3H1LG

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1lG00
2A06G 1NTKG 3L73G 5KLVG 1EZVG 1KYOH 3CWBG 3H1JG 2FYUG 3BCCG 3L75G 2BCCG 1BGYG 1NTZG 1BCCG 1NU1G 1KB9H 3H1LG 1NTMG 3H1IG 4PD4H 1SQQG 3L70G 1L0NG 1PP9G 3H1HG 3CX5H 1SQXG 3L72G 1PPJG 3L74G 1SQVG 1L0LG 1SQBG 1BE3G 2IBZG 4D6TG 3CXHH 1SQPG 3L71G 4U3FG 3TGUG 3H1KG 1P84H
chains in the Genus database with same CATH superfamily
3CCJP 2IFMA 3CLQA 3AECC 1JOCA 3VN0A 1SQXK 3EFFK 4OWFA 1Q81Q 3CD6P 3L72E 1M1KQ 1YBKA 2K9JB 2W6BA 3SFEC 4EIJA 2VRSA 2B87B 3M0AA 2O3JA 1P84H 4ASWA 1BGYE 2B9BA 1BCCJ 2QG4A 1LP1A 2QJKB 2UWJE 4PD4D 1KB9H 1N7SB 3BCCD 2P10A 5KJ7A 1NHLA 2BCCJ 3L75E 2ZVNB 3C1LA 3W67A 1EXJA 1N86A 1JNMA 1JUNA 3RL0g 3N7NA 1NH4A 3A2AA 2E76C 3HD7A 2N9BA 1A02J 1GD2E 2A45H 5APUA 4KJMA 2O1KA 3RK3B 1Q7YQ 1LP1B 1MV8A 1KFMA 1RE4A 5EFWB 3RL0D 1L0NE 1FDMA 3OAKA 1NOHA 2M0BA 1EDLA 1BE3J 1JCDA 3F89A 4N78D 3H25A 2G3AA 3L72G 4I7ZB 4K35A 2R5DA 3USSA 1KILD 2FY8A 2KNCA 3VTPC 4DJGA 2FYZA 3UIAA 4PV1C 2P1JA 1VQMP 5APVA 1BGYG 4H13B 1VQ5P 3HD7B 2Q5UA 3PLNA 3CCEP 1KQSO 1NTKJ 1RQUA 2PRRA 3CC7P 4IOIH 3CXHI 4A7PA 1YJ9P 3NTNA 3EQ2A 5GTIE 3AE7C 1N2DC 3MGNA 3RK2D 3BASA 5C39A 3I56P 2KB7P 2KNCB 2E5YA 1S9KD 3E7KA 2ZJSE 2BEZF 2WMMA 1QL1A 1OW8A 1L0NG 4U3FJ 2I1KA 3B71A 1S3JA 1MKMA 4W80A 1FZCC 1W2EA 1K05A 4I6MC 1FU1A 2WPVB 3AE2C 3G71P 1LWUA 2RKLA 3H1HE 2ZYGA 3E1IA 2YKQA 1AVYA 2FYNC 2E43A 3KQGA 5AW5B 2Z5IA 3L73E 4OVNF 4H0LC 4UB6H 3A0HH 1EXIA 1FZEA 1S72P 1NU1E 4XFJA 4O9BA 4TLFA 3FGAD 1RHZB 4HB1A 3SWYA 1Q90D 2E75D 3H1KG 1VPCA 1EDJA 5GTHE 1X9VA 1LWUB 1AFOA 2CPSA 3WUVA 3M9BA 1LT1A 3VMAA 3H1KD 1RE3A 3KZIH 3TGUE 1LTIC 3MIWA 3MHVA 2GUSA 1CZQA 2L91A 5AVVB 5KAFE 3VMXA 5AVWB 1BDDA 3HTKA 1NTME 2O01H 3RGUA 5AW3B 2WSSH 2OYIA 4HJGH 1YTZI 1KD1Q 1M7LA 2IDBA 1KN7A 3H1HG 3CX5H 3C8VA 2M8RA 2QJPC 4IL6X 2K88A 5BVZA 3L73G 3RK3C 3H1HD 2KSEA 3NFQA 1U7JA 1NU1G 2JEEA 1QLED 3L73D 1PIXA 1FBMA 1NU1D 1FZBA 2LKMA 1LTAC 3HTKB 4L73A 1K8AQ 1S5LH 2W8ZA 5APSA 2OYIB 2QEXP 3CCRP 1CI6A 1BSNA 3V2NA 1L4AA 1YI2P 5AVZB 3JCUH 3AEGC 1NU1K 5APYA 3TGUG 1PFIA 1NTZE 3M0DA 5APTA 1JM0A 1G1JA 3M9HA 5APQA 3HUSA 1VQ6P 1NTMG 1PPJE 1GU5A 3TGUD 5H2FE 3VP9A 1FAVA 4UB8H 1EZVE 3CXHE 2JP3A 1AA0A 1NTMD 1GL2A 5BU5A 2Y9YA 1CI6B 1S5LX 2QVAA 4JQ0D 1HUCA 1U57A 2J5UA 1RF1B 2GM4A 1L4AB 1AVOA 4H0LD 3H32B 4RESB 3D71A 2Q7CA 1JMMA 2HFED 2WT7A 5KAIE 2POHA 1NTMK 1KYOH 1J1EB 4RKUJ 1N7LA 2H7HA 3HUSB 3L72J 4EYYQ 3IF4A 3D70A 1SQPE 2JDIH 3ITKA 3GW6A 2XV5A 1RH5B 2OARA 1YQ3C 2LXBA 1R8EA 1BGYJ 2NPSD 2FKWB 1GL2B 2RN0A 1QEXA 4H44C 3TK1A 4L75A 4ZMDA 4KT0J 3H1LG 1SQXE 4GT1A 2M3BA 4C7NA 2K9YA 1PPJG 2WT7B 2Z4EA 5CCHC 3N4XA 1K04A 1P84E 3L75J 3H1LD 3CMAP 5TISE 1VL2A 1GU4A 1EZVG 1X22A 4NPDA 3V2PA 5AVSB 3PRJA 2R3SA 1SLQA 1LWUC 1PP9J 2M3EA 3IN6A 3D6ZA 3L36A 1FDOA 5KLVD 1EZVD 5AW2B 3P7KA 1NO4A 1LTGC 4DZOA 