3H1LH

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 25
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1lH00
1NTKH 3L74H 1PP9H 3H1JH 2A06H 1NTMH 1SQPH 1KYOF 3H1KH 1SQQH 3H1HH 3L73H 1SQBH 3L71H 1BE3H 1KB9F 4PD4F 1EZVH 1SQXH 3CX5F 1NTZH 3CWBH 3TGUH 2IBZH 3BCCH 3H1LH 4U3FH 3H1IH 1L0NH 1SQVH 1BGYH 1L0LH 3CXHF 4D6TH 1BCCH 2BCCH 1P84F 5KLVH 3L72H 1PPJH 2FYUH 3L75H 1NU1H 3L70H
chains in the Genus database with same CATH superfamily
2EIMC 4E4EA 3FKSG 4F6EA 3EHBB 3RYHB 3CRMA 1G1XB 3LUTB 1WLEA 1N32B 1BS3A 3ICXA 3IGAC 1FFXB 5JCOA 3BHPA 1FD9A 1AI6A 2UXBO 3N2KA 5IWAB 3D8CA 4X64B 1J5EB 2OTLV 1TUBB 4A5UB 4RQFA 1V9PA 2JGUA 4X64O 4B3TO 4JI3B 1Q43A 1SQBH 4X1YB 4TUYB 2OIEA 2FL4A 2DYRB 1R3LC 4U7NA 1SERA 1IXMA 1NS1A 2WLIB 5LA6A 5KAFZ 1XDCA 4OX9B 3R65A 1YSCA 1Q86W 4UV9A 5DN6G 4G27B 5H5NA 4P9OA 2OYQA 2CGOA 3AG1B 2QWNB 1B6QA 4GLXA 4WFGA 1XNRB 1KUQA 4LF7B 2EILB 2ADPA 3CC4V 1MG1A 2EBOA 4BIZA 2UUAO 4LFAB 4W4KA 5JJNB 3W7XA 5EBWC 1PNKA 4AQYB 2CH7A 1B04A 2DJVA 4KXRA 5IJ9A 4LF6O 2Q0AA 1I5YA 2Q68A 1H2KA 3MHSC 4KL1A 3CX5F 2VWJA 4DV3O 2A9HA 1XUQA 3CE2A 4YHHO 2CE4A 2IJHA 3I56V 4DV3B 3BABA 1KD1W 4G2KA 1OCCC 4I55A 1AP6A 1I7FA 1H8HG 4GKKB 2WLLA 5IJ9B 1QLEB 3SYOA 1RPOA 2YSUB 1P4RA 4YY3O 4Q20A 1HWYA 3ZHTA 2DN9A 1OCOC 3HKCA 5IWAO 1I0HA 3OR6C 1JOYA 2HKOA 4TQFA 1XHZA 3HKDB 1LUWA 3BRCA 3TK1A 2R9IA 3VQXA 5LXTA 1AR4A 2UXDO 4DK1A 1PP9H 2HLDG 5B1BC 4FM2A 4IHJA 2GTAA 1O9GA 3TXSA 2M6YA 3G80A 3CCLV 4GZRB 1VMGA 3CB2A 1XNQB 4X66B 4DUZB 4JYCA 3CD6V 1M57B 4UVBA 2A0LA 1K4DC 1HNWO 1F23A 5EC1C 3E8BA 1P49A 1AI4A 4B3SB 4K35A 2F4VO 3AG4C 4UCVA 1Q6IA 4NTWA 1AI5A 4F6RA 2CGNA 2Y69B 1Y66A 4JYYA 4LFCO 3DC6A 3K08A 2NR5A 4LFAO 5ITZB 1R3KC 2XAQA 2LP7A 2ZDIC 3JSNA 4CS3A 1WP8A 5KUMA 3MDSA 4DV5B 3MD0A 5D5PA 1MNGA 1IBKB 3FB6C 4FLTA 2GDSA 1R3JC 4IT5A 5IYBO 1PM9A 2BE3A 1FKAO 2F23A 1NJIW 2R9RB 1EN5A 3WB0A 2QM4A 1FAFA 5KHJA 1KU9A 5KLVH 1WA8B 3K58A 1JJOA 3BVOA 2H8PC 3CRCA 2HJFC 4D7SA 2CUGA 1JX9A 2F93B 1EN4A 1FJGB 1VF6A 3TCUA 2BSKA 2Y0PA 1N33O 3L9DA 1M93A 4FZ0A 2LW7A 1L0LH 4JI6B 3ZHSA 1MZFA 4IIJA 1ROPA 3G67A 2QTSA 2Q67A 4MTXA 2QKCA 3RYFA 3TJTA 1K9MW 2UXDB 1ENVA 4O2BB 4NYKA 5IYZB 4NXNB 3RYIB 2K9PA 2YIBD 3ZIAG 2YEVA 1SA0A 2QWQB 2H94A 4CS2A 1VQPV 2X6BA 4XDLA 5JQGA 4PDMA 4FLVA 2EIKB 3VOUA 1YTFB 4PV1B 1VF7A 1D2DA 1SQXH 3GWKC 4BWAA 5LHHA 2F4VB 5C93A 3WB1A 4JYAB 3JYCA 2AHYA 3OAAG 4DYLA 3QO7A 2AZ0A 1VP7A 2AXTZ 5LYJB 4JI8O 3RBZA 1VQMV 3ZRXA 4ICGA 3UT5B 4XDKA 3OTFA 5H2FZ 3KCXA 2EINB 4FK5C 2BSKB 2IJIA 1RP3B 3AK3A 1P7BA 2OCHA 1Y74B 3NR7A 4JI7B 1MMMA 5EZYB 1QVGU 2FYUH 3ABLC 1EBOA 3L71H 1E79G 2L35A 4MVMA 3ZHVA 4B3MO 1AJQA 4X1YA 4TUYA 3EFFK 5B66Z 4C7UA 5JJJB 1NR1A 3DXRA 1Y74A 1K5SA 1W2BU 3ABMB 1K33A 4P9PA 1J95A 1GRJA 5L3EA 5K1XA 3SJCC 2E5LO 4TV8B 3D36A 3ABTA 3ASOC 2XTAA 2ZCEA 1JVMA 4HNAB 3ML0A 3H1KH 2ITCC 4GCZA 1XBLA 3L73H 2R72A 1NR7A 3CMAV 4LF7O 3ABLB 2JK5C 4PDVA 1XILA 4ZI7A 2WLIA 5LYJA 3K59A 1S77D 2WLHA 5GW7A 4R8CA 3P32A 1OCCB 3LDDA 3W7WA 4MVUA 1S3JA 3P3PA 5LMUB 1U96A 4MTOA 5TISZ 1M4UA 3ASOB 3VQYA 1FJGO 4JI8B 2ZDIA 1WNSA 5CBGA 4FLXA 3JASB 2DYSB 4H44B 1O9HA 2YIDA 2PI4A 4IL6Z 3CHXA 4MW8A 4H0LB 5BR8B 4I50A 4FM0A 3RWRD 3HKDA 3DTUB 3UO3A 2RMKB 1KBHA 5LP6A 3WG7B 3CCUV 1URFA 3PN1A 5B1BB 3E83A 3HKBB 4DW0A 4GUNA 4AI8A 2UUAB 4LF5O 5GONB 2QA4V 3RN4A 2UXCB 4DV7B 2G38A 4I55B 3L74H 4U3JB 1THZA 3LSSA 4K8XA 2Z5UA 5HFMA 4EKWA 1Q5OA 4X8AA 4O4LA 5LHIA 3T1HO 1FS0G 4CH4A 2OT5A 1BGYH 1XQ8A 5DEDA 5J2TB 3JAKA 4O4IB 5C8YB 3SJBC 1WB7A 1F4MA 1S5HC 3RYCA 3SGIA 1Y6XA 4GX1A 1SS3A 2Z3YA 4CC6A 1EZVH 1HR0O 2DWDC 4EB6B 1K92A 5EBLC 3AG3B 3IAYA 1D5NA 3ZRWA 2RQ6A 1TVKB 1K73W 2YXLA 1GAXA 2UUCB 5BY1A 4JAVA 1GM8A 3JD0A 4Z1VA 1K7DA 5EC2C 4UCSA 4LR3A 2Y4TA 4DR3B 3T1CA 2JS3A 3CPWU 2DWEC 1VARA 4MT8A 1JMKC 1IBKO 3DC5A 5A9GA 1I94B 2RJZA 3ZHRA 5GONA 2RNBA 4TV9A 3HPLC 2W0XA 2YDEA 3FFQA 3SJAC 3RW0A 1N34O 2ZR2A 3N2KB 1D5AA 