3H1LG

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1lG00
1KB9H 1PPJG 1BE3G 3H1JG 3L70G 1NTKG 1P84H 2A06G 3H1KG 3L72G 3TGUG 3H1LG 2FYUG 3L71G 1L0NG 1SQQG 4D6TG 1NTZG 1SQVG 1BGYG 1EZVG 1KYOH 3H1IG 1BCCG 4PD4H 3L73G 3BCCG 1NTMG 3CXHH 3L75G 1L0LG 3CX5H 2IBZG 1SQPG 1SQBG 2BCCG 3CWBG 1NU1G 5KLVG 4U3FG 3H1HG 3L74G 1SQXG 1PP9G
chains in the Genus database with same CATH superfamily
1FDOA 1Q90D 1KD1Q 5AVWB 1USDA 1GL2C 2HODA 2R32A 3AEGC 1BDDA 3CWBE 3M9HA 1IJDB 1JM0A 1BGYE 3A7OA 1U7JA 3H6PA 4LGDE 1PGJA 1PGQA 1XTGB 5AW0B 2FYNC 4ZKUA 2N1TC 3I5CA 3Q1MA 5KJ7D 4WY4B 1KV4A 2A06G 4N6JA 3RL0B 3I55P 2QEXP 2DW3A 2WPQA 3RL0C 5BVZA 3PP5A 1M1JA 1GL2A 2YXRB 3CX5I 5APQA 5KLVK 5CMZA 2WPRA 1PP9J 1SQVG 1X9VA 2B87B 2O1JA 2XV5A 3CL3D 3H1KD 3PTZA 1OW8A 4ASVA 1R5SA 2G8YA 3BATA 1LTGC 3G6EP 2BCCJ 3ITKA 1SQXE 4ZMDA 4AUWA 1KILB 2IBZG 4H13B 2BCCG 1DEEG 1L0NJ 4N78E 1NGMB 2AEJA 1YTZI 1NH4A 3BCCD 3HE5A 1SQBE 1VQ5P 1K8AQ 2IYPA 1EZVE 2KI7B 4OWFA 1PP9G 2PFXA 2RKLA 3C8VA 2JEEA 2E75B 2M5AB 4JBZA 1DEBA 1VDFA 1GZLA 1HUCA 1NU1D 1KQFB 2H7HA 2E43A 3L70D 3G9RA 1N7SB 1LP1B 1Q2NA 2WTYA 1IFDA 4UB6H 3HD7A 1FOSF 2QRXA 3L70G 1LT9B 1H88A 4IL6H 1GK4A 1ZN5A 4YTPC 2WSFJ 1PV3A 4RJTA 1M8OB 3WUTA 2OQQA 3LIEA 2WT7B 4WY4C 3IR9A 1G1IA 1YQ3C 1QL2A 1MFZA 2RMZA 4WBAA 1W2BO 1PIXA 1KYOH 1FZCC 5K5GB 2K9JB 1FZCB 2Y0EA 3LW5J 1NOHA 2WSEH 3CX5D 1L0LG 1BGYD 4UB6E 4PD4E 1DD4A 2KB7P 3H1ID 3HUSB 1HBWA 1JOCA 2JDIH 1OVUA 1YTZT 3SFDC 3G4SP 1YBKA 2QE7H 2QJKC 4M3LA 1N86A 2FXMA 1AQTA 4NPDA 2W27A 4R4LA 4WWIA 4WVZA 1PPJG 2I8DA 1KILA 1GL2B 4I7ZB 3E1RA 2QJPB 1VF5C 3GG2A 4XA4A 1KTMA 1QL1A 1AQ5A 1SS1A 3P32A 2OARA 1EDLA 1YJNP 5AW1B 4BRYA 1S4XA 1MZ9A 2KLVA 2ZVOB 1LP1A 3TSIA 3L75D 1QGKB 3Q3DA 2OTJP 1NTZK 3HD7B 4PV1B 2W6JH 2YO2A 3CLQA 1Z56A 4PD4H 3I56P 2RN0A 4BXLA 1ZR2A 1IC2A 1GW4A 3PLNA 1RF1A 2Q3EA 3WU2E 1EZVI 1LT1A 5CJ0A 1T6AA 1RQVA 5TISH 3NTNA 1W2EA 1LTSC 3L70J 1SQPD 1KB9D 2V7QJ 1SQPE 2E5YA 3FWNA 3MUDC 2H8PD 2KP8A 1KB9H 1YQ4C 2QSIA 5CCGC 3RK2B 3CMEP 1EQ7A 3TGUD 3AE1C 3VMAA 2WMMA 2KK7A 2YKPA 5APUA 5AVSB 3VTPC 3B5NC 1BE3D 1SLQA 3CC7P 1S3JA 1ZR4A 1VQPP 1VQ9P 5KLVJ 2GM4A 1BDCA 2FYUG 3T97A 2YO3A 1VQOP 1FE6A 3SWYA 2OYIB 3GW6A 2PGDA 4WY4A 1ZW0A 2M3EA 3A3YB 1LTIC 3GMAA 3RGUA 3S9OA 4ASWA 1L4AD 1SQQJ 3L71E 3G71P 2B87A 3L36A 3AEDC 1JB0J 2FY8A 3H1IJ 3V2QA 3EFGA 2PP6A 1M57D 1NTMG 3HD7C 3L73G 3PJSK 4TT3H 2PRRA 3AE3C 1RHZB 5AW5B 3H25A 2E76C 1VF5D 3AE9C 4H44D 5AVVB 2HG5D 3W67A 3Q5PA 2Q9IA 5KAIH 4DJGA 3RK3D 1CSBA 1YI2P 1OVRA 3AE8C 1SQBD 4U3FJ 2A45I 3L75E 2ZXEB 2QA4P 2HFED 3D6YA 1Y47A 4PD4D 1KB9I 2D2CD 3CCSP 1K73Q 3FX0A 1JUNA 3L35A 1AVYA 1FJKA 5TJHA 3ZDMA 1KYOD 4GIFA 1G1JA 1BE3J 2JR8A 1LNQA 2LKMA 1RE4A 3KZIH 3CCLP 1Q86Q 4JYBA 4IL6E 5B5EH 1FJPA 1AA0A 1NWQA 1IK9A 2HR3A 1M1KQ 1LTJB 1LWUC 2WITA 3IAOA 3D6ZA 1NTKJ 4D6TD 2QJYB 2YXQB 