1EQ7A 2FXPA 2YNYA 1NKNA 2KP8A 1G2CA 2Q6QA 5L8RJ 4XA4A 1L0NJ 1PV3A 1KQFB 1R5LA 2Z5HA 3F5HA 2OYOA 2H8PD 1SQVE 3V5BA 5KLVK 4C7NB 2ITAA 3WU2E 2H89C 2Y0DA 4I1LA 2JJLA 2WWWA 2E42A 3RBZA 3BCCE 1FS0E 3BRTB 3CCUP 1DIPA 1YHQP 1SQBD 2GUVA 2KUBA 5B66H 1J2JB 3KYQA 2YXQB 1G2CB 1KFNA 1LTBC 2ZFCA 1SQBK 4WY4D 3B5NA 2ZYAA 1GDTA 3L37A 1OFCX 2KYVA 1P84D 2O01N 2IBZG 4N78E 3PH0A 2SPZA 1ZLLA 1LTTC 1KB9D 1IK7A 1KILE 3A5TA 1JO5A 1SQQJ 2IBZD 4JYBA 3TF5A 1KZUB 5CCGD 1IJDB 1SQVG 2A45G 2WSFJ 2IYOA 2I8DA 1SVFA 3BCCG 1HVVA 5CMZA 2IPPA 2AXTH 1SQVD 3B5NB 1DX7A 3I5CA 3U1AA 2XNXA 1RF1C 3AE6C 1Q86Q 1L4AC 5AW9B 2ZT9B 2OTLP 2XNDH 3CPWO 3P8CD 1JTHA 4H44D 2M5AB 4GKGA 4OGQD 4I2LC 3M0DC 2LR2A 3H1IE 4HKZH 1SQVK 1J1EC 1S9KE 1T3JA 3HUSC 3OJAB 4DCKA 3A7OA 2QRXA 3H6PA 5CCHD 3U59A 3SFDC 1EDIA 1GMJA 3MUDA 1T2KC 2QJYB 2N1TC 2P7JA 4L76A 2D2CB 3BVHA 2YXRB 3CC4P 2KOGA 3V6IA 3AEFC 2JWDA 4PD4H 3TGUJ 1OVVA 2YO3A 2RH0A 1FE6A 1GW3A 1HGZA 1JTHB 3PHLA 4WB4A 2KS1A 1NTMJ 1W5CE 4W7ZA 2MJZA 2JO1A 1URQD 5KTBA 3TDKA 1W2BO 2K1AA 2QIWA 2NRGA 3A0BH 1N73A 5DJUB 1MUUA 3KZIE 1SFCA 2FXMA 1OIPA 1KTMA 5CHXA 1IFPA 1VF5B 1VQOP 1CW5A 3ABVC 1VQLP 2KIKA 5AW0B 3G9RA 3FXEA 1EZVI 2O1JA 3L74J 1KV4A 3H1IG 1L0LE 3CX5E 5E79H 5M1BA 3H1KE 1NWQA 3H1JE 3FWLA 3H1ID 2W90A 5B5EH 3AEAC 1OW6A 1GTWA 1JB0J 1N73B 3AE8C 1SFCB 3L70G 1LJ2A 2JKVA 2DW3A 1HWTC 4Y99B 1WMKA 1MFZA 1OX3A 2HR3A 1NTZJ 3L70D 2FYUG 4YTPC 2Q3EA 3M06A 3S1KA 2FYUD 2HYNA 3AEDC 3V2RA 2AEMA 2I1JA 2YMKA 3U1CA 2R3CA 1L4AD 1JCCA 1P84I 2C9LY 4UB8E 1L2PA 2FYUK 1L0LG 4IL6H 1KB9I 1PZQA 3AEEC 2A06G 1KILA 1OMIA 2IBZI 3H1JG 3CCQP 2E76D 2QJKC 1L0LD 1RF0A 4HH2A 3CX5D 2K37A 3B5NC 4YPCA 4HYTB 1SQPJ 1IFIA 2A06D 2YIUB 4GOFA 1N7SC 3H1JD 3W68A 2N1TD 1VQKP 2ZT9C 3L71G 4ZKPA 2OTJP 2WSEJ 3GHGA 4LLHA 2A45I 1L0LK 3RL0B 1SQXJ 3L71D 1U7MA 2C0WA 2KLVA 1JMBA 2V7QJ 4N6JA 1LTJA 4PJ0E 1T3UA 2WSCH 1SP4A 1QVGO 2BASA 3HE4A 2QJYC 1KILB 4PV1D 4RJTA 2D2CC 3SWKA 1BCCG 2H88C 3CCSP 5GTIH 2IZ0A 4D6TE 3GMAA 2MKVA 1NTKE 1S1CX 3S9OA 5KJ7C 4I7ZC 1BCCD 2FFDA 1YYCA 2IFNA 3GHGB 3P8MC 3CCMP 1X0TA 1QGKB 5AVRB 1SQVJ 2IX7C 2XKMA 4H13C 2QA4P 1LTJB 3HD7C 3CMEP 2ZYDA 1N8RQ 1FZFA 4NPEA 1YIJP 4GODA 4AYCA 2BCCD 3BCCJ 3MUDC 5AW7B 3Q5PA 3HE4B 1NJIQ 2V4HA 2C9NY 2WSFH 3LW5J 5AW4B 3H1LE 1DD4A 1IZNB 1RE4C 2AEFA 1OVRA 5AVUB 1VQ4P 3VMZA 2Q1KA 4U3FE 1VQPP 5KLVE 1BE3G 1KYOD 2FFDB 2PFXA 3AEBC 4JYCA 1M90Q 3CC2P 3RK3E 2WPRA 3O6QA 4ASVA 1BE3D 1N73C 2ZVOB 1SFCC 2YMYA 1VDFA 1X8YA 2QM7A 1JY2N 4Y99C 4D6TG 3CWBE 5CBOA 1NTKG 3FXDA 2FBWC 5GTHH 3LIEA 2B89A 1H0TA 5AVTB 2QSIA 2LXCB 1HH0A 4D6TD 3R2PA 1SQBE 2K3RA 1NTKD 1FOSE 2YO2A 2IZ1A 1ZRTD 2OYHA 3PP5A 2E75B 5KAFH 2Y9ZA 2KK7A 1HJ0A 3O6QB 1JY3P 2R44A 2W83C 2IYPA 1N7SD 1IC2A 1NTKK 2ZT9D 3O8ZA 1JEKA 3AE5C 4U3FG 5CJ0A 1ZXGA 5KLVG 2N9YB 1H0TB 1R5SA 1AV1A 3I55P 1M1JA 1KB9E 3PTZA 1S2EA 1ZN5A 4U3FD 