3H1LG

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1lG00
1SQQG 1SQBG 3H1IG 3L72G 2IBZG 3L73G 3TGUG 1NTKG 4D6TG 3H1LG 1NU1G 1BCCG 1SQXG 1NTMG 4U3FG 5KLVG 1PP9G 3L75G 1KB9H 1BE3G 1PPJG 1L0LG 3CX5H 3CXHH 3CWBG 3L70G 1BGYG 3L74G 3H1KG 3H1HG 1L0NG 4PD4H 1NTZG 2BCCG 3BCCG 2A06G 1KYOH 1EZVG 1P84H 3L71G 2FYUG 3H1JG 1SQVG 1SQPG
chains in the Genus database with same CATH superfamily
1JUNA 2FY8A 2QEXP 3IAOA 4JYBA 1LP1B 4C7RA 1JMMA 1FC2C 1T2KD 2JP3A 2Q3IA 2XU6A 1AJYA 1NTZJ 2E76B 2FFDB 2K88A 2OARA 3RL0g 1M56D 1M7LA 4Y99B 1LTGC 3CX5H 1XTGB 3H1KG 2E76C 2FYUK 1S5LH 2FFDC 1JCDA 1HUCA 4LGDE 1FJKA 3HRNA 2FBWC 1JMBA 1HVVA 4Y99C 1LP1A 3M0AA 3Q5RA 1L0ND 1VQPP 2WMMA 3OW2O 1HJBA 3M9HA 2XZRA 4C46A 4GKGA 1FZEA 3A2AA 2V7QH 3VMZA 1YIJP 1RE4C 2QE7H 3V4QA 3BRTB 3GG2A 3HE4B 2JEEA 3RK3D 3L74G 3L71E 1EZVD 4PJ0E 1SQBE 1L4AD 3VP8A 2D2CB 2O1JA 3H1JG 3LW5H 1HF9A 4HJGH 3U1CA 1RE4A 2JO1A 4IL6H 1LTSC 4YXWH 3AE7C 1JY3N 1KC8Q 2Z4EA 2D2CC 1BCCD 1RQUA 5BVZA 5H2FE 3HE4A 1NTMG 2A45H 3GMAA 2WPRA 1AVYA 1NAYA 1P84D 3FX0A 1IFJA 2Q7CA 1SQPK 1T3UA 1H8AA 2A06G 5KJ7D 3S1KA 2XKMA 3N4XA 1SVFA 2H7HA 1T6AA 1FE6A 3GHGB 2P7JA 2E75D 2XV5A 3L75J 5CBNA 3GW6A 2KS1B 3NFQA 3PH0A 1T3JA 3NMDA 1VL2A 3GHGC 3H1HD 1NTKJ 4GDOA 2P67A 3BCCD 3G3ZA 1GZLA 1ZR4A 1NTZG 2YXQB 2R3SA 3L72D 2JR8A 3H1ID 2K9YA 1URQB 2C0WA 2K9JB 1PGOA 2XNDH 1GW4A 2Z5IA 3M0DC 3L4FA 1X22A 1KQGB 5APVA 5APUA 2ZAEB 1JY2O 3I56P 4L76A 5BU8B 1XTCC 2K37A 4RO0A 2WT7B 1S3JA 5L8RJ 1KZUB 1AVOA 2IYPA 2JJLA 1URQC 3FGAD 4U3FE 4Z1MH 1JTHB 5AW1B 1PP9E 3S9OA 3TNUB 3L71J 3JSVC 1L0LK 3CCSP 2HG5D 1SQBJ 3L70D 3EWKA 2KXPB 2IZ0A 4ZKUA 1MFTA 1SQQK 1Z56A 1D7MA 1URQA 2FYZA 5AW4B 5CCGC 3CXHD 2JDIH 3CCQP 2I8DA 4HB1A 5AVTB 5CMZA 1L0NK 2J58A 1GTWA 3H1LJ 2WT7A 1JB0J 3VMYA 2J59M 1KYOI 3AEBC 1SQPE 4DZOA 3VMXA 1NU1E 1JTHA 1S9KE 3TNUA 2KSEA 1J1DB 5CCGA 2P10A 4H13B 5KAFE 4PD4I 2BCCE 5CCHD 4EOTA 1M1KQ 4ASVA 1FZAA 1PGPA 2G3AA 4O9BA 3QWOC 4N6JA 1J1DC 2O01N 5AW7B 4H13C 1FZCB 3S4RA 1NH4A 2FYUJ 4JBZA 3CD6P 3VP9A 1KB9H 3F5HA 4I7ZB 1EZVI 1Y8AA 1SQVK 1FZCC 3LIDA 1E79H 2UWJE 1FAVA 5CJ4A 5DJUB 4IOIH 1RY3A 4I7ZC 3L75G 4PV1D 1H0TB 2R5BA 4HYTB 4HH2A 3AECC 1FZCA 2IBZI 1Q81Q 4D6TD 5APXA 1NTKG 2R44A 1YHQP 5TISE 2R5DA 1PP9J 4ZKPA 1GK4A 3W67A 5KLIB 2P2UA 3USSA 1L0NE 5EFWB 3TGUJ 2KZJA 1H0TA 3PP5A 2W83C 2KNCA 4CPGA 4OGQB 2I1JA 1ZMEC 1OFCX 2BEQD 1RF1B 5KLIC 2KP8A 3HUSB 1JO5A 1SP4A 1BE3D 4PJ0H 1K8AQ 4KT0J 1SQXG 4M3LA 1GL2B 3RK3E 1VF5D 4OGQC 4LC1A 1EZVE 3WUVA 3MHVA 3TF5A 2Q6QA 3JC22 3CI9A 4H0LB 2M3EA 1RF1C 3CWBJ 1PGQA 2KK7A 2WPSA 3HUSC 3JCUE 4RJTA 3Q5PA 4IFDK 1GL2C 1PPJD 3H1LG 3AE6C 5AW6B 3HD7D 4H0LC 1USEA 1FBMA 1R5LA 2ZXXA 5H2FH 2KOGA 1RF1A 1HJ0A 2YNYA 3TSIA 4BXLA 1BCCE 3HUSA 5AVVB 2W27A 1X79B 4DT0A 1DH3A 1VQKP 4OH8B 1P84E 3B4SA 1JY2P 2PP6A 1IFIA 4KHXA 1YQ3C 3A0HE 1T2KC 1DX7A 