3H1KJ

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 20
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1kJ00
1SQQJ 5KLVJ 1L0LJ 3CXHI 3L74J 2FYUJ 3H1JJ 3TGUJ 3H1HJ 1EZVI 3H1LJ 1NTMJ 1NTKJ 1SQPJ 4PD4I 3CX5I 3L70J 3H1KJ 3CWBJ 2BCCJ 1KB9I 1BE3J 1NTZJ 3L75J 1BGYJ 1PP9J 1SQBJ 3L71J 3L72J 1SQVJ 1KYOI 1NU1J 4D6TJ 1L0NJ 4U3FJ 1BCCJ 1SQXJ 3H1IJ 1P84I 3BCCJ 2IBZI 3L73J
chains in the Genus database with same CATH superfamily
2K3RA 2WSCH 2MKVA 2HPCA 2OTJP 1M1JC 3VMZA 1DD4A 1EZVD 3LW5J 1YI2P 4RJTA 4JYCA 1SQQE 3L74E 2I1JA 1KQFB 3RK2B 1FE6A 4N3YB 3H1HD 4UB8E 1L0NK 2QG4A 2KI7B 1OMIA 3FWLA 2WTYA 2QM8A 4ASVA 1QLED 2FKWB 1SQBD 1RE4C 2RMZA 1JMMA 1RH5B 2RN0A 2ZYAA 1NYHA 4YXWH 2D2CC 1NAFA 2FYNB 3CX5H 1FC2C 1H0TB 2BCCG 1J1DB 2ZXXA 1U57A 5GTHE 2CPBA 1VPCA 1L0NJ 2XNXA 2Y9ZA 4I6MC 3GMAA 3L71E 3RK2C 3V6IA 3CCLP 2QJKC 2FYZA 4JBZA 4OGQD 4HJGH 3RK2D 5CJ0A 1FS0E 2OYIA 5AVYB 1PIXA 3HE5A 2BCCD 1WMKA 4D6TJ 1HTLC 1N7SB 3KZIE 1W5CE 2FYNC 3EWKA 1NTKE 4H44B 2ZFCA 1YITP 3AEGC 1W2BO 1KTMA 1J1DC 2QE7H 1U7JA 1LTBC 1VF5C 1JY3N 3MIWA 2FFDB 2GUVA 1FZBA 3EFGA 5B66H 2YKPA 3GW6A 4EYYQ 2WSSH 1FDOA 3AE5C 3CC7P 1VF5D 1YYCA 2AXCA 2JR8A 2FXMA 2HYNA 3CX5E 3VMXA 3AECC 1K04A 3TSIA 1SFCC 2A45I 2NPSC 4RESB 1KQLA 3MHVA 5KAIH 2Q6QA 2M3EA 1FZGA 4B86A 3GF3A 1N7SC 1SFCD 2Y9YA 3AE7C 2NPSD 5AW5B 3SFEC 1RE3C 1NO4A 3D71A 4H44C 1KFNA 1LP1B 2FYUK 2WVRA 1OW6A 3V2PA 2ZYGA 1CI6A 1T3UA 1L0LG 1NJIQ 2E74D 3HD7A 3B8EB 3H1LG 3PLNA 1QVGO 2HPCB 1HH0A 2ITAA 4W7ZA 1W2EA 3CCEP 4QMAA 2R3CA 2QJYB 1MFZA 3A3YB 4KT0J 4Y28J 3WMM0 3TGUE 4XFJA 3OJAB 3VYIA 3CCVP 2LXCB 1D7MA 2KNCA 3B71A 3HE4A 3H1JJ 3CX5I 3K5BA 1LWUA 2M5AB 1VQ8P 2WPRA 5B66E 4N6JA 1YJNP 1VQ4P 2KS1A 4OVNF 3PP5A 5AVUB 1NKZB 4GKGA 3GF7A 4L76A 2ZJSE 3UIAA 3H1IG 1L0ND 2ZT9B 3AE4C 1YTZI 4KJMA 3VTPC 4BWNA 1R8EA 3MZWB 1PPJE 1X79B 1S2EA 5CJ4A 1YQ4C 2Z5IA 4U3FE 2FXOA 3BCCE 3TDKA 5KAIE 1NOHA 1LTAC 1X0TA 2VRSA 2QJYC 1SQQJ 3P8CD 5DJUB 1Q90D 3B4SA 3USSA 4TT3H 2OYHA 3CLQA 1N86A 3Q2YA 3BASA 3RL0g 3W68A 3Q5PA 2OARA 4D6TD 4AUWA 1LGHB 3TK1A 1NTME 3IF4A 3AE8C 1P84H 1NU1K 3CWBE 2JEEA 2OTLP 1IJDB 2YKQA 1ZW0A 3L75E 1NTZE 1RE4A 2OYIB 1IFNA 1QVFO 3E7KA 1OW7A 2AEJA 1KQSO 5KAFH 2LR2A 2ZVOB 2GA1A 1K73Q 3S1KA 3CC2P 3Q3DA 3QWOC 2KXPB 2Q1KA 4PV1B 1EDIA 1BE3E 1G1IA 3SWKA 4I7ZB 2WSFH 1BCCE 2Z5HA 4EI2A 4IFFA 3L71J 1NU1J 1HF9A 4R4MA 3M9HA 4WB4A 3NXSA 3WUVA 2H89C 1S3JA 4TLFA 1EXJA 1AFOA 1FJKA 2WSEH 2WT7A 2B89A 4PJ0H 3V2RA 2PAJA 2BEZF 4UB6H 3A0HH 1JO5A 3H1KE 1NTKJ 3I55P 5APUA 4C7NA 5AVRB 2B9BA 2HR3A 1Y8AA 1ZLLA 1PGQA 3VN0A 3CL3D 3V4QA 1CW5A 3Q5SA 1ZRTD 2NRGA 1S9KE 1DEBA 1P84E 1CI6B 2YMKA 1SQQG 3L74G 3H1JD 3HD7B 2Y0CA 5KAFE 1ZMEC 1KILD 1WRGA 2WITA 2IFNA 5K5GB 1SLQA 3HE4B 1GW3A 1SFCA 2M8RA 3TF5A 2NPSA 2WPSA 1LWUB 3RGUA 3B5NC 1KMIZ 3R2PA 1EDKA 2KS1B 3AE2C 1R5SA 1RE3A 2W27A 1SQPE 