3G6EP 3Q1MA 2IBZE 4BXLA 5DJTB 3BRVB 2OYHB 4GOEA 4B86A 3RK3D 1AQTA 3KPEA 1LT9A 4L74A 3CX5I 1TU3F 2FXOA 3CWBG 1OXZA 1KQLA 3RL0C 3VYIA 1LNQA 5KJ7D 4WBAA 3CWBD 1SQBG 2NZ2A 3NXSA 2KSJA 3P8CE 1M1JB 4H13D 3HD7D 1GW4A 1NYHA 2R5BA 2WSCJ 1RE3C 1VQNP 3CXHH 5AVQB 3IR9A 1LT9B 3V4WA 4DOJA 1SS1A 3GHGC 2GA1A 1XTCC 3A0BE 2OYIC 1DD3A 1LTJC 3VMYA 2HLOA 1OW7A 3H1KJ 3TNUA 5KAIH 1NAYA 3GF3A 3RBXA 2E74B 3HE5A 2NPSA 4XE5B 4JPZB 1VQ8P 5KLIB 1SFCD 2HPCA 1VQ9P 4EOTA 1IO4A 3MZWB 3AE9C 2OTKE 2FFDC 3FX0A 5B5EE 4WVZA 2WSEH 2HODA 3H1HJ 1PGJA 3K5BA 3V2QA 1KYOI 2V7QH 3B8EB 1BSHA 1YTZT 3L73J 3TNUB 1K9MQ 2JR8A 5TISH 4YXWH 3HE5B 2NPSB 1NU1J 3CI9A 4YXDC 2HPCB 2P58A 5AW8B 3ZDMA 4UB6E 3A0HE 3M91A 2E75C 3KXDA 2WZ7A 5AW6B 1FOSF 1GL2C 2HODB 1PP9E 4QMAA 3L70E 1UIXA 5CBNA 4BWNA 1EDKA 3Q3DA 2QJPB 3WU2H 4IL6E 2FYUE 3LW5H 1HF9A 2XDJA 4WY4A 2WQYC 1JY2P 2W27A 1NVOA 4ZKUA 2OYHC 1XTGB 1EC5A 3II6A 3TYYA 2B88A 5AVXB 3L72D 1DEEG 3P32A 4LGDE 3CL3D 1JY3N 4D6TJ 1YJNP 2ZAEB 3Q2YA 5CCGA 4M3LA 3PJSK 1BGYD 2A06E 4NPFX 3VP8A 2KS1B 3L75G 3A3YB 1M1JC 1Y9BA 4JF7A 4WY4B 1Q82Q 3KHUA 4N3YB 1OWAA 2KLUA 2JWAA 3OW2O 1PGPA 1PP9G 1RY3A 3L71E 1PGOA 1KQGB 3L75D 3AE4C 2Y0EA 3JC22 3AE3C 1OVUA 3CCVP 1LGHB 4CPGA 1LT9C 1WT6A 3H1LJ 1PP9D 1S5LE 5KKZB 1SQQE 1QX8A 4Z1MH 3E1RA 5KLVJ 5CCHA 2CPBA 3JCUE 1USDA 4LC1A 2PAJA 3IFMA 1WRGA 1QVFO 2PP6A 1L0ND 2E74C 1BCCE 1ZR2A 1HTLC 1T6AA 4R4LA 3M9QA 5KLIC 2W6JH 1Y8AA 3MTUE 1MZ9A 3TSIA 3LIDA 4BRYA 1ZV8A 3SSUA 3CWBJ 4RO0A 2XZRA 4H44B 3BATA 2BCCE 1L0NK 4OGQB 3KDPB 1VQ7P 4EDFA 1URQA 3S4RA 1NGMB 1SQBJ 1CSBA 1DEBA 4TT3H 1IFDA 1T2KD 4GIFA 2QM8A 1FJKA 2AEJA 1GL2D 1J1DB 3MD0A 1KYOE 2NPSC 5APXA 3WMM0 5APWA 1JY2O 3VOPA 2YKOA 4ZNCA 4BRYB 1SQQG 1BE3E 2Q3IA 2R32A 1AJYA 1H8AA 4PD4I 1SQQD 1DH3A 2J59M 1URQB 3C9IA 2KXPB 1BDCA 4OH8B 1IFJA 3OA7A 1ZP0C 3QH9A 1SQQK 1ZRTE 2KZJA 1T8ZA 1USEA 4WWIA 2BCCG 1KORA 1KC8Q 3L74E 4DT0A 1Z56A 4KHXA 2W6AA 3RK2B 5K5GB 3MP7B 2C0XA 1OZHA 1VF5C 2QE7H 3GG2A 4U7JA 4IFDK 1ZOYC 2KI7B 4C7RA 3HRNA 1M8OB 1AQ5A 1RF1A 4MN4C 2P2UA 4Y28J 3H32A 1RQVA 2Q9IA 2WITA 3D6YA 1E5WA 1NKZB 2KZIA 2P67A 1Y47A 1ZW0A 5AW1B 3L35A 2BEQD 4WY4C 5B66E 2H43A 4AUWA 2XU6A 2YKPA 4C46A 2N1TA 2E74D 1YJWP 1S4XA 1NAFA 2ZXXA 5KKZC 1YITP 3SWFA 2G8YA 4JBZA 5CCGC 3L74G 3CCLP 4EI2A 1E79H 1ZMEC 3NMDA 1FC2C 3EFGA 3B5ND 2E76B 3L74D 4K3AA 3GF7A 3WUTA 1PGQA 5AVYB 5CJ4A 3Q5RA 4PJ0H 1FZGA 2N1TB 1G1IA 3L4FA 2E5TA 2WPQA 3H1IJ 1M56D 4OGQC 1IFMA 2AXTE 1NTZG 3FWNA 2WVRA 3AE1C 4W7YA 2WPSA 2YIUC 1HJBA 1NTZD 1HGVA 2D2CD 1J1DC 1A02F 4PV1B 1PPJD 2J58A 3IAOA 3T97A 3L70J 1GK4A 1YQ4C 3CXHD 1GK6A 4R4MA 2WTYA 1PL5A 2OQQA 1NTZK 2FYUJ 1FZCA 2L5GB 3EWKA 1QL2A 1KILC 2HG5D 1LTSC 1URQC 1KMIZ 1H89A 1RF0C 1Q2NA 1H88A 4PD4E 1GZLA 5H2FH 3QWOC 2Y0CA 3Q5SA 3G4SP 1SQPG 1VF5D 1IFNA 1D7MA 5TJHA 2RMZA 2AXCA 3R4YA 4IFMA 2ZXEB 3GLMA 1ZR4A 2O01J 1FZAA 3T97B 4GDOA 5BU8B 1SQPD 1FJPA 1L0LJ 1IK9A 1K73Q 1SQXG 2K9JA 1FZCB 3H1JJ 2B87A 3RK2C 1UIIA 3G3ZA 3B4SA 1FDIA 1MFTA 1SQXD 2OGUA 1SQPK 2FYNB 3WUUA 5E79E 1M57D 1N7SA 3L71J 3JSVC 4H0LB 1X79B 2PGDA 3V4QA 1HBWA 1JY3O 2CK3H 4IFFA 4AQRD 2M5AA