3KZIE 1N7SD 2FYUG 2FKWB 1NU1D 3KYQA 3CXHI 1S9KD 1G1JA 3H1KD 1LTBC 4UB6E 1IFNA 1L0LJ 3RL0D 5AVUB 2FXOA 4K3AA 1U7JA 1SFCD 2V4HA 2BEZF 3RK2D 1ZV8A 3H1HE 2L5GB 1K9MQ 1SQQJ 3BCCE 2GUSA 3V2RA 3L72E 1L0NJ 3L73E 2YO3A 1DEEG 2QJPB 3RBXA 1FZFA 4JQ0D 2OTKE 3L36A 2M5AB 2OQQA 3A3YB 2H88C 4GOEA 1L4AB 1LTJB 3MGNA 1NOHA 5AW0B 2KUBA 1AQ5A 1PP9G 5KLVJ 2QJPC 4ASWA 1H89A 3EFFK 1IC2A 1YJNP 3H1JD 3A5TA 2YMKA 4JPZB 3E1IA 2NPSD 1L4AC 1IK7A 1LTJC 2B87B 3L70E 2IYOA 3MD0A 3TGUG 4IFMA 2IPPA 1KYOD 3SFEC 2JKVA 4GT1A 1NO4A 1FS0E 2M5AA 3CXHE 1NTMD 1L4AA 4TT3H 1LTJA 1SQVJ 3OAKA 4PD4D 2XNXA 2OGUA 1FOSF 3CWBG 2A06D 2HR3A 5KAFH 2FFDA 2ZT9B 2B87A 2E75B 5DJTB 1LTIC 1RHZB 5KJ7C 2O3JA 3G4SP 2WSCH 3CC7P 3CCUP 1BSNA 2E74D 1PV3A 1MUUA 2QIWA 2ZT9C 1GW3A 2E75C 1OW8A 1MZ9A 2OTLP 1CSBA 1N86A 2K1AA 1FDIA 2RKLA 3AEFC 1PL5A 1LWUB 1RH5B 1EDKA 4H44D 1PGJA 3F89A 3CPWO 1OW6A 2E5YA 4L73A 1AV1A 1KQLA 1WRGA 1BGYJ 5APSA 4XFJA 5AW5B 4C7NB 3EQ2A 2IBZD 2Y9YA 1LGHB 2WVRA 1K05A 1LWUC 4JF7A 4LLHA 2A45G 3H1IJ 1L0LG 5APTA 2OYHB 2IDBA 2QG4A 4D6TE 2Z5HA 5TISH 1W5CE 3BVHA 1NU1K 2L91A 3IF4A 5AVZB 1VQLP 1LWUA 3LIEA 1SQQG 1LT1A 1JNMA 1YJ9P 2OYHC 1H88A 4EYYQ 1S72P 5APYA 4C7NA 3C8VA 2Y0EA 3CX5I 2B9BA 2YKOA 2QJKB 2E43A 2FYNB 4U7JA 5KLVG 2Y9ZA 3GF7A 3K5BA 3L35A 2HLOA 3BASA 1N2DC 3CCRP 3L73D 2QJKC 1BE3E 1OVVA 2FYNC 1GU5A 2ZYAA 1Q86Q 2GA1A 3GHGA 3JCUH 2D2CD 2NZ2A 5CCHC 2P1JA 3Q3DA 4WVZA 2KS1A 4L74A 3WU2E 1YYCA 4A7PA 2I1KA 1PPJE 1SQVG 2LKMA 5B5EH 2FXPA 3CLQA 1LT9B 2P58A 3VYIA 3M0DA 3SWFA 1ZRTD 2DW3A 2JWAA 3QH9A 2WQYC 3N7NA 3C9IA 1P84H 4PV1B 1PFIA 1NTMK 3AE1C 1LT9C 2K9JA 1DD4A 2YKPA 3L75D 1IJDB 2PGDA 3CCMP 3A0HH 2WSEJ 3KZIH 2Q1KA 3OJAB 1S2EA 1JOCA 1Q7YQ 2IX7C 2ZYDA 5GTIE 4GIFA 4PV1C 2QM7A 2ZXEB 3O8ZA 2CPBA 2WPQA 1NTKD 2A45I 1USDA 3PRJA 1LT9A 1DD3A 4UB6H 1YI2P 3H1KE 3HTKB 1QX8A 1S5LE 3KDPB 2Y0DA 1KQSO 4N3YB 1BGYG 1NYHA 2KYVA 1M90Q 4BRYB 4EI2A 1OIPA 3H1IG 3AE9C 1IFDA 2KB7P 2QJYB 2NRGA 3BATA 1VF5B 2GM4A 3H32B 1SQXD 2CPSA 4WY4D 3L74E 1S5LX 2ZYGA 2QJYC 3M91A 1QEXA 1BE3J 3H1JE 4BRYA 1Q2NA 1VF5C 5CCGD 2YO2A 2YXRB 3HD7B 2HPCB 3H1LD 1U7MA 1MFZA 3TDKA 2B89A 1M8OB 1KYOE 4U3FJ 2OTJP 3HD7C 1JY2N 1KILE 3H32A 1LTAC 1NTME 4UB8E 3D70A 2MKVA 4PD4E 3SSUA 1G2CB 2A06E 3GLMA 3M9QA 1OWAA 2Q9IA 3R4YA 3HD7A 2Y0CA 4IL6X 3CCJP 3RGUA 1ZOYC 3FWNA 2W6BA 3AE8C 1MKMA 3L71G 1PIXA 1DIPA 3RL0B 5K5GB 1SQBG 1N73B 1SQPJ 1Y47A 1SFCB 4R4LA 2E5TA 1NU1J 1X8YA 2OYIB 1N7LA 2C9LY 2BCCJ 1E5WA 3RL0C 3CCLP 2JWDA 2LXCB 1N73C 3T97B 2QRXA 1NHLA 1G2CA 5BU5A 1SFCC 3MTUE 2M8RA 1NKZB 1NTZE 3V6IA 2R3CA 2WSCJ 2WSEH 2OYIC 5AVQB 3CMEP 4MN4C 1KORA 4AYCA 2IBZE 1SS1A 1BSHA 2XDJA 1KB9I 1N73A 3P32A 2H43A 1SFCA 1FZBA 1YQ4C 1UIIA 1GL2A 1RF0C 2NPSB 1ZN5A 1Q90D 1OZHA 1VPCA 4TLFA 5KKZB 4I2LC 5TJHA 5AVXB 1VQ9P 3TGUD 1HTLC 3Q5SA 3CX5D 3MP7B 2NPSC 2WZ7A 2W8ZA 1RF0A 1ZLLA 4YTPC 