2JWDA 4LGDE 2YO2A 1SQQD 3B5ND 3ZDMA 2G8YA 2P58A 1PFIA 4PD4H 2E42A 4IOIH 1KC8Q 2K9JA 4PJ0E 1RF0C 2QJPC 3L71G 2KZJA 5KLVE 3HD7C 1IFIA 4UB6E 1P84I 3A0HE 2OTKE 1GDTA 4KHXA 4LC1A 2C0XA 1L2PA 2V7QJ 1G2CA 1NVOA 2OYHB 1J1EB 3M06A 5CMZA 3VMAA 1EC5A 3M0AA 1GTWA 1YTZT 1FOSE 5AVWB 3GG2A 5AVQB 3OW2O 4L74A 1ZV8A 1YIJP 3P7KA 3D70A 1JMBA 1NTKG 4WVZA 3U59A 4XA4A 3E1IA 2NZ2A 1SQXE 1LJ2A 2R3SA 1KB9H 3L71D 1EQ7A 1NU1D 1FU1A 3A2AA 2P10A 3KQGA 3BCCJ 3RK3E 3D6ZA 2P7JA 1IFJA 3CXHI 4IFDK 3V5BA 1PP9E 2ZAEB 1MKMA 2N1TC 2C0WA 3GLMA 3LIEA 3FX0A 3V2NA 4IL6H 2OYHC 4OGQB 1J1EC 1HGZA 3KZIH 2J58A 1U7MA 2N1TD 4IL6X 1KV4A 2GUSA 2YXQB 1MFTA 2QJKB 4PD4E 2M5AA 1NTKD 3CWBJ 1L0LK 1NTZJ 2IZ1A 2YIUB 2WT7B 3CCSP 1ZOYC 3G4SP 1DH3A 3PRJA 5APQA 5AVTB 2IBZE 1SP4A 2PGDA 1JTHA 1USEA 3M9BA 3N7NA 5AW4B 1VL2A 4C7NB 1BE3J 1QEXA 2ZXEB 5KLIB 3CX5D 3SFDC 3A0BE 1VF5B 5B5EH 4BRYB 2YKOA 1L0LJ 2W6JH 2ZVNB 3TGUG 5M1BA 3H1LJ 1BSNA 2H43A 1LTSC 4H0LC 4OGQC 1Y47A 1KB9E 1HVVA 2Z4EA 1OX3A 3CCJP 1DX7A 1NH4A 3RL0C 3OAKA 1GK6A 3O6QA 4H0LD 4DZOA 4JF7A 3CCMP 2YXRB 3L70E 5BVZA 2YIUC 1SFCB 5KJ7C 4PD4I 3RL0D 3KPEA 5AVVB 2NPSB 3W67A 3BRVB 3H1KJ 1VQNP 3L35A 3V2QA 2JKVA 1N7LA 2R44A 1PPJG 4IL6E 1FBMA 1USDA 1Z56A 1FZAA 1NAYA 5KJ7D 4U3FG 3H1IJ 1KYOH 3P32A 2IBZI 5AW6B 3BVHA 3BCCG 5APTA 3FWNA 1HWTC 3KHUA 2E74B 5KLIC 4N78D 2IDBA 1OIPA 4C46A 4JYBA 1KILA 2K9JB 1M56D 3R4YA 3H1HE 2N9BA 1AVYA 3AEBC 4ASWA 5AW1B 3KDPB 1G2CB 1NTMG 1SQBE 3V4WA 3CWBG 3PHLA 4DT0A 3L75G 2WSFJ 1NTZG 4W7YA 2XDJA 3I56P 1JY2O 5B5EE 2OYOA 3MP7B 1TU3F 3BCCD 3B5NA 3IR9A 2IFMA 1FOSF 1SQPJ 1E79H 3NMDA 3A5TA 3FXDA 3II6A 1OXZA 2PRRA 1BE3G 2E74C 2WSEJ 1T8ZA 1A02F 2KOGA 1BCCG 1OVVA 1RF0A 5APVA 2RKLA 5DJTB 2WMMA 1ZR2A 3CWBD 2WZ7A 3CCUP 1NTZD 1KYOE 5AW7B 2IPPA 1JNMA 1FZCB 2E75B 1NWQA 1Q81Q 2I1KA 2XU6A 3H1KG 1SQQK 1VQ5P 1BE3D 2PP6A 4EOTA 1RY3A 1SQXJ 3HTKB 1L0LD 1JTHB 3F5HA 3L37A 3H1LD 1IFMA 1N73C 1BGYE 2O01N 1PGJA 1YHQP 1FAVA 3OA7A 5BU8B 2B87A 2N1TA 3L74J 1BDCA 3NTNA 1FZCC 3H1KD 2KSJA 1VDFA 2HODA 2E75C 4GT1A 1Q86Q 1KYOI 1JOCA 3CD6P 3H1ID 3O6QB 2J5UA 1XTCC 2ZYDA 4OH8B 3TNUB 1EDJA 3VP8A 2E75D 3IN6A 2WQYC 1SQPG 1H89A 1SQVE 2IZ0A 1Q7YQ 1GL2C 2MJZA 3FGAD 3AE1C 2K9YA 1J2JB 3I5CA 4H13C 1VQ6P 5KLVG 1H8AA 1GL2D 1GU5A 3T97A 4XE5B 3H25A 1T2KC 4H13D 3WU2H 1KILB 3L73E 1SVFA 1NTKK 4AQRD 2H88C 3PH0A 1YJWP 1T2KD 1JY3O 2KLVA 4C7RA 2G3AA 3L70J 1SQPD 2WSCJ 3U1AA 3CXHD 1L0NE 1EXIA 2AEMA 4L73A 5AW8B 5KJ7A 2IYOA 4IFMA 3Q1MA 1SQXG 2UWJE 1N8RQ 1ZN5A 3B5NB 1L4AC 2M0BA 1GD2E 3JSVC 1FZFA 2RH0A 2Q9IA 3HUSA 2GM4A 5EFWB 1PP9G 1GU4A 1L4AD 1MZ9A 3P8CE 3QH9A 4BRYA 2C9NY 1M8OB 1UIXA 5E79E 1KILC 2QJPB 1JCDA 3O8ZA 1AV1A 3L72E 4D6TE 1DD3A 4A7PA 1URQC 5CCHC 4WWIA 2LXBA 1IZNB 1SQXD 2I8DA 5CBNA 1GK4A 3CC4P 1URQD 2HG5D 4HB1A 3HRNA 4NPEA 2QM7A 2CPSA 5CCHD 2IBZG 3MUDC 1VQOP 3WU2E 2KSEA 1HUCA 2R32A 