4LLHA 5TISE 2QJYC 1HVVA 1L2PA 1NTMJ 2K9YA 1IFMA 3B5ND 3EFFK 3L74E 3L74D 5APVA 2QG4A 1ZRTE 2V7QH 2Y0CA 3BCCE 3EWKA 3GLMA 3QH9A 1NU1G 3Q2YA 2ZT9D 1E5WA 3RK2C 1L0LE 1JCDA 2P2UA 2OYHB 1OWAA 1OZHA 2WQYC 3FXDA 4W7ZA 1FZBA 4AQRD 2AXCA 1J1DB 1HGVA 1NKZB 2LXBA 1A02J 3IF4A 4BWNA 3A2AA 3CMAP 3TNUB 3HD7D 3G3ZA 2Y9ZA 4DZOA 4O9BA 1QEXA 3L72G 3CWBJ 4H44C 1NU1J 3H1LG 5GTHE 1SQQK 2L5GB 3HE4A 4XE5B 3CCVP 2OYHC 1YJ9P 3OAKA 1BGYG 2SPZA 3A0HE 1NTKK 4N3YB 3OA7A 3M91A 2R44A 3H1IG 3H1JJ 3HE4B 5CHXA 1KFMA 1KYOI 2CPSA 1N2DC 2KNCB 3F5HA 4HJGH 4EDFA 3MP7B 3KPEA 3FGAD 1SFCC 1JCCA 3H1LJ 2YMKA 1PPJD 3CCMP 1L4AA 3C9IA 2B88A 5GTIE 1KN7A 3K5BA 5CCHC 4WY4D 3LIDA 1IO4A 3L73J 5AVYB 3Q5RA 3JC22 1L0NE 4Y99B 2A45G 2Q3IA 2ZFCA 1IFPA 3GF7A 2GUVA 4HH2A 2FYUK 3SSUA 3TGUE 2KSJA 1SFCB 5B66E 1ZMEC 2BEZF 1U57A 2FXOA 1SQBK 1ZOYC 3BVHA 2FYUJ 1M90Q 1NTKG 1SFCA 2YMYA 2IPPA 2P67A 4OVNF 1A02F 1X8YA 5GTIH 2WSFH 5APWA 2OYIC 1S72P 1JY2N 1NTKD 4IL6X 3W68A 4D6TJ 1Q81Q 1VQNP 1RF0C 1JY3O 5KKZB 1FDMA 4OGQC 2IZ1A 2ZT9B 4YPCA 1URQB 4GT1A 3BRVB 4PJ0E 5KLIC 2MKVA 1FZAA 2ZVNB 1ZXGA 3CXHH 3VMZA 5KJ7A 1JO5A 1G2CA 1M56D 1S5LX 1HTLC 3U1AA 2FFDB 1SP4A 1BCCE 2WSSH 2D2CC 5KLVG 3L72J 1GK6A 2KS1B 4L73A 1T3JA 1URQD 4CPGA 1JMMA 2P58A 2KYVA 3OJAB 4H0LC 2E74D 2C0XA 2QM8A 4MN4C 1TU3F 1KILC 2M8RA 3CXHE 1KMIZ 1X0TA 3TNUA 2YNYA 3P8CD 4OH8B 1RE3A 3V4QA 3CCUP 1SQQE 1HJBA 2E5TA 2FYZA 1WMKA 3H1IE 3CC4P 2JJLA 1CI6A 1PGOA 2AEMA 1SQVE 3SWFA 2O01H 1ZLLA 1FBMA 1KYOE 2CK3H 1GTWA 2QJKB 1LWUA 2XZRA 3CXHI 3GHGC 2FYUD 5AW6B 2NPSD 2YIUB 5CBOA 1EDIA 1OW7A 2LR2A 3H1HE 4IOIH 3H1HD 4U3FE 4U3FD 1SQBG 5H2FH 3TYYA 1FZFA 2UWJE 5APYA 3IN6A 2JWAA 3L73D 1L4AB 3CPWO 4IFDK 4A7PA 1ZRTD 2AEFA 1L0NK 3LW5H 3PHLA 1PFIA 1HF9A 3L4FA 2I1KA 1WRGA 4ZNCA 2V4HA 2J59M 2WSCJ 2NRGA 3GF3A 3HTKB 2Q1KA 3H1JG 4K3AA 3L70E 5KAIE 3CC2P 4RO0A 1J2JB 2RH0A 3CI9A 5BU8B 3L37A 2QJPC 1N7SC 2VRSA 4QMAA 3UIAA 2Z4EA 1SQVD 3H1KG 1J1EC 3MIWA 3VN0A 4DOJA 2WPVB 4Z1MH 1BCCD 4K35A 1EDKA 2XKMA 1ZV8A 2M0BA 3MTUE 3KDPB 1AVOA 1NTZG 3U1CA 2ZYDA 3BRTB 1URQC 2B9BA 5AW8B 1MV8A 5KTBA 3VMYA 1L0LJ 1CI6B 3M0AA 2FYNB 3CXHD 1P84D 4DT0A 2OGUA 1S2EA 1NTMK 2WVRA 5KAFE 2IBZE 3AE6C 2E42A 2IBZD 2BCCE 1AFOA 4PV1D 3GHGA 4JQ0D 3H32B 3TK1A 1SQPK 1GU4A 1NO4A 1NYHA 2OYOA 5CCGA 3RL0g 3Q5SA 2IFMA 2Z5HA 3A0BE 3B5NB 1R8EA 2QVAA 1BSNA 1K9MQ 3CCRP 3PH0A 2P10A 5AW4B 2IFNA 2GA1A 3WU2H 2W90A 1KQGB 1GW3A 3O6QB 2O1KA 3VP8A 1Q82Q 5CJ4A 3H1LD 2B89A 1PL5A 3H1LE 2WT7A 2FXPA 1H8AA 4AYCA 1S5LH 3B5NA 5AVRB 1BE3E 1CZQA 2J58A 1H0TB 2E76B 4KHXA 3CX5H 2M3BA 1KORA 2D2CB 1D7MA 1OMIA 1JY2P 1IZNB 3V2NA 1NKNA 2K3RA 4HKZH 1PPJE 1L0LD 2E75C 3MGNA 1K04A 1RF0A 2XNXA 1IFNA 4HB1A 2KOGA 2GUSA 1QLED 3A0HH 1HGZA 4GKGA 3TDKA 1KQLA 2H89C 1GD2E 1SQBJ 1RQUA 5AVZB 1DH3A 2O01J 2YKQA 1VF5B 2A45H 1ZP0C 3AEBC 2N1TB 3E7KA 3HUSC 3VYIA 4YXWH 