5KKZC 4Y28J 2POHA 3OA7A 1L2PA 3TYYA 5AW3B 1DEBA 2J5UA 1UIXA 2NPSA 4XE5B 1CW5A 3SWYA 1JY3O 1S1CX 1GDTA 1JCCA 3GF3A 1FDOA 1HH0A 3B5ND 2WWWA 2AXCA 1EQ7A 3WUTA 3A0BE 1SQXK 3RK3B 2YKQA 3WU2H 4U3FG 3H6PA 1EDIA 3L74D 1J1EB 3MUDC 2HYNA 3VN0A 2N1TD 3D6ZA 3SFDC 4H44B 3Q1MA 3RK3C 2LXBA 4QMAA 2FXMA 3E7KA 1EC5A 1J1EC 1ZRTE 1VQ6P 3O6QB 2RMZA 1A02J 4DJGA 3MUDA 5E79E 1GK6A 4H44C 4IFFA 2YIUB 1KILD 3L75E 2RN0A 1SQPG 5AW2B 3D6YA 5GTIH 1L0LD 1K73Q 1NU1G 1NAFA 1NKNA 2WSFJ 1OXZA 1BCCJ 1VQ5P 2YIUC 3CL3D 2BCCG 2G8YA 1OW7A 2ZVOB 2OYOA 1WMKA 1EXJA 1NTKE 5M1BA 1YTZI 1SQQD 3A7OA 1HGVA 3R2PA 5GTHE 2C0XA 3V2PA 1R5SA 3KQGA 3G6EP 3O6QA 2M3BA 1HBWA 5KAIE 3IN6A 3NTNA 4DOJA 3MIWA 4N78D 4NPDA 1VQ7P 1EXIA 1KFNA 2AEFA 2RH0A 1ZR2A 1R8EA 1OMIA 2N9BA 5KLVD 1S4XA 3M06A 4RESB 4I1LA 5KJ7A 3VMAA 1NTZD 1ZP0C 3U1AA 2HFED 2C9NY 4ZMDA 2IZ1A 2CK3H 3H1HJ 3HE5B 1SQXE 3BCCJ 2YMYA 3WUUA 3II6A 4GOFA 1U57A 3FWLA 3P8CD 2AXTE 5AVWB 3L72J 3L73J 1IFPA 2E76D 3Q2YA 2PAJA 4WBAA 1KTMA 2QSIA 1SQVD 3H1LE 1KYOH 2KI7B 1RQVA 2LR2A 3AEAC 2BASA 3RBZA 4DCKA 2IFMA 4UB8H 3AEDC 3CC2P 1L0NG 4PD4H 3HE5A 1FU1A 3L70J 1LJ2A 2WPVB 4JYCA 5KTBA 4HKZH 2KSJA 1KD1Q 3KXDA 3M9BA 1FDMA 3D71A 3AE3C 2OYHA 3E1RA 2ZT9D 2FYUE 3CCEP 2ZFCA 3ITKA 5CHXA 3AE4C 1EZVG 4I6MC 4R4MA 4NPFX 2WITA 1YJWP 1BGYD 1G1IA 1N8RQ 1AFOA 2QM8A 4EDFA 2ZJSE 2R32A 3G9RA 2H89C 2M0BA 3TK1A 3U59A 2O1KA 1W2BO 1OX3A 4WB4A 1NVOA 3FXEA 3V5BA 1KB9D 1VQ4P 2IBZG 2WSFH 2W6JH 1BCCG 1K04A 1JY3P 3VTPC 5B66E 4WY4B 3FXDA 5CCHA 3CMAP 1OVUA 1FOSE 3CC4P 1QVFO 2PFXA 4OWFA 2KZIA 3AEGC 4ZNCA 3ZDMA 4WY4C 1SQXJ 1A02F 4WWIA 2WTYA 2IFNA 3UIAA 4L75A 4GODA 2AEMA 3TGUE 3BRVB 3CX5E 1EDJA 1EDLA 1QGKB 3V2QA 1KN7A 2QA4P 2AEJA 4WY4A 4D6TJ 1KFMA 2ITAA 3H1HG 1Y9BA 3B71A 3BCCG 4XA4A 1QL1A 5KLVK 3CWBE 3L72G 3L73G 2N9YB 3C1LA 1NTZK 2ZVNB 4RKUJ 5AVSB 2E42A 3A0BH 1BDDA 2KLUA 1URQD 3L71D 3MZWB 1KQFB 1SQBD 2MJZA 1M57D 3HTKA 3P8MC 1T8ZA 2PRRA 3L70G 1VQOP 2GUVA 2W6AA 4OVNF 3P7KA 1CI6B 1YITP 4IL6E 1VQNP 4W7ZA 2W90A 5E79H 1HWTC 2WSSH 1VQ8P 3AE2C 2O01J 2SPZA 2K3RA 3CXHH 2KNCB 2QVAA 3PJSK 1ZW0A 1BDCA 3IR9A 1SLQA 2H8PD 1L0LE 4B86A 2VRSA 1AQTA 4BWNA 1QVGO 3SWKA 1N7SB 1P84I 1Q82Q 5GTHH 5C39A 1CI6A 1SQQE 1IO4A 4H13D 2FYUD 5KAIH 1LNQA 3NXSA 4KJMA 2HPCA 3AE5C 1TU3F 2B88A 4W7YA 1NJIQ 1IZNB 3AEEC 1N7SC 1PZQA 1IK9A 4N78E 3WMM0 3RK2B 1WT6A 1IFMA 3H1KJ 4K35A 1RE3C 1FJPA 3B5NB 5KLVE 1KV4A 1QL2A 1X0TA 1N7SA 1LTTC 3VOPA 3RK2C 2HODB 5AW9B 3PLNA 4AUWA 1ZXGA 1VDFA 3I5CA 5CBOA 2AXTH 3B5NC 1VQMP 1RE3A 1X9VA 2N1TB 3P8CE 3B8EB 4U3FD 1JM0A 1NWQA 2V7QJ 5AW8B 3ABVC 1PP9D 2KIKA 4EIJA 4D6TG 4AQRD 1J2JB 2OYIA 3V4WA 5B5EE 1MV8A 5AVRB 4NPEA 1GMJA 2KLVA 1SQVE 3L37A 1OVRA 3KHUA 1HGZA 5AVYB 2N1TC 3L74J 3W68A 1YTZT 1M1JB 3B5NA 4YXDC 1NTKK 3T97A 1JEKA 1AA0A 5APWA 3LW5J 3H1JJ 4W80A 5APQA 1KILB 2HODA 3V2NA 1M1JC 1YBKA 2N1TA 2Q3EA 1SQPD 1GD2E 3IFMA 1CZQA 3CCVP 4OGQD 1KILC 3CWBD 2BCCD 1BE3G 1NTMJ 3PHLA 1FZGA 1GU4A 1KMIZ 1M1JA 3EFGA 1SQBK 5CJ0A 2E74B 1GL2D 1NGMB 1BGYE 3PTZA 4H0LD 1QLED 1KILA 2O01H 1PPJG 3I55P 3G71P 3KPEA 3H1IE 3H25A 2E74C 2Q5UA 4YPCA 1W2EA 1KB9E 5B66H