4K3AA 2Q5UA 1RF1B 1XTGB 1LT1A 5TISH 3L74D 3H6PA 4L75A 2OQQA 2JP3A 1VQKP 1OVUA 4PD4D 4YTPC 4GDOA 1JUNA 2B87B 3N4XA 3TGUJ 3U1CA 2N1TB 1NHLA 3BRTB 3VP9A 5APSA 2H8PD 5APYA 1JCCA 3L70G 5KTBA 2HODB 2JO1A 3GHGC 2K37A 3A0BH 3KYQA 4O9BA 2QIWA 1RF1C 1ZRTE 1DIPA 2JJLA 3CMEP 2KIKA 1BGYJ 3S4RA 2C9LY 1NTMK 2E76D 1MUUA 1N73A 3H1JE 4U3FJ 2FYUE 5CHXA 2N9YB 1PZQA 2KLUA 1NTZK 1T3JA 1SQVK 1N2DC 3H1HG 2A06E 5TJHA 2O01H 2M3BA 1NKNA 3L70D 3T97B 4ZKUA 2HLOA 3CMAP 1SQBG 3C8VA 3G3ZA 3L36A 3M0DC 4H0LB 4WY4C 5TISE 1FZCA 2WPQA 3EFFK 4W80A 3AEAC 4LLHA 1NTMJ 3RL0B 2DW3A 2XZRA 4HKZH 4WY4D 1KZUB 3L75J 2XKMA 1SQVJ 3JCUH 1LNQA 4BXLA 2YO3A 1BSHA 3IFMA 5KKZB 3HTKA 1GL2A 2W6BA 2IX7C 3VMYA 1JY3P 5APWA 1IK7A 5CCGC 3HUSB 4RKUJ 4HH2A 3PJSK 3LIDA 1AQTA 1BCCJ 2QSIA 1QX8A 3L73J 5CCGD 2L5GB 4I2LC 4GOFA 3RBZA 1S72P 1X9VA 4M3LA 1M7LA 1NGMB 2HFED 1WT6A 2D2CD 5APXA 4DCKA 3TNUA 5AW9B 4GODA 5GTIH 1GZLA 4EDFA 1NU1E 1FDMA 1LT9A 5AW0B 5KKZC 2QA4P 1L4AA 3SSUA 1BGYG 4EIJA 5BU5A 1LTJA 2E43A 3CCQP 1Y9BA 2WPVB 3HUSC 1KYOD 1CZQA 2FBWC 2V4HA 1EZVE 3TGUD 3RBXA 3JCUE 5AVZB 3L72J 4OWFA 2AXTH 1SQPK 1URQA 1LTGC 4U7JA 2V7QH 3IAOA 2AEFA 5CCHA 2CK3H 2O1KA 2XNDH 5KLVK 1KB9I 1VQLP 1BGYD 3WUTA 1SQVG 1PPJD 2P1JA 3AE3C 3MUDA 4U3FD 2XV5A 2B88A 1S1CX 2H7HA 3MTUE 1GMJA 4ZNCA 1AVOA 5H2FH 1N73B 5KLVJ 3L73G 1PGOA 1KN7A 1EZVI 5GTIE 4NPDA 2O3JA 1SQXK 1NTMD 3G6EP 1KQGB 4WBAA 3KXDA 3LW5H 3SWYA 3L75D 2P2UA 2Q3IA 1SQVD 1N7SD 1L0NG 4JQ0D 2FFDC 1JB0J 4H44D 1IK9A 2R5BA 2YMYA 3GHGA 2BCCE 4JPZB 2AXTE 4ZKPA 4AYCA 1A02J 1RF1A 4N78E 1MV8A 2IYPA 3S9OA 1BCCD 3Q5RA 4DJGA 1ZR4A 3L73D 2FYUJ 1GL2B 5L8RJ 3JC22 1S5LH 1OFCX 1IFPA 3NFQA 1IFDA 5AW3B 4Y99B 4H13B 1S5LX 1PP9J 1RQUA 1PL5A 1Q2NA 3L72G 4D6TG 1SS1A 2FY8A 1EDLA 1KFMA 2O1JA 3M0DA 1H88A 3AEEC 4GOEA 2FXPA 4WY4A 3FXEA 3AEFC 1QL2A 5H2FE 4DOJA 1K8AQ 1M1JA 5AW2B 1QGKB 3E1RA 1AJYA 1OW8A 4GIFA 2OGUA 3VOPA 1OWAA 1S9KD 2W6AA 1P84D 1ZXGA 3WUUA 3M91A 5E79H 1LT9B 4CPGA 1VQMP 1L4AB 3H32A 3ITKA 3L72D 1QL1A 1K05A 1LTJB 1Q82Q 1M90Q 4Y99C 1E5WA 4Z1MH 5CCGA 1RHZB 1T6AA 4R4LA 3TYYA 2ZT9C 3MGNA 3HE5B 3M9QA 2K88A 1R5LA 2ZT9D 1S4XA 1G1JA 1RQVA 1URQB 3ABVC 1S5LE 4I1LA 3RK3B 3CPWO 3AE6C 2QVAA 2O01J 2Y0EA 1OZHA 1L0LE 2Q7CA 2E5YA 3H1LE 1PV3A 4RO0A 1LT9C 1HGVA 1SQBK 5KLVD 3H1JG 3CXHH 2BEQD 2FYUG 2WWWA 3C1LA 2L91A 2E5TA 3G71P 1LTJC 1VQPP 2A06G 1AQ5A 1BDDA 1FZEA 2OYIC 2KK7A 1K9MQ 3PTZA 1JY2P 1M57D 1M1KQ 1KORA 1FJPA 2W90A 3H1HJ 3MD0A 2R5DA 1IO4A 1H0TA 1HBWA 3H1IE 2W8ZA 3AE9C 1SQBJ 2Q3EA 4PV1C 3A7OA 1YJ9P 3RK3C 1LTTC 1HJ0A 4I7ZC 4NPFX 4YPCA 1UIIA 4K35A 2FYUD 4PV1D 4ZMDA 3GHGB 2J59M 5AVXB 3RK3D 5C39A 2KZIA 1X22A 2A06D 2YNYA 1PP9D 2E76B 2W83C 1JM0A 1JEKA 2KB7P 3CCRP 2K1AA 1VQ9P 3F89A 2JWAA 2KNCB 1VQ7P 2QRXA 2KUBA 3P8MC 4HYTB 1PGPA 2KP8A 1N7SA 3EQ2A 1OVRA 1HJBA 2P67A 1CSBA 3CXHE 4MN4C 1YBKA 2LKMA 4UB8H 2IBZD 3CI9A 2FFDA 2BCCJ 4WY4B 1ZP0C 3G9RA 5CBOA 3BATA 5AVSB 2JDIH 1NU1G 1M1JB 3SWFA 2A45G 3L4FA 1JY2N 1YQ3C 2E76C 3HD7D 2POHA 1IC2A 1EZVG 2KYVA 3H32B 4YXDC 1AA0A 1LWUC 1KB9D 5GTHH 1FDIA 1X8YA 3D6YA 3C9IA 2QEXP 1LTIC 2SPZA 1KILE 1LP1A 3AEDC 2BASA 2PFXA 1DEEG 2D2CB 2A45H 1KD1Q 2Y0DA 1GW4A
