3T97 B;  2AXT E;  1YJW P;  3EFF K;  5B5E H;  2FKW B;  1SVF A;  3TGU D;  1NAF A;  2R3C A;  1VPC A;  2WVR A;  4IL6 H;  1FDI A;  3C8V A;  2N1T D;  2OTL P;  3GMA A;  3HUS B;  1LTI C;  1NTK J;  3CXH D;  1S3J A;  4I7Z C;  2E5Y A;  2O01 H;  5GTH E;  2ITA A;  1M1J C;  1L0N D;  1G1I A;  1FC2 C;  3H1H E;  3HE4 B;  1LTA C;  1KZU B;  4PJ0 H;  4XA4 A;  1OWA A;  3HD7 C;  3ZDM A;  2BCC E;  1N73 A;  1AQ5 A;  1NGM B;  3M0A A;  1IZN B;  3E1R A;  5KJ7 D;  5APU A;  1GU5 A;  3I5C A;  2BAS A;  1OW8 A;  1FZE A;  3TF5 A;  1PP9 E;  4OGQ C;  1S9K D;  1WMK A;  1LJ2 A;  5APX A;  1FDM A;  1NTM J;  1RH5 B;  3AEA C;  1JMM A;  2O1K A;  3HE4 A;  2P10 A;  4I2L C;  4B86 A;  2JWD A;  3E1I A;  3H1I E;  4IFF A;  3RGU A;  3U59 A;  5KLV K;  3RK2 B;  2KK7 A;  3KZI H;  1YTZ T;  3M0D A;  2Y0D A;  3VP9 A;  2J58 A;  2Q6Q A;  1YHQ P;  2RMZ A;  1PV3 A;  2IZ0 A;  2QA4 P;  3CCL P;  5AW7 B;  2QRX A;  2AXT H;  4RO0 A;  1FZA A;  4YXD C;  2CPS A;  3H1K E;  2WTY A;  3K5B A;  1KYO D;  1N7S B;  4NPF X;  4WWI A;  1L0N K;  2FYU G;  2WWW A;  2PP6 A;  3SWF A;  2J5U A;  1KFN A;  4U7J A;  2A45 G;  1GTW A;  1PP9 G;  5GTH H;  1L0L E;  1FZC C;  1SFC A;  1N8R Q;  1FOS F;  2Q1K A;  1HJ0 A;  4LC1 A;  2G8Y A;  1ZR4 A;  3HRN A;  1PFI A;  1BE3 E;  1NTZ E;  1IC2 A;  1GL2 B;  3TDK A;  1GK6 A;  1T3U A;  2LXC B;  3S1K A;  2NPS B;  4A7P A;  1D7M A;  2IDB A;  2LR2 A;  3L4F A;  1DIP A;  1OW7 A;  4L74 A;  3Q5P A;  2HR3 A;  2E42 A;  2KSE A;  1ZRT D;  3HD7 D;  3PHL A;  2IBZ I;  3RBZ A;  1KB9 D;  3V5B A;  2RN0 A;  4EOT A;  2B87 B;  1P84 I;  1VDF A;  2Q7C A;  4AQR D;  1NJI Q;  3FXE A;  2P1J A;  4YTP C;  1QL1 A;  1RY3 A;  3V4Q A;  2E76 B;  5CCH A;  4OGQ D;  1QL2 A;  4LGD E;  4UB6 E;  4N78 E;  2NPS A;  4H44 C;  3B5N C;  3HTK B;  5AW3 B;  1LTJ B;  1BCC E;  1SQP E;  1BGY G;  3SSU A;  5E79 E;  1J1D B;  3AE5 C;  2QJY B;  1HTL C;  2WT7 A;  2B87 A;  2JDI H;  3L74 G;  2C9N Y;  2YKQ A;  2ZT9 B;  5APW A;  1SQQ E;  2QM8 A;  5AVV B;  1JO5 A;  4PV1 C;  3CX5 D;  4WB4 A;  1SQB J;  5CBO A;  1NTZ G;  3AEC C;  1LWU C;  1SQV G;  4D6T J;  3NXS A;  3D6Z A;  1HH0 A;  1PPJ D;  2FYU D;  1RF1 C;  1LTJ A;  5AW5 B;  2WPV B;  2LKM A;  2XKM A;  1PP9 D;  1OW6 A;  1KIL D;  1NTK K;  3RL0 C;  1JEK A;  3L75 E;  3V2N A;  2MJZ A;  2K1A A;  5AW1 B;  4GKG A;  4DT0 A;  1X8Y A;  1CW5 A;  2V4H A;  5M1B A;  3QH9 A;  4ZKU A;  2R44 A;  1Y47 A;  3CCU P;  1ZR2 A;  2Y0E A;  1M1K Q;  4U3F G;  1KOR A;  2WPQ A;  2UWJ E;  4I6M C;  1BCC G;  4GT1 A;  3RK3 C;  4EIJ A;  1PGJ A;  1H8A A;  4PD4 D;  2P67 A;  1RF0 A;  3BVH A;  3NTN A;  4RJT A;  1MFZ A;  1URQ B;  1JY2 P;  5KKZ B;  2B88 A;  2P7J A;  4K3A A;  4R4M A;  4RES B;  4UB6 H;  1X79 B;  1BDD A;  1IK7 A;  4OVN F;  1KQF B;  2QJK B;  3H32 B;  4Y99 C;  1XTC C;  4M3L A;  1BGY D;  3SFD C;  1UII A;  4MN4 C;  4HH2 A;  5E79 H;  1NU1 G;  3MD0 A;  3G71 P;  1L4A B;  3L74 D;  2KS1 A;  1ZV8 A;  2R5B A;  1VF5 C;  3F5H A;  1KD1 Q;  5KLV J;  4H44 D;  3B5N D;  1OFC X;  3AE1 C;  1H89 A;  