1SRYA 3JAMN 1H38A 1ORQC 4B7KA 1WPBA 3QTCA 2E3CA 1XMOO 5IYCO 3K5NA 1QR8A 3SPIA 2KQXA 4DV0B 3ZN0A 5BZBA 2UUCO 1XREA 4X9QA 1SA0B 1GKFA 2QWRB 4ZBMA 4ZOLB 3K04A 2HFEC 5LGUA 1IDSA 1SQPH 4JI5B 3ZRSA 4PA3A 2XOKG 2FMLA 4DXWA 4B3TB 1YDXA 1EZJA 1FXHA 3CMEV 2P22C 4H33A 4FFKA 1NT2B 4LH6A 2AZ2A 2N74A 1H8EG 1W0JG 4IYIA 1VQLV 3CCRV 2MK3A 2Z0AA 4JZ2A 2LGQA 4ZOLA 1SZXA 4CZZA 4N21A 1QVFU 2QTOA 1IXBA 2YIAA 5CA1B 1YVWA 4B08A 3CYOA 3IFXA 3CJHB 3CC2V 4DRXA 1R73A 2PGGA 2WLMA 4WF9V 3WFVA 4BR6A 1X4TA 3K06A 2EINC 1N36O 4ZKIA 3H1IH 1HR0B 3OMIB 1N33B 2YEVB 3Q4HB 1SESA 3F5TA 3ZMSA 1PPJH 1CXZB 3OGCC 3JCUZ 4FVMA 3KKYA 2WLLB 3ZJZA 1YTFD 4FM1A 1NBMG 4W4LA 4X89A 1QU7A 4KUMA 3NXSA 4ZI7B 4TQDA 2L6LA 4J7JA 1K97A 4UUJC 2P6JA 4LC1A 5LHGA 1F51A 3JALA 1L8DA 1S76D 3D3IA 5LBQA 3ABMC 2K1EA 1NVPB 1GO3F 1M56C 3C3SA 3B40A 3UO2A 4GKKO 2XAHA 3U0ZA 1B06A 1COWG 1H2GA 4B3RB 4QPJA 1AR5A 4YJ3B 4NXNO 2Q0OC 1HNZB 2F1MA 3ABKB 4X1IA 5EYPA 1AR1B 1Q81W 4FIPC 1SQVH 4RAIA 5LXTB 5BXZA 3K5OA 4P30A 4JI2B 2YI9A 1QQCA 5EZYA 1GK9A 3AK2A 4JI2O 5K1PA 4DR7B 5H6QA 1MOFA 1MZEA 2CTPA 1KMIZ 4KP4A 3ETDA 4LNUA 4MVRA 2WLNA 5GTIZ 3ZMUA 5L3DA 1UPGA 1SF9A 4ZIBA 1S72V 2ZT9B 1B3QA 3HKEB 4U3FH 2QKAA 2ZINA 2P90A 1XNQO 1K4CC 3RT3C 3U10A 4GX0A 5H9CA 4J7KA 5IYDO 5L3GA 4LF5B 5ITZA 2EIJC 1M9NA 5FLXN 1Z5VA 5FNVB 3K3WA 2UUBO 1N4CA 2QM8A 1SQGA 3N27A 2IBZH 3JAKB 4DV7O 1W59A 1Y67A 4I4TA 2ZD9A 4K0KB 4LF4O 3BAAA 4N23A 3FAVB 4FZ1A 3F7VC 3SYCA 3DSQA 3JATA 4JF3A 4I9QA 1G6UA 3A0HZ 1GN3A 3STZC 2HP8A 3O65A 3ZRVA 2UXBB 4P2ZA 3OR7C 3MHHC 4I5SA 4PA6A 3DGEA 4FLYA 3VQWA 2EIMB 1SZTA 4JTDB 4JI3O 3JD4A 3CXHF 1ZUQA 2P4VA 2RCVA 4DR6O 1YITV 4JTCB 2JEXA 1YIJV 4ZHQB 1PKXA 1CPYA 1QHTA 4I50B 2ZQMA 2W0FC 2JGDA 1YF2A 3K57A 1XMQO 1BHBA 2HVKC 5KX5B 4FPPA 3FB7C 4LF4B 3OTOB 3AK1A 1IBLO 2ZNIA 1NH2B 3OD4A 1NU1H 2EILC 2N04A 3CCQV 4PDLA 4FFBA 3E35A 1TGOA 5LMNO 1PL0A 5JWPA 1XEQA 5B1OA 2DW4A 3AG4B 1FFXA 1GM9A 4JI7O 3S3WA 2DQ3A 5B1AC 2Q8VA 4LF8B 4NKGB 1YZBA 1WN7A 1R6KA 4B3RO 1Q6HA 1LUVA 3APQA 4JI1O 2QEXV 1F7YA 3X2QC 1AJNA 4GKJB 1BT8A 3ZBHA 1KKCA 3ABUA 4IHJB 2CTRA 5IJ0A 3CSXA 2PI5A 3ZHUA 1WPXA 5JH7B 2ZE7A 2IW5A 2EJRA 3E8GA 2QE7G 1CP9A 3QVNA 4R6ZA 1V54C 4D7TA 4HZ3A 3K5LA 1YCIA 3BY6A 2H3OA 4EFEA 5LL6Y 1G4YB 2VQFO 4WBNB 4UVAA 1BSMA 1H2NA 2AHZA 3W7SA 3ETGA 3QNEA 3AG3C 4KHPO 3OTOO 1ZX3A 4G28B 3CXCU 3K0DA 4F6RB 3SPJA 4DRXB 3APOA 1KP2A 3RVYA 4MVSA 3OE7G 3P30A 4JYAO 5HFLA 2IH3C 3B8NA 1P84F 4KFMA 4RWUA 1AJPA 1U97A 4J41A 4J10A 3ZMTA 4ZHQA 1Y4MA 3CS5A 1MABG 4YJ2A 5KHHA 4DW1A 4O4HA 3QO5A 4DV6B 1L0NH 1KQSU 2LW1A 1TUEB 2V4DA 1V54B 3RVZA 3J7AU 3TXQA 2CH7B 4DR2B 2X0LA 4LF9B 1FYJA 1VQ9V 1NI8A 2WA3A 3LNNA 4K0KO 3RYCB 4LF9O 1JFFB 3IJ4A 2XAGA 3E8HA 5CB4B 2IJJA 2EJ7A 4X66O 4O2AA 1RM1C 2Q5ZA 5IT9N 3E8FA 1ZLZA 1CEZA 4JASA 2WPDG 5EYPB 1DGSA 4LFBB 3ABKC 1GN4A 2BOCC 2XASA 4ABMA 4CH3A 1RSOB 5KUKA 2KB1A 2X6AA 2JIZG 1R6NA 4PELA 3GVMA 3K03A 1P7GA 1EFRG 1RPRA 2ZIMA 1DF4A 2CTWA 3JCZA 3CC7V 5IDJA 4X1KB 4PDRA 4DUYO 1XMQB 3MAQA 3K5MA 3H1JH 3M7MX 3CRRA 2EZOA 4O4JB 4YXWG 2BTOA 2YXYA 2UXXA 3AG2B 4DV0O 3ZMVA 4MTGA 1S0VA 1Y76A 4LFBO 3A0RA 1BCCH 5CA0A 1XOUA 1RM1B 1TVKA 4HBNA 2KKWA 3I55V 1IVSA 2B1IA 4X20B 4WFHA 4AILC 3J81N 3FX7A 2M7WA 5KX5A 1F4NA 3ZRWB 1UJWB 2IH1C 4NVPA 3BCCH 5LGTA 1S5JA 5KMGB 2OWOA 5FPOA 2QDOA 2JVDA 4DV6O 3JATB 3G6EV 2GV9A 3SPGA 4X88A 4EFBA 1TUBA 2GUZA 4PA4A 1NTMH 1N32O 2X6CA 3CRQA 2GHYA 4X65O 2P7TC 2IU3A 2ILMA 3CEIA 3O9OA 2Q7EA 3CWBH 2X7RB 4B3SO 2ARHA 3OMAB 1Q82W 4GT1A 3T2MA 3F5WC 1SKVA 5B3SB 4FLUA 3AG2C 5LOVA 1NKDA 4I4TB 2HG5C 2ZE6A 5DM6V 2FKXA 3ZX6A 4U7OA 3B09A 2XT9A 4K8ZA 1ZL8A 4QE7A 1DTOA 1BZKA 1JR9A 5JJEB 5EIBD 4DV4O 3L75H 3JAWB 2Q7GA 4L8JA 2DMXA 2DYRC 4DUZO 2AW9A 4TV8A 1OHHG 4FLWA 4JI1B 3ZCCA 3OUFA 2PTMA 4AHCA 3RYIA 2F66C 1OJHA 4AQYO 1FFTB 1PD3A 4J42A 1KKDA 3JASA 1H2MA 2ZE5A 3JALB 3STLC 4J11A 3BPZA 3QG5A 3K9SA 1NZ6A 1DLBA 3IC9A 4MTFA 1AB3A 4CBCA 