3H1LH

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1lH00
3L75H 3H1LH 1BE3H 1SQVH 3L74H 1KYOF 3TGUH 1BCCH 3BCCH 1KB9F 4D6TH 1PPJH 1SQXH 4PD4F 1NTKH 1PP9H 2BCCH 1L0LH 2FYUH 1BGYH 2A06H 1NTZH 2IBZH 3H1KH 3L72H 1L0NH 1EZVH 3L71H 3L70H 3H1JH 3L73H 1SQQH 4U3FH 1SQPH 3CX5F 3H1IH 5KLVH 1NTMH 1P84F 3H1HH 3CWBH 1NU1H 1SQBH 3CXHF
chains in the Genus database with same CATH superfamily
3CRAA 4ZHQB 3K59A 1XDCA 1M90W 4UVBA 1GM7A 3CRQA 2X0LA 2Q68A 1TVKA 3QTCA 2ODMA 4W4KA 1Y76A 4LF8B 3OM3B 2F23A 4LFBB 1ZTEA 4DV3O 4BWAA 1MA1A 5CMUA 4X66O 5CBGA 1XMQB 2A7WA 2PUSA 1M93A 1S5HC 3AK3A 2AZ2A 3ZN1A 3B09A 5H5NA 1TVKB 1D5AA 3B40A 2GDSA 2P6JA 1BZKA 2JVDA 1FAFA 2GHYA 3RFRA 2NNUA 3FB8C 2K1EA 4B3SO 1N33B 3A0BZ 3RVZA 5IYCO 3JASA 2L35A 4FLZA 2AZ0A 2LP7A 3LDDA 1QCEA 4AQYB 1VQMV 2DJVA 4FFBB 3BABA 1M56B 2ZXWC 4YJ2B 3J81N 4B3MO 1YXBA 2QSAA 3CRRA 2LFRA 4MVZA 2HEPA 2XAJA 4JTDB 5BR8O 3FFQA 2QJ1A 1GH6A 5IJ9A 2WAMA 3JASB 4K8XA 2ZQMA 3W7SA 1F23A 4GT1A 2HKOA 4CS2A 1VIBA 1L0LH 4YJ3A 3OGCC 2IW5A 5B1AB 3ZN0A 1Q90D 2JK5C 5J2UB 3RBZA 3SJBC 2ZR2A 3P3PA 4TWKA 2HJDA 4U3JA 5IJ9B 1MNGA 2P67A 3LSSA 3ZRSA 1B3QA 5L3DA 5LOVA 4I55B 4MVQA 1JMKC 3F5TA 1E1QG 2Y4UA 4X65O 3ETEA 4UCVA 4JI1O 2IH1C 1M5IA 3M7MX 5EK0A 4IYHA 2Y4TA 1QBZA 3IC7A 1VQOV 4GCZA 5FPOA 1Y74A 2O57A 1SA0A 4MTOA 2CTWA 1I94B 3KG2A 4UB8Z 5JCOC 4MVUA 1ENVA 1LR1A 1P84F 5LOVB 4KP4A 2WA4A 2WLMA 4UV8A 1I08A 3K0DA 1Q6HA 1HNZO 3I55V 4H44B 4J11A 3SPHA 3FAVB 1KQSU 1KKCA 3A0RA 4JF3A 3APQA 1Y74B 1KC8W 1AI7A 1SA0B 2V7QG 1SETA 1TA8A 3GWKC 2AXTZ 3S3XA 3WB2A 4I9QA 2Y0IA 4UCRA 5B66Z 1GAXA 2N74A 2ZE6A 1TUBA 1PNLA 5ITZA 4LCUC 3U0ZA 1Q3EA 2IBZH 1VQKV 1PM9A 3OMNB 2X6CA 3GWOA 1TUEB 4CS3A 3ZMSA 2UXDO 5B1NA 1RP3B 4FK5C 2FB5A 1YEWA 4F4LA 3FYEB 4DV6B 1UPGA 4IIJA 5IWAB 3BCCH 3JD0A 1DF5A 1SQXH 5ITZB 2FYUH 2CTPA 1Q6IA 1W0JG 1K97A 1VF6A 2R72A 1GN6A 1HNXO 4NXMB 4KHPB 3WG7B 1K92A 5IY5C 2A3QA 5KA5A 5EBMC 1QNMA 2DOSA 5CB4A 4I7ZB 2OCCC 3K5OA 3KZIZ 4IIJB 2ARHA 3ZHUA 5LA6A 1W0KG 4QNHB 1Y4MA 3Q4HA 4JI7O 3T1HB 5BY1A 4ZKIA 1V54C 2WLNA 3ICXA 4NTYA 4XDKA 2B5UA 4CBCA 3IFXA 5CB4B 3RGBA 4CH4A 5BR8B 1OCOC 4LF4B 3TGUH 2IU0A 3OUSA 1Q5OA 1AI6A 4BR6A 3SYPA 4GLXA 2UXCB 1WPBA 4DR6O 4R50A 3AG4B 2GV9A 4O2AA 3FD9A 1DLBA 1H2LA 1MZFA 4I50A 1CEZA 1XOUA 3FB7C 2HR3A 1R3LC 1G1XB 4JAAA 1EM1A 4CC5A 2PYJA 3ZRVA 4P9PA 1HW7A 3B8MA 3ASOB 3CXCU 2WLIA 3AK2A 3QVNA 1FFTB 1XI1A 3L72H 3EXAA 4ZBMA 2Q7HA 3EFFK 3LSUA 4LF9O 5LGUA 1NBMG 5FL7G 1NTMH 5LP6A 3E89A 2BTOA 3ZEDA 4LFCB 1JJOA 1SQVH 2KKWA 5KAFZ 4H0LB 4JI3B 3E35A 2EX3A 3A8TA 3CEIA 1Z5WA 2CAZC 2WA3A 3MAQA 4X64O 2WWWA 3UO3A 5GONB 3UKMA 4DR7O 3RW0A 3H01A 2UU9O 2VQFO 1N0JA 5J2TA 3ZMVA 1DK1A 4LC1A 4E4EA 1AB3A 2VQEO 1OCRB 4GZRB 3CYOA 5B1BC 5LP6B 3JAKA 1AI5A 3D36A 4RO2A 2UUAB 1FD9A 3JALA 1HWYA 3CE2A 3T4ZA 1QR8A 3SYOA 3I5DA 3G71V 4LF5O 4G27B 4JI4B 2PF4E 5DM6V 1CXZB 3JAKB 2OT5A 2V4DA 5EZYA 1G8MA 4PDVA 1NH2D 5BMVA 1XMOO 5LMNB 2XAFA 1SZTA 2F4VB 3LDCA 3ZJZA 2CTRA 1R6TA 3CCJV 1AJPA 1NVPD 3ZCCA 4DR5B 1M1KW 4RQFA 1IBKO 3C3TA 1WB8A 3RN4A 3H1LH 1DGSA 5BMVB 3CB2A 3TXSA 1KB9F 1ZL8A 5L3GA 1MG1A 3WB1A 4DV5O 3CCRV 3K08A 1RSOB 4DV7O 2QM8A 3VQYA 1R73A 1BHAA 4OX9B 1SRYA 1R3JC 5HFLA 4K8ZA 1K5SA 5E79Z 3K5LA 1XILA 3G67A 4G28B 3ZRXA 1YHQV 2OIGA 3WB0A 3SR2C 2E3CA 5LMUO 2F93B 1FJGB 1NI8A 5K1XA 2H94A 5LXTB 3QG5A 4DR6B 1VQ7V 4UCTA 3JARA 1JX9A 4XDLA 5KHHA 5LHIA 4PA9A 2Q7GA 4KUMA 3JCZA 1XNRO 4DR1O 1FXKA 1GN3A 3E8FA 3X2QB 1Z2GA 4JZ2A 1TAEA 4QPJA 3TK1A 1BSMA 1YJWV 1GN2A 2DYSC 2VRZA 4JI6B 1EBOA 3FB5C 1Y6XA 3QNEA 3ABLB 1V55B 2YS8A 3RYIA 3JARB 2YEVB 1YTFB 4Q20A 1AR5A 4J80A 1V55C 3BAAA 2LO1A 1PL4A 2QEXV 3STLC 3EVKA 1H2NA 3RYFA 4DUYB 3IC9A 1VQ5V 1K9MW 3S3WA 5B3SB 3H1IH 5BZBA 5KHIA 3CS5A 4O2BB 2VQFB 3E83A 1XHXA 2YIAA 3RYIB 3L9DA 4UCUA 4GKKB 1D2DA 4JYBA 2BSKA 4GUNA 2WLKA 4QIWF 4BW5A 5JQGB 1AP6A 3OTFA 4PJ0Z 4PHZA 