chains in the Genus database with same CATH topology
2A06G 1NTKG 3L73G 5KLVG 1EZVG 1KYOH 3CWBG 3H1JG 2FYUG 3BCCG 3L75G 2BCCG 1BGYG 1NTZG 1BCCG 1NU1G 1KB9H 3H1LG 1NTMG 3H1IG 4PD4H 1SQQG 3L70G 1L0NG 1PP9G 3H1HG 3CX5H 1SQXG 3L72G 1PPJG 3L74G 1SQVG 1L0LG 1SQBG 1BE3G 2IBZG 4D6TG 3CXHH 1SQPG 3L71G 4U3FG 3TGUG 3H1KG 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1NTK G;  3L73 G;  5KLV G;  1EZV G;  1KYO H;  3CWB G;  3H1J G;  2FYU G;  3BCC G;  3L75 G;  2BCC G;  1BGY G;  1NTZ G;  1BCC G;  1NU1 G;  1KB9 H;  3H1L G;  1NTM G;  3H1I G;  4PD4 H;  1SQQ G;  3L70 G;  1L0N G;  1PP9 G;  3H1H G;  3CX5 H;  1SQX G;  3L72 G;  1PPJ G;  3L74 G;  1SQV G;  1L0L G;  1SQB G;  1BE3 G;  2IBZ G;  4D6T G;  3CXH H;  1SQP G;  3L71 G;  4U3F G;  3TGU G;  3H1K G;  1P84 H; 
#chains in the Genus database with same CATH topology
 3CCJ P;  2IFM A;  3CLQ A;  3AEC C;  1JOC A;  3VN0 A;  1SQX K;  3EFF K;  4OWF A;  1Q81 Q;  3CD6 P;  3L72 E;  1M1K Q;  1YBK A;  2K9J B;  2W6B A;  3SFE C;  4EIJ A;  2VRS A;  2B87 B;  3M0A A;  2O3J A;  1P84 H;  4ASW A;  1BGY E;  2B9B A;  1BCC J;  2QG4 A;  1LP1 A;  2QJK B;  2UWJ E;  4PD4 D;  1KB9 H;  1N7S B;  3BCC D;  2P10 A;  5KJ7 A;  1NHL A;  2BCC J;  3L75 E;  2ZVN B;  3C1L A;  3W67 A;  1EXJ A;  1N86 A;  1JNM A;  1JUN A;  3RL0 g;  3N7N A;  1NH4 A;  3A2A A;  2E76 C;  3HD7 A;  2N9B A;  1A02 J;  1GD2 E;  2A45 H;  5APU A;  4KJM A;  2O1K A;  3RK3 B;  1Q7Y Q;  1LP1 B;  1MV8 A;  1KFM A;  1RE4 A;  5EFW B;  3RL0 D;  1L0N E;  1FDM A;  3OAK A;  1NOH A;  2M0B A;  1EDL A;  1BE3 J;  1JCD A;  3F89 A;  4N78 D;  3H25 A;  2G3A A;  3L72 G;  4I7Z B;  4K35 A;  2R5D A;  3USS A;  1KIL D;  2FY8 A;  2KNC A;  3VTP C;  4DJG A;  2FYZ A;  3UIA A;  4PV1 C;  2P1J A;  1VQM P;  5APV A;  1BGY G;  4H13 B;  1VQ5 P;  3HD7 B;  2Q5U A;  3PLN A;  3CCE P;  1KQS O;  1NTK J;  1RQU A;  2PRR A;  3CC7 P;  4IOI H;  3CXH I;  4A7P A;  1YJ9 P;  3NTN A;  3EQ2 A;  5GTI E;  3AE7 C;  1N2D C;  3MGN A;  3RK2 D;  3BAS A;  5C39 A;  3I56 P;  2KB7 P;  2KNC B;  2E5Y A;  1S9K D;  3E7K A;  2ZJS E;  2BEZ F;  2WMM A;  1QL1 A;  1OW8 A;  1L0N G;  4U3F J;  2I1K A;  3B71 A;  1S3J A;  1MKM A;  4W80 A;  1FZC C;  1W2E A;  1K05 A;  4I6M C;  1FU1 A;  2WPV B;  3AE2 C;  3G71 P;  1LWU A;  2RKL A;  3H1H E;  2ZYG A;  3E1I A;  2YKQ A;  1AVY A;  2FYN C;  2E43 A;  3KQG A;  5AW5 B;  2Z5I A;  3L73 E;  4OVN F;  4H0L C;  4UB6 H;  3A0H H;  1EXI A;  1FZE A;  1S72 P;  1NU1 E;  4XFJ A;  4O9B A;  4TLF A;  3FGA D;  1RHZ B;  4HB1 A;  3SWY A;  1Q90 D;  2E75 D;  3H1K G;  1VPC A;  1EDJ A;  