1RF1C 1BSHA 1K05A 4UB8H 4I6MC 3CD6P 3S1KA 2O01N 1MFTA 5CBNA 1KILE 1S5LE 2I1JA 1FOSE 1HWTC 2R3SA 1U7MA 2W6AA 4IFMA 3CCEP 4B86A 1LTJC 2Q6QA 3VP9A 2HYNA 1NU1E 2A06E 3CX5E 4GOEA 1R5LA 3GHGB 2IYOA 3RK2D 2HLOA 2KSEA 3L75G 3P8MC 1Q7YQ 5C39A 3AE2C 4PJ0H 1JTHA 1NVOA 2NZ2A 5CCGD 3S4RA 1Y9BA 1BGYJ 4W7YA 1VQ6P 1OIPA 2CPBA 4L76A 2AXTE 1FC2C 4NPFX 3U59A 2WPSA 3AE4C 4XFJA 4C7NA 3TF5A 3CCQP 2OTLP 3VOPA 5CCHD 1SQXD 2C9LY 1LJ2A 3A0BH 1MKMA 3MZWB 4W80A 1AV1A 4RKUJ 1HH0A 2N9YB 2HODB 2G3AA 2Z5IA 3NMDA 3P8CE 3RBXA 1USEA 1LTBC 1RH5B 1S1CX 3NXSA 4N78D 5CCHA 3A5TA 2ZXXA 3ABVC 4H44B 1EZVD 1L4AC 2QM7A 2ZJSE 3L71G 1FZGA 2PAJA 1NTZJ 2OYIA 1L0NG 3FXEA 4WB4A 1NTMD 4ZKPA 3JSVC 1GL2D 2WZ7A 2FYUE 1EZVG 1XTCC 3HTKA 5AVQB 1T3UA 2JP3A 1LTAC 2YIUC 3H1KE 4PD4I 3SWKA 4H13C 1KC8Q 1N73A 2KNCA 1DIPA 1OFCX 1JMBA 5AVTB 5AW9B 3RK3C 2FFDA 1T2KC 4OGQD 2C9NY 3PRJA 1G2CB 2H88C 4IFFA 2HPCA 1GDTA 5E79E 3OW2O 2O3JA 3CWBG 4JYCA 2N1TA 2QIWA 5AW3B 3RK3E 4GODA 4C46A 1S9KD 3H1HG 2HPCB 2KZJA 1RY3A 3HE5B 1IK7A 1JY2O 1SQVK 3AE7C 3CWBD 3V2PA 1SQXK 1H89A 2P1JA 2A06D 1NHLA 4L75A 1LT9C 3L72E 2NPSB 2K37A 3RK3B 1SQPJ 3AE5C 3H32A 3CCJP 1FDIA 2E74C 2J5UA 1MUUA 1P84H 1WT6A 3EQ2A 1LT9A 3H1JE 1IFIA 1JY3P 2NPSA 3H1JD 1J1EB 4JF7A 4JPZB 2ITAA 3AEFC 1PZQA 1M1JC 4YXDC 4D6TG 3SFEC 5B5EE 1FAVA 1KB9E 2KZIA 1CW5A 3KZIE 4H0LB 1BCCG 1SVFA 1N7SA 1J1DC 2E75D 5KLIB 5KLVE 1PGPA 2Q5UA 3BCCG 5DJUB 1NTZD 2E74B 4EYYQ 3T97B 1P84E 2KIKA 3R2PA 4LC1A 1FU1A 1PP9E 1PP9D 1NJIQ 1RE4C 1N7SD 2FFDC 3C1LA 3D70A 2C0WA 1QX8A 1RE3C 3O8ZA 3VMXA 2R5BA 3IFMA 3II6A 3TGUJ 2H43A 3L74G 4DCKA 1SQXJ 2BCCD 3BASA 5KAFH 1H0TA 1NTME 1DD3A 2LXCB 2ZAEB 1IFJA 2ZT9C 3L72D 1UIXA 2BASA 4Y28J 2JKVA 4Y99C 3R4YA 2N9BA 3M0DC 3N7NA 5AVUB 3KQGA 4EIJA 3B4SA 2KUBA 5M1BA 5AW2B 1EDJA 3QWOC 1YHQP 2IDBA 1FZEA 4KJMA 5GTHH 2ZYAA 5EFWB 2N1TD 2KLUA 2WSCH 1JNMA 1E79H 1GMJA 1SFCD 3RL0D 1N73C 4TLFA 5APXA 1VQLP 3B71A 1RF1B 3D71A 2Y0DA 2BEQD 1OW6A 3JCUH 1YYCA 1HJ0A 5L8RJ 2XU6A 5APTA 1NAFA 1LTJA 1VQ4P 3FWLA 1X79B 2M5AA 4L74A 3L74J 4HYTB 2E76D 5APSA 3V4WA 2WSEJ 4RESB 1YJWP 4PV1C 2P7JA 2ZYGA 1AJYA 4OGQB 1FS0E 5B66H 1GU5A 4GDOA 5BU5A 1OXZA 1W5CE 1JTHB 2W83C 4D6TE 5KJ7C 3L73E 2WWWA 4U7JA 3L71J 3MUDA 2OTKE 3HUSA 2JWDA 3KYQA 3M9QA 3O6QA 1KFNA 4H13D 3WUUA 1N8RQ 1X22A 3KHUA 3WMM0 1QVGO 1NU1K 3H1HJ 1JEKA 3NFQA 1Y8AA 1DX7A 3AECC 3JCUE 2R5DA 3V6IA 2W8ZA 1LTTC 2MJZA 3M06A 3P7KA 2OYHA 4EI2A 5E79H 2IZ0A 4UB8E 3V2RA 1SQPG 1N73B 3L75J 4NPEA 1L0LK 1VQ8P 5DJTB 1UIIA 1P84I 4R4MA 2JO1A 4H0LD 2L91A 4BRYB 1YIJP 1SQXG 1LGHB 2KXPB 1T8ZA 3MD0A 1LWUB 1BE3G 1OX3A 2IBZI 1VPCA 5KLVD 1BCCJ 1QVFO 1SQVJ 3F89A 1NTZE 3MHVA 2K88A 2YKOA 2Q7CA 1N7LA 1VL2A 2XDJA 5AVXB 2FKWB 1SQQD 2POHA 4EOTA 1EC5A 3E1IA 3TGUG 5AW7B 3USSA 1KILD 3H1KJ 4I2LC 3M9BA 1KZUB 1NTKE 2KS1A 1SQQG 3HRNA 1EXJA 3B8EB 2AXTH 2K1AA 3KXDA 2FBWC 3BCCJ 3L71D 3V5BA 1VQKP 1L0ND 4I7ZC 1OVVA 2R3CA 2W6BA 2K9JA 3M0DA 5KKZC 1FZCA 3N4XA 1JY3N 4GOFA 4I1LA 1VQMP 1KQSO 2XNDH 1VQ7P 2Y9YA 2NPSC 5H2FE 1M7LA 1EXIA 1T2KD 2IX7C 3WUVA 4C7RA 3RBZA 3AEAC 1YITP 4KT0J 1S9KE 4U3FG 4C7NB 1URQA 1M1JB 1NAYA 3AEEC