2Q4PA 2QKSA 2WLKA 3GB7C 1Q7YW 4JI6O 3CP1A 5B3SC 4YJ3A 4TWKA 4DV1B 4BIUA 2R9AA 1KB9F 2RN9A 4FFBB 1GN2A 4TSFG 5E79Z 4JGSA 2YS8A 4IYHA 5JCOC 3E2EA 1N0NA 4DR3O 1VQ7V 5KA6A 4YJ2B 1SC5B 1XHXA 2V7QG 2FTKA 4KHPB 2EZPA 4X20A 1QR9A 2Y48A 1YJWV 1I94O 3E22A 1Z5WA 2OCCB 4DR4B 2JJ2G 4OGQB 3OGIB 4RUFA 1YI2V 1V55B 4OPHA 5IYZA 1G8MA 3AG7A 4HYOA 1JA8A 5KMGA 2NLJC 2LFSA 3T1HB 1N34B 2RDCA 4NXMO 2ETNA 4CH5A 2LGWA 2GUZB 3RFRA 2UU9O 3LSUA 4O2AB 2ZXWC 3UCSC 1VQKV 4PI0A 2XAFA 3A2FA 1QNMA 4PI2A 4MVZA 3ZMZA 1XNRO 1FXKA 2Q69A 4R50A 2VQEB 2WLJA 2QWOB 3OT7A 3VQVA 3E86A 4DR7O 2W6JG 2QJ1A 4O4HB 4DV2B 1BMFG 1OV9A 5B1AB 4O2BA 4TV9B 4WFEA 2QM7A 4GX2A 2QWPB 2F95B 1S5LZ 3HKBA 3HB3B 3AG1C 1XL4A 3ASNB 2HHHO 1WJZA 3N2GA 3OEEG 4YIPA 1NTKH 3SYPA 4TOIA 5FNVA 3LNMB 5L3CA 3E22B 3I5DA 3G4SV 5CB4A 1RSOA 3LSQA 1KP3A 3ZS8C 3OMNB 4WFFA 4YIOA 1PV0A 3H01A 1XMOB 1ZAUA 2ZXWB 2ITDC 3D36C 3G71V 1VQNV 1K8AW 2PYLA 1IX9A 5J2TA 3SPHA 3KG2A 5DECA 4RQEA 2DE0X 3K79A 4BAYA 1VF6C 4CC5A 1OCRB 4NXMB 3H1HH 1HW7A 1AVMA 1SQFA 3SYAA 5B1NA 1M56B 3FD9A 4PHZA 1AP5A 3QO8A 1N36B 1GM7A 4PJ0Z 4NTYA 4OXSA 4OPAA 1LNQA 2ZIOA 1IBLB 4JI0B 4J9ZB 3BEHA 3KZIZ 1BHAA 2Y4UA 4OX9O 4I9WA 2NNUA 2A3QA 3BA9A 1L1FA 1R1BA 3W7TA 5FL7G 2UU9B 4FLZA 2A7WA 1Y76B 1JQ0A 4K3AA 3JARA 1QCEA 1H2SB 4QNHB 4O4IA 1VQ5V 5EIBC 1N0JA 3JSLA 1M90W 3T4DA 4BIOA 3E89A 3SR2C 1OCZC 4BW5A 4WBNA 3FYIB 1IURA 2B9ZA 1TAEA 3FB8C 1R3IC 2YI8A 1E1RG 1NTZH 1TA8A 1OCRC 1YXBA 5JQGB 3BA8A 5FPRA 2EIKC 1AROP 4GX5A 3EVKA 2OTJV 4UV8A 2A79B 4J9YB 2E5LB 4UFZA 2BOBC 4GYCB 1NQTA 1KYOF 1H2LA 3K0GA 2UUBB 3F7YC 1BE3H 2YIBA 1N8RW 2WA4A 4I0XB 3A0BZ 4X62B 5KHGA 1UFIA 4R7CA 2EULA 4Z1MG 4UXNA 5H6RA 4J7ZA 5JVDA 5JH7A 2LJ2A 2YC0A 1KC8W 5CA1A 1W0KG 5KAIZ 2HEPA 4UCTA 1Q90D 4QGPA 1PNLA 3ETEA 5KHIA 4B7EA 1DF5A 2VRZA 4EEQA 1M1KW 2GBOA 4LFCB 1T5EA 2Q9LA 3JD1A 1OZ0A 1ZWIC 5IY5B 3UT5A 3CCEV 2JRIA 2LQTA 1HNWB 1A32A 3UQ8A 3GWOA 5CMUA 3JD3A 1AILA 4DUYB 2EIJB 3H9VA 2B5UA 3L72H 4X1KA 3T1YB 2O57A 4IGGA 2KSDA 3FB5C 5C8YA 3R66A 5CA3A 2PY5A 1GMGA 2V1DA 5F2VO 2UXNA 4I0XA 5A2QN 2VS0A 4NTXA 4DR4O 2MW2B 1JPXA 4UB8Z 4QPKA 4YHHB 4JV5O 2QGNA 1VQ4V 3B77A 4X1IB 1VEWA 3JARB 1Q8IA 1YEWA 4I7ZB 4U3JA 2XHBA 2HHHB 1JCHA 2JJ1G 1VIBA 3THOA 2XNDG 2A06H 3X2QB 3T1YO 2Q6AA 1ZSPA 2DYSC 1PNMA 2IU0A 1GH6A 2KG7A 4NB5A 1HNXB 2WAMA 5EBMC 2UXCO 3N2GB 3OW2U 2WSSG 4LP8A 5E1AC 3ZHQA 1WP7A 3TETA 4JAAA 4F4LA 2CK3G 2LFRA 2IM9A 4PD4F 3SDLA 4JI5O 4EB6A 4QE9A 1SETA 1Q6UA 3LDEA 3OM3B 3Q4HA 3WB2A 5B5EZ 5BR8O 3C3TA 2Q7HA 2GTSA 2ADQB 1WA8A 2BCCH 1R6TA 4MS2A 3LDCA 1HDJA 2P67A 1Q3EA 3QF7A 1J5EO 2Q73A 2P5OA 2ZKOA 3FAVA 3ZEDA 5LOVB 2BTQB 1GTOA 1FPOA 5KHKA 1OCOB 2C2AA 3FYEB 4BW9A 1LR1A 3OFNG 4PA7A 1QLEC 3CCVV 4DR1B 2HVJC 3M99B 1K34A 4FJCC 4MSWC 3RYFB 2ZNJA 3ZN1A 2DQ0A 3K9AA 2OCCC 1MA1A 4B3MB 4LH7A 4DV5O 1PL4A 2GSMB 1VF5B 4H13B 2JGDB 1M57C 2XAJA 2VQEO 4UVCA 2R70A 5L3FA 5J2UB 4DR1O 3J80N 1V55C 3B4SA 4DO2A 4NR1A 3UKMA 2ZM6B 4LWSA 2ATKC 1E1QG 1WB8A 1ZTEA 3VBBA 2CTQA 4XDJA 4CS4A 5IJ0B 1VQ6V 4LF8O 3JD2A 1M5IA 2QSAA 4IIJB 4JTAB 1VQOV 2CAZC 2XUMA 3KCYA 4L87A 2WWWA 4WCEV 4LWSB 3HKEA 4WFBV 1YJ9V 3M8AA 2P4KA 3WG7C 1MSDA 3CRAA 4X65B 3JAWA 4JYBA 2QR4A 2Y69C 2W6IG 5D5QA 1ZL8B 2JEUA 4DV2O 3UM7A 2D3OW 3SYQA 3EXAA 3ASNC 4QIWF 2IJKA 2KG7B 4RO2A 2PZSA 4MVQA 2ZR3A 2DOSA 4UCOA 1NH2D 1US6A 1IBMB 4JI4O 4PA9A 1AI7A 1FXVA 2E76B 4UCRA 2VWKA 3SPCA 5BMVB 3HKCB 1IBMO 4JI4B 2LO1A 1IZ3A 1XL6A 4X62O 3CCMV 2HJDA 3OUSA 2VQFB 1MSWD 5LMNB 3PJSK 4GKJO 1Z2GA 4JI0O 4Q6GA 5J9PC 1NVPD 4HNAA 4LCUC 4TT3G 1K3EA 5LGNA 4LF6B 2ZM6O 5BMVA 2JS5A 5GTHZ 2YXHA 3IC7A 5LMUO 2BTQA 1BQ0A 3HR0A 4E2LA 1JJ2U 1JFFA 2CDYA 3DXRB 4DR5O 3B8MA 4QJFB 2AGAA 1EN6A 2EX3A 5JVDB 4D6TH 5L3BA 3W7UA 4HAMA 4ASUG 4DR2O 1EM1A 4LBEC 4O4JA 3D3QA 4DR6B 1SQQH 3RGBA 3C90A 3CJHA 2D2CB 4MVOA 5LP6C 1QLNA 1FXKB 2JDIG 2N05A 2YUAA 1OCZB 2F43G 2Y0IA 1DK1A 4DK0A 5J2UA 5CBHA 4JZGA 3ETQA 1WAZA 5CN0A 3U11A 2PUSA 3S3XA 4JV5B 4DV1O 4Z2WA 1BL8A 2E74B 5AG2A 1HP8A 1YJNV 1QBZA 4XBFA 4H37A 4J80A 4O4LB 1BQZA 3P3NA 1HNXO 4JPRA 3CCJV 1X59A 3T4ZA 2B1GA 3B2EE 1RFYA 4LNUB 3L70H 4YY3B 2PF4E 1KECA 4UB6Z 1YHQV 3CCSV 5CBFA 4RUEA 2HR3A 3AEIA 1XI1A 4WFAV 3BFRA 4DV4B 1K5QA 1I08A 4DR5B 2PYJA 5LA6B 5LP6B 2P06A 2YICA 3SJQC 1FXKC 1I5XA 3A8TA 2NN4A 4UCUA 2FB5A 4CH6A 2ZE8A 3RYHA 1GN6A 3TGUH 2ODMA 4FMTA 5IE9A 2OIGA 3H1LH 1HNZO 2E75B 4JAUA 3G6BA 5KA5A 3WU2Z 5IY5C 1VQ8V 5EK0A 3OEHG 4MW3A 5CA0B