chains in the Genus database with same CATH topology
1SQQJ 5KLVJ 1L0LJ 3CXHI 3L74J 2FYUJ 3H1JJ 3TGUJ 3H1HJ 1EZVI 3H1LJ 1NTMJ 1NTKJ 1SQPJ 4PD4I 3CX5I 3L70J 3H1KJ 3CWBJ 2BCCJ 1KB9I 1BE3J 1NTZJ 3L75J 1BGYJ 1PP9J 1SQBJ 3L71J 3L72J 1SQVJ 1KYOI 1NU1J 4D6TJ 1L0NJ 4U3FJ 1BCCJ 1SQXJ 3H1IJ 1P84I 3BCCJ 2IBZI 3L73J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ J;  5KLV J;  1L0L J;  3CXH I;  3L74 J;  2FYU J;  3H1J J;  3TGU J;  3H1H J;  1EZV I;  3H1L J;  1NTM J;  1NTK J;  1SQP J;  4PD4 I;  3CX5 I;  3L70 J;  3H1K J;  3CWB J;  2BCC J;  1KB9 I;  1BE3 J;  1NTZ J;  3L75 J;  1BGY J;  1PP9 J;  1SQB J;  3L71 J;  3L72 J;  1SQV J;  1KYO I;  1NU1 J;  4D6T J;  1L0N J;  4U3F J;  1BCC J;  1SQX J;  3H1I J;  1P84 I;  3BCC J;  2IBZ I;  3L73 J; 
#chains in the Genus database with same CATH topology
 2K3R A;  2WSC H;  2MKV A;  2HPC A;  2OTJ P;  1M1J C;  3VMZ A;  1DD4 A;  1EZV D;  3LW5 J;  1YI2 P;  4RJT A;  4JYC A;  1SQQ E;  3L74 E;  2I1J A;  1KQF B;  3RK2 B;  1FE6 A;  4N3Y B;  3H1H D;  4UB8 E;  1L0N K;  2QG4 A;  2KI7 B;  1OMI A;  3FWL A;  2WTY A;  2QM8 A;  4ASV A;  1QLE D;  2FKW B;  1SQB D;  1RE4 C;  2RMZ A;  1JMM A;  1RH5 B;  2RN0 A;  2ZYA A;  1NYH A;  4YXW H;  2D2C C;  1NAF A;  2FYN B;  3CX5 H;  1FC2 C;  1H0T B;  2BCC G;  1J1D B;  2ZXX A;  1U57 A;  5GTH E;  2CPB A;  1VPC A;  1L0N J;  2XNX A;  2Y9Z A;  4I6M C;  3GMA A;  3L71 E;  3RK2 C;  3V6I A;  3CCL P;  2QJK C;  2FYZ A;  4JBZ A;  4OGQ D;  4HJG H;  3RK2 D;  5CJ0 A;  1FS0 E;  2OYI A;  5AVY B;  1PIX A;  3HE5 A;  2BCC D;  1WMK A;  4D6T J;  1HTL C;  1N7S B;  3KZI E;  1W5C E;  2FYN C;  3EWK A;  1NTK E;  4H44 B;  2ZFC A;  1YIT P;  3AEG C;  1W2B O;  1KTM A;  1J1D C;  2QE7 H;  1U7J A;  1LTB C;  1VF5 C;  1JY3 N;  3MIW A;  2FFD B;  2GUV A;  1FZB A;  3EFG A;  5B66 H;  2YKP A;  3GW6 A;  4EYY Q;  2WSS H;  1FDO A;  3AE5 C;  3CC7 P;  1VF5 D;  1YYC A;  2AXC A;  2JR8 A;  2FXM A;  2HYN A;  3CX5 E;  3VMX A;  3AEC C;  1K04 A;  3TSI A;  1SFC C;  2A45 I;  2NPS C;  4RES B;  1KQL A;  3MHV A;  5KAI H;  2Q6Q A;  2M3E A;  1FZG A;  4B86 A;  3GF3 A;  1N7S C;  1SFC D;  2Y9Y A;  3AE7 C;  2NPS D;  5AW5 B;  3SFE C;  1RE3 C;  1NO4 A;  3D71 A;  4H44 C;  1KFN A;  1LP1 B;  2FYU K;  2WVR A;  1OW6 A;  3V2P A;  2ZYG A;  1CI6 A;  1T3U A;  1L0L G;  1NJI Q;  2E74 D;  3HD7 A;  3B8E B;  3H1L G;  3PLN A;  1QVG O;  2HPC B;  1HH0 A;  2ITA A;  4W7Z A;  1W2E A;  3CCE P;  4QMA A;  2R3C A;  2QJY B;  1MFZ A;  3A3Y B;  4KT0 J;  4Y28 J;  3WMM 0;  3TGU E;  4XFJ A;  3OJA B;  