chains in the Genus database with same CATH topology
1SQQG 1SQBG 3H1IG 3L72G 2IBZG 3L73G 3TGUG 1NTKG 4D6TG 3H1LG 1NU1G 1BCCG 1SQXG 1NTMG 4U3FG 5KLVG 1PP9G 3L75G 1KB9H 1BE3G 1PPJG 1L0LG 3CX5H 3CXHH 3CWBG 3L70G 1BGYG 3L74G 3H1KG 3H1HG 1L0NG 4PD4H 1NTZG 2BCCG 3BCCG 2A06G 1KYOH 1EZVG 1P84H 3L71G 2FYUG 3H1JG 1SQVG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  1SQB G;  3H1I G;  3L72 G;  2IBZ G;  3L73 G;  3TGU G;  1NTK G;  4D6T G;  3H1L G;  1NU1 G;  1BCC G;  1SQX G;  1NTM G;  4U3F G;  5KLV G;  1PP9 G;  3L75 G;  1KB9 H;  1BE3 G;  1PPJ G;  1L0L G;  3CX5 H;  3CXH H;  3CWB G;  3L70 G;  1BGY G;  3L74 G;  3H1K G;  3H1H G;  1L0N G;  4PD4 H;  1NTZ G;  2BCC G;  3BCC G;  2A06 G;  1KYO H;  1EZV G;  1P84 H;  3L71 G;  2FYU G;  3H1J G;  1SQV G;  1SQP G; 
#chains in the Genus database with same CATH topology
 1JUN A;  2FY8 A;  2QEX P;  3IAO A;  4JYB A;  1LP1 B;  4C7R A;  1JMM A;  1FC2 C;  1T2K D;  2JP3 A;  2Q3I A;  2XU6 A;  1AJY A;  1NTZ J;  2E76 B;  2FFD B;  2K88 A;  2OAR A;  3RL0 g;  1M56 D;  1M7L A;  4Y99 B;  1LTG C;  3CX5 H;  1XTG B;  3H1K G;  2E76 C;  2FYU K;  1S5L H;  2FFD C;  1JCD A;  1HUC A;  4LGD E;  1FJK A;  3HRN A;  2FBW C;  1JMB A;  1HVV A;  4Y99 C;  1LP1 A;  3M0A A;  3Q5R A;  1L0N D;  1VQP P;  2WMM A;  3OW2 O;  1HJB A;  3M9H A;  2XZR A;  4C46 A;  4GKG A;  1FZE A;  3A2A A;  2V7Q H;  3VMZ A;  1YIJ P;  1RE4 C;  2QE7 H;  3V4Q A;  3BRT B;  3GG2 A;  3HE4 B;  2JEE A;  3RK3 D;  3L74 G;  3L71 E;  1EZV D;  4PJ0 E;  1SQB E;  1L4A D;  3VP8 A;  2D2C B;  2O1J A;  3H1J G;  3LW5 H;  1HF9 A;  4HJG H;  3U1C A;  1RE4 A;  2JO1 A;  4IL6 H;  1LTS C;  4YXW H;  3AE7 C;  1JY3 N;  1KC8 Q;  2Z4E A;  2D2C C;  1BCC D;  1RQU A;  5BVZ A;  5H2F E;  3HE4 A;  1NTM G;  2A45 H;  3GMA A;  2WPR A;  1AVY A;  1NAY A;  1P84 D;  3FX0 A;  1IFJ A;  2Q7C A;  1SQP K;  1T3U A;  1H8A A;  2A06 G;  5KJ7 D;  3S1K A;  2XKM A;  3N4X A;  1SVF A;  2H7H A;  1T6A A;  1FE6 A;  3GHG B;  2P7J A;  2E75 D;  2XV5 A;  3L75 J;  5CBN A;  3GW6 A;  2KS1 B;  3NFQ A;  3PH0 A;  1T3J A;  3NMD A;  1VL2 A;  3GHG C;  3H1H D;  1NTK J;  4GDO A;  2P67 A;  3BCC D;  3G3Z A;  1GZL A;  1ZR4 A;  1NTZ G;  2YXQ B;  2R3S A;  3L72 D;  2JR8 A;  3H1I D;  2K9Y A;  1URQ B;  2C0W A;  2K9J B;  1PGO A;  2XND H;  1GW4 A;  2Z5I A;  3M0D C;  3L4F A;  1X22 A;  1KQG B;  5APV A;  5APU A;  2ZAE B;  1JY2 O;  3I56 P;  4L76 A;  5BU8 B;  1XTC C;  2K37 A;  4RO0 A;  2WT7 B;  1S3J A;  5L8R J;  1KZU B;  1AVO A;  2IYP A;  2JJL A;  1URQ C;  3FGA D;  4U3F E;  4Z1M H;  1JTH B;  5AW1 B;  1PP9 E;  