5GTH E;  1X9V A;  1LWU B;  1AFO A;  2CPS A;  3WUV A;  3M9B A;  1LT1 A;  3VMA A;  3H1K D;  1RE3 A;  3KZI H;  3TGU E;  1LTI C;  3MIW A;  3MHV A;  2GUS A;  1CZQ A;  2L91 A;  5AVV B;  5KAF E;  3VMX A;  5AVW B;  1BDD A;  3HTK A;  1NTM E;  2O01 H;  3RGU A;  5AW3 B;  2WSS H;  2OYI A;  4HJG H;  1YTZ I;  1KD1 Q;  1M7L A;  2IDB A;  1KN7 A;  3H1H G;  3CX5 H;  3C8V A;  2M8R A;  2QJP C;  4IL6 X;  2K88 A;  5BVZ A;  3L73 G;  3RK3 C;  3H1H D;  2KSE A;  3NFQ A;  1U7J A;  1NU1 G;  2JEE A;  1QLE D;  3L73 D;  1PIX A;  1FBM A;  1NU1 D;  1FZB A;  2LKM A;  1LTA C;  3HTK B;  4L73 A;  1K8A Q;  1S5L H;  2W8Z A;  5APS A;  2OYI B;  2QEX P;  3CCR P;  1CI6 A;  1BSN A;  3V2N A;  1L4A A;  1YI2 P;  5AVZ B;  3JCU H;  3AEG C;  1NU1 K;  5APY A;  3TGU G;  1PFI A;  1NTZ E;  3M0D A;  5APT A;  1JM0 A;  1G1J A;  3M9H A;  5APQ A;  3HUS A;  1VQ6 P;  1NTM G;  1PPJ E;  1GU5 A;  3TGU D;  5H2F E;  3VP9 A;  1FAV A;  4UB8 H;  1EZV E;  3CXH E;  2JP3 A;  1AA0 A;  1NTM D;  1GL2 A;  5BU5 A;  2Y9Y A;  1CI6 B;  1S5L X;  2QVA A;  4JQ0 D;  1HUC A;  1U57 A;  2J5U A;  1RF1 B;  2GM4 A;  1L4A B;  1AVO A;  4H0L D;  3H32 B;  4RES B;  3D71 A;  2Q7C A;  1JMM A;  2HFE D;  2WT7 A;  5KAI E;  2POH A;  1NTM K;  1KYO H;  1J1E B;  4RKU J;  1N7L A;  2H7H A;  3HUS B;  3L72 J;  4EYY Q;  3IF4 A;  3D70 A;  1SQP E;  2JDI H;  3ITK A;  3GW6 A;  2XV5 A;  1RH5 B;  2OAR A;  1YQ3 C;  2LXB A;  1R8E A;  1BGY J;  2NPS D;  2FKW B;  1GL2 B;  2RN0 A;  1QEX A;  4H44 C;  3TK1 A;  4L75 A;  4ZMD A;  4KT0 J;  3H1L G;  1SQX E;  4GT1 A;  2M3B A;  4C7N A;  2K9Y A;  1PPJ G;  2WT7 B;  2Z4E A;  5CCH C;  3N4X A;  1K04 A;  1P84 E;  3L75 J;  3H1L D;  3CMA P;  5TIS E;  1VL2 A;  1GU4 A;  1EZV G;  1X22 A;  4NPD A;  3V2P A;  5AVS B;  3PRJ A;  2R3S A;  1SLQ A;  1LWU C;  1PP9 J;  2M3E A;  3IN6 A;  3D6Z A;  3L36 A;  1FDO A;  5KLV D;  1EZV D;  5AW2 B;  3P7K A;  1NO4 A;  1LTG C;  4DZO A;  1EQ7 A;  2FXP A;  2YNY A;  1NKN A;  2KP8 A;  1G2C A;  2Q6Q A;  5L8R J;  4XA4 A;  1L0N J;  1PV3 A;  1KQF B;  1R5L A;  2Z5H A;  3F5H A;  2OYO A;  2H8P D;  1SQV E;  3V5B A;  5KLV K;  4C7N B;  2ITA A;  3WU2 E;  2H89 C;  2Y0D A;  4I1L A;  2JJL A;  2WWW A;  2E42 A;  3RBZ A;  3BCC E;  1FS0 E;  3BRT B;  3CCU P;  1DIP A;  1YHQ P;  1SQB D;  2GUV A;  2KUB A;  5B66 H;  1J2J B;  3KYQ A;  2YXQ B;  1G2C B;  1KFN A;  1LTB C;  2ZFC A;  1SQB K;  4WY4 D;  3B5N A;  2ZYA A;  1GDT A;  3L37 A;  1OFC X;  2KYV A;  1P84 D;  2O01 N;  2IBZ G;  4N78 E;  3PH0 A;  2SPZ A;  1ZLL A;  1LTT C;  1KB9 D;  1IK7 A;  1KIL E;  3A5T A;  1JO5 A;  1SQQ J;  2IBZ D;  4JYB A;  3TF5 A;  1KZU B;  5CCG D;  1IJD B;  1SQV G;  2A45 G;  2WSF J;  2IYO A;  2I8D A;  1SVF A;  3BCC G;  1HVV A;  5CMZ A;  2IPP A;  2AXT H;  1SQV D;  3B5N B;  1DX7 A;  3I5C A;  3U1A A;  2XNX A;  1RF1 C;  3AE6 C;  1Q86 Q;  1L4A C;  