3VYI A;  3CCV P;  2LXC B;  1D7M A;  2KNC A;  3B71 A;  3HE4 A;  3H1J J;  3CX5 I;  3K5B A;  1LWU A;  2M5A B;  1VQ8 P;  2WPR A;  5B66 E;  4N6J A;  1YJN P;  1VQ4 P;  2KS1 A;  4OVN F;  3PP5 A;  5AVU B;  1NKZ B;  4GKG A;  3GF7 A;  4L76 A;  2ZJS E;  3UIA A;  3H1I G;  1L0N D;  2ZT9 B;  3AE4 C;  1YTZ I;  4KJM A;  3VTP C;  4BWN A;  1R8E A;  3MZW B;  1PPJ E;  1X79 B;  1S2E A;  5CJ4 A;  1YQ4 C;  2Z5I A;  4U3F E;  2FXO A;  3BCC E;  3TDK A;  5KAI E;  1NOH A;  1LTA C;  1X0T A;  2VRS A;  2QJY C;  1SQQ J;  3P8C D;  5DJU B;  1Q90 D;  3B4S A;  3USS A;  4TT3 H;  2OYH A;  3CLQ A;  1N86 A;  3Q2Y A;  3BAS A;  3RL0 g;  3W68 A;  3Q5P A;  2OAR A;  4D6T D;  4AUW A;  1LGH B;  3TK1 A;  1NTM E;  3IF4 A;  3AE8 C;  1P84 H;  1NU1 K;  3CWB E;  2JEE A;  2OTL P;  1IJD B;  2YKQ A;  1ZW0 A;  3L75 E;  1NTZ E;  1RE4 A;  2OYI B;  1IFN A;  1QVF O;  3E7K A;  1OW7 A;  2AEJ A;  1KQS O;  5KAF H;  2LR2 A;  2ZVO B;  2GA1 A;  1K73 Q;  3S1K A;  3CC2 P;  3Q3D A;  3QWO C;  2KXP B;  2Q1K A;  4PV1 B;  1EDI A;  1BE3 E;  1G1I A;  3SWK A;  4I7Z B;  2WSF H;  1BCC E;  2Z5H A;  4EI2 A;  4IFF A;  3L71 J;  1NU1 J;  1HF9 A;  4R4M A;  3M9H A;  4WB4 A;  3NXS A;  3WUV A;  2H89 C;  1S3J A;  4TLF A;  1EXJ A;  1AFO A;  1FJK A;  2WSE H;  2WT7 A;  2B89 A;  4PJ0 H;  3V2R A;  2PAJ A;  2BEZ F;  4UB6 H;  3A0H H;  1JO5 A;  3H1K E;  1NTK J;  3I55 P;  5APU A;  4C7N A;  5AVR B;  2B9B A;  2HR3 A;  1Y8A A;  1ZLL A;  1PGQ A;  3VN0 A;  3CL3 D;  3V4Q A;  1CW5 A;  3Q5S A;  1ZRT D;  2NRG A;  1S9K E;  1DEB A;  1P84 E;  1CI6 B;  2YMK A;  1SQQ G;  3L74 G;  3H1J D;  3HD7 B;  2Y0C A;  5KAF E;  1ZME C;  1KIL D;  1WRG A;  2WIT A;  2IFN A;  5K5G B;  1SLQ A;  3HE4 B;  1GW3 A;  1SFC A;  2M8R A;  3TF5 A;  2NPS A;  2WPS A;  1LWU B;  3RGU A;  3B5N C;  1KMI Z;  3R2P A;  1EDK A;  2KS1 B;  3AE2 C;  1R5S A;  1RE3 A;  2W27 A;  1SQP E;  2JWD A;  4LGD E;  2YO2 A;  1SQQ D;  3B5N D;  3ZDM A;  2G8Y A;  2P58 A;  1PFI A;  4PD4 H;  2E42 A;  4IOI H;  1KC8 Q;  2K9J A;  4PJ0 E;  1RF0 C;  2QJP C;  3L71 G;  2KZJ A;  5KLV E;  3HD7 C;  1IFI A;  4UB6 E;  1P84 I;  3A0H E;  2OTK E;  1GDT A;  4KHX A;  4LC1 A;  2C0X A;  1L2P A;  2V7Q J;  1G2C A;  1NVO A;  2OYH B;  1J1E B;  3M06 A;  5CMZ A;  3VMA A;  1EC5 A;  3M0A A;  1GTW A;  1YTZ T;  1FOS E;  5AVW B;  3GG2 A;  5AVQ B;  3OW2 O;  4L74 A;  1ZV8 A;  1YIJ P;  3P7K A;  3D70 A;  1JMB A;  1NTK G;  4WVZ A;  3U59 A;  4XA4 A;  3E1I A;  2NZ2 A;  1SQX E;  1LJ2 A;  2R3S A;  1KB9 H;  3L71 D;  1EQ7 A;  1NU1 D;  1FU1 A;  3A2A A;  2P10 A;  3KQG A;  3BCC J;  3RK3 E;  3D6Z A;  2P7J A;  1IFJ A;  3CXH I;  4IFD K;  3V5B A;  1PP9 E;  2ZAE B;  1MKM A;  2N1T C;  2C0W A;  3GLM A;  3LIE A;  3FX0 A;  3V2N A;  4IL6 H;  2OYH C;  4OGQ B;  1J1E C;  1HGZ A;  3KZI H;  2J58 A;  1U7M A;  2N1T D;  4IL6 X;  1KV4 A;  2GUS A;  2YXQ B;  1MFT