chains in the Genus database with same CATH topology
1KB9H 1PPJG 1BE3G 3H1JG 3L70G 1NTKG 1P84H 2A06G 3H1KG 3L72G 3TGUG 3H1LG 2FYUG 3L71G 1L0NG 1SQQG 4D6TG 1NTZG 1SQVG 1BGYG 1EZVG 1KYOH 3H1IG 1BCCG 4PD4H 3L73G 3BCCG 1NTMG 3CXHH 3L75G 1L0LG 3CX5H 2IBZG 1SQPG 1SQBG 2BCCG 3CWBG 1NU1G 5KLVG 4U3FG 3H1HG 3L74G 1SQXG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  1PPJ G;  1BE3 G;  3H1J G;  3L70 G;  1NTK G;  1P84 H;  2A06 G;  3H1K G;  3L72 G;  3TGU G;  3H1L G;  2FYU G;  3L71 G;  1L0N G;  1SQQ G;  4D6T G;  1NTZ G;  1SQV G;  1BGY G;  1EZV G;  1KYO H;  3H1I G;  1BCC G;  4PD4 H;  3L73 G;  3BCC G;  1NTM G;  3CXH H;  3L75 G;  1L0L G;  3CX5 H;  2IBZ G;  1SQP G;  1SQB G;  2BCC G;  3CWB G;  1NU1 G;  5KLV G;  4U3F G;  3H1H G;  3L74 G;  1SQX G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1FDO A;  1Q90 D;  1KD1 Q;  5AVW B;  1USD A;  1GL2 C;  2HOD A;  2R32 A;  3AEG C;  1BDD A;  3CWB E;  3M9H A;  1IJD B;  1JM0 A;  1BGY E;  3A7O A;  1U7J A;  3H6P A;  4LGD E;  1PGJ A;  1PGQ A;  1XTG B;  5AW0 B;  2FYN C;  4ZKU A;  2N1T C;  3I5C A;  3Q1M A;  5KJ7 D;  4WY4 B;  1KV4 A;  2A06 G;  4N6J A;  3RL0 B;  3I55 P;  2QEX P;  2DW3 A;  2WPQ A;  3RL0 C;  5BVZ A;  3PP5 A;  1M1J A;  1GL2 A;  2YXR B;  3CX5 I;  5APQ A;  5KLV K;  5CMZ A;  2WPR A;  1PP9 J;  1SQV G;  1X9V A;  2B87 B;  2O1J A;  2XV5 A;  3CL3 D;  3H1K D;  3PTZ A;  1OW8 A;  4ASV A;  1R5S A;  2G8Y A;  3BAT A;  1LTG C;  3G6E P;  2BCC J;  3ITK A;  1SQX E;  4ZMD A;  4AUW A;  1KIL B;  2IBZ G;  4H13 B;  2BCC G;  1DEE G;  1L0N J;  4N78 E;  1NGM B;  2AEJ A;  1YTZ I;  1NH4 A;  3BCC D;  3HE5 A;  1SQB E;  1VQ5 P;  1K8A Q;  2IYP A;  1EZV E;  2KI7 B;  4OWF A;  1PP9 G;  2PFX A;  2RKL A;  3C8V A;  2JEE A;  2E75 B;  2M5A B;  4JBZ A;  1DEB A;  1VDF A;  1GZL A;  1HUC A;  1NU1 D;  1KQF B;  2H7H A;  2E43 A;  3L70 D;  3G9R A;  1N7S B;  1LP1 B;  1Q2N A;  2WTY A;  1IFD A;  4UB6 H;  3HD7 A;  1FOS F;  2QRX A;  3L70 G;  1LT9 B;  1H88 A;  4IL6 H;  1GK4 A;  1ZN5 A;  4YTP C;  2WSF J;  1PV3 A;  4RJT A;  1M8O B;  3WUT A;  2OQQ A;  3LIE A;  2WT7 B;  4WY4 C;  3IR9 A;  1G1I A;  1YQ3 C;  1QL2 A;  1MFZ A;  2RMZ A;  4WBA A;  1W2B O;  1PIX A;  1KYO H;  1FZC C;  5K5G B;  2K9J B;  1FZC B;  2Y0E A;  3LW5 J;  1NOH A;  2WSE H;  3CX5 D;  1L0L G;  1BGY D;  4UB6 E;  4PD4 E;  1DD4 A;  2KB7 P;  3H1I D;  3HUS B;  1HBW A;  1JOC A;  2JDI H;  1OVU A;  1YTZ T;  3SFD C;  3G4S P;  1YBK A;  2QE7 H;  2QJK C;  4M3L A;  1N86 A;  2FXM A;  1AQT A;  4NPD A;  2W27 A;  4R4L A;  4WWI A;  4WVZ A;  1PPJ G;  2I8D A;  