1OV9A 4DRXA 1NT2B 4FLVA 1SKVA 3DSQA 1B6QA 2JGDB 3M8AA 1UFIA 2YUAA 4C7UA 3CXHF 3HB3B 2EULA 4R8CA 2B9ZA 2EINC 2LW7A 2JDIG 2A06H 2WLJA 4DO2A 4DRXB 5LHGA 3AG2B 1RPOA 4B3TO 4J41A 1W2BU 3KCYA 4J7ZA 3K57A 3CRMA 4DV2B 2V1DA 4ZOLA 4DR2B 1N8RW 2UXBB 4X1KA 2R9RB 5JJNB 1BHBA 1QLEB 4WFFA 3SYCA 4I0XA 3E22B 4MW8A 4P9OA 1JPXA 4RUFA 4K0KO 1Y67A 1S72V 4NTXA 1Q8IA 4YXWG 5JJJB 1DTOA 2F95B 1N32O 1WP7A 3ETDA 4X1KB 4UFZA 1QVGU 2RJZA 5EC1C 1L0NH 5CA0A 4I0XB 1L8DA 3HKEA 2FMLA 4B3RO 1NJIW 2QKCA 5LMUB 3LUTB 2QGNA 2XT9A 3JD2A 2IJKA 4FZ0A 5KHGA 4EB6A 4B7KA 4MTFA 1OHHG 1XNQO 4EFEA 5EBWC 1Y76B 4PDLA 1HR0O 4CH6A 3T1CA 3J80N 2Q69A 1SC5B 4WCEV 5LGNA 4EB6B 2OIEA 2R70A 1H8HG 1N36O 3LDEA 4N21A 4I9WA 1M56C 2P90A 5EIBD 4LF6O 1PNKA 5D5QA 2WLHA 4E2LA 1N34O 1KECA 3ZHQA 3N27A 3OR7C 3ABKB 5H6RA 3SJQC 1WP8A 3B2EE 1F4NA 1XBLA 3PJSK 2E5LO 3G6EV 1SQPH 4EFBA 4DR4O 4JYAO 5FNVA 4JYYA 5B1AC 1JA8A 1GKFA 1AP5A 4DV4O 4WFHA 2ZINA 2LW1A 4TV9A 3A0HZ 5J9PC 2DW4A 1SQQH 2UUBB 1GRJA 5TISZ 5B5EZ 1HNWB 5BXZA 3CP1A 3ZRWA 1NTKH 2DQ0A 3TXQA 1YVWA 4JV5O 4YJ3B 4CH3A 4XDJA 2FKXA 3THOA 5JCOA 1N4CA 3OGIB 3JAWA 3OR6C 1KU9A 4A5UB 5GW7A 1S5LZ 4U3JB 3BA8A 3ZMZA 3DTUB 4IHJA 4I5SA 4NXNO 3CCVV 2JS3A 4B3TB 3ZRWB 3C3SA 4I4TA 3CCLV 4PA3A 3AG3B 3K06A 1NTZH 1IURA 1WA8A 4WF9V 3CC7V 3L70H 1A32A 2OTJV 2HG5C 4IHJB 3IJ4A 4MSWC 3G4SV 2VS0A 1J5EB 1MMMA 4RUEA 4GKJO 1KUQA 4JI8B 4NB5A 1LUWA 4IYIA 4YY3O 2P4VA 1KBHA 1FXVA 1US6A 4JTCB 4JI2O 2OWOA 2KSDA 4X62O 1ORQC 2EIMB 1M57B 3RYCA 4D6TH 4QJFB 2XHBA 1TUBB 4DV3B 2XASA 2DQ3A 4B7EA 4X66B 4D7SA 3OEEG 4GX5A 3ABUA 2ZM6O 1MZEA 3N2KA 3RWRD 4JGSA 1K33A 2ATKC 1K7DA 3ZMUA 4B08A 2OCHA 4FM2A 4FZ1A 3O9OA 1MABG 4GX0A 5H2FZ 3ETGA 4JI5O 2QDOA 1IZ3A 5B1OA 1X4TA 1Q6UA 1FYJA 2D3OW 1GMGA 1BQZA 3WG7C 1GM9A 3L75H 4B3SB 2QE7G 3CCMV 3MD0A 2A9HA 2BOBC 3OTOO 1AR1B 4X1YA 3JATA 4BW9A 1IBLO 1IVSA 4AI8A 2ITDC 1FXHA 4IL6Z 4DV1O 1NZ6A 4B3MB 4R7CA 3SPIA 1VF6C 3SPCA 3K9AA 4UCSA 5DECA 2AHZA 1O9GA 4F6EA 4EKWA 1I5YA 3U10A 4RQEA 5LA6B 5A2QN 3SPJA 2JJ1G 3Q4HB 4LFAO 3CPWU 3JATB 4HNAA 2PZSA 1OZ0A 3K79A 5JH7A 4PELA 4O4LA 5H6QA 4YHHO 3T1YO 2Z3YA 3GB7C 1NU1H 2ZT9B 4H13B 3AG4C 2QM4A 4LWSA 4JYAB 2M7WA 1SS3A 2PY5A 1XL6A 4MVSA 2E76B 3M99B 4X65B 4JI1B 3DXRA 1XEQA 5JH7B 3ASOC 4UV9A 3CMAV 3QO7A 4OGQB 4O2AB 4JI0O 4ASUG 1P4RA 2P06A 1TGOA 4I50B 4LWSB 1IXMA 1K73W 2YC0A 2ZNJA 2WLIB 4WFAV 1AILA 3DXRB 2AGAA 3FYIB 3OW2U 1HNZB 4L87A 2YIBD 3ZX6A 3I56V 3CJHA 4NYKA 2XAGA 3K0GA 2Q5ZA 1EN5A 4FVMA 1OCRC 5LP6C 2YICA 2BCCH 3OFNG 4DYLA 1H38A 2RCVA 2JEUA 3R65A 4OPHA 4DUZO 3CX5F 3E8GA 1VF7A 3BPZA 2QWNB 5J2TB 5JWPA 2NR5A 5D5PA 4FMTA 3CJHB 4XBFA 3SJCC 5LYJA 2H8PC 3JALB 1BCCH 1X59A 4IT5A 2UXDB 2EIJB 3D36C 3BA9A 1SQGA 1IXBA 2E75B 1WN7A 1WB7A 1YITV 1MSWD 1U96A 1IBMO 2JEXA 4BIZA 3HKDA 1Y66A 5EZYB 1HNXB 4ABMA 4JI5B 1JVMA 3CCSV 2YIBA 2ILMA 3RYHA 3W7WA 2EILB 5EYPA 1H2SB 1H2GA 3AG1B 3VOUA 3NR7A 4JI7B 4JAVA 4QPKA 2KQXA 3K04A 3ASNB 2YSUB 3HKDB 1VF5B 5IDJA 4O4JA 4NKGB 3ML0A 4TT3G 3T4DA 4J42A 3ASNC 4Z1VA 4PA6A 1ZL8B 4JPRA 3RYHB 2RDCA 1AJQA 1QLNA 5EYPB 4FM1A 4JTAB 2ZE5A 1OCCB 2X6BA 3FX7A 1PD3A 3TJTA 4LBEC 3P30A 2GBOA 3B4SA 3ABMB 4DV0O 2QWQB 1YJ9V 2WLLA 5IJ0A 2P4KA 3BY6A 4X89A 1EZJA 1BMFG 1OCZB 5IYBO 4H33A 1VP7A 4LF8O 1VQNV 2QWPB 3HKBA 3K58A 4LFBO 5KMGA 2Q6AA 2PTMA 4GYCB 4HAMA 4JYCA 1OCZC 1S5JA 2LGWA 1D5NA 2Y48A 2XTAA 1NH2B 2GUZA 5IJ0B 3X2QC 3K5NA 2CGNA 4U7OA 3U11A 3WFVA 4OXSA 4O4IA 2KB1A 3CMEV 4LF9B 4X9QA 1NVPB 3HKBB 3ABLC 3P32A 5C8YA 2CH7A 4FLTA 1FXKB 1B06A 2ZE7A 4BAYA 4X20A 2GUZB 1BS3A 4AQYO 4X64B 4KXRA 4DR7B 4UXNA 5A9GA 1KYOF 1SQBH 5B3SC 1KMIZ 4O4IB 2UU9B 1K4CC 4X1IA 5CA3A 1EFRG 1I7FA 2YXHA 1WAZA 1WPXA 3UO2A 2VQEB 3FB6C 4CC6A 4FJCC 3B77A 4QGPA 2VWJA 3RYFB 3P3NA 4FIPC 4X20B 2DYRB 3JYCA 2DWDC 3N2GA 2EJ7A 2FL4A 1Q7YW 3CSXA 4PI0A 1CP9A 3VBBA 4LF5B 1GN4A 4X1IB 4AILC 2NN4A 3AEIA 3QO8A 1FFXA 4TV8A 