A;  2QJK B;  4PD4 E;  2M5A A;  1NTK D;  3CWB J;  1L0L K;  1NTZ J;  2IZ1 A;  2YIU B;  2WT7 B;  3CCS P;  1ZOY C;  3G4S P;  1DH3 A;  3PRJ A;  5APQ A;  5AVT B;  2IBZ E;  1SP4 A;  2PGD A;  1JTH A;  1USE A;  3M9B A;  3N7N A;  5AW4 B;  1VL2 A;  4C7N B;  1BE3 J;  1QEX A;  2ZXE B;  5KLI B;  3CX5 D;  3SFD C;  3A0B E;  1VF5 B;  5B5E H;  4BRY B;  2YKO A;  1L0L J;  2W6J H;  2ZVN B;  3TGU G;  5M1B A;  3H1L J;  1BSN A;  2H43 A;  1LTS C;  4H0L C;  4OGQ C;  1Y47 A;  1KB9 E;  1HVV A;  2Z4E A;  1OX3 A;  3CCJ P;  1DX7 A;  1NH4 A;  3RL0 C;  3OAK A;  1GK6 A;  3O6Q A;  4H0L D;  4DZO A;  4JF7 A;  3CCM P;  2YXR B;  3L70 E;  5BVZ A;  2YIU C;  1SFC B;  5KJ7 C;  4PD4 I;  3RL0 D;  3KPE A;  5AVV B;  2NPS B;  3W67 A;  3BRV B;  3H1K J;  1VQN P;  3L35 A;  3V2Q A;  2JKV A;  1N7L A;  2R44 A;  1PPJ G;  4IL6 E;  1FBM A;  1USD A;  1Z56 A;  1FZA A;  1NAY A;  5KJ7 D;  4U3F G;  3H1I J;  1KYO H;  3P32 A;  2IBZ I;  5AW6 B;  3BVH A;  3BCC G;  5APT A;  3FWN A;  1HWT C;  3KHU A;  2E74 B;  5KLI C;  4N78 D;  2IDB A;  1OIP A;  4C46 A;  4JYB A;  1KIL A;  2K9J B;  1M56 D;  3R4Y A;  3H1H E;  2N9B A;  1AVY A;  3AEB C;  4ASW A;  5AW1 B;  3KDP B;  1G2C B;  1NTM G;  1SQB E;  3V4W A;  3CWB G;  3PHL A;  4DT0 A;  3L75 G;  2WSF J;  1NTZ G;  4W7Y A;  2XDJ A;  3I56 P;  1JY2 O;  5B5E E;  2OYO A;  3MP7 B;  1TU3 F;  3BCC D;  3B5N A;  3IR9 A;  2IFM A;  1FOS F;  1SQP J;  1E79 H;  3NMD A;  3A5T A;  3FXD A;  3II6 A;  1OXZ A;  2PRR A;  1BE3 G;  2E74 C;  2WSE J;  1T8Z A;  1A02 F;  2KOG A;  1BCC G;  1OVV A;  1RF0 A;  5APV A;  2RKL A;  5DJT B;  2WMM A;  1ZR2 A;  3CWB D;  2WZ7 A;  3CCU P;  1NTZ D;  1KYO E;  5AW7 B;  2IPP A;  1JNM A;  1FZC B;  2E75 B;  1NWQ A;  1Q81 Q;  2I1K A;  2XU6 A;  3H1K G;  1SQQ K;  1VQ5 P;  1BE3 D;  2PP6 A;  4EOT A;  1RY3 A;  1SQX J;  3HTK B;  1L0L D;  1JTH B;  3F5H A;  3L37 A;  3H1L D;  1IFM A;  1N73 C;  1BGY E;  2O01 N;  1PGJ A;  1YHQ P;  1FAV A;  3OA7 A;  5BU8 B;  2B87 A;  2N1T A;  3L74 J;  1BDC A;  3NTN A;  1FZC C;  3H1K D;  2KSJ A;  1VDF A;  2HOD A;  2E75 C;  4GT1 A;  1Q86 Q;  1KYO I;  1JOC A;  3CD6 P;  3H1I D;  3O6Q B;  2J5U A;  1XTC C;  2ZYD A;  4OH8 B;  3TNU B;  1EDJ A;  3VP8 A;  2E75 D;  3IN6 A;  2WQY C;  1SQP G;  1H89 A;  1SQV E;  2IZ0 A;  1Q7Y Q;  1GL2 C;  2MJZ A;  3FGA D;  3AE1 C;  2K9Y A;  1J2J B;  3I5C A;  4H13 C;  1VQ6 P;  5KLV G;  1H8A A;  1GL2 D;  1GU5 A;  3T97 A;  4XE5 B;  3H25 A;  1T2K C;  4H13 D;  3WU2 H;  1KIL B;  3L73 E;  1SVF A;  1NTK K;  4AQR D;  2H88 C;  3PH0 A;  1YJW P;  1T2K D;  1JY3 O;  2KLV A;  4C7R A;  2G3A A;  3L70 J;  1SQP D;  2WSC J;  3U1A A;  3CXH D;  1L0N E;  1EXI A;  2AEM A;  4L73 A;  5AW8 B;  5KJ7 A;  2IYO A;  4IFM A;  3Q1M A;  1SQX G;  2UWJ E;  1N8R Q;  1ZN5 A;  3B5N B;  1L4A C;  2M0B A;  1GD2 E;  3JSV C;  1FZF A;  2RH0 A;  2Q9I A;  3HUS