chains in the Genus database with same CATH topology
1NTKH 3L74H 1PP9H 3H1JH 2A06H 1NTMH 1SQPH 1KYOF 3H1KH 1SQQH 3H1HH 3L73H 1SQBH 3L71H 1BE3H 1KB9F 4PD4F 1EZVH 1SQXH 3CX5F 1NTZH 3CWBH 3TGUH 2IBZH 3BCCH 3H1LH 4U3FH 3H1IH 1L0NH 1SQVH 1BGYH 1L0LH 3CXHF 4D6TH 1BCCH 2BCCH 1P84F 5KLVH 3L72H 1PPJH 2FYUH 3L75H 1NU1H 3L70H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK H;  3L74 H;  1PP9 H;  3H1J H;  2A06 H;  1NTM H;  1SQP H;  1KYO F;  3H1K H;  1SQQ H;  3H1H H;  3L73 H;  1SQB H;  3L71 H;  1BE3 H;  1KB9 F;  4PD4 F;  1EZV H;  1SQX H;  3CX5 F;  1NTZ H;  3CWB H;  3TGU H;  2IBZ H;  3BCC H;  3H1L H;  4U3F H;  3H1I H;  1L0N H;  1SQV H;  1BGY H;  1L0L H;  3CXH F;  4D6T H;  1BCC H;  2BCC H;  1P84 F;  5KLV H;  3L72 H;  1PPJ H;  2FYU H;  3L75 H;  1NU1 H;  3L70 H; 
#chains in the Genus database with same CATH topology
 2EIM C;  4E4E A;  3FKS G;  4F6E A;  3EHB B;  3RYH B;  3CRM A;  1G1X B;  3LUT B;  1WLE A;  1N32 B;  1BS3 A;  3ICX A;  3IGA C;  1FFX B;  5JCO A;  3BHP A;  1FD9 A;  1AI6 A;  2UXB O;  3N2K A;  5IWA B;  3D8C A;  4X64 B;  1J5E B;  2OTL V;  1TUB B;  4A5U B;  4RQF A;  1V9P A;  2JGU A;  4X64 O;  4B3T O;  4JI3 B;  1Q43 A;  1SQB H;  4X1Y B;  4TUY B;  2OIE A;  2FL4 A;  2DYR B;  1R3L C;  4U7N A;  1SER A;  1IXM A;  1NS1 A;  2WLI B;  5LA6 A;  5KAF Z;  1XDC A;  4OX9 B;  3R65 A;  1YSC A;  1Q86 W;  4UV9 A;  5DN6 G;  4G27 B;  5H5N A;  4P9O A;  2OYQ A;  2CGO A;  3AG1 B;  2QWN B;  1B6Q A;  4GLX A;  4WFG A;  1XNR B;  1KUQ A;  4LF7 B;  2EIL B;  2ADP A;  3CC4 V;  1MG1 A;  2EBO A;  4BIZ A;  2UUA O;  4LFA B;  4W4K A;  5JJN B;  3W7X A;  5EBW C;  1PNK A;  4AQY B;  2CH7 A;  1B04 A;  2DJV A;  4KXR A;  5IJ9 A;  4LF6 O;  2Q0A A;  1I5Y A;  2Q68 A;  1H2K A;  3MHS C;  4KL1 A;  3CX5 F;  2VWJ A;  4DV3 O;  2A9H A;  1XUQ A;  3CE2 A;  4YHH O;  2CE4 A;  2IJH A;  3I56 V;  4DV3 B;  3BAB A;  1KD1 W;  4G2K A;  1OCC C;  4I55 A;  1AP6 A;  1I7F A;  1H8H G;  4GKK B;  2WLL A;  5IJ9 B;  1QLE B;  3SYO A;  1RPO A;  2YSU B;  1P4R A;  4YY3 O;  4Q20 A;  1HWY A;  3ZHT A;  2DN9 A;  1OCO C;  3HKC A;  5IWA O;  1I0H A;  3OR6 C;  1JOY A;  2HKO A;  4TQF A;  1XHZ A;  3HKD B;  1LUW A;  3BRC A;  3TK1 A;  2R9I A;  3VQX A;  5LXT A;  1AR4 A;  2UXD O;  4DK1 A;  1PP9 H;  2HLD G;  5B1B C;  4FM2 A;  4IHJ A;  2GTA A;  1O9G A;  3TXS A;  2M6Y A;  3G80 A;  3CCL V;  4GZR B;  1VMG A;  3CB2 A;  1XNQ B;  4X66 B;  4DUZ B;  4JYC A;  3CD6 V;  1M57 B;  4UVB A;  2A0L A;  1K4D C;  1HNW O;  1F23 A;  5EC1 C;  3E8B A;  1P49 A;  1AI4 A;  4B3S B;  4K35 A;  2F4V O;  3AG4 C;  4UCV A;  1Q6I A;  4NTW A;  1AI5 A;  4F6R A;  2CGN A;  2Y69 B;  1Y66 A;  4JYY A;  4LFC O;  3DC6 A;  3K08 A;  2NR5 A;  4LFA O;  5ITZ B;  1R3K C;  2XAQ A;  2LP7 A;  2ZDI C;  3JSN A;  4CS3 A;  1WP8 A;  5KUM A;  3MDS A;  4DV5 B;  3MD0 A;  5D5P A;  1MNG A;  1IBK B;  3FB6 C;  4FLT A;  2GDS A;  1R3J C;  4IT5 A;  5IYB O;  1PM9 A;  2BE3 A;  1FKA O;  2F23 A;  1NJI W;  2R9R B;  1EN5 A;  3WB0 A;  2QM4 A;  1FAF A;  5KHJ A;  1KU9 A;  5KLV H;  1WA8 B;  3K58 A;  1JJO A;  3BVO A;  2H8P C;  3CRC A;  2HJF C;  4D7S A;  2CUG A;  1JX9 A;  2F93 B;  1EN4 A;  1FJG B;  1VF6 A;  3TCU A;  2BSK A;  2Y0P A;  1N33 O;  3L9D A;  1M93 A;  4FZ0 A;  2LW7 A;  1L0L H;  4JI6 B;  3ZHS A;  1MZF A;  4IIJ A;  1ROP A;  3G67 A;  2QTS A;  2Q67 A;  4MTX A;  2QKC A;  3RYF A;  3TJT A;  1K9M W;  2UXD B;  