2BSKB 2ZKOA 4X8AA 5IT9N 1NS1A 1XMOB 2YIDA 4FM0A 1M9NA 3K3WA 2DE0X 1AROP 2L6LA 3SGIA 5JVDA 1KKDA 1SZXA 4LH7A 1QR9A 3AG2C 3CD6V 4J9YB 4DK1A 4WBNA 1FFXB 1IX9A 4TOIA 1I94O 2LQTA 1IBKB 4TV8B 5GTHZ 2ZDIA 1F7YA 3MHHC 1EZVH 4RAIA 2B1GA 2W0XA 1F51A 3G6BA 5CBHA 1QLEC 4DV5B 1RM1B 4PDRA 3JD4A 4DV7B 2HLDG 4MW3A 4DK0A 2YXLA 1LUVA 1S0VA 2Q7EA 2XAHA 1SQFA 1BE3H 3STZC 2BTQA 1ZWIC 3G80A 4ZOLB 2WSSG 2OYQA 1NR1A 4O4HA 4CZZA 5LBQA 4WFBV 2WPDG 2EIKB 2RMKB 3E86A 5KHKA 3UCSC 3KCXA 1VQ9V 3LSQA 1HP8A 1K4DC 4DV0B 3OT7A 2BTQB 2UUCO 2ZR3A 3C90A 1NQTA 4O4HB 1BGYH 2HVKC 1QQCA 4JZGA 4NR1A 3K03A 4DV6O 5CA0B 2X7RB 4U3FH 3HKEB 5IWAO 1XNRB 4DR1B 1P7BA 4FLUA 4P30A 4P2ZA 2QKAA 1WJZA 4FFBA 4NXMO 4Z1MG 4KHPO 1FS0G 4YJ2A 4LR3A 4LNUA 1ZAUA 4UB6Z 4JASA 1QHTA 4K35A 2EZOA 4NVPA 3VQWA 1V9PA 3ZHTA 1Z5VA 2EJRA 2RNBA 3ZHRA 4FLXA 3OD4A 1XL4A 3ZS8C 2N04A 5CBFA 2LGQA 3T1HO 1HDJA 2ZXWB 1AJNA 3IGAC 3AK1A 2VWKA 1B04A 2A79B 1R1BA 4MTXA 1OJHA 2UXXA 4LNUB 5LHHA 4LF7O 3ABTA 2P7TC 1Q43A 3ABKC 5J2UA 4LF4O 1Q86W 2C2AA 2P22C 5IYZA 4I55A 3OAAG 2BOCC 1XQ8A 1SF9A 2Y0PA 1O9HA 1VQ8V 1BL8A 2UXCO 1J95A 4PD4F 3JAMN 2YI8A 3H1KH 4PDMA 2JRIA 1G6UA 4PI2A 3OMIB 5AG2A 3SPGA 2BE3A 1K5QA 2GSMB 3VQVA 1THZA 5FNVB 5IYZB 1K8AW 3SYQA 2Q73A 3CC2V 4TV9B 2DWEC 2HHHO 4FPPA 4J10A 3FKSG 3ZMTA 2R9IA 3MHSC 2R9AA 3OMAB 2XAQA 3BEHA 2JGUA 4WFEA 3FAVA 1AR4A 2YI9A 3JAWB 2MK3A 1EN6A 4LFCO 1PKXA 3AG3C 3EHBB 4JI3O 2HP8A 3BVOA 1PL0A 2F43G 4CS4A 1EN4A 1ROPA 3T2MA 1PP9H 4K0KB 3LNNA 4I4TB 4ICGA 5E1AC 5EIBC 1JOYA 5GTIZ 1WA8B 2Q4PA 3QO5A 5C93A 1N32B 2UUAO 2QTSA 5K1PA 1XHZA 2CUGA 1VQ4V 3PN1A 2D2CB 2JS5A 1WLEA 4B3RB 4JI4O 4UUJC 4LP8A 5KUMA 3BHPA 1COWG 2GTAA 2EIMC 2KG7A 1M57C 2UUCB 3HR0A 2XUMA 3J7AU 2CGOA 4G2KA 4D7TA 4YIOA 2P5OA 2H3OA 3D3IA 5LMNO 2ZNIA 1XNQB 1N0NA 2F4VO 3AG7A 4TQDA 4OPAA 4BIUA 2X6AA 1F4MA 1HR0B 1RFYA 3RYCB 4IGGA 2QM7A 1KP3A 2KG7B 3CC4V 5IY5B 4DR5O 5EBLC 3N2KB 1MOFA 1VQLV 1R3IC 4HBNA 2OCCB 3D8CA 4QE9A 3CCUV 4TSFG 1N36B 1ZUQA 5IYDO 3CHXA 3JD3A 3L74H 3SJAC 4LF6B 2Y69B 2ZD9A 1V54B 2ZIOA 4J7KA 4MVOA 1JFFA 4OX9O 3JCUZ 2FTKA 2Y69C 1N34B 2ZE8A 4X1YB 1H8EG 2CK3G 2ZCEA 1OCOB 2AHYA 5H9CA 1VEWA 4LF7B 1YF2A 2E5LB 1U97A 4J9ZB 3W7UA 2YDEA 2LFSA 3SDLA 2Q8VA 3D3QA 4CH5A 1JCHA 4YIPA 4DR4B 2N05A 1JR9A 1R3KC 2RN9A 4DV4B 1JFFB 2CTQA 3DC6A 2Z5UA 1FJGO 4ZIBA 4HNAB 4DW1A 1P49A 3TETA 3L73H 4WFGA 3JD1A 2IJJA 4JV5B 4O4LB 1R6KA 2QTOA 1I5XA 4TQFA 1H2KA 2QA4V 1PNMA 4EEQA 3H9VA 5CA1A 3IAYA 2HHHB 4UVCA 4NXNB 4JI6O 5GONA 2F66C 3BFRA 1GK9A 3F7VC 1H2MA 2MW2B 4N23A 5FPRA 5KAIZ 3E8HA 3OEHG 5KLVH 2JIZG 3B8NA 3WU2Z 2YXYA 5L3EA 4R6ZA 4DW0A 4DUYO 1JJ2U 3K5MA 2IM9A 3LNMB 5CA1B 4Q6GA 5DEDA 4PV1B 5HFMA 2HVJC 5KX5A 4TUYA 5LGTA 4GKJB 5B1BB 4MS2A 4HZ3A 2EZPA 5DN6G 4GKKO 4KL1A 4YY3B 1VARA 2EBOA 3CWBH 3O65A 1S77D 1IDSA 2PYLA 5L3BA 4FLYA 4JI2B 2IJHA 1VQPV 1MSDA 4U7NA 4X62B 2JJ2G 5KX5B 1RPRA 4TUYB 4DR3O 2EIJC 1P7GA 2XOKG 2RQ6A 3L71H 5F2VO 1SESA 2ZM6B 3MDSA 3A2FA 5KHJA 4BIOA 4FLWA 5LYJB 1CPYA 5EC2C 5JJEB 1RSOA 2B1IA 1I0HA 1ZLZA 2EILC 1YTFD 4DV2O 3OTOB 4DR2O 2UXBO 3AG1C 1S76D 2IH3C 1FKAO 5IE9A 4GX2A 4KFMA 1IBLB 1QVFU 4DV1B 4ZI7A 1VMGA 4QE7A 1WNSA 1AI4A 1QU7A 3E8BA 1YZBA 4F6RA 2XNDG 3NXSA 4RWUA 1R6NA 1OCCC 2HJFC 4LFAB 5LXTA 1E79G 1XREA 1NR7A 2K9PA 3ABMC 4O4JB 3VQXA 4PA7A 3E2EA 2M6YA 4ZI7B 2LJ2A 4YHHB 3T1YB 2CE4A 2OTLV 1XUQA 4MT8A 4F6RB 3K9SA 1M4UA 2Q67A 4DXWA 1ZX3A 3ETQA 4L8JA 1XMQO 1BT8A 3HKCA 4PA4A 3ZIAG 1LNQA 4MTGA 2WLLB 3UM7A 4UCOA 4UVAA 2PI4A 2ADQB 1Q82W 2IJIA 2YEVA 2NLJC 2Q9LA 1YDXA 2QKSA 3JSLA 3ZHVA 4JI0B 1UJWB 4K3AA 3W7TA 5KMGB 3R66A 1K34A 2AW9A 1G4YB 2DYSB 4J7JA 1N33O 1YIJV 2ETNA 3HKCB 3GVMA 1FXKC 2PGGA 2A0LA 2QWOB 4O2BA 3TCUA 3DC5A 5LL6Y 3OE7G 2G38A 1YSCA 5C8YB 1S3JA 2CH7B 4HYOA 4AHCA 1BQ0A 5JQGA 5L3CA 2ITCC 3UT5A 3JSNA 3KKYA 1PV0A 2JGDA 1JQ0A 1YJNV 2DYRC 3H1HH 1W59A 1URFA 3QF7A 4MVRA 2IU3A 4Z2WA 1T5EA 1Q81W 4DUZB 4MVMA 2PI5A 3ZHSA 3UT5B 3BRCA 3UQ8A 3ZBHA 2QR4A 2Q0OC 3F5WC 2UUBO 3N2GB 1VQ6V 1L1FA 1HNWO 1SERA 4GX1A 2W6JG 4DR3B 2EINB 4NTWA 2W6IG 5CN0A 5L3FA 1YI2V 1KD1W 2CDYA 1E1RG 1DF4A 1AVMA 4W4LA 2Z0AA 2ZIMA 1FPOA 1IBMB 4H37A 3APOA 3CCQV 2HFEC 3SYAA 2F1MA 1ZSPA 3E22A 3CCEV 4X88A 3F7YC 3DGEA 4LH6A 5JVDB 2DN9A 3W7XA 1GM8A 1KP2A 2E74B 4ZHQA 3RVYA 1PPJH 2W0FC 4WBNB 1RM1C 3HPLC 4FFKA 1GO3F 4JAUA 2DMXA 1YCIA 2UXNA 5KUKA 5FLXN 3OUFA 2GTSA 2QWRB 1GTOA 2ADPA 2Q0AA 1J5EO 3H1JH 2ZDIC 5KA6A 3CRCA 1K3EA 4JI8O 3RT3C 1NKDA 2EIKC