5AW9 B;  2ZT9 B;  2OTL P;  2XND H;  3CPW O;  3P8C D;  1JTH A;  4H44 D;  2M5A B;  4GKG A;  4OGQ D;  4I2L C;  3M0D C;  2LR2 A;  3H1I E;  4HKZ H;  1SQV K;  1J1E C;  1S9K E;  1T3J A;  3HUS C;  3OJA B;  4DCK A;  3A7O A;  2QRX A;  3H6P A;  5CCH D;  3U59 A;  3SFD C;  1EDI A;  1GMJ A;  3MUD A;  1T2K C;  2QJY B;  2N1T C;  2P7J A;  4L76 A;  2D2C B;  3BVH A;  2YXR B;  3CC4 P;  2KOG A;  3V6I A;  3AEF C;  2JWD A;  4PD4 H;  3TGU J;  1OVV A;  2YO3 A;  2RH0 A;  1FE6 A;  1GW3 A;  1HGZ A;  1JTH B;  3PHL A;  4WB4 A;  2KS1 A;  1NTM J;  1W5C E;  4W7Z A;  2MJZ A;  2JO1 A;  1URQ D;  5KTB A;  3TDK A;  1W2B O;  2K1A A;  2QIW A;  2NRG A;  3A0B H;  1N73 A;  5DJU B;  1MUU A;  3KZI E;  1SFC A;  2FXM A;  1OIP A;  1KTM A;  5CHX A;  1IFP A;  1VF5 B;  1VQO P;  1CW5 A;  3ABV C;  1VQL P;  2KIK A;  5AW0 B;  3G9R A;  3FXE A;  1EZV I;  2O1J A;  3L74 J;  1KV4 A;  3H1I G;  1L0L E;  3CX5 E;  5E79 H;  5M1B A;  3H1K E;  1NWQ A;  3H1J E;  3FWL A;  3H1I D;  2W90 A;  5B5E H;  3AEA C;  1OW6 A;  1GTW A;  1JB0 J;  1N73 B;  3AE8 C;  1SFC B;  3L70 G;  1LJ2 A;  2JKV A;  2DW3 A;  1HWT C;  4Y99 B;  1WMK A;  1MFZ A;  1OX3 A;  2HR3 A;  1NTZ J;  3L70 D;  2FYU G;  4YTP C;  2Q3E A;  3M06 A;  3S1K A;  2FYU D;  2HYN A;  3AED C;  3V2R A;  2AEM A;  2I1J A;  2YMK A;  3U1C A;  2R3C A;  1L4A D;  1JCC A;  1P84 I;  2C9L Y;  4UB8 E;  1L2P A;  2FYU K;  1L0L G;  4IL6 H;  1KB9 I;  1PZQ A;  3AEE C;  2A06 G;  1KIL A;  1OMI A;  2IBZ I;  3H1J G;  3CCQ P;  2E76 D;  2QJK C;  1L0L D;  1RF0 A;  4HH2 A;  3CX5 D;  2K37 A;  3B5N C;  4YPC A;  4HYT B;  1SQP J;  1IFI A;  2A06 D;  2YIU B;  4GOF A;  1N7S C;  3H1J D;  3W68 A;  2N1T D;  1VQK P;  2ZT9 C;  3L71 G;  4ZKP A;  2OTJ P;  2WSE J;  3GHG A;  4LLH A;  2A45 I;  1L0L K;  3RL0 B;  1SQX J;  3L71 D;  1U7M A;  2C0W A;  2KLV A;  1JMB A;  2V7Q J;  4N6J A;  1LTJ A;  4PJ0 E;  1T3U A;  2WSC H;  1SP4 A;  1QVG O;  2BAS A;  3HE4 A;  2QJY C;  1KIL B;  4PV1 D;  4RJT A;  2D2C C;  3SWK A;  1BCC G;  2H88 C;  3CCS P;  5GTI H;  2IZ0 A;  4D6T E;  3GMA A;  2MKV A;  1NTK E;  1S1C X;  3S9O A;  5KJ7 C;  4I7Z C;  1BCC D;  2FFD A;  1YYC A;  2IFN A;  3GHG B;  3P8M C;  3CCM P;  1X0T A;  1QGK B;  5AVR B;  1SQV J;  2IX7 C;  2XKM A;  4H13 C;  2QA4 P;  1LTJ B;  3HD7 C;  3CME P;  2ZYD A;  1N8R Q;  1FZF A;  4NPE A;  1YIJ P;  4GOD A;  4AYC A;  2BCC D;  3BCC J;  3MUD C;  5AW7 B;  3Q5P A;  3HE4 B;  1NJI Q;  2V4H A;  2C9N Y;  2WSF H;  3LW5 J;  5AW4 B;  3H1L E;  1DD4 A;  1IZN B;  1RE4 C;  2AEF A;  1OVR A;  5AVU B;  1VQ4 P;  3VMZ A;  2Q1K A;  4U3F E;  1VQP P;  5KLV E;  1BE3 G;  1KYO D;  2FFD B;  2PFX A;  3AEB C;  4JYC A;  1M90 Q;  3CC2 P;  3RK3 E;  2WPR A;  3O6Q A;  4ASV A;  1BE3 D;  1N73 C;  2ZVO B;  1SFC C;  2YMY A;  1VDF A;  1X8Y A;  2QM7 A;  1JY2 N;  4Y99 C;  4D6T G;  3CWB E;  5CBO A;  1NTK G;  