1ENV A;  4O2B B;  4NYK A;  5IYZ B;  4NXN B;  3RYI B;  2K9P A;  2YIB D;  3ZIA G;  2YEV A;  1SA0 A;  2QWQ B;  2H94 A;  4CS2 A;  1VQP V;  2X6B A;  4XDL A;  5JQG A;  4PDM A;  4FLV A;  2EIK B;  3VOU A;  1YTF B;  4PV1 B;  1VF7 A;  1D2D A;  1SQX H;  3GWK C;  4BWA A;  5LHH A;  2F4V B;  5C93 A;  3WB1 A;  4JYA B;  3JYC A;  2AHY A;  3OAA G;  4DYL A;  3QO7 A;  2AZ0 A;  1VP7 A;  2AXT Z;  5LYJ B;  4JI8 O;  3RBZ A;  1VQM V;  3ZRX A;  4ICG A;  3UT5 B;  4XDK A;  3OTF A;  5H2F Z;  3KCX A;  2EIN B;  4FK5 C;  2BSK B;  2IJI A;  1RP3 B;  3AK3 A;  1P7B A;  2OCH A;  1Y74 B;  3NR7 A;  4JI7 B;  1MMM A;  5EZY B;  1QVG U;  2FYU H;  3ABL C;  1EBO A;  3L71 H;  1E79 G;  2L35 A;  4MVM A;  3ZHV A;  4B3M O;  1AJQ A;  4X1Y A;  4TUY A;  3EFF K;  5B66 Z;  4C7U A;  5JJJ B;  1NR1 A;  3DXR A;  1Y74 A;  1K5S A;  1W2B U;  3ABM B;  1K33 A;  4P9P A;  1J95 A;  1GRJ A;  5L3E A;  5K1X A;  3SJC C;  2E5L O;  4TV8 B;  3D36 A;  3ABT A;  3ASO C;  2XTA A;  2ZCE A;  1JVM A;  4HNA B;  3ML0 A;  3H1K H;  2ITC C;  4GCZ A;  1XBL A;  3L73 H;  2R72 A;  1NR7 A;  3CMA V;  4LF7 O;  3ABL B;  2JK5 C;  4PDV A;  1XIL A;  4ZI7 A;  2WLI A;  5LYJ A;  3K59 A;  1S77 D;  2WLH A;  5GW7 A;  4R8C A;  3P32 A;  1OCC B;  3LDD A;  3W7W A;  4MVU A;  1S3J A;  3P3P A;  5LMU B;  1U96 A;  4MTO A;  5TIS Z;  1M4U A;  3ASO B;  3VQY A;  1FJG O;  4JI8 B;  2ZDI A;  1WNS A;  5CBG A;  4FLX A;  3JAS B;  2DYS B;  4H44 B;  1O9H A;  2YID A;  2PI4 A;  4IL6 Z;  3CHX A;  4MW8 A;  4H0L B;  5BR8 B;  4I50 A;  4FM0 A;  3RWR D;  3HKD A;  3DTU B;  3UO3 A;  2RMK B;  1KBH A;  5LP6 A;  3WG7 B;  3CCU V;  1URF A;  3PN1 A;  5B1B B;  3E83 A;  3HKB B;  4DW0 A;  4GUN A;  4AI8 A;  2UUA B;  4LF5 O;  5GON B;  2QA4 V;  3RN4 A;  2UXC B;  4DV7 B;  2G38 A;  4I55 B;  3L74 H;  4U3J B;  1THZ A;  3LSS A;  4K8X A;  2Z5U A;  5HFM A;  4EKW A;  1Q5O A;  4X8A A;  4O4L A;  5LHI A;  3T1H O;  1FS0 G;  4CH4 A;  2OT5 A;  1BGY H;  1XQ8 A;  5DED A;  5J2T B;  3JAK A;  4O4I B;  5C8Y B;  3SJB C;  1WB7 A;  1F4M A;  1S5H C;  3RYC A;  3SGI A;  1Y6X A;  4GX1 A;  1SS3 A;  2Z3Y A;  4CC6 A;  1EZV H;  1HR0 O;  2DWD C;  4EB6 B;  1K92 A;  5EBL C;  3AG3 B;  3IAY A;  1D5N A;  3ZRW A;  2RQ6 A;  1TVK B;  1K73 W;  2YXL A;  1GAX A;  2UUC B;  5BY1 A;  4JAV A;  1GM8 A;  3JD0 A;  4Z1V A;  1K7D A;  5EC2 C;  4UCS A;  4LR3 A;  2Y4T A;  4DR3 B;  3T1C A;  2JS3 A;  3CPW U;  2DWE C;  1VAR A;  4MT8 A;  1JMK C;  1IBK O;  3DC5 A;  5A9G A;  1I94 B;  2RJZ A;  3ZHR A;  5GON A;  2RNB A;  4TV9 A;  3HPL C;  2W0X A;  2YDE A;  3FFQ A;  3SJA C;  3RW0 A;  1N34 O;  2ZR2 A;  3N2K B;  1D5A A;  1SRY A;  3JAM N;  1H38 A;  1ORQ C;  4B7K A;  1WPB A;  3QTC A;  2E3C A;  1XMO O;  5IYC O;  3K5N A;  1QR8 A;  3SPI A;  2KQX A;  4DV0 B;  3ZN0 A;  5BZB A;  2UUC O;  1XRE A;  4X9Q A;  1SA0 B;  1GKF A;  2QWR B;  4ZBM A;  4ZOL B;  3K04 A;  2HFE C;  5LGU A;  1IDS A;  1SQP H;  4JI5 B;  3ZRS A;  4PA3 A;  2XOK G;  2FML A;  4DXW A;  4B3T B;  1YDX A;  1EZJ A;  1FXH A;  3CME V;  2P22 C;  4H33 A;  4FFK A;  1NT2 B;  4LH6 A;  2AZ2 A;  2N74 A;  1H8E G;  1W0J G;  4IYI A;  1VQL V;  3CCR V;  2MK3 A;  2Z0A A;  4JZ2 A;  2LGQ A;  4ZOL A;  1SZX A;  4CZZ A;  4N21 A;  1QVF U;  2QTO A;  1IXB A;  2YIA A;  5CA1 B;  1YVW A;  4B08 A;  3CYO A;  3IFX A;  3CJH B;  3CC2 V;  4DRX A;  1R73 A;  2PGG A;  2WLM A;  4WF9 V;  3WFV A;  4BR6 A;  1X4T A;  3K06 A;  2EIN C;  1N36 O;  4ZKI A;  3H1I H;  1HR0 B;  3OMI B;  1N33 B;  2YEV B;  3Q4H B;  1SES A;  3F5T A;  3ZMS A;  1PPJ H;  1CXZ B;  3OGC C;  3JCU Z;  4FVM A;  3KKY A;  2WLL B;  3ZJZ A;  1YTF D;  4FM1 A;  1NBM G;  4W4L A;  4X89 A;  1QU7 A;  4KUM A;  3NXS A;  4ZI7 B;  4TQD A;  2L6L A;  4J7J A;  1K97 A;  4UUJ C;  2P6J A;  4LC1 A;  5LHG A;  1F51 A;  3JAL A;  1L8D A;  1S76 D;  3D3I A;  5LBQ A;  3ABM C;  2K1E A;  1NVP B;  1GO3 F;  1M56 C;  3C3S A;  3B40 A;  3UO2 A;  4GKK O;  2XAH A;  3U0Z