A;  2GM4 A;  5EFW B;  1PP9 G;  1GU4 A;  1L4A D;  1MZ9 A;  3P8C E;  3QH9 A;  4BRY A;  2C9N Y;  1M8O B;  1UIX A;  5E79 E;  1KIL C;  2QJP B;  1JCD A;  3O8Z A;  1AV1 A;  3L72 E;  4D6T E;  1DD3 A;  4A7P A;  1URQ C;  5CCH C;  4WWI A;  2LXB A;  1IZN B;  1SQX D;  2I8D A;  5CBN A;  1GK4 A;  3CC4 P;  1URQ D;  2HG5 D;  4HB1 A;  3HRN A;  4NPE A;  2QM7 A;  2CPS A;  5CCH D;  2IBZ G;  3MUD C;  1VQO P;  3WU2 E;  2KSE A;  1HUC A;  2R32 A;  4K3A A;  2Q5U A;  1RF1 B;  1XTG B;  1LT1 A;  5TIS H;  3L74 D;  3H6P A;  4L75 A;  2OQQ A;  2JP3 A;  1VQK P;  1OVU A;  4PD4 D;  4YTP C;  4GDO A;  1JUN A;  2B87 B;  3N4X A;  3TGU J;  3U1C A;  2N1T B;  1NHL A;  3BRT B;  3VP9 A;  5APS A;  2H8P D;  5APY A;  1JCC A;  3L70 G;  5KTB A;  2HOD B;  2JO1 A;  3GHG C;  2K37 A;  3A0B H;  3KYQ A;  4O9B A;  2QIW A;  1RF1 C;  1ZRT E;  1DIP A;  2JJL A;  3CME P;  2KIK A;  1BGY J;  3S4R A;  2C9L Y;  1NTM K;  2E76 D;  1MUU A;  1N73 A;  3H1J E;  4U3F J;  2FYU E;  5CHX A;  2N9Y B;  1PZQ A;  2KLU A;  1NTZ K;  1T3J A;  1SQV K;  1N2D C;  3H1H G;  2A06 E;  5TJH A;  2O01 H;  2M3B A;  1NKN A;  3L70 D;  3T97 B;  4ZKU A;  2HLO A;  3CMA P;  1SQB G;  3C8V A;  3G3Z A;  3L36 A;  3M0D C;  4H0L B;  4WY4 C;  5TIS E;  1FZC A;  2WPQ A;  3EFF K;  4W80 A;  3AEA C;  4LLH A;  1NTM J;  3RL0 B;  2DW3 A;  2XZR A;  4HKZ H;  4WY4 D;  1KZU B;  3L75 J;  2XKM A;  1SQV J;  3JCU H;  1LNQ A;  4BXL A;  2YO3 A;  1BSH A;  3IFM A;  5KKZ B;  3HTK A;  1GL2 A;  2W6B A;  2IX7 C;  3VMY A;  1JY3 P;  5APW A;  1IK7 A;  5CCG C;  3HUS B;  4RKU J;  4HH2 A;  3PJS K;  3LID A;  1AQT A;  1BCC J;  2QSI A;  1QX8 A;  3L73 J;  5CCG D;  2L5G B;  4I2L C;  4GOF A;  3RBZ A;  1S72 P;  1X9V A;  4M3L A;  1M7L A;  1NGM B;  2HFE D;  1WT6 A;  2D2C D;  5APX A;  4DCK A;  3TNU A;  5AW9 B;  4GOD A;  5GTI H;  1GZL A;  4EDF A;  1NU1 E;  1FDM A;  1LT9 A;  5AW0 B;  5KKZ C;  2QA4 P;  1L4A A;  3SSU A;  1BGY G;  4EIJ A;  5BU5 A;  1LTJ A;  2E43 A;  3CCQ P;  1Y9B A;  2WPV B;  3HUS C;  1KYO D;  1CZQ A;  2FBW C;  2V4H A;  1EZV E;  3TGU D;  3RBX A;  3JCU E;  5AVZ B;  3L72 J;  4OWF A;  2AXT H;  1SQP K;  1URQ A;  1LTG C;  4U7J A;  2V7Q H;  3IAO A;  2AEF A;  5CCH A;  2CK3 H;  2O1K A;  2XND H;  5KLV K;  1KB9 I;  1VQL P;  1BGY D;  3WUT A;  1SQV G;  1PPJ D;  2P1J A;  3AE3 C;  3MUD A;  4U3F D;  2XV5 A;  2B88 A;  1S1C X;  2H7H A;  3MTU E;  1GMJ A;  4ZNC A;  1AVO A;  5H2F H;  1N73 B;  5KLV J;  3L73 G;  1PGO A;  1KN7 A;  1EZV I;  5GTI E;  4NPD A;  2O3J A;  1SQX K;  1NTM D;  3G6E P;  1KQG B;  4WBA A;  3KXD A;  3LW5 H;  3SWY A;  3L75 D;  2P2U A;  2Q3I A;  1SQV D;  1N7S D;  1L0N G;  4JQ0 D;  2FFD C;  1JB0 J;  4H44 D;  1IK9 A;  2R5B A;  2YMY A;  3GHG A;  2BCC E;  4JPZ B;  2AXT E;  4ZKP A;  4AYC A;  1A02 J;  1RF1 A;  4N78 E;  1MV8 A;  2IYP A;  3S9O A;  1BCC D;  3Q5R A;  4DJG