chains in the Genus database with same CATH topology
3L75H 3H1LH 1BE3H 1SQVH 3L74H 1KYOF 3TGUH 1BCCH 3BCCH 1KB9F 4D6TH 1PPJH 1SQXH 4PD4F 1NTKH 1PP9H 2BCCH 1L0LH 2FYUH 1BGYH 2A06H 1NTZH 2IBZH 3H1KH 3L72H 1L0NH 1EZVH 3L71H 3L70H 3H1JH 3L73H 1SQQH 4U3FH 1SQPH 3CX5F 3H1IH 5KLVH 1NTMH 1P84F 3H1HH 3CWBH 1NU1H 1SQBH 3CXHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 H;  3H1L H;  1BE3 H;  1SQV H;  3L74 H;  1KYO F;  3TGU H;  1BCC H;  3BCC H;  1KB9 F;  4D6T H;  1PPJ H;  1SQX H;  4PD4 F;  1NTK H;  1PP9 H;  2BCC H;  1L0L H;  2FYU H;  1BGY H;  2A06 H;  1NTZ H;  2IBZ H;  3H1K H;  3L72 H;  1L0N H;  1EZV H;  3L71 H;  3L70 H;  3H1J H;  3L73 H;  1SQQ H;  4U3F H;  1SQP H;  3CX5 F;  3H1I H;  5KLV H;  1NTM H;  1P84 F;  3H1H H;  3CWB H;  1NU1 H;  1SQB H;  3CXH F; 
#chains in the Genus database with same CATH topology
 3CRA A;  4ZHQ B;  3K59 A;  1XDC A;  1M90 W;  4UVB A;  1GM7 A;  3CRQ A;  2X0L A;  2Q68 A;  1TVK A;  3QTC A;  2ODM A;  4W4K A;  1Y76 A;  4LF8 B;  3OM3 B;  2F23 A;  4LFB B;  1ZTE A;  4DV3 O;  4BWA A;  1MA1 A;  5CMU A;  4X66 O;  5CBG A;  1XMQ B;  2A7W A;  2PUS A;  1M93 A;  1S5H C;  3AK3 A;  2AZ2 A;  3ZN1 A;  3B09 A;  5H5N A;  1TVK B;  1D5A A;  3B40 A;  2GDS A;  2P6J A;  1BZK A;  2JVD A;  1FAF A;  2GHY A;  3RFR A;  2NNU A;  3FB8 C;  2K1E A;  4B3S O;  1N33 B;  3A0B Z;  3RVZ A;  5IYC O;  3JAS A;  2L35 A;  4FLZ A;  2AZ0 A;  2LP7 A;  3LDD A;  1QCE A;  4AQY B;  1VQM V;  2DJV A;  4FFB B;  3BAB A;  1M56 B;  2ZXW C;  4YJ2 B;  3J81 N;  4B3M O;  1YXB A;  2QSA A;  3CRR A;  2LFR A;  4MVZ A;  2HEP A;  2XAJ A;  4JTD B;  5BR8 O;  3FFQ A;  2QJ1 A;  1GH6 A;  5IJ9 A;  2WAM A;  3JAS B;  4K8X A;  2ZQM A;  3W7S A;  1F23 A;  4GT1 A;  2HKO A;  4CS2 A;  1VIB A;  1L0L H;  4YJ3 A;  3OGC C;  2IW5 A;  5B1A B;  3ZN0 A;  1Q90 D;  2JK5 C;  5J2U B;  3RBZ A;  3SJB C;  2ZR2 A;  3P3P A;  4TWK A;  2HJD A;  4U3J A;  5IJ9 B;  1MNG A;  2P67 A;  3LSS A;  3ZRS A;  1B3Q A;  5L3D A;  5LOV A;  4I55 B;  4MVQ A;  1JMK C;  3F5T A;  1E1Q G;  2Y4U A;  4X65 O;  3ETE A;  4UCV A;  4JI1 O;  2IH1 C;  1M5I A;  3M7M X;  5EK0 A;  4IYH A;  2Y4T A;  1QBZ A;  3IC7 A;  1VQO V;  4GCZ A;  5FPO A;  1Y74 A;  2O57 A;  1SA0 A;  4MTO A;  2CTW A;  1I94 B;  3KG2 A;  4UB8 Z;  5JCO C;  4MVU A;  1ENV A;  1LR1 A;  1P84 F;  5LOV B;  4KP4 A;  2WA4 A;  2WLM A;  4UV8 A;  1I08 A;  3K0D A;  1Q6H A;  1HNZ O;  3I55 V;  4H44 B;  4J11 A;  3SPH A;  3FAV B;  1KQS U;  1KKC A;  3A0R A;  4JF3 A;  3APQ A;  1Y74 B;  1KC8 W;  1AI7 A;  1SA0 B;  2V7Q G;  1SET A;  1TA8 A;  3GWK C;  2AXT Z;  3S3X A;  3WB2 A;  4I9Q A;  2Y0I A;  4UCR A;  5B66 Z;  1GAX A;  2N74 A;  2ZE6 A;  1TUB A;  1PNL A;  5ITZ A;  4LCU C;  3U0Z A;  1Q3E A;  2IBZ H;  1VQK V;  1PM9 A;  3OMN B;  2X6C A;  3GWO A;  1TUE B;  4CS3 A;  3ZMS A;  2UXD O;  5B1N A;  1RP3 B;  4FK5 C;  2FB5 A;  1YEW A;  4F4L A;  3FYE B;  4DV6 B;  1UPG A;  4IIJ A;  5IWA B;  3BCC H;  3JD0 A;  1DF5 A;  1SQX H;  5ITZ B;  2FYU H;  2CTP A;  1Q6I A;  1W0J G;  1K97 A;  1VF6 A;  2R72 A;  1GN6 A;  1HNX O;  4NXM B;  4KHP B;  3WG7 B;  1K92 A;  5IY5 C;  2A3Q A;  5KA5 A;  5EBM C;  1QNM A;  2DOS A;  5CB4 A;  4I7Z B;  2OCC C;  3K5O A;  3KZI Z;  4IIJ B;  2ARH A;  3ZHU A;  5LA6 A;  1W0K G;  4QNH B;  1Y4M A;  3Q4H A;  4JI7 O;  