3S9O A;  3TNU B;  3L71 J;  3JSV C;  1L0L K;  3CCS P;  2HG5 D;  1SQB J;  3L70 D;  3EWK A;  2KXP B;  2IZ0 A;  4ZKU A;  1MFT A;  1SQQ K;  1Z56 A;  1D7M A;  1URQ A;  2FYZ A;  5AW4 B;  5CCG C;  3CXH D;  2JDI H;  3CCQ P;  2I8D A;  4HB1 A;  5AVT B;  5CMZ A;  1L0N K;  2J58 A;  1GTW A;  3H1L J;  2WT7 A;  1JB0 J;  3VMY A;  2J59 M;  1KYO I;  3AEB C;  1SQP E;  4DZO A;  3VMX A;  1NU1 E;  1JTH A;  1S9K E;  3TNU A;  2KSE A;  1J1D B;  5CCG A;  2P10 A;  4H13 B;  5KAF E;  4PD4 I;  2BCC E;  5CCH D;  4EOT A;  1M1K Q;  4ASV A;  1FZA A;  1PGP A;  2G3A A;  4O9B A;  3QWO C;  4N6J A;  1J1D C;  2O01 N;  5AW7 B;  4H13 C;  1FZC B;  3S4R A;  1NH4 A;  2FYU J;  4JBZ A;  3CD6 P;  3VP9 A;  1KB9 H;  3F5H A;  4I7Z B;  1EZV I;  1Y8A A;  1SQV K;  1FZC C;  3LID A;  1E79 H;  2UWJ E;  1FAV A;  5CJ4 A;  5DJU B;  4IOI H;  1RY3 A;  4I7Z C;  3L75 G;  4PV1 D;  1H0T B;  2R5B A;  4HYT B;  4HH2 A;  3AEC C;  1FZC A;  2IBZ I;  1Q81 Q;  4D6T D;  5APX A;  1NTK G;  2R44 A;  1YHQ P;  5TIS E;  2R5D A;  1PP9 J;  4ZKP A;  1GK4 A;  3W67 A;  5KLI B;  2P2U A;  3USS A;  1L0N E;  5EFW B;  3TGU J;  2KZJ A;  1H0T A;  3PP5 A;  2W83 C;  2KNC A;  4CPG A;  4OGQ B;  2I1J A;  1ZME C;  1OFC X;  2BEQ D;  1RF1 B;  5KLI C;  2KP8 A;  3HUS B;  1JO5 A;  1SP4 A;  1BE3 D;  4PJ0 H;  1K8A Q;  4KT0 J;  1SQX G;  4M3L A;  1GL2 B;  3RK3 E;  1VF5 D;  4OGQ C;  4LC1 A;  1EZV E;  3WUV A;  3MHV A;  3TF5 A;  2Q6Q A;  3JC2 2;  3CI9 A;  4H0L B;  2M3E A;  1RF1 C;  3CWB J;  1PGQ A;  2KK7 A;  2WPS A;  3HUS C;  3JCU E;  4RJT A;  3Q5P A;  4IFD K;  1GL2 C;  1PPJ D;  3H1L G;  3AE6 C;  5AW6 B;  3HD7 D;  4H0L C;  1USE A;  1FBM A;  1R5L A;  2ZXX A;  5H2F H;  2KOG A;  1RF1 A;  1HJ0 A;  2YNY A;  3TSI A;  4BXL A;  1BCC E;  3HUS A;  5AVV B;  2W27 A;  1X79 B;  4DT0 A;  1DH3 A;  1VQK P;  4OH8 B;  1P84 E;  3B4S A;  1JY2 P;  2PP6 A;  1IFI A;  4KHX A;  1YQ3 C;  3A0H E;  1T2K C;  1DX7 A;  3KZI E;  1N7S D;  2FYU G;  2FKW B;  1NU1 D;  3KYQ A;  3CXH I;  1S9K D;  1G1J A;  3H1K D;  1LTB C;  4UB6 E;  1IFN A;  1L0L J;  3RL0 D;  5AVU B;  2FXO A;  4K3A A;  1U7J A;  1SFC D;  2V4H A;  2BEZ F;  3RK2 D;  1ZV8 A;  3H1H E;  2L5G B;  1K9M Q;  1SQQ J;  3BCC E;  2GUS A;  3V2R A;  3L72 E;  1L0N J;  3L73 E;  2YO3 A;  1DEE G;  2QJP B;  3RBX A;  1FZF A;  4JQ0 D;  2OTK E;  3L36 A;  2M5A B;  2OQQ A;  3A3Y B;  2H88 C;  4GOE A;  1L4A B;  1LTJ B;  3MGN A;  1NOH A;  5AW0 B;  2KUB A;  1AQ5 A;  1PP9 G;  5KLV J;  2QJP C;  4ASW A;  1H89 A;  3EFF K;  1IC2 A;  1YJN P;  3H1J D;  3A5T A;  2YMK A;  4JPZ B;  3E1I A;  2NPS D;  1L4A C;  1IK7 A;  1LTJ C;  2B87 B;  3L70 E;  2IYO A;  3MD0 A;  3TGU G;  4IFM A;  2IPP A;  1KYO D;  3SFE C;  2JKV A;  4GT1 A;  1NO4 A;  1FS0 E;  2M5A A;  3CXH E;  1NTM D;  1L4A A;  4TT3 H;  1LTJ A;  1SQV J;  3OAK A;  4PD4 D;  2XNX A;  2OGU A;  1FOS F;  