3FXD A;  2FBW C;  5GTH H;  3LIE A;  2B89 A;  1H0T A;  5AVT B;  2QSI A;  2LXC B;  1HH0 A;  4D6T D;  3R2P A;  1SQB E;  2K3R A;  1NTK D;  1FOS E;  2YO2 A;  2IZ1 A;  1ZRT D;  2OYH A;  3PP5 A;  2E75 B;  5KAF H;  2Y9Z A;  2KK7 A;  1HJ0 A;  3O6Q B;  1JY3 P;  2R44 A;  2W83 C;  2IYP A;  1N7S D;  1IC2 A;  1NTK K;  2ZT9 D;  3O8Z A;  1JEK A;  3AE5 C;  4U3F G;  5CJ0 A;  1ZXG A;  5KLV G;  2N9Y B;  1H0T B;  1R5S A;  1AV1 A;  3I55 P;  1M1J A;  1KB9 E;  3PTZ A;  1S2E A;  1ZN5 A;  4U3F D;  3G6E P;  3Q1M A;  2IBZ E;  4BXL A;  5DJT B;  3BRV B;  2OYH B;  4GOE A;  4B86 A;  3RK3 D;  1AQT A;  3KPE A;  1LT9 A;  4L74 A;  3CX5 I;  1TU3 F;  2FXO A;  3CWB G;  1OXZ A;  1KQL A;  3RL0 C;  3VYI A;  1LNQ A;  5KJ7 D;  4WBA A;  3CWB D;  1SQB G;  2NZ2 A;  3NXS A;  2KSJ A;  3P8C E;  1M1J B;  4H13 D;  3HD7 D;  1GW4 A;  1NYH A;  2R5B A;  2WSC J;  1RE3 C;  1VQN P;  3CXH H;  5AVQ B;  3IR9 A;  1LT9 B;  3V4W A;  4DOJ A;  1SS1 A;  3GHG C;  2GA1 A;  1XTC C;  3A0B E;  2OYI C;  1DD3 A;  1LTJ C;  3VMY A;  2HLO A;  1OW7 A;  3H1K J;  3TNU A;  5KAI H;  1NAY A;  3GF3 A;  3RBX A;  2E74 B;  3HE5 A;  2NPS A;  4XE5 B;  4JPZ B;  1VQ8 P;  5KLI B;  1SFC D;  2HPC A;  1VQ9 P;  4EOT A;  1IO4 A;  3MZW B;  3AE9 C;  2OTK E;  2FFD C;  3FX0 A;  5B5E E;  4WVZ A;  2WSE H;  2HOD A;  3H1H J;  1PGJ A;  3K5B A;  3V2Q A;  1KYO I;  2V7Q H;  3B8E B;  1BSH A;  1YTZ T;  3L73 J;  3TNU B;  1K9M Q;  2JR8 A;  5TIS H;  4YXW H;  3HE5 B;  2NPS B;  1NU1 J;  3CI9 A;  4YXD C;  2HPC B;  2P58 A;  5AW8 B;  3ZDM A;  4UB6 E;  3A0H E;  3M91 A;  2E75 C;  3KXD A;  2WZ7 A;  5AW6 B;  1FOS F;  1GL2 C;  2HOD B;  1PP9 E;  4QMA A;  3L70 E;  1UIX A;  5CBN A;  4BWN A;  1EDK A;  3Q3D A;  2QJP B;  3WU2 H;  4IL6 E;  2FYU E;  3LW5 H;  1HF9 A;  2XDJ A;  4WY4 A;  2WQY C;  1JY2 P;  2W27 A;  1NVO A;  4ZKU A;  2OYH C;  1XTG B;  1EC5 A;  3II6 A;  3TYY A;  2B88 A;  5AVX B;  3L72 D;  1DEE G;  3P32 A;  4LGD E;  3CL3 D;  1JY3 N;  4D6T J;  1YJN P;  2ZAE B;  3Q2Y A;  5CCG A;  4M3L A;  3PJS K;  1BGY D;  2A06 E;  4NPF X;  3VP8 A;  2KS1 B;  3L75 G;  3A3Y B;  1M1J C;  1Y9B A;  4JF7 A;  4WY4 B;  1Q82 Q;  3KHU A;  4N3Y B;  1OWA A;  2KLU A;  2JWA A;  3OW2 O;  1PGP A;  1PP9 G;  1RY3 A;  3L71 E;  1PGO A;  1KQG B;  3L75 D;  3AE4 C;  2Y0E A;  3JC2 2;  3AE3 C;  1OVU A;  3CCV P;  1LGH B;  4CPG A;  1LT9 C;  1WT6 A;  3H1L J;  1PP9 D;  1S5L E;  5KKZ B;  1SQQ E;  1QX8 A;  4Z1M H;  3E1R A;  5KLV J;  5CCH A;  2CPB A;  3JCU E;  1USD A;  4LC1 A;  2PAJ A;  3IFM A;  1WRG A;  1QVF O;  2PP6 A;  1L0N D;  2E74 C;  1BCC E;  1ZR2 A;  1HTL C;  1T6A A;  4R4L A;  3M9Q A;  5KLI C;  2W6J H;  1Y8A A;  3MTU E;  1MZ9 A;  3TSI A;  3LID A;  4BRY A;  1ZV8 A;  3SSU A;  3CWB J;  4RO0 A;  2XZR A;  4H44 B;  3BAT A;  2BCC E;  1L0N K;  4OGQ B;  3KDP B;  1VQ7 P;  4EDF A;  1URQ A;  3S4R A;  