3T1H B;  5BY1 A;  4ZKI A;  1V54 C;  2WLN A;  3ICX A;  4NTY A;  4XDK A;  2B5U A;  4CBC A;  3IFX A;  5CB4 B;  3RGB A;  4CH4 A;  5BR8 B;  1OCO C;  4LF4 B;  3TGU H;  2IU0 A;  3OUS A;  1Q5O A;  1AI6 A;  4BR6 A;  3SYP A;  4GLX A;  2UXC B;  1WPB A;  4DR6 O;  4R50 A;  3AG4 B;  2GV9 A;  4O2A A;  3FD9 A;  1DLB A;  1H2L A;  1MZF A;  4I50 A;  1CEZ A;  1XOU A;  3FB7 C;  2HR3 A;  1R3L C;  1G1X B;  4JAA A;  1EM1 A;  4CC5 A;  2PYJ A;  3ZRV A;  4P9P A;  1HW7 A;  3B8M A;  3ASO B;  3CXC U;  2WLI A;  3AK2 A;  3QVN A;  1FFT B;  1XI1 A;  3L72 H;  3EXA A;  4ZBM A;  2Q7H A;  3EFF K;  3LSU A;  4LF9 O;  5LGU A;  1NBM G;  5FL7 G;  1NTM H;  5LP6 A;  3E89 A;  2BTO A;  3ZED A;  4LFC B;  1JJO A;  1SQV H;  2KKW A;  5KAF Z;  4H0L B;  4JI3 B;  3E35 A;  2EX3 A;  3A8T A;  3CEI A;  1Z5W A;  2CAZ C;  2WA3 A;  3MAQ A;  4X64 O;  2WWW A;  3UO3 A;  5GON B;  3UKM A;  4DR7 O;  3RW0 A;  3H01 A;  2UU9 O;  2VQF O;  1N0J A;  5J2T A;  3ZMV A;  1DK1 A;  4LC1 A;  4E4E A;  1AB3 A;  2VQE O;  1OCR B;  4GZR B;  3CYO A;  5B1B C;  5LP6 B;  3JAK A;  1AI5 A;  3D36 A;  4RO2 A;  2UUA B;  1FD9 A;  3JAL A;  1HWY A;  3CE2 A;  3T4Z A;  1QR8 A;  3SYO A;  3I5D A;  3G71 V;  4LF5 O;  4G27 B;  4JI4 B;  2PF4 E;  5DM6 V;  1CXZ B;  3JAK B;  2OT5 A;  2V4D A;  5EZY A;  1G8M A;  4PDV A;  1NH2 D;  5BMV A;  1XMO O;  5LMN B;  2XAF A;  1SZT A;  2F4V B;  3LDC A;  3ZJZ A;  2CTR A;  1R6T A;  3CCJ V;  1AJP A;  1NVP D;  3ZCC A;  4DR5 B;  1M1K W;  4RQF A;  1IBK O;  3C3T A;  1WB8 A;  3RN4 A;  3H1L H;  1DGS A;  5BMV B;  3CB2 A;  3TXS A;  1KB9 F;  1ZL8 A;  5L3G A;  1MG1 A;  3WB1 A;  4DV5 O;  3CCR V;  3K08 A;  1RSO B;  4DV7 O;  2QM8 A;  3VQY A;  1R73 A;  1BHA A;  4OX9 B;  1SRY A;  1R3J C;  5HFL A;  4K8Z A;  1K5S A;  5E79 Z;  3K5L A;  1XIL A;  3G67 A;  4G28 B;  3ZRX A;  1YHQ V;  2OIG A;  3WB0 A;  3SR2 C;  2E3C A;  5LMU O;  2F93 B;  1FJG B;  1NI8 A;  5K1X A;  2H94 A;  5LXT B;  3QG5 A;  4DR6 B;  1VQ7 V;  4UCT A;  3JAR A;  1JX9 A;  4XDL A;  5KHH A;  5LHI A;  4PA9 A;  2Q7G A;  4KUM A;  3JCZ A;  1XNR O;  4DR1 O;  1FXK A;  1GN3 A;  3E8F A;  3X2Q B;  1Z2G A;  4JZ2 A;  1TAE A;  4QPJ A;  3TK1 A;  1BSM A;  1YJW V;  1GN2 A;  2DYS C;  2VRZ A;  4JI6 B;  1EBO A;  3FB5 C;  1Y6X A;  3QNE A;  3ABL B;  1V55 B;  2YS8 A;  3RYI A;  3JAR B;  2YEV B;  1YTF B;  4Q20 A;  1AR5 A;  4J80 A;  1V55 C;  3BAA A;  2LO1 A;  1PL4 A;  2QEX V;  3STL C;  3EVK A;  1H2N A;  3RYF A;  4DUY B;  3IC9 A;  1VQ5 V;  1K9M W;  3S3W A;  5B3S B;  3H1I H;  5BZB A;  5KHI A;  3CS5 A;  4O2B B;  2VQF B;  3E83 A;  1XHX A;  2YIA A;  3RYI B;  3L9D A;  4UCU A;  4GKK B;  1D2D A;  4JYB A;  2BSK A;  4GUN A;  2WLK A;  4QIW F;  4BW5 A;  5JQG B;  1AP6 A;  3OTF A;  4PJ0 Z;  4PHZ A;  1OV9 A;  4DRX A;  1NT2 B;  4FLV A;  1SKV A;  3DSQ A;  1B6Q A;  2JGD B;  3M8A A;  1UFI A;  2YUA A;  4C7U A;  3CXH F;  3HB3 B;  2EUL A;  4R8C A;  2B9Z A;  2EIN C;  2LW7 A;  2JDI G;  2A06 H;  2WLJ A;  4DO2 A;  4DRX B;  5LHG A;  3AG2 B;  1RPO A;  4B3T O;  4J41 A;  1W2B U;  3KCY A;  4J7Z A;  3K57 A;  3CRM A;  4DV2 B;  2V1D A;  4ZOL A;  4DR2 B;  1N8R W;  2UXB B;  4X1K A;  2R9R B;  5JJN B;  1BHB A;  1QLE B;  4WFF A;  3SYC A;  4I0X A;  3E22 B;  4MW8 A;  4P9O A;  1JPX A;  4RUF A;  4K0K O;  1Y67 A;  1S72 V;  4NTX A;  1Q8I A;  4YXW G;  5JJJ B;  1DTO A;  2F95 B;  1N32 O;  1WP7 A;  3ETD A;  4X1K B;  4UFZ A;  1QVG U;  2RJZ A;  5EC1 C;  1L0N H;  5CA0 A;  4I0X B;  1L8D A;  3HKE A;  2FML A;  4B3R O;  1NJI W;  2QKC A;  5LMU B;  3LUT B;  2QGN A;  2XT9 A;  3JD2 A;  2IJK A;  4FZ0 A;  5KHG A;  4EB6 A;  4B7K A;  4MTF A;  1OHH G;  1XNQ O;  4EFE A;  5EBW C;  1Y76 B;  4PDL A;  1HR0 O;  4CH6 A;  3T1C A;  3J80 N;  2Q69 A;  1SC5 B;  4WCE V;  5LGN A;  4EB6 B;  2OIE A;  2R70 A;  1H8H G;  1N36 O;  3LDE A;  4N21 A;  4I9W A;  1M56 C;  2P90 A;  5EIB D;  4LF6 O;  1PNK A;  