3CWB G;  2A06 D;  2HR3 A;  5KAF H;  2FFD A;  2ZT9 B;  2B87 A;  2E75 B;  5DJT B;  1LTI C;  1RHZ B;  5KJ7 C;  2O3J A;  3G4S P;  2WSC H;  3CC7 P;  3CCU P;  1BSN A;  2E74 D;  1PV3 A;  1MUU A;  2QIW A;  2ZT9 C;  1GW3 A;  2E75 C;  1OW8 A;  1MZ9 A;  2OTL P;  1CSB A;  1N86 A;  2K1A A;  1FDI A;  2RKL A;  3AEF C;  1PL5 A;  1LWU B;  1RH5 B;  1EDK A;  4H44 D;  1PGJ A;  3F89 A;  3CPW O;  1OW6 A;  2E5Y A;  4L73 A;  1AV1 A;  1KQL A;  1WRG A;  1BGY J;  5APS A;  4XFJ A;  5AW5 B;  4C7N B;  3EQ2 A;  2IBZ D;  2Y9Y A;  1LGH B;  2WVR A;  1K05 A;  1LWU C;  4JF7 A;  4LLH A;  2A45 G;  3H1I J;  1L0L G;  5APT A;  2OYH B;  2IDB A;  2QG4 A;  4D6T E;  2Z5H A;  5TIS H;  1W5C E;  3BVH A;  1NU1 K;  2L91 A;  3IF4 A;  5AVZ B;  1VQL P;  1LWU A;  3LIE A;  1SQQ G;  1LT1 A;  1JNM A;  1YJ9 P;  2OYH C;  1H88 A;  4EYY Q;  1S72 P;  5APY A;  4C7N A;  3C8V A;  2Y0E A;  3CX5 I;  2B9B A;  2YKO A;  2QJK B;  2E43 A;  2FYN B;  4U7J A;  5KLV G;  2Y9Z A;  3GF7 A;  3K5B A;  3L35 A;  2HLO A;  3BAS A;  1N2D C;  3CCR P;  3L73 D;  2QJK C;  1BE3 E;  1OVV A;  2FYN C;  1GU5 A;  2ZYA A;  1Q86 Q;  2GA1 A;  3GHG A;  3JCU H;  2D2C D;  2NZ2 A;  5CCH C;  2P1J A;  3Q3D A;  4WVZ A;  2KS1 A;  4L74 A;  3WU2 E;  1YYC A;  4A7P A;  2I1K A;  1PPJ E;  1SQV G;  2LKM A;  5B5E H;  2FXP A;  3CLQ A;  1LT9 B;  2P58 A;  3VYI A;  3M0D A;  3SWF A;  1ZRT D;  2DW3 A;  2JWA A;  3QH9 A;  2WQY C;  3N7N A;  3C9I A;  1P84 H;  4PV1 B;  1PFI A;  1NTM K;  3AE1 C;  1LT9 C;  2K9J A;  1DD4 A;  2YKP A;  3L75 D;  1IJD B;  2PGD A;  3CCM P;  3A0H H;  2WSE J;  3KZI H;  2Q1K A;  3OJA B;  1S2E A;  1JOC A;  1Q7Y Q;  2IX7 C;  2ZYD A;  5GTI E;  4GIF A;  4PV1 C;  2QM7 A;  2ZXE B;  3O8Z A;  2CPB A;  2WPQ A;  1NTK D;  2A45 I;  1USD A;  3PRJ A;  1LT9 A;  1DD3 A;  4UB6 H;  1YI2 P;  3H1K E;  3HTK B;  1QX8 A;  1S5L E;  3KDP B;  2Y0D A;  1KQS O;  4N3Y B;  1BGY G;  1NYH A;  2KYV A;  1M90 Q;  4BRY B;  4EI2 A;  1OIP A;  3H1I G;  3AE9 C;  1IFD A;  2KB7 P;  2QJY B;  2NRG A;  3BAT A;  1VF5 B;  2GM4 A;  3H32 B;  1SQX D;  2CPS A;  4WY4 D;  3L74 E;  1S5L X;  2ZYG A;  2QJY C;  3M91 A;  1QEX A;  1BE3 J;  3H1J E;  4BRY A;  1Q2N A;  1VF5 C;  5CCG D;  2YO2 A;  2YXR B;  3HD7 B;  2HPC B;  3H1L D;  1U7M A;  1MFZ A;  3TDK A;  2B89 A;  1M8O B;  1KYO E;  4U3F J;  2OTJ P;  3HD7 C;  1JY2 N;  1KIL E;  3H32 A;  1LTA C;  1NTM E;  4UB8 E;  3D70 A;  2MKV A;  4PD4 E;  3SSU A;  1G2C B;  2A06 E;  3GLM A;  3M9Q A;  1OWA A;  2Q9I A;  3R4Y A;  3HD7 A;  2Y0C A;  4IL6 X;  3CCJ P;  3RGU A;  1ZOY C;  3FWN A;  2W6B A;  3AE8 C;  1MKM A;  3L71 G;  1PIX A;  1DIP A;  3RL0 B;  5K5G B;  1SQB G;  1N73 B;  1SQP J;  1Y47 A;  1SFC B;  4R4L A;  2E5T A;  1NU1 J;  1X8Y A;  2OYI B;  1N7L A;  2C9L Y;  2BCC J;  1E5W A;  3RL0 C;  3CCL P;  2JWD A;  2LXC B;  1N73 C;  3T97 B;  2QRX A;  1NHL A;  