1NGM B;  1SQB J;  1CSB A;  1DEB A;  4TT3 H;  1IFD A;  1T2K D;  4GIF A;  2QM8 A;  1FJK A;  2AEJ A;  1GL2 D;  1J1D B;  3MD0 A;  1KYO E;  2NPS C;  5APX A;  3WMM 0;  5APW A;  1JY2 O;  3VOP A;  2YKO A;  4ZNC A;  4BRY B;  1SQQ G;  1BE3 E;  2Q3I A;  2R32 A;  1AJY A;  1H8A A;  4PD4 I;  1SQQ D;  1DH3 A;  2J59 M;  1URQ B;  3C9I A;  2KXP B;  1BDC A;  4OH8 B;  1IFJ A;  3OA7 A;  1ZP0 C;  3QH9 A;  1SQQ K;  1ZRT E;  2KZJ A;  1T8Z A;  1USE A;  4WWI A;  2BCC G;  1KOR A;  1KC8 Q;  3L74 E;  4DT0 A;  1Z56 A;  4KHX A;  2W6A A;  3RK2 B;  5K5G B;  3MP7 B;  2C0X A;  1OZH A;  1VF5 C;  2QE7 H;  3GG2 A;  4U7J A;  4IFD K;  1ZOY C;  2KI7 B;  4C7R A;  3HRN A;  1M8O B;  1AQ5 A;  1RF1 A;  4MN4 C;  2P2U A;  4Y28 J;  3H32 A;  1RQV A;  2Q9I A;  2WIT A;  3D6Y A;  1E5W A;  1NKZ B;  2KZI A;  2P67 A;  1Y47 A;  1ZW0 A;  5AW1 B;  3L35 A;  2BEQ D;  4WY4 C;  5B66 E;  2H43 A;  4AUW A;  2XU6 A;  2YKP A;  4C46 A;  2N1T A;  2E74 D;  1YJW P;  1S4X A;  1NAF A;  2ZXX A;  5KKZ C;  1YIT P;  3SWF A;  2G8Y A;  4JBZ A;  5CCG C;  3L74 G;  3CCL P;  4EI2 A;  1E79 H;  1ZME C;  3NMD A;  1FC2 C;  3EFG A;  3B5N D;  2E76 B;  3L74 D;  4K3A A;  3GF7 A;  3WUT A;  1PGQ A;  5AVY B;  5CJ4 A;  3Q5R A;  4PJ0 H;  1FZG A;  2N1T B;  1G1I A;  3L4F A;  2E5T A;  2WPQ A;  3H1I J;  1M56 D;  4OGQ C;  1IFM A;  2AXT E;  1NTZ G;  3FWN A;  2WVR A;  3AE1 C;  4W7Y A;  2WPS A;  2YIU C;  1HJB A;  1NTZ D;  1HGV A;  2D2C D;  1J1D C;  1A02 F;  4PV1 B;  1PPJ D;  2J58 A;  3IAO A;  3T97 A;  3L70 J;  1GK4 A;  1YQ4 C;  3CXH D;  1GK6 A;  4R4M A;  2WTY A;  1PL5 A;  2OQQ A;  1NTZ K;  2FYU J;  1FZC A;  2L5G B;  3EWK A;  1QL2 A;  1KIL C;  2HG5 D;  1LTS C;  1URQ C;  1KMI Z;  1H89 A;  1RF0 C;  1Q2N A;  1H88 A;  4PD4 E;  1GZL A;  5H2F H;  3QWO C;  2Y0C A;  3Q5S A;  3G4S P;  1SQP G;  1VF5 D;  1IFN A;  1D7M A;  5TJH A;  2RMZ A;  2AXC A;  3R4Y A;  4IFM A;  2ZXE B;  3GLM A;  1ZR4 A;  2O01 J;  1FZA A;  3T97 B;  4GDO A;  5BU8 B;  1SQP D;  1FJP A;  1L0L J;  1IK9 A;  1K73 Q;  1SQX G;  2K9J A;  1FZC B;  3H1J J;  2B87 A;  3RK2 C;  1UII A;  3G3Z A;  3B4S A;  1FDI A;  1MFT A;  1SQX D;  2OGU A;  1SQP K;  2FYN B;  3WUU A;  5E79 E;  1M57 D;  1N7S A;  3L71 J;  3JSV C;  4H0L B;  1X79 B;  2PGD A;  3V4Q A;  1HBW A;  1JY3 O;  2CK3 H;  4IFF A;  4AQR D;  2M5A A; 
#chains in the Genus database with same CATH homology
 2A06 G;  1NTK G;  3L73 G;  5KLV G;  1EZV G;  1KYO H;  3CWB G;  3H1J G;  2FYU G;  3BCC G;  3L75 G;  2BCC G;  1BGY G;  1NTZ G;  1BCC G;  1NU1 G;  1KB9 H;  3H1L G;  1NTM G;  3H1I G;  4PD4 H;  1SQQ G;  3L70 G;  1L0N G;  1PP9 G;  3H1H G;  3CX5 H;  1SQX G;  3L72 G;  1PPJ G;  3L74 G;  1SQV G;  1L0L G;  1SQB G;  1BE3 G;  2IBZ G;  4D6T G;  3CXH H;  1SQP G;  3L71 G;  4U3F G;  3TGU G;  3H1K G;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...