A;  1B06 A;  1COW G;  1H2G A;  4B3R B;  4QPJ A;  1AR5 A;  4YJ3 B;  4NXN O;  2Q0O C;  1HNZ B;  2F1M A;  3ABK B;  4X1I A;  5EYP A;  1AR1 B;  1Q81 W;  4FIP C;  1SQV H;  4RAI A;  5LXT B;  5BXZ A;  3K5O A;  4P30 A;  4JI2 B;  2YI9 A;  1QQC A;  5EZY A;  1GK9 A;  3AK2 A;  4JI2 O;  5K1P A;  4DR7 B;  5H6Q A;  1MOF A;  1MZE A;  2CTP A;  1KMI Z;  4KP4 A;  3ETD A;  4LNU A;  4MVR A;  2WLN A;  5GTI Z;  3ZMU A;  5L3D A;  1UPG A;  1SF9 A;  4ZIB A;  1S72 V;  2ZT9 B;  1B3Q A;  3HKE B;  4U3F H;  2QKA A;  2ZIN A;  2P90 A;  1XNQ O;  1K4C C;  3RT3 C;  3U10 A;  4GX0 A;  5H9C A;  4J7K A;  5IYD O;  5L3G A;  4LF5 B;  5ITZ A;  2EIJ C;  1M9N A;  5FLX N;  1Z5V A;  5FNV B;  3K3W A;  2UUB O;  1N4C A;  2QM8 A;  1SQG A;  3N27 A;  2IBZ H;  3JAK B;  4DV7 O;  1W59 A;  1Y67 A;  4I4T A;  2ZD9 A;  4K0K B;  4LF4 O;  3BAA A;  4N23 A;  3FAV B;  4FZ1 A;  3F7V C;  3SYC A;  3DSQ A;  3JAT A;  4JF3 A;  4I9Q A;  1G6U A;  3A0H Z;  1GN3 A;  3STZ C;  2HP8 A;  3O65 A;  3ZRV A;  2UXB B;  4P2Z A;  3OR7 C;  3MHH C;  4I5S A;  4PA6 A;  3DGE A;  4FLY A;  3VQW A;  2EIM B;  1SZT A;  4JTD B;  4JI3 O;  3JD4 A;  3CXH F;  1ZUQ A;  2P4V A;  2RCV A;  4DR6 O;  1YIT V;  4JTC B;  2JEX A;  1YIJ V;  4ZHQ B;  1PKX A;  1CPY A;  1QHT A;  4I50 B;  2ZQM A;  2W0F C;  2JGD A;  1YF2 A;  3K57 A;  1XMQ O;  1BHB A;  2HVK C;  5KX5 B;  4FPP A;  3FB7 C;  4LF4 B;  3OTO B;  3AK1 A;  1IBL O;  2ZNI A;  1NH2 B;  3OD4 A;  1NU1 H;  2EIL C;  2N04 A;  3CCQ V;  4PDL A;  4FFB A;  3E35 A;  1TGO A;  5LMN O;  1PL0 A;  5JWP A;  1XEQ A;  5B1O A;  2DW4 A;  3AG4 B;  1FFX A;  1GM9 A;  4JI7 O;  3S3W A;  2DQ3 A;  5B1A C;  2Q8V A;  4LF8 B;  4NKG B;  1YZB A;  1WN7 A;  1R6K A;  4B3R O;  1Q6H A;  1LUV A;  3APQ A;  4JI1 O;  2QEX V;  1F7Y A;  3X2Q C;  1AJN A;  4GKJ B;  1BT8 A;  3ZBH A;  1KKC A;  3ABU A;  4IHJ B;  2CTR A;  5IJ0 A;  3CSX A;  2PI5 A;  3ZHU A;  1WPX A;  5JH7 B;  2ZE7 A;  2IW5 A;  2EJR A;  3E8G A;  2QE7 G;  1CP9 A;  3QVN A;  4R6Z A;  1V54 C;  4D7T A;  4HZ3 A;  3K5L A;  1YCI A;  3BY6 A;  2H3O A;  4EFE A;  5LL6 Y;  1G4Y B;  2VQF O;  4WBN B;  4UVA A;  1BSM A;  1H2N A;  2AHZ A;  3W7S A;  3ETG A;  3QNE A;  3AG3 C;  4KHP O;  3OTO O;  1ZX3 A;  4G28 B;  3CXC U;  3K0D A;  4F6R B;  3SPJ A;  4DRX B;  3APO A;  1KP2 A;  3RVY A;  4MVS A;  3OE7 G;  3P30 A;  4JYA O;  5HFL A;  2IH3 C;  3B8N A;  1P84 F;  4KFM A;  4RWU A;  1AJP A;  1U97 A;  4J41 A;  4J10 A;  3ZMT A;  4ZHQ A;  1Y4M A;  3CS5 A;  1MAB G;  4YJ2 A;  5KHH A;  4DW1 A;  4O4H A;  3QO5 A;  4DV6 B;  1L0N H;  1KQS U;  2LW1 A;  1TUE B;  2V4D A;  1V54 B;  3RVZ A;  3J7A U;  3TXQ A;  2CH7 B;  4DR2 B;  2X0L A;  4LF9 B;  1FYJ A;  1VQ9 V;  1NI8 A;  2WA3 A;  3LNN A;  4K0K O;  3RYC B;  4LF9 O;  1JFF B;  3IJ4 A;  2XAG A;  3E8H A;  5CB4 B;  2IJJ A;  2EJ7 A;  4X66 O;  4O2A A;  1RM1 C;  2Q5Z A;  5IT9 N;  3E8F A;  1ZLZ A;  1CEZ A;  4JAS A;  2WPD G;  5EYP B;  1DGS A;  4LFB B;  3ABK C;  1GN4 A;  2BOC C;  2XAS A;  4ABM A;  4CH3 A;  1RSO B;  5KUK A;  2KB1 A;  2X6A A;  2JIZ G;  1R6N A;  4PEL A;  3GVM A;  3K03 A;  1P7G A;  1EFR G;  1RPR A;  2ZIM A;  1DF4 A;  2CTW A;  3JCZ A;  3CC7 V;  5IDJ A;  4X1K B;  4PDR A;  4DUY O;  1XMQ B;  3MAQ A;  3K5M A;  3H1J H;  3M7M X;  3CRR A;  2EZO A;  4O4J B;  4YXW G;  2BTO A;  2YXY A;  2UXX A;  3AG2 B;  4DV0 O;  3ZMV A;  4MTG A;  1S0V A;  1Y76 A;  4LFB O;  3A0R A;  1BCC H;  5CA0 A;  1XOU A;  1RM1 B;  1TVK A;  4HBN A;  2KKW A;  3I55 V;  1IVS A;  2B1I A;  4X20 B;  4WFH A;  4AIL C;  3J81 N;  3FX7 A;  2M7W A;  5KX5 A;  1F4N A;  3ZRW B;  1UJW B;  2IH1 C;  4NVP A;  3BCC H;  5LGT A;  1S5J A;  5KMG B;  2OWO A;  5FPO A;  2QDO A;  2JVD A;  4DV6 O;  3JAT B;  3G6E V;  2GV9 A;  3SPG A;  4X88 A;  4EFB A;  1TUB A;  2GUZ A;  4PA4 A;  1NTM H;  1N32 O;  2X6C A;  3CRQ A;  2GHY A;  4X65 O;  2P7T C;  2IU3 A;  2ILM A;  3CEI A;  3O9O A;  2Q7E A;  3CWB H;  2X7R B;  4B3S O;  