1G2C A;  5BU5 A;  1SFC C;  3MTU E;  2M8R A;  1NKZ B;  1NTZ E;  3V6I A;  2R3C A;  2WSC J;  2WSE H;  2OYI C;  5AVQ B;  3CME P;  4MN4 C;  1KOR A;  4AYC A;  2IBZ E;  1SS1 A;  1BSH A;  2XDJ A;  1KB9 I;  1N73 A;  3P32 A;  2H43 A;  1SFC A;  1FZB A;  1YQ4 C;  1UII A;  1GL2 A;  1RF0 C;  2NPS B;  1ZN5 A;  1Q90 D;  1OZH A;  1VPC A;  4TLF A;  5KKZ B;  4I2L C;  5TJH A;  5AVX B;  1VQ9 P;  3TGU D;  1HTL C;  3Q5S A;  3CX5 D;  3MP7 B;  2NPS C;  2WZ7 A;  2W8Z A;  1RF0 A;  1ZLL A;  4YTP C;  5KKZ C;  4Y28 J;  2POH A;  3OA7 A;  1L2P A;  3TYY A;  5AW3 B;  1DEB A;  2J5U A;  1UIX A;  2NPS A;  4XE5 B;  1CW5 A;  3SWY A;  1JY3 O;  1S1C X;  1GDT A;  1JCC A;  3GF3 A;  1FDO A;  1HH0 A;  3B5N D;  2WWW A;  2AXC A;  1EQ7 A;  3WUT A;  3A0B E;  1SQX K;  3RK3 B;  2YKQ A;  3WU2 H;  4U3F G;  3H6P A;  1EDI A;  3L74 D;  1J1E B;  3MUD C;  2HYN A;  3VN0 A;  2N1T D;  3D6Z A;  3SFD C;  4H44 B;  3Q1M A;  3RK3 C;  2LXB A;  4QMA A;  2FXM A;  3E7K A;  1EC5 A;  1J1E C;  1ZRT E;  1VQ6 P;  3O6Q B;  2RMZ A;  1A02 J;  4DJG A;  3MUD A;  5E79 E;  1GK6 A;  4H44 C;  4IFF A;  2YIU B;  1KIL D;  3L75 E;  2RN0 A;  1SQP G;  5AW2 B;  3D6Y A;  5GTI H;  1L0L D;  1K73 Q;  1NU1 G;  1NAF A;  1NKN A;  2WSF J;  1OXZ A;  1BCC J;  1VQ5 P;  2YIU C;  3CL3 D;  2BCC G;  2G8Y A;  1OW7 A;  2ZVO B;  2OYO A;  1WMK A;  1EXJ A;  1NTK E;  5M1B A;  1YTZ I;  1SQQ D;  3A7O A;  1HGV A;  3R2P A;  5GTH E;  2C0X A;  3V2P A;  1R5S A;  3KQG A;  3G6E P;  3O6Q A;  2M3B A;  1HBW A;  5KAI E;  3IN6 A;  3NTN A;  4DOJ A;  3MIW A;  4N78 D;  4NPD A;  1VQ7 P;  1EXI A;  1KFN A;  2AEF A;  2RH0 A;  1ZR2 A;  1R8E A;  1OMI A;  2N9B A;  5KLV D;  1S4X A;  3M06 A;  4RES B;  4I1L A;  5KJ7 A;  3VMA A;  1NTZ D;  1ZP0 C;  3U1A A;  2HFE D;  2C9N Y;  4ZMD A;  2IZ1 A;  2CK3 H;  3H1H J;  3HE5 B;  1SQX E;  3BCC J;  2YMY A;  3WUU A;  3II6 A;  4GOF A;  1U57 A;  3FWL A;  3P8C D;  2AXT E;  5AVW B;  3L72 J;  3L73 J;  1IFP A;  2E76 D;  3Q2Y A;  2PAJ A;  4WBA A;  1KTM A;  2QSI A;  1SQV D;  3H1L E;  1KYO H;  2KI7 B;  1RQV A;  2LR2 A;  3AEA C;  2BAS A;  3RBZ A;  4DCK A;  2IFM A;  4UB8 H;  3AED C;  3CC2 P;  1L0N G;  4PD4 H;  3HE5 A;  1FU1 A;  3L70 J;  1LJ2 A;  2WPV B;  4JYC A;  5KTB A;  4HKZ H;  2KSJ A;  1KD1 Q;  3KXD A;  3M9B A;  1FDM A;  3D71 A;  3AE3 C;  2OYH A;  3E1R A;  2ZT9 D;  2FYU E;  3CCE P;  2ZFC A;  3ITK A;  5CHX A;  3AE4 C;  1EZV G;  4I6M C;  4R4M A;  4NPF X;  2WIT A;  1YJW P;  1BGY D;  1G1I A;  1N8R Q;  1AFO A;  2QM8 A;  4EDF A;  2ZJS E;  2R32 A;  3G9R A;  2H89 C;  2M0B A;  3TK1 A;  3U59 A;  2O1K A;  1W2B O;  1OX3 A;  4WB4 A;  1NVO A;  3FXE A;  3V5B A;  1KB9 D;  1VQ4 P;  2IBZ G;  2WSF H;  2W6J H;  1BCC G;  1K04 A;  1JY3 P;  3VTP C;  5B66 E;  4WY4 B;  3FXD A;  5CCH A;  3CMA P;  1OVU A;  1FOS E;  3CC4 P;  1QVF O;  2PFX A;  4OWF A;  2KZI A;  