A;  1ZR4 A;  3L73 D;  2FYU J;  1GL2 B;  5L8R J;  3JC2 2;  1S5L H;  1OFC X;  1IFP A;  3NFQ A;  1IFD A;  5AW3 B;  4Y99 B;  4H13 B;  1S5L X;  1PP9 J;  1RQU A;  1PL5 A;  1Q2N A;  3L72 G;  4D6T G;  1SS1 A;  2FY8 A;  1EDL A;  1KFM A;  2O1J A;  3M0D A;  1H88 A;  3AEE C;  4GOE A;  2FXP A;  4WY4 A;  3FXE A;  3AEF C;  1QL2 A;  5H2F E;  4DOJ A;  1K8A Q;  1M1J A;  5AW2 B;  1QGK B;  3E1R A;  1AJY A;  1OW8 A;  4GIF A;  2OGU A;  3VOP A;  1OWA A;  1S9K D;  2W6A A;  1P84 D;  1ZXG A;  3WUU A;  3M91 A;  5E79 H;  1LT9 B;  4CPG A;  1VQM P;  1L4A B;  3H32 A;  3ITK A;  3L72 D;  1QL1 A;  1K05 A;  1LTJ B;  1Q82 Q;  1M90 Q;  4Y99 C;  1E5W A;  4Z1M H;  5CCG A;  1RHZ B;  1T6A A;  4R4L A;  3TYY A;  2ZT9 C;  3MGN A;  3HE5 B;  3M9Q A;  2K88 A;  1R5L A;  2ZT9 D;  1S4X A;  1G1J A;  1RQV A;  1URQ B;  3ABV C;  1S5L E;  4I1L A;  3RK3 B;  3CPW O;  3AE6 C;  2QVA A;  2O01 J;  2Y0E A;  1OZH A;  1L0L E;  2Q7C A;  2E5Y A;  3H1L E;  1PV3 A;  4RO0 A;  1LT9 C;  1HGV A;  1SQB K;  5KLV D;  3H1J G;  3CXH H;  2BEQ D;  2FYU G;  2WWW A;  3C1L A;  2L91 A;  2E5T A;  3G71 P;  1LTJ C;  1VQP P;  2A06 G;  1AQ5 A;  1BDD A;  1FZE A;  2OYI C;  2KK7 A;  1K9M Q;  3PTZ A;  1JY2 P;  1M57 D;  1M1K Q;  1KOR A;  1FJP A;  2W90 A;  3H1H J;  3MD0 A;  2R5D A;  1IO4 A;  1H0T A;  1HBW A;  3H1I E;  2W8Z A;  3AE9 C;  1SQB J;  2Q3E A;  4PV1 C;  3A7O A;  1YJ9 P;  3RK3 C;  1LTT C;  1HJ0 A;  4I7Z C;  4NPF X;  4YPC A;  1UII A;  4K35 A;  2FYU D;  4PV1 D;  4ZMD A;  3GHG B;  2J59 M;  5AVX B;  3RK3 D;  5C39 A;  2KZI A;  1X22 A;  2A06 D;  2YNY A;  1PP9 D;  2E76 B;  2W83 C;  1JM0 A;  1JEK A;  2KB7 P;  3CCR P;  2K1A A;  1VQ9 P;  3F89 A;  2JWA A;  2KNC B;  1VQ7 P;  2QRX A;  2KUB A;  3P8M C;  4HYT B;  1PGP A;  2KP8 A;  1N7S A;  3EQ2 A;  1OVR A;  1HJB A;  2P67 A;  1CSB A;  3CXH E;  4MN4 C;  1YBK A;  2LKM A;  4UB8 H;  2IBZ D;  3CI9 A;  2FFD A;  2BCC J;  4WY4 B;  1ZP0 C;  3G9R A;  5CBO A;  3BAT A;  5AVS B;  2JDI H;  1NU1 G;  1M1J B;  3SWF A;  2A45 G;  3L4F A;  1JY2 N;  1YQ3 C;  2E76 C;  3HD7 D;  2POH A;  1IC2 A;  1EZV G;  2KYV A;  3H32 B;  4YXD C;  1AA0 A;  1LWU C;  1KB9 D;  5GTH H;  1FDI A;  1X8Y A;  3D6Y A;  3C9I A;  2QEX P;  1LTI C;  2SPZ A;  1KIL E;  1LP1 A;  3AED C;  2BAS A;  2PFX A;  1DEE G;  2D2C B;  2A45 H;  1KD1 Q;  2Y0D A;  1GW4 A; 
#chains in the Genus database with same CATH homology
 1SQQ J;  5KLV J;  1L0L J;  3CXH I;  3L74 J;  2FYU J;  3H1J J;  3TGU J;  3H1H J;  1EZV I;  3H1L J;  1NTM J;  1NTK J;  1SQP J;  4PD4 I;  3CX5 I;  3L70 J;  3H1K J;  3CWB J;  2BCC J;  1KB9 I;  1BE3 J;  1NTZ J;  3L75 J;  1BGY J;  1PP9 J;  1SQB J;  3L71 J;  3L72 J;  1SQV J;  1KYO I;  1NU1 J;  4D6T J;  1L0N J;  4U3F J;  1BCC J;  1SQX J;  3H1I J;  1P84 I;  3BCC J;  2IBZ I;  3L73 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...