5D5Q A;  2WLH A;  4E2L A;  1N34 O;  1KEC A;  3ZHQ A;  3N27 A;  3OR7 C;  3ABK B;  5H6R A;  3SJQ C;  1WP8 A;  3B2E E;  1F4N A;  1XBL A;  3PJS K;  2E5L O;  3G6E V;  1SQP H;  4EFB A;  4DR4 O;  4JYA O;  5FNV A;  4JYY A;  5B1A C;  1JA8 A;  1GKF A;  1AP5 A;  4DV4 O;  4WFH A;  2ZIN A;  2LW1 A;  4TV9 A;  3A0H Z;  5J9P C;  2DW4 A;  1SQQ H;  2UUB B;  1GRJ A;  5TIS Z;  5B5E Z;  1HNW B;  5BXZ A;  3CP1 A;  3ZRW A;  1NTK H;  2DQ0 A;  3TXQ A;  1YVW A;  4JV5 O;  4YJ3 B;  4CH3 A;  4XDJ A;  2FKX A;  3THO A;  5JCO A;  1N4C A;  3OGI B;  3JAW A;  3OR6 C;  1KU9 A;  4A5U B;  5GW7 A;  1S5L Z;  4U3J B;  3BA8 A;  3ZMZ A;  3DTU B;  4IHJ A;  4I5S A;  4NXN O;  3CCV V;  2JS3 A;  4B3T B;  3ZRW B;  3C3S A;  4I4T A;  3CCL V;  4PA3 A;  3AG3 B;  3K06 A;  1NTZ H;  1IUR A;  1WA8 A;  4WF9 V;  3CC7 V;  3L70 H;  1A32 A;  2OTJ V;  2HG5 C;  4IHJ B;  3IJ4 A;  4MSW C;  3G4S V;  2VS0 A;  1J5E B;  1MMM A;  4RUE A;  4GKJ O;  1KUQ A;  4JI8 B;  4NB5 A;  1LUW A;  4IYI A;  4YY3 O;  2P4V A;  1KBH A;  1FXV A;  1US6 A;  4JTC B;  4JI2 O;  2OWO A;  2KSD A;  4X62 O;  1ORQ C;  2EIM B;  1M57 B;  3RYC A;  4D6T H;  4QJF B;  2XHB A;  1TUB B;  4DV3 B;  2XAS A;  2DQ3 A;  4B7E A;  4X66 B;  4D7S A;  3OEE G;  4GX5 A;  3ABU A;  2ZM6 O;  1MZE A;  3N2K A;  3RWR D;  4JGS A;  1K33 A;  2ATK C;  1K7D A;  3ZMU A;  4B08 A;  2OCH A;  4FM2 A;  4FZ1 A;  3O9O A;  1MAB G;  4GX0 A;  5H2F Z;  3ETG A;  4JI5 O;  2QDO A;  1IZ3 A;  5B1O A;  1X4T A;  1Q6U A;  1FYJ A;  2D3O W;  1GMG A;  1BQZ A;  3WG7 C;  1GM9 A;  3L75 H;  4B3S B;  2QE7 G;  3CCM V;  3MD0 A;  2A9H A;  2BOB C;  3OTO O;  1AR1 B;  4X1Y A;  3JAT A;  4BW9 A;  1IBL O;  1IVS A;  4AI8 A;  2ITD C;  1FXH A;  4IL6 Z;  4DV1 O;  1NZ6 A;  4B3M B;  4R7C A;  3SPI A;  1VF6 C;  3SPC A;  3K9A A;  4UCS A;  5DEC A;  2AHZ A;  1O9G A;  4F6E A;  4EKW A;  1I5Y A;  3U10 A;  4RQE A;  5LA6 B;  5A2Q N;  3SPJ A;  2JJ1 G;  3Q4H B;  4LFA O;  3CPW U;  3JAT B;  4HNA A;  2PZS A;  1OZ0 A;  3K79 A;  5JH7 A;  4PEL A;  4O4L A;  5H6Q A;  4YHH O;  3T1Y O;  2Z3Y A;  3GB7 C;  1NU1 H;  2ZT9 B;  4H13 B;  3AG4 C;  2QM4 A;  4LWS A;  4JYA B;  2M7W A;  1SS3 A;  2PY5 A;  1XL6 A;  4MVS A;  2E76 B;  3M99 B;  4X65 B;  4JI1 B;  3DXR A;  1XEQ A;  5JH7 B;  3ASO C;  4UV9 A;  3CMA V;  3QO7 A;  4OGQ B;  4O2A B;  4JI0 O;  4ASU G;  1P4R A;  2P06 A;  1TGO A;  4I50 B;  4LWS B;  1IXM A;  1K73 W;  2YC0 A;  2ZNJ A;  2WLI B;  4WFA V;  1AIL A;  3DXR B;  2AGA A;  3FYI B;  3OW2 U;  1HNZ B;  4L87 A;  2YIB D;  3ZX6 A;  3I56 V;  3CJH A;  4NYK A;  2XAG A;  3K0G A;  2Q5Z A;  1EN5 A;  4FVM A;  1OCR C;  5LP6 C;  2YIC A;  2BCC H;  3OFN G;  4DYL A;  1H38 A;  2RCV A;  2JEU A;  3R65 A;  4OPH A;  4DUZ O;  3CX5 F;  3E8G A;  1VF7 A;  3BPZ A;  2QWN B;  5J2T B;  5JWP A;  2NR5 A;  5D5P A;  4FMT A;  3CJH B;  4XBF A;  3SJC C;  5LYJ A;  2H8P C;  3JAL B;  1BCC H;  1X59 A;  4IT5 A;  2UXD B;  2EIJ B;  3D36 C;  3BA9 A;  1SQG A;  1IXB A;  2E75 B;  1WN7 A;  1WB7 A;  1YIT V;  1MSW D;  1U96 A;  1IBM O;  2JEX A;  4BIZ A;  3HKD A;  1Y66 A;  5EZY B;  1HNX B;  4ABM A;  4JI5 B;  1JVM A;  3CCS V;  2YIB A;  2ILM A;  3RYH A;  3W7W A;  2EIL B;  5EYP A;  1H2S B;  1H2G A;  3AG1 B;  3VOU A;  3NR7 A;  4JI7 B;  4JAV A;  4QPK A;  2KQX A;  3K04 A;  3ASN B;  2YSU B;  3HKD B;  1VF5 B;  5IDJ A;  4O4J A;  4NKG B;  3ML0 A;  4TT3 G;  3T4D A;  4J42 A;  3ASN C;  4Z1V A;  4PA6 A;  1ZL8 B;  4JPR A;  3RYH B;  2RDC A;  1AJQ A;  1QLN A;  5EYP B;  4FM1 A;  4JTA B;  2ZE5 A;  1OCC B;  2X6B A;  3FX7 A;  1PD3 A;  3TJT A;  4LBE C;  3P30 A;  2GBO A;  3B4S A;  3ABM B;  4DV0 O;  2QWQ B;  1YJ9 V;  2WLL A;  5IJ0 A;  2P4K A;  3BY6 A;  4X89 A;  1EZJ A;  1BMF G;  1OCZ B;  5IYB O;  4H33 A;  1VP7 A;  4LF8 O;  1VQN V;  2QWP B;  3HKB A;  3K58 A;  4LFB O;  5KMG A;  2Q6A A;  2PTM A;  4GYC B;  4HAM A;  4JYC A;  1OCZ C;  1S5J A;  