3AEG C;  4ZNC A;  3ZDM A;  4WY4 C;  1SQX J;  1A02 F;  4WWI A;  2WTY A;  2IFN A;  3UIA A;  4L75 A;  4GOD A;  2AEM A;  3TGU E;  3BRV B;  3CX5 E;  1EDJ A;  1EDL A;  1QGK B;  3V2Q A;  1KN7 A;  2QA4 P;  2AEJ A;  4WY4 A;  4D6T J;  1KFM A;  2ITA A;  3H1H G;  1Y9B A;  3B71 A;  3BCC G;  4XA4 A;  1QL1 A;  5KLV K;  3CWB E;  3L72 G;  3L73 G;  2N9Y B;  3C1L A;  1NTZ K;  2ZVN B;  4RKU J;  5AVS B;  2E42 A;  3A0B H;  1BDD A;  2KLU A;  1URQ D;  3L71 D;  3MZW B;  1KQF B;  1SQB D;  2MJZ A;  1M57 D;  3HTK A;  3P8M C;  1T8Z A;  2PRR A;  3L70 G;  1VQO P;  2GUV A;  2W6A A;  4OVN F;  3P7K A;  1CI6 B;  1YIT P;  4IL6 E;  1VQN P;  4W7Z A;  2W90 A;  5E79 H;  1HWT C;  2WSS H;  1VQ8 P;  3AE2 C;  2O01 J;  2SPZ A;  2K3R A;  3CXH H;  2KNC B;  2QVA A;  3PJS K;  1ZW0 A;  1BDC A;  3IR9 A;  1SLQ A;  2H8P D;  1L0L E;  4B86 A;  2VRS A;  1AQT A;  4BWN A;  1QVG O;  3SWK A;  1N7S B;  1P84 I;  1Q82 Q;  5GTH H;  5C39 A;  1CI6 A;  1SQQ E;  1IO4 A;  4H13 D;  2FYU D;  5KAI H;  1LNQ A;  3NXS A;  4KJM A;  2HPC A;  3AE5 C;  1TU3 F;  2B88 A;  4W7Y A;  1NJI Q;  1IZN B;  3AEE C;  1N7S C;  1PZQ A;  1IK9 A;  4N78 E;  3WMM 0;  3RK2 B;  1WT6 A;  1IFM A;  3H1K J;  4K35 A;  1RE3 C;  1FJP A;  3B5N B;  5KLV E;  1KV4 A;  1QL2 A;  1X0T A;  1N7S A;  1LTT C;  3VOP A;  3RK2 C;  2HOD B;  5AW9 B;  3PLN A;  4AUW A;  1ZXG A;  1VDF A;  3I5C A;  5CBO A;  2AXT H;  3B5N C;  1VQM P;  1RE3 A;  1X9V A;  2N1T B;  3P8C E;  3B8E B;  4U3F D;  1JM0 A;  1NWQ A;  2V7Q J;  5AW8 B;  3ABV C;  1PP9 D;  2KIK A;  4EIJ A;  4D6T G;  4AQR D;  1J2J B;  2OYI A;  3V4W A;  5B5E E;  1MV8 A;  5AVR B;  4NPE A;  1GMJ A;  2KLV A;  1SQV E;  3L37 A;  1OVR A;  3KHU A;  1HGZ A;  5AVY B;  2N1T C;  3L74 J;  3W68 A;  1YTZ T;  1M1J B;  3B5N A;  4YXD C;  1NTK K;  3T97 A;  1JEK A;  1AA0 A;  5APW A;  3LW5 J;  3H1J J;  4W80 A;  5APQ A;  1KIL B;  2HOD A;  3V2N A;  1M1J C;  1YBK A;  2N1T A;  2Q3E A;  1SQP D;  1GD2 E;  3IFM A;  1CZQ A;  3CCV P;  4OGQ D;  1KIL C;  3CWB D;  2BCC D;  1BE3 G;  1NTM J;  3PHL A;  1FZG A;  1GU4 A;  1KMI Z;  1M1J A;  3EFG A;  1SQB K;  5CJ0 A;  2E74 B;  1GL2 D;  1NGM B;  1BGY E;  3PTZ A;  4H0L D;  1QLE D;  1KIL A;  2O01 H;  1PPJ G;  3I55 P;  3G71 P;  3KPE A;  3H1I E;  3H25 A;  2E74 C;  2Q5U A;  4YPC A;  1W2E A;  1KB9 E;  5B66 H; 
#chains in the Genus database with same CATH homology
 1SQQ G;  1SQB G;  3H1I G;  3L72 G;  2IBZ G;  3L73 G;  3TGU G;  1NTK G;  4D6T G;  3H1L G;  1NU1 G;  1BCC G;  1SQX G;  1NTM G;  4U3F G;  5KLV G;  1PP9 G;  3L75 G;  1KB9 H;  1BE3 G;  1PPJ G;  1L0L G;  3CX5 H;  3CXH H;  3CWB G;  3L70 G;  1BGY G;  3L74 G;  3H1K G;  3H1H G;  1L0N G;  4PD4 H;  1NTZ G;  2BCC G;  3BCC G;  2A06 G;  1KYO H;  1EZV G;  1P84 H;  3L71 G;  2FYU G;  3H1J G;  1SQV G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...