1KIL A;  1GL2 B;  4I7Z B;  3E1R A;  2QJP B;  1VF5 C;  3GG2 A;  4XA4 A;  1KTM A;  1QL1 A;  1AQ5 A;  1SS1 A;  3P32 A;  2OAR A;  1EDL A;  1YJN P;  5AW1 B;  4BRY A;  1S4X A;  1MZ9 A;  2KLV A;  2ZVO B;  1LP1 A;  3TSI A;  3L75 D;  1QGK B;  3Q3D A;  2OTJ P;  1NTZ K;  3HD7 B;  4PV1 B;  2W6J H;  2YO2 A;  3CLQ A;  1Z56 A;  4PD4 H;  3I56 P;  2RN0 A;  4BXL A;  1ZR2 A;  1IC2 A;  1GW4 A;  3PLN A;  1RF1 A;  2Q3E A;  3WU2 E;  1EZV I;  1LT1 A;  5CJ0 A;  1T6A A;  1RQV A;  5TIS H;  3NTN A;  1W2E A;  1LTS C;  3L70 J;  1SQP D;  1KB9 D;  2V7Q J;  1SQP E;  2E5Y A;  3FWN A;  3MUD C;  2H8P D;  2KP8 A;  1KB9 H;  1YQ4 C;  2QSI A;  5CCG C;  3RK2 B;  3CME P;  1EQ7 A;  3TGU D;  3AE1 C;  3VMA A;  2WMM A;  2KK7 A;  2YKP A;  5APU A;  5AVS B;  3VTP C;  3B5N C;  1BE3 D;  1SLQ A;  3CC7 P;  1S3J A;  1ZR4 A;  1VQP P;  1VQ9 P;  5KLV J;  2GM4 A;  1BDC A;  2FYU G;  3T97 A;  2YO3 A;  1VQO P;  1FE6 A;  3SWY A;  2OYI B;  3GW6 A;  2PGD A;  4WY4 A;  1ZW0 A;  2M3E A;  3A3Y B;  1LTI C;  3GMA A;  3RGU A;  3S9O A;  4ASW A;  1L4A D;  1SQQ J;  3L71 E;  3G71 P;  2B87 A;  3L36 A;  3AED C;  1JB0 J;  2FY8 A;  3H1I J;  3V2Q A;  3EFG A;  2PP6 A;  1M57 D;  1NTM G;  3HD7 C;  3L73 G;  3PJS K;  4TT3 H;  2PRR A;  3AE3 C;  1RHZ B;  5AW5 B;  3H25 A;  2E76 C;  1VF5 D;  3AE9 C;  4H44 D;  5AVV B;  2HG5 D;  3W67 A;  3Q5P A;  2Q9I A;  5KAI H;  4DJG A;  3RK3 D;  1CSB A;  1YI2 P;  1OVR A;  3AE8 C;  1SQB D;  4U3F J;  2A45 I;  3L75 E;  2ZXE B;  2QA4 P;  2HFE D;  3D6Y A;  1Y47 A;  4PD4 D;  1KB9 I;  2D2C D;  3CCS P;  1K73 Q;  3FX0 A;  1JUN A;  3L35 A;  1AVY A;  1FJK A;  5TJH A;  3ZDM A;  1KYO D;  4GIF A;  1G1J A;  1BE3 J;  2JR8 A;  1LNQ A;  2LKM A;  1RE4 A;  3KZI H;  3CCL P;  1Q86 Q;  4JYB A;  4IL6 E;  5B5E H;  1FJP A;  1AA0 A;  1NWQ A;  1IK9 A;  2HR3 A;  1M1K Q;  1LTJ B;  1LWU C;  2WIT A;  3IAO A;  3D6Z A;  1NTK J;  4D6T D;  2QJY B;  2YXQ B;  4LLH A;  5TIS E;  2QJY C;  1HVV A;  1L2P A;  1NTM J;  2K9Y A;  1IFM A;  3B5N D;  3EFF K;  3L74 E;  3L74 D;  5APV A;  2QG4 A;  1ZRT E;  2V7Q H;  2Y0C A;  3BCC E;  3EWK A;  3GLM A;  3QH9 A;  1NU1 G;  3Q2Y A;  2ZT9 D;  1E5W A;  3RK2 C;  1L0L E;  1JCD A;  2P2U A;  2OYH B;  1OWA A;  1OZH A;  2WQY C;  3FXD A;  4W7Z A;  1FZB A;  4AQR D;  2AXC A;  1J1D B;  1HGV A;  1NKZ B;  2LXB A;  1A02 J;  3IF4 A;  4BWN A;  3A2A A;  3CMA P;  3TNU B;  3HD7 D;  3G3Z A;  2Y9Z A;  4DZO A;  4O9B A;  1QEX A;  3L72 G;  3CWB J;  4H44 C;  1NU1 J;  3H1L G;  5GTH E;  1SQQ K;  2L5G B;  3HE4 A;  4XE5 B;  3CCV P;  2OYH C;  1YJ9 P;  3OAK A;  1BGY G;  2SPZ A;  3A0H E;  1NTK K;  4N3Y B;  3OA7 A;  3M91 A;  2R44 A;  3H1I G;  3H1J J;  3HE4 B;  5CHX A;  1KFM A;  1KYO I;  2CPS A;  1N2D C;  2KNC B;  3F5H A;  4HJG H;  4EDF A;  3MP7 B;  3KPE A;  3FGA D;  1SFC C;  1JCC A;  3H1L J;  2YMK A;  1PPJ D;  3CCM