2LGW A;  1D5N A;  2Y48 A;  2XTA A;  1NH2 B;  2GUZ A;  5IJ0 B;  3X2Q C;  3K5N A;  2CGN A;  4U7O A;  3U11 A;  3WFV A;  4OXS A;  4O4I A;  2KB1 A;  3CME V;  4LF9 B;  4X9Q A;  1NVP B;  3HKB B;  3ABL C;  3P32 A;  5C8Y A;  2CH7 A;  4FLT A;  1FXK B;  1B06 A;  2ZE7 A;  4BAY A;  4X20 A;  2GUZ B;  1BS3 A;  4AQY O;  4X64 B;  4KXR A;  4DR7 B;  4UXN A;  5A9G A;  1KYO F;  1SQB H;  5B3S C;  1KMI Z;  4O4I B;  2UU9 B;  1K4C C;  4X1I A;  5CA3 A;  1EFR G;  1I7F A;  2YXH A;  1WAZ A;  1WPX A;  3UO2 A;  2VQE B;  3FB6 C;  4CC6 A;  4FJC C;  3B77 A;  4QGP A;  2VWJ A;  3RYF B;  3P3N A;  4FIP C;  4X20 B;  2DYR B;  3JYC A;  2DWD C;  3N2G A;  2EJ7 A;  2FL4 A;  1Q7Y W;  3CSX A;  4PI0 A;  1CP9 A;  3VBB A;  4LF5 B;  1GN4 A;  4X1I B;  4AIL C;  2NN4 A;  3AEI A;  3QO8 A;  1FFX A;  4TV8 A;  2BSK B;  2ZKO A;  4X8A A;  5IT9 N;  1NS1 A;  1XMO B;  2YID A;  4FM0 A;  1M9N A;  3K3W A;  2DE0 X;  1ARO P;  2L6L A;  3SGI A;  5JVD A;  1KKD A;  1SZX A;  4LH7 A;  1QR9 A;  3AG2 C;  3CD6 V;  4J9Y B;  4DK1 A;  4WBN A;  1FFX B;  1IX9 A;  4TOI A;  1I94 O;  2LQT A;  1IBK B;  4TV8 B;  5GTH Z;  2ZDI A;  1F7Y A;  3MHH C;  1EZV H;  4RAI A;  2B1G A;  2W0X A;  1F51 A;  3G6B A;  5CBH A;  1QLE C;  4DV5 B;  1RM1 B;  4PDR A;  3JD4 A;  4DV7 B;  2HLD G;  4MW3 A;  4DK0 A;  2YXL A;  1LUV A;  1S0V A;  2Q7E A;  2XAH A;  1SQF A;  1BE3 H;  3STZ C;  2BTQ A;  1ZWI C;  3G80 A;  4ZOL B;  2WSS G;  2OYQ A;  1NR1 A;  4O4H A;  4CZZ A;  5LBQ A;  4WFB V;  2WPD G;  2EIK B;  2RMK B;  3E86 A;  5KHK A;  3UCS C;  3KCX A;  1VQ9 V;  3LSQ A;  1HP8 A;  1K4D C;  4DV0 B;  3OT7 A;  2BTQ B;  2UUC O;  2ZR3 A;  3C90 A;  1NQT A;  4O4H B;  1BGY H;  2HVK C;  1QQC A;  4JZG A;  4NR1 A;  3K03 A;  4DV6 O;  5CA0 B;  2X7R B;  4U3F H;  3HKE B;  5IWA O;  1XNR B;  4DR1 B;  1P7B A;  4FLU A;  4P30 A;  4P2Z A;  2QKA A;  1WJZ A;  4FFB A;  4NXM O;  4Z1M G;  4KHP O;  1FS0 G;  4YJ2 A;  4LR3 A;  4LNU A;  1ZAU A;  4UB6 Z;  4JAS A;  1QHT A;  4K35 A;  2EZO A;  4NVP A;  3VQW A;  1V9P A;  3ZHT A;  1Z5V A;  2EJR A;  2RNB A;  3ZHR A;  4FLX A;  3OD4 A;  1XL4 A;  3ZS8 C;  2N04 A;  5CBF A;  2LGQ A;  3T1H O;  1HDJ A;  2ZXW B;  1AJN A;  3IGA C;  3AK1 A;  2VWK A;  1B04 A;  2A79 B;  1R1B A;  4MTX A;  1OJH A;  2UXX A;  4LNU B;  5LHH A;  4LF7 O;  3ABT A;  2P7T C;  1Q43 A;  3ABK C;  5J2U A;  4LF4 O;  1Q86 W;  2C2A A;  2P22 C;  5IYZ A;  4I55 A;  3OAA G;  2BOC C;  1XQ8 A;  1SF9 A;  2Y0P A;  1O9H A;  1VQ8 V;  1BL8 A;  2UXC O;  1J95 A;  4PD4 F;  3JAM N;  2YI8 A;  3H1K H;  4PDM A;  2JRI A;  1G6U A;  4PI2 A;  3OMI B;  5AG2 A;  3SPG A;  2BE3 A;  1K5Q A;  2GSM B;  3VQV A;  1THZ A;  5FNV B;  5IYZ B;  1K8A W;  3SYQ A;  2Q73 A;  3CC2 V;  4TV9 B;  2DWE C;  2HHH O;  4FPP A;  4J10 A;  3FKS G;  3ZMT A;  2R9I A;  3MHS C;  2R9A A;  3OMA B;  2XAQ A;  3BEH A;  2JGU A;  4WFE A;  3FAV A;  1AR4 A;  2YI9 A;  3JAW B;  2MK3 A;  1EN6 A;  4LFC O;  1PKX A;  3AG3 C;  3EHB B;  4JI3 O;  2HP8 A;  3BVO A;  1PL0 A;  2F43 G;  4CS4 A;  1EN4 A;  1ROP A;  3T2M A;  1PP9 H;  4K0K B;  3LNN A;  4I4T B;  4ICG A;  5E1A C;  5EIB C;  1JOY A;  5GTI Z;  1WA8 B;  2Q4P A;  3QO5 A;  5C93 A;  1N32 B;  2UUA O;  2QTS A;  5K1P A;  1XHZ A;  2CUG A;  1VQ4 V;  3PN1 A;  2D2C B;  2JS5 A;  1WLE A;  4B3R B;  4JI4 O;  4UUJ C;  4LP8 A;  5KUM A;  3BHP A;  1COW G;  2GTA A;  2EIM C;  2KG7 A;  1M57 C;  2UUC B;  3HR0 A;  2XUM A;  3J7A U;  2CGO A;  4G2K A;  4D7T A;  4YIO A;  2P5O A;  2H3O A;  3D3I A;  5LMN O;  2ZNI A;  1XNQ B;  1N0N A;  2F4V O;  3AG7 A;  4TQD A;  4OPA A;  4BIU A;  2X6A A;  1F4M A;  1HR0 B;  1RFY A;  3RYC B;  4IGG A;  2QM7 A;  1KP3 A;  2KG7 B;  3CC4 V;  5IY5 B;  4DR5 O;  5EBL C;  3N2K B;  1MOF A;  1VQL V;  1R3I C;  4HBN A;  2OCC B;  3D8C A;  4QE9 A;  3CCU V;  4TSF G;  1N36 B;  1ZUQ A;  5IYD O;  3CHX A;  3JD3 A;  3L74 H;  3SJA C;  4LF6 B;  2Y69 B;  2ZD9 