2ARH A;  3OMA B;  1Q82 W;  4GT1 A;  3T2M A;  3F5W C;  1SKV A;  5B3S B;  4FLU A;  3AG2 C;  5LOV A;  1NKD A;  4I4T B;  2HG5 C;  2ZE6 A;  5DM6 V;  2FKX A;  3ZX6 A;  4U7O A;  3B09 A;  2XT9 A;  4K8Z A;  1ZL8 A;  4QE7 A;  1DTO A;  1BZK A;  1JR9 A;  5JJE B;  5EIB D;  4DV4 O;  3L75 H;  3JAW B;  2Q7G A;  4L8J A;  2DMX A;  2DYR C;  4DUZ O;  2AW9 A;  4TV8 A;  1OHH G;  4FLW A;  4JI1 B;  3ZCC A;  3OUF A;  2PTM A;  4AHC A;  3RYI A;  2F66 C;  1OJH A;  4AQY O;  1FFT B;  1PD3 A;  4J42 A;  1KKD A;  3JAS A;  1H2M A;  2ZE5 A;  3JAL B;  3STL C;  4J11 A;  3BPZ A;  3QG5 A;  3K9S A;  1NZ6 A;  1DLB A;  3IC9 A;  4MTF A;  1AB3 A;  4CBC A;  2Q4P A;  2QKS A;  2WLK A;  3GB7 C;  1Q7Y W;  4JI6 O;  3CP1 A;  5B3S C;  4YJ3 A;  4TWK A;  4DV1 B;  4BIU A;  2R9A A;  1KB9 F;  2RN9 A;  4FFB B;  1GN2 A;  4TSF G;  5E79 Z;  4JGS A;  2YS8 A;  4IYH A;  5JCO C;  3E2E A;  1N0N A;  4DR3 O;  1VQ7 V;  5KA6 A;  4YJ2 B;  1SC5 B;  1XHX A;  2V7Q G;  2FTK A;  4KHP B;  2EZP A;  4X20 A;  1QR9 A;  2Y48 A;  1YJW V;  1I94 O;  3E22 A;  1Z5W A;  2OCC B;  4DR4 B;  2JJ2 G;  4OGQ B;  3OGI B;  4RUF A;  1YI2 V;  1V55 B;  4OPH A;  5IYZ A;  1G8M A;  3AG7 A;  4HYO A;  1JA8 A;  5KMG A;  2NLJ C;  2LFS A;  3T1H B;  1N34 B;  2RDC A;  4NXM O;  2ETN A;  4CH5 A;  2LGW A;  2GUZ B;  3RFR A;  2UU9 O;  3LSU A;  4O2A B;  2ZXW C;  3UCS C;  1VQK V;  4PI0 A;  2XAF A;  3A2F A;  1QNM A;  4PI2 A;  4MVZ A;  3ZMZ A;  1XNR O;  1FXK A;  2Q69 A;  4R50 A;  2VQE B;  2WLJ A;  2QWO B;  3OT7 A;  3VQV A;  3E86 A;  4DR7 O;  2W6J G;  2QJ1 A;  4O4H B;  4DV2 B;  1BMF G;  1OV9 A;  5B1A B;  4O2B A;  4TV9 B;  4WFE A;  2QM7 A;  4GX2 A;  2QWP B;  2F95 B;  1S5L Z;  3HKB A;  3HB3 B;  3AG1 C;  1XL4 A;  3ASN B;  2HHH O;  1WJZ A;  3N2G A;  3OEE G;  4YIP A;  1NTK H;  3SYP A;  4TOI A;  5FNV A;  3LNM B;  5L3C A;  3E22 B;  3I5D A;  3G4S V;  5CB4 A;  1RSO A;  3LSQ A;  1KP3 A;  3ZS8 C;  3OMN B;  4WFF A;  4YIO A;  1PV0 A;  3H01 A;  1XMO B;  1ZAU A;  2ZXW B;  2ITD C;  3D36 C;  3G71 V;  1VQN V;  1K8A W;  2PYL A;  1IX9 A;  5J2T A;  3SPH A;  3KG2 A;  5DEC A;  4RQE A;  2DE0 X;  3K79 A;  4BAY A;  1VF6 C;  4CC5 A;  1OCR B;  4NXM B;  3H1H H;  1HW7 A;  1AVM A;  1SQF A;  3SYA A;  5B1N A;  1M56 B;  3FD9 A;  4PHZ A;  1AP5 A;  3QO8 A;  1N36 B;  1GM7 A;  4PJ0 Z;  4NTY A;  4OXS A;  4OPA A;  1LNQ A;  2ZIO A;  1IBL B;  4JI0 B;  4J9Z B;  3BEH A;  3KZI Z;  1BHA A;  2Y4U A;  4OX9 O;  4I9W A;  2NNU A;  2A3Q A;  3BA9 A;  1L1F A;  1R1B A;  3W7T A;  5FL7 G;  2UU9 B;  4FLZ A;  2A7W A;  1Y76 B;  1JQ0 A;  4K3A A;  3JAR A;  1QCE A;  1H2S B;  4QNH B;  4O4I A;  1VQ5 V;  5EIB C;  1N0J A;  3JSL A;  1M90 W;  3T4D A;  4BIO A;  3E89 A;  3SR2 C;  1OCZ C;  4BW5 A;  4WBN A;  3FYI B;  1IUR A;  2B9Z A;  1TAE A;  3FB8 C;  1R3I C;  2YI8 A;  1E1R G;  1NTZ H;  1TA8 A;  1OCR C;  1YXB A;  5JQG B;  3BA8 A;  5FPR A;  2EIK C;  1ARO P;  4GX5 A;  3EVK A;  2OTJ V;  4UV8 A;  2A79 B;  4J9Y B;  2E5L B;  4UFZ A;  2BOB C;  4GYC B;  1NQT A;  1KYO F;  1H2L A;  3K0G A;  2UUB B;  3F7Y C;  1BE3 H;  2YIB A;  1N8R W;  2WA4 A;  4I0X B;  3A0B Z;  4X62 B;  5KHG A;  1UFI A;  4R7C A;  2EUL A;  4Z1M G;  4UXN A;  5H6R A;  4J7Z A;  5JVD A;  5JH7 A;  2LJ2 A;  2YC0 A;  1KC8 W;  5CA1 A;  1W0K G;  5KAI Z;  2HEP A;  4UCT A;  1Q90 D;  4QGP A;  1PNL A;  3ETE A;  5KHI A;  4B7E A;  1DF5 A;  2VRZ A;  4EEQ A;  1M1K W;  2GBO A;  4LFC B;  1T5E A;  2Q9L A;  3JD1 A;  1OZ0 A;  1ZWI C;  5IY5 B;  3UT5 A;  3CCE V;  2JRI A;  2LQT A;  1HNW B;  1A32 A;  3UQ8 A;  3GWO A;  5CMU A;  3JD3 A;  1AIL A;  4DUY B;  2EIJ B;  3H9V A;  2B5U A;  3L72 H;  4X1K A;  3T1Y B;  2O57 A;  4IGG A;  2KSD A;  3FB5 C;  5C8Y A;  3R66 A;  5CA3 A;  2PY5 A;  1GMG A;  2V1D A;  5F2V O;  2UXN A;  4I0X A;  5A2Q N;  2VS0 A;  4NTX A;  4DR4 O;  2MW2 B;  1JPX A;  4UB8 Z;  4QPK A;  4YHH B;  4JV5 O;  2QGN A;  1VQ4 V;  3B77 A;  4X1I B;  1VEW A;  3JAR