2WSC J;  1URQ A;  2B9B A;  1KQL A;  2J59 M;  2FYU K;  1U57 A;  1NTZ D;  2C0W A;  1SQV D;  1U7J A;  2D2C B;  5BVZ A;  1E5W A;  1RQV A;  1S5L E;  1YJ9 P;  2W6J H;  3H1L G;  2WSF H;  3TGU J;  1Q82 Q;  4WY4 C;  2KZI A;  1GDT A;  2IBZ E;  4PV1 D;  1PIX A;  1FAV A;  3OW2 O;  3L73 E;  3L35 A;  1P84 E;  2JWA A;  5APS A;  5KAI E;  2Q3I A;  3GHG C;  1VQ4 P;  5BU5 A;  2OQQ A;  1YIJ P;  4H13 B;  3EFG A;  2Q5U A;  1NKN A;  1L0N J;  3RL0 D;  2HFE D;  4N78 D;  2FYN C;  5KLI B;  4U3F D;  1RHZ B;  3L72 G;  1AVY A;  3CI9 A;  1LTS C;  3NFQ A;  1WT6 A;  2H88 C;  1BCC D;  1S1C X;  3KPE A;  2OYH C;  1MKM A;  3A2A A;  2M8R A;  5AVQ B;  2B89 A;  1N2D C;  1S72 P;  1IFN A;  3H25 A;  3IAO A;  1KMI Z;  1EDJ A;  2Z5H A;  3RK3 D;  1VQN P;  4JYC A;  2LXB A;  4XFJ A;  1HF9 A;  3TSI A;  4ASW A;  1Q90 D;  1GW3 A;  1NU1 D;  2KB7 P;  2KLV A;  1HJB A;  1L2P A;  1K73 Q;  1FBM A;  1BSH A;  4EYY Q;  1NTZ K;  3VP8 A;  1SQV K;  2IPP A;  4OH8 B;  1GW4 A;  2ZXE B;  2M3B A;  1AVO A;  3L70 G;  3CCR P;  2YMK A;  5CCG A;  2O01 J;  2E74 B;  2K9Y A;  1S5L H;  2H8P D;  1VQP P;  3H1L D;  1A02 F;  1VF5 D;  1HGZ A;  2N9B A;  3CPW O;  3Q5S A;  1IFJ A;  4YXW H;  3TK1 A;  1P84 H;  1RE3 C;  3BAT A;  5KAI H;  1N73 B;  3N4X A;  3L71 E;  1HBW A;  3A5T A;  1A02 J;  2W90 A;  3CCM P;  5AVS B;  2RKL A;  4WY4 D;  3H1J E;  1IJD B;  3JCU E;  1NTM E;  4H0L B;  3L72 D;  1Y8A A;  3WUT A;  2N9Y B;  4L73 A;  5GTI E;  5BU8 B;  2N1T A;  5CMZ A;  3P8C D;  3AEE C;  2GUS A;  5AW2 B;  4BXL A;  1W2B O;  2HG5 D;  4Y28 J;  4WVZ A;  1VL2 A;  3GHG A;  1NO4 A;  2IFN A;  1VQL P;  1VQ7 P;  1LTG C;  1KN7 A;  1DX7 A;  3MP7 B;  2O3J A;  3AE2 C;  1NU1 K;  3LW5 H;  1GU4 A;  4JPZ B;  1X0T A;  2WPR A;  4NPD A;  2RH0 A;  5KJ7 A;  1W5C E;  2KOG A;  4EI2 A;  1SQX G;  2YMY A;  5K5G B;  1BSN A;  2W6B A;  1ZLL A;  1MZ9 A;  3WUU A;  3L70 D;  1LP1 B;  3C9I A;  3L71 G;  4OWF A;  1CSB A;  3H1J G;  1VQ9 P;  3CCE P;  1LNQ A;  1NTM G;  1T6A A;  5AVU B;  1SFC B;  2FXM A;  2E5T A;  3U1A A;  3V6I A;  3IR9 A;  3BAS A;  3KHU A;  3H1H G;  3FX0 A;  2FYU J;  1KIL C;  1T3J A;  1RQU A;  3QWO C;  1X9V A;  2BCC G;  2OTK E;  1LP1 A;  1FOS E;  1PP9 J;  1YIT P;  4DOJ A;  1J1E C;  3B8E B;  2PAJ A;  2KYV A;  2WSE J;  1AFO A;  3VMZ A;  1JM0 A;  3JCU H;  2WPS A;  2FXP A;  1PL5 A;  2SPZ A;  1QX8 A;  2O1J A;  2VRS A;  4I7Z B;  2I1J A;  1YJN P;  5GTI H;  3G9R A;  2JO1 A;  3CXH I;  3CC4 P;  4NPE A;  2PRR A;  2IYP A;  3H1I G;  3HD7 B; 
#chains in the Genus database with same CATH homology
 1KYO I;  3L73 J;  1L0L J;  1NTK J;  3L74 J;  1BCC J;  3L75 J;  3H1K J;  1SQB J;  1P84 I;  2FYU J;  3BCC J;  1SQP J;  3L70 J;  3L71 J;  3H1I J;  3H1H J;  1EZV I;  4D6T J;  1KB9 I;  1PP9 J;  1BE3 J;  3L72 J;  1SQX J;  3H1J J;  1NTZ J;  3CXH I;  4U3F J;  4PD4 I;  3CX5 I;  1BGY J;  3CWB J;  1NU1 J;  1SQV J;  2BCC J;  1SQQ J;  3TGU J;  5KLV J;  1L0N J;  1NTM J;  2IBZ I;  3H1L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...