P;  1L4A A;  3C9I A;  2B88 A;  5GTI E;  1KN7 A;  3K5B A;  5CCH C;  4WY4 D;  3LID A;  1IO4 A;  3L73 J;  5AVY B;  3Q5R A;  3JC2 2;  1L0N E;  4Y99 B;  2A45 G;  2Q3I A;  2ZFC A;  1IFP A;  3GF7 A;  2GUV A;  4HH2 A;  2FYU K;  3SSU A;  3TGU E;  2KSJ A;  1SFC B;  5B66 E;  1ZME C;  2BEZ F;  1U57 A;  2FXO A;  1SQB K;  1ZOY C;  3BVH A;  2FYU J;  1M90 Q;  1NTK G;  1SFC A;  2YMY A;  2IPP A;  2P67 A;  4OVN F;  1A02 F;  1X8Y A;  5GTI H;  2WSF H;  5APW A;  2OYI C;  1S72 P;  1JY2 N;  1NTK D;  4IL6 X;  3W68 A;  4D6T J;  1Q81 Q;  1VQN P;  1RF0 C;  1JY3 O;  5KKZ B;  1FDM A;  4OGQ C;  2IZ1 A;  2ZT9 B;  4YPC A;  1URQ B;  4GT1 A;  3BRV B;  4PJ0 E;  5KLI C;  2MKV A;  1FZA A;  2ZVN B;  1ZXG A;  3CXH H;  3VMZ A;  5KJ7 A;  1JO5 A;  1G2C A;  1M56 D;  1S5L X;  1HTL C;  3U1A A;  2FFD B;  1SP4 A;  1BCC E;  2WSS H;  2D2C C;  5KLV G;  3L72 J;  1GK6 A;  2KS1 B;  4L73 A;  1T3J A;  1URQ D;  4CPG A;  1JMM A;  2P58 A;  2KYV A;  3OJA B;  4H0L C;  2E74 D;  2C0X A;  2QM8 A;  4MN4 C;  1TU3 F;  1KIL C;  2M8R A;  3CXH E;  1KMI Z;  1X0T A;  3TNU A;  2YNY A;  3P8C D;  4OH8 B;  1RE3 A;  3V4Q A;  3CCU P;  1SQQ E;  1HJB A;  2E5T A;  2FYZ A;  1WMK A;  3H1I E;  3CC4 P;  2JJL A;  1CI6 A;  1PGO A;  2AEM A;  1SQV E;  3SWF A;  2O01 H;  1ZLL A;  1FBM A;  1KYO E;  2CK3 H;  1GTW A;  2QJK B;  1LWU A;  2XZR A;  3CXH I;  3GHG C;  2FYU D;  5AW6 B;  2NPS D;  2YIU B;  5CBO A;  1EDI A;  1OW7 A;  2LR2 A;  3H1H E;  4IOI H;  3H1H D;  4U3F E;  4U3F D;  1SQB G;  5H2F H;  3TYY A;  1FZF A;  2UWJ E;  5APY A;  3IN6 A;  2JWA A;  3L73 D;  1L4A B;  3CPW O;  4IFD K;  4A7P A;  1ZRT D;  2AEF A;  1L0N K;  3LW5 H;  3PHL A;  1PFI A;  1HF9 A;  3L4F A;  2I1K A;  1WRG A;  4ZNC A;  2V4H A;  2J59 M;  2WSC J;  2NRG A;  3GF3 A;  3HTK B;  2Q1K A;  3H1J G;  4K3A A;  3L70 E;  5KAI E;  3CC2 P;  4RO0 A;  1J2J B;  2RH0 A;  3CI9 A;  5BU8 B;  3L37 A;  2QJP C;  1N7S C;  2VRS A;  4QMA A;  3UIA A;  2Z4E A;  1SQV D;  3H1K G;  1J1E C;  3MIW A;  3VN0 A;  4DOJ A;  2WPV B;  4Z1M H;  1BCC D;  4K35 A;  1EDK A;  2XKM A;  1ZV8 A;  2M0B A;  3MTU E;  3KDP B;  1AVO A;  1NTZ G;  3U1C A;  2ZYD A;  3BRT B;  1URQ C;  2B9B A;  5AW8 B;  1MV8 A;  5KTB A;  3VMY A;  1L0L J;  1CI6 B;  3M0A A;  2FYN B;  3CXH D;  1P84 D;  4DT0 A;  2OGU A;  1S2E A;  1NTM K;  2WVR A;  5KAF E;  2IBZ E;  3AE6 C;  2E42 A;  2IBZ D;  2BCC E;  1AFO A;  4PV1 D;  3GHG A;  4JQ0 D;  3H32 B;  3TK1 A;  1SQP K;  1GU4 A;  1NO4 A;  1NYH A;  2OYO A;  5CCG A;  3RL0 g;  3Q5S A;  2IFM A;  2Z5H A;  3A0B E;  3B5N B;  1R8E A;  2QVA A;  1BSN A;  1K9M Q;  3CCR P;  3PH0 A;  2P10 A;  5AW4 B;  2IFN A;  2GA1 A;  3WU2 H;  2W90 A;  1KQG B;  1GW3 A;  3O6Q B;  2O1K A;  3VP8 A;  1Q82 Q;  5CJ4 A;  3H1L D;  2B89 A;  1PL5 A;  3H1L E;  2WT7 A;  2FXP A;  1H8A A;  4AYC A;  1S5L H;  3B5N A;  5AVR B;  1BE3 