B;  1Q8I A;  1YEW A;  4I7Z B;  4U3J A;  2XHB A;  2HHH B;  1JCH A;  2JJ1 G;  1VIB A;  3THO A;  2XND G;  2A06 H;  3X2Q B;  3T1Y O;  2Q6A A;  1ZSP A;  2DYS C;  1PNM A;  2IU0 A;  1GH6 A;  2KG7 A;  4NB5 A;  1HNX B;  2WAM A;  5EBM C;  2UXC O;  3N2G B;  3OW2 U;  2WSS G;  4LP8 A;  5E1A C;  3ZHQ A;  1WP7 A;  3TET A;  4JAA A;  4F4L A;  2CK3 G;  2LFR A;  2IM9 A;  4PD4 F;  3SDL A;  4JI5 O;  4EB6 A;  4QE9 A;  1SET A;  1Q6U A;  3LDE A;  3OM3 B;  3Q4H A;  3WB2 A;  5B5E Z;  5BR8 O;  3C3T A;  2Q7H A;  2GTS A;  2ADQ B;  1WA8 A;  2BCC H;  1R6T A;  4MS2 A;  3LDC A;  1HDJ A;  2P67 A;  1Q3E A;  3QF7 A;  1J5E O;  2Q73 A;  2P5O A;  2ZKO A;  3FAV A;  3ZED A;  5LOV B;  2BTQ B;  1GTO A;  1FPO A;  5KHK A;  1OCO B;  2C2A A;  3FYE B;  4BW9 A;  1LR1 A;  3OFN G;  4PA7 A;  1QLE C;  3CCV V;  4DR1 B;  2HVJ C;  3M99 B;  1K34 A;  4FJC C;  4MSW C;  3RYF B;  2ZNJ A;  3ZN1 A;  2DQ0 A;  3K9A A;  2OCC C;  1MA1 A;  4B3M B;  4LH7 A;  4DV5 O;  1PL4 A;  2GSM B;  1VF5 B;  4H13 B;  2JGD B;  1M57 C;  2XAJ A;  2VQE O;  4UVC A;  2R70 A;  5L3F A;  5J2U B;  4DR1 O;  3J80 N;  1V55 C;  3B4S A;  4DO2 A;  4NR1 A;  3UKM A;  2ZM6 B;  4LWS A;  2ATK C;  1E1Q G;  1WB8 A;  1ZTE A;  3VBB A;  2CTQ A;  4XDJ A;  4CS4 A;  5IJ0 B;  1VQ6 V;  4LF8 O;  3JD2 A;  1M5I A;  2QSA A;  4IIJ B;  4JTA B;  1VQO V;  2CAZ C;  2XUM A;  3KCY A;  4L87 A;  2WWW A;  4WCE V;  4LWS B;  3HKE A;  4WFB V;  1YJ9 V;  3M8A A;  2P4K A;  3WG7 C;  1MSD A;  3CRA A;  4X65 B;  3JAW A;  4JYB A;  2QR4 A;  2Y69 C;  2W6I G;  5D5Q A;  1ZL8 B;  2JEU A;  4DV2 O;  3UM7 A;  2D3O W;  3SYQ A;  3EXA A;  3ASN C;  4QIW F;  2IJK A;  2KG7 B;  4RO2 A;  2PZS A;  4MVQ A;  2ZR3 A;  2DOS A;  4UCO A;  1NH2 D;  1US6 A;  1IBM B;  4JI4 O;  4PA9 A;  1AI7 A;  1FXV A;  2E76 B;  4UCR A;  2VWK A;  3SPC A;  5BMV B;  3HKC B;  1IBM O;  4JI4 B;  2LO1 A;  1IZ3 A;  1XL6 A;  4X62 O;  3CCM V;  2HJD A;  3OUS A;  2VQF B;  1MSW D;  5LMN B;  3PJS K;  4GKJ O;  1Z2G A;  4JI0 O;  4Q6G A;  5J9P C;  1NVP D;  4HNA A;  4LCU C;  4TT3 G;  1K3E A;  5LGN A;  4LF6 B;  2ZM6 O;  5BMV A;  2JS5 A;  5GTH Z;  2YXH A;  3IC7 A;  5LMU O;  2BTQ A;  1BQ0 A;  3HR0 A;  4E2L A;  1JJ2 U;  1JFF A;  2CDY A;  3DXR B;  4DR5 O;  3B8M A;  4QJF B;  2AGA A;  1EN6 A;  2EX3 A;  5JVD B;  4D6T H;  5L3B A;  3W7U A;  4HAM A;  4ASU G;  4DR2 O;  1EM1 A;  4LBE C;  4O4J A;  3D3Q A;  4DR6 B;  1SQQ H;  3RGB A;  3C90 A;  3CJH A;  2D2C B;  4MVO A;  5LP6 C;  1QLN A;  1FXK B;  2JDI G;  2N05 A;  2YUA A;  1OCZ B;  2F43 G;  2Y0I A;  1DK1 A;  4DK0 A;  5J2U A;  5CBH A;  4JZG A;  3ETQ A;  1WAZ A;  5CN0 A;  3U11 A;  2PUS A;  3S3X A;  4JV5 B;  4DV1 O;  4Z2W A;  1BL8 A;  2E74 B;  5AG2 A;  1HP8 A;  1YJN V;  1QBZ A;  4XBF A;  4H37 A;  4J80 A;  4O4L B;  1BQZ A;  3P3N A;  1HNX O;  4JPR A;  3CCJ V;  1X59 A;  3T4Z A;  2B1G A;  3B2E E;  1RFY A;  4LNU B;  3L70 H;  4YY3 B;  2PF4 E;  1KEC A;  4UB6 Z;  1YHQ V;  3CCS V;  5CBF A;  4RUE A;  2HR3 A;  3AEI A;  1XI1 A;  4WFA V;  3BFR A;  4DV4 B;  1K5Q A;  1I08 A;  4DR5 B;  2PYJ A;  5LA6 B;  5LP6 B;  2P06 A;  2YIC A;  3SJQ C;  1FXK C;  1I5X A;  3A8T A;  2NN4 A;  4UCU A;  2FB5 A;  4CH6 A;  2ZE8 A;  3RYH A;  1GN6 A;  3TGU H;  2ODM A;  4FMT A;  5IE9 A;  2OIG A;  3H1L H;  1HNZ O;  2E75 B;  4JAU A;  3G6B A;  5KA5 A;  3WU2 Z;  5IY5 C;  1VQ8 V;  5EK0 A;  3OEH G;  4MW3 A;  5CA0 B; 
#chains in the Genus database with same CATH homology
 1NTK H;  3L74 H;  1PP9 H;  3H1J H;  2A06 H;  1NTM H;  1SQP H;  1KYO F;  3H1K H;  1SQQ H;  3H1H H;  3L73 H;  1SQB H;  3L71 H;  1BE3 H;  1KB9 F;  4PD4 F;  1EZV H;  1SQX H;  3CX5 F;  1NTZ H;  3CWB H;  3TGU H;  2IBZ H;  3BCC H;  3H1L H;  4U3F H;  3H1I H;  1L0N H;  1SQV H;  1BGY H;  1L0L H;  3CXH F;  4D6T H;  1BCC H;  2BCC H;  1P84 F;  5KLV H;  3L72 H;  1PPJ H;  2FYU H;  3L75 H;  1NU1 H;  3L70 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...