E;  1CZQ A;  2J58 A;  1H0T B;  2E76 B;  4KHX A;  3CX5 H;  2M3B A;  1KOR A;  2D2C B;  1D7M A;  1OMI A;  1JY2 P;  1IZN B;  3V2N A;  1NKN A;  2K3R A;  4HKZ H;  1PPJ E;  1L0L D;  2E75 C;  3MGN A;  1K04 A;  1RF0 A;  2XNX A;  1IFN A;  4HB1 A;  2KOG A;  2GUS A;  1QLE D;  3A0H H;  1HGZ A;  4GKG A;  3TDK A;  1KQL A;  2H89 C;  1GD2 E;  1SQB J;  1RQU A;  5AVZ B;  1DH3 A;  2O01 J;  2YKQ A;  1VF5 B;  2A45 H;  1ZP0 C;  3AEB C;  2N1T B;  3E7K A;  3HUS C;  3VYI A;  4YXW H;  1RF1 C;  1BSH A;  1K05 A;  4UB8 H;  4I6M C;  3CD6 P;  3S1K A;  2O01 N;  1MFT A;  5CBN A;  1KIL E;  1S5L E;  2I1J A;  1FOS E;  1HWT C;  2R3S A;  1U7M A;  2W6A A;  4IFM A;  3CCE P;  4B86 A;  1LTJ C;  2Q6Q A;  3VP9 A;  2HYN A;  1NU1 E;  2A06 E;  3CX5 E;  4GOE A;  1R5L A;  3GHG B;  2IYO A;  3RK2 D;  2HLO A;  2KSE A;  3L75 G;  3P8M C;  1Q7Y Q;  5C39 A;  3AE2 C;  4PJ0 H;  1JTH A;  1NVO A;  2NZ2 A;  5CCG D;  3S4R A;  1Y9B A;  1BGY J;  4W7Y A;  1VQ6 P;  1OIP A;  2CPB A;  4L76 A;  2AXT E;  1FC2 C;  4NPF X;  3U59 A;  2WPS A;  3AE4 C;  4XFJ A;  4C7N A;  3TF5 A;  3CCQ P;  2OTL P;  3VOP A;  5CCH D;  1SQX D;  2C9L Y;  1LJ2 A;  3A0B H;  1MKM A;  3MZW B;  4W80 A;  1AV1 A;  4RKU J;  1HH0 A;  2N9Y B;  2HOD B;  2G3A A;  2Z5I A;  3NMD A;  3P8C E;  3RBX A;  1USE A;  1LTB C;  1RH5 B;  1S1C X;  3NXS A;  4N78 D;  5CCH A;  3A5T A;  2ZXX A;  3ABV C;  4H44 B;  1EZV D;  1L4A C;  2QM7 A;  2ZJS E;  3L71 G;  1FZG A;  2PAJ A;  1NTZ J;  2OYI A;  1L0N G;  3FXE A;  4WB4 A;  1NTM D;  4ZKP A;  3JSV C;  1GL2 D;  2WZ7 A;  2FYU E;  1EZV G;  1XTC C;  3HTK A;  5AVQ B;  1T3U A;  2JP3 A;  1LTA C;  2YIU C;  3H1K E;  4PD4 I;  3SWK A;  4H13 C;  1KC8 Q;  1N73 A;  2KNC A;  1DIP A;  1OFC X;  1JMB A;  5AVT B;  5AW9 B;  3RK3 C;  2FFD A;  1T2K C;  4OGQ D;  2C9N Y;  3PRJ A;  1G2C B;  2H88 C;  4IFF A;  2HPC A;  1GDT A;  5E79 E;  3OW2 O;  2O3J A;  3CWB G;  4JYC A;  2N1T A;  2QIW A;  5AW3 B;  3RK3 E;  4GOD A;  4C46 A;  1S9K D;  3H1H G;  2HPC B;  2KZJ A;  1RY3 A;  3HE5 B;  1IK7 A;  1JY2 O;  1SQV K;  3AE7 C;  3CWB D;  3V2P A;  1SQX K;  1H89 A;  2P1J A;  2A06 D;  1NHL A;  4L75 A;  1LT9 C;  3L72 E;  2NPS B;  2K37 A;  3RK3 B;  1SQP J;  3AE5 C;  3H32 A;  3CCJ P;  1FDI A;  2E74 C;  2J5U A;  1MUU A;  1P84 H;  1WT6 A;  3EQ2 A;  1LT9 A;  3H1J E;  1IFI A;  1JY3 P;  2NPS A;  3H1J D;  1J1E B;  4JF7 A;  4JPZ B;  2ITA A;  3AEF C;  1PZQ A;  1M1J C;  4YXD C;  4D6T G;  3SFE C;  5B5E E;  1FAV A;  1KB9 E;  2KZI A;  1CW5 A;  3KZI E;  4H0L B;  1BCC G;  1SVF A;  1N7S A;  1J1D C;  2E75 D;  5KLI B;  5KLV E;  1PGP A;  2Q5U A;  3BCC G;  5DJU B;  1NTZ D;  2E74 B;  4EYY Q;  3T97 B;  1P84 E;  2KIK A;  3R2P A;  4LC1 A;  1FU1 A;  1PP9 E;  1PP9 D;  1NJI Q;  1RE4 C;  1N7S D;  2FFD C;  3C1L A;  3D70 A;  2C0W A;  1QX8 A;  1RE3 C;  3O8Z A;  3VMX A;  2R5B A;  3IFM A;  3II6 A;  3TGU J;  2H43 A;  3L74 G;  4DCK A;  1SQX J;  2BCC D;  3BAS A;  5KAF H;  1H0T A;  1NTM E;  1DD3 A;  2LXC B;  2ZAE B;  1IFJ A;  2ZT9 C;  3L72 D;  1UIX A;  2BAS A;  4Y28 J;  2JKV A;  4Y99 C;  3R4Y A;  2N9B A;  3M0D C;  3N7N A;  5AVU B;  3KQG A;  4EIJ A;  3B4S A;  2KUB A;  5M1B A;  5AW2 B;  1EDJ A;  3QWO C;  1YHQ P;  2IDB A;  1FZE A;  4KJM A;  5GTH H;  2ZYA A;  5EFW B;  2N1T D;  2KLU A;  2WSC H;  1JNM A;  1E79 H;  1GMJ A;  1SFC D;  3RL0 D;  1N73 C;  4TLF A;  5APX A;  1VQL P;  3B71 A;  1RF1 B;  3D71 A;  2Y0D A;  2BEQ D;  1OW6 A;  3JCU H;  1YYC A;  1HJ0 A;  5L8R J;  2XU6 A;  5APT A;  1NAF A;  1LTJ A;  1VQ4 P;  3FWL A;  1X79 B;  2M5A A;  4L74 A;  3L74 J;  4HYT B;  2E76 D;  5APS A;  3V4W A;  2WSE J;  4RES B;  1YJW P;  4PV1 C;  2P7J A;  2ZYG A;  1AJY A;  4OGQ B;  1FS0 E;  5B66 H;  1GU5 A;  4GDO A;  5BU5 A;  1OXZ A;  1W5C E;  1JTH B;  2W83 C;  4D6T E;  5KJ7 C;  3L73 E;  2WWW A;  4U7J A;  3L71 J;  3MUD A;  2OTK E;  3HUS A;  2JWD A;  3KYQ A;  3M9Q A;  3O6Q A;  1KFN A;  4H13 D;  3WUU A;  1N8R Q;  1X22 A;  3KHU A;  3WMM 0;  1QVG O;  1NU1 K;  3H1H J;  1JEK A;  3NFQ A;  1Y8A A;  1DX7 A;  3AEC C;  3JCU E;  2R5D A;  3V6I A;  2W8Z A;  1LTT C;  2MJZ A;  3M06 A;  3P7K A;  2OYH A;  4EI2 A;  5E79 H;  2IZ0 A;  4UB8 E;  3V2R A;  1SQP G;  1N73 B;  3L75 J;  4NPE A;  1L0L K;  1VQ8 P;  5DJT B;  1UII A;  1P84 I;  4R4M A;  2JO1 A;  4H0L D;  2L91 A;  4BRY B;  1YIJ P;  1SQX G;  1LGH B;  2KXP B;  1T8Z A;  3MD0 A;  1LWU B;  1BE3 G;  1OX3 A;  2IBZ I;  1VPC A;  5KLV D;  1BCC J;  1QVF O;  1SQV J;  3F89 A;  1NTZ E;  3MHV A;  2K88 A;  2YKO A;  2Q7C A;  1N7L A;  1VL2 A;  2XDJ A;  5AVX B;  2FKW B;  1SQQ D;  2POH A;  4EOT A;  1EC5 A;  3E1I A;  3TGU G;  5AW7 B;  3USS A;  1KIL D;  3H1K J;  4I2L C;  3M9B A;  1KZU B;  1NTK E;  2KS1 A;  1SQQ G;  3HRN A;  1EXJ A;  3B8E B;  2AXT H;  2K1A A;  3KXD A;  2FBW C;  3BCC J;  3L71 D;  3V5B A;  1VQK P;  1L0N D;  4I7Z C;  1OVV A;  2R3C A;  2W6B A;  2K9J A;  3M0D A;  5KKZ C;  1FZC A;  3N4X A;  1JY3 N;  4GOF A;  4I1L A;  1VQM P;  1KQS O;  2XND H;  1VQ7 P;  2Y9Y A;  2NPS C;  5H2F E;  1M7L A;  1EXI A;  1T2K D;  2IX7 C;  3WUV A;  4C7R A;  3RBZ A;  3AEA C;  1YIT P;  4KT0 J;  1S9K E;  4U3F G;  4C7N B;  1URQ A;  1M1J B;  1NAY A;  3AEE C; 
#chains in the Genus database with same CATH homology
 1KB9 H;  1PPJ G;  1BE3 G;  3H1J G;  3L70 G;  1NTK G;  1P84 H;  2A06 G;  3H1K G;  3L72 G;  3TGU G;  3H1L G;  2FYU G;  3L71 G;  1L0N G;  1SQQ G;  4D6T G;  1NTZ G;  1SQV G;  1BGY G;  1EZV G;  1KYO H;  3H1I G;  1BCC G;  4PD4 H;  3L73 G;  3BCC G;  1NTM G;  3CXH H;  3L75 G;  1L0L G;  3CX5 H;  2IBZ G;  1SQP G;  1SQB G;  2BCC G;  3CWB G;  1NU1 G;  5KLV G;  4U3F G;  3H1H G;  3L74 G;  1SQX G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...