A;  1V54 B;  2ZIO A;  4J7K A;  4MVO A;  1JFF A;  4OX9 O;  3JCU Z;  2FTK A;  2Y69 C;  1N34 B;  2ZE8 A;  4X1Y B;  1H8E G;  2CK3 G;  2ZCE A;  1OCO B;  2AHY A;  5H9C A;  1VEW A;  4LF7 B;  1YF2 A;  2E5L B;  1U97 A;  4J9Z B;  3W7U A;  2YDE A;  2LFS A;  3SDL A;  2Q8V A;  3D3Q A;  4CH5 A;  1JCH A;  4YIP A;  4DR4 B;  2N05 A;  1JR9 A;  1R3K C;  2RN9 A;  4DV4 B;  1JFF B;  2CTQ A;  3DC6 A;  2Z5U A;  1FJG O;  4ZIB A;  4HNA B;  4DW1 A;  1P49 A;  3TET A;  3L73 H;  4WFG A;  3JD1 A;  2IJJ A;  4JV5 B;  4O4L B;  1R6K A;  2QTO A;  1I5X A;  4TQF A;  1H2K A;  2QA4 V;  1PNM A;  4EEQ A;  3H9V A;  5CA1 A;  3IAY A;  2HHH B;  4UVC A;  4NXN B;  4JI6 O;  5GON A;  2F66 C;  3BFR A;  1GK9 A;  3F7V C;  1H2M A;  2MW2 B;  4N23 A;  5FPR A;  5KAI Z;  3E8H A;  3OEH G;  5KLV H;  2JIZ G;  3B8N A;  3WU2 Z;  2YXY A;  5L3E A;  4R6Z A;  4DW0 A;  4DUY O;  1JJ2 U;  3K5M A;  2IM9 A;  3LNM B;  5CA1 B;  4Q6G A;  5DED A;  4PV1 B;  5HFM A;  2HVJ C;  5KX5 A;  4TUY A;  5LGT A;  4GKJ B;  5B1B B;  4MS2 A;  4HZ3 A;  2EZP A;  5DN6 G;  4GKK O;  4KL1 A;  4YY3 B;  1VAR A;  2EBO A;  3CWB H;  3O65 A;  1S77 D;  1IDS A;  2PYL A;  5L3B A;  4FLY A;  4JI2 B;  2IJH A;  1VQP V;  1MSD A;  4U7N A;  4X62 B;  2JJ2 G;  5KX5 B;  1RPR A;  4TUY B;  4DR3 O;  2EIJ C;  1P7G A;  2XOK G;  2RQ6 A;  3L71 H;  5F2V O;  1SES A;  2ZM6 B;  3MDS A;  3A2F A;  5KHJ A;  4BIO A;  4FLW A;  5LYJ B;  1CPY A;  5EC2 C;  5JJE B;  1RSO A;  2B1I A;  1I0H A;  1ZLZ A;  2EIL C;  1YTF D;  4DV2 O;  3OTO B;  4DR2 O;  2UXB O;  3AG1 C;  1S76 D;  2IH3 C;  1FKA O;  5IE9 A;  4GX2 A;  4KFM A;  1IBL B;  1QVF U;  4DV1 B;  4ZI7 A;  1VMG A;  4QE7 A;  1WNS A;  1AI4 A;  1QU7 A;  3E8B A;  1YZB A;  4F6R A;  2XND G;  3NXS A;  4RWU A;  1R6N A;  1OCC C;  2HJF C;  4LFA B;  5LXT A;  1E79 G;  1XRE A;  1NR7 A;  2K9P A;  3ABM C;  4O4J B;  3VQX A;  4PA7 A;  3E2E A;  2M6Y A;  4ZI7 B;  2LJ2 A;  4YHH B;  3T1Y B;  2CE4 A;  2OTL V;  1XUQ A;  4MT8 A;  4F6R B;  3K9S A;  1M4U A;  2Q67 A;  4DXW A;  1ZX3 A;  3ETQ A;  4L8J A;  1XMQ O;  1BT8 A;  3HKC A;  4PA4 A;  3ZIA G;  1LNQ A;  4MTG A;  2WLL B;  3UM7 A;  4UCO A;  4UVA A;  2PI4 A;  2ADQ B;  1Q82 W;  2IJI A;  2YEV A;  2NLJ C;  2Q9L A;  1YDX A;  2QKS A;  3JSL A;  3ZHV A;  4JI0 B;  1UJW B;  4K3A A;  3W7T A;  5KMG B;  3R66 A;  1K34 A;  2AW9 A;  1G4Y B;  2DYS B;  4J7J A;  1N33 O;  1YIJ V;  2ETN A;  3HKC B;  3GVM A;  1FXK C;  2PGG A;  2A0L A;  2QWO B;  4O2B A;  3TCU A;  3DC5 A;  5LL6 Y;  3OE7 G;  2G38 A;  1YSC A;  5C8Y B;  1S3J A;  2CH7 B;  4HYO A;  4AHC A;  1BQ0 A;  5JQG A;  5L3C A;  2ITC C;  3UT5 A;  3JSN A;  3KKY A;  1PV0 A;  2JGD A;  1JQ0 A;  1YJN V;  2DYR C;  3H1H H;  1W59 A;  1URF A;  3QF7 A;  4MVR A;  2IU3 A;  4Z2W A;  1T5E A;  1Q81 W;  4DUZ B;  4MVM A;  2PI5 A;  3ZHS A;  3UT5 B;  3BRC A;  3UQ8 A;  3ZBH A;  2QR4 A;  2Q0O C;  3F5W C;  2UUB O;  3N2G B;  1VQ6 V;  1L1F A;  1HNW O;  1SER A;  4GX1 A;  2W6J G;  4DR3 B;  2EIN B;  4NTW A;  2W6I G;  5CN0 A;  5L3F A;  1YI2 V;  1KD1 W;  2CDY A;  1E1R G;  1DF4 A;  1AVM A;  4W4L A;  2Z0A A;  2ZIM A;  1FPO A;  1IBM B;  4H37 A;  3APO A;  3CCQ V;  2HFE C;  3SYA A;  2F1M A;  1ZSP A;  3E22 A;  3CCE V;  4X88 A;  3F7Y C;  3DGE A;  4LH6 A;  5JVD B;  2DN9 A;  3W7X A;  1GM8 A;  1KP2 A;  2E74 B;  4ZHQ A;  3RVY A;  1PPJ H;  2W0F C;  4WBN B;  1RM1 C;  3HPL C;  4FFK A;  1GO3 F;  4JAU A;  2DMX A;  1YCI A;  2UXN A;  5KUK A;  5FLX N;  3OUF A;  2GTS A;  2QWR B;  1GTO A;  2ADP A;  2Q0A A;  1J5E O;  3H1J H;  2ZDI C;  5KA6 A;  3CRC A;  1K3E A;  4JI8 O;  3RT3 C;  1NKD A;  2EIK C; 
#chains in the Genus database with same CATH homology
 3L75 H;  3H1L H;  1BE3 H;  1SQV H;  3L74 H;  1KYO F;  3TGU H;  1BCC H;  3BCC H;  1KB9 F;  4D6T H;  1PPJ H;  1SQX H;  4PD4 F;  1NTK H;  1PP9 H;  2BCC H;  1L0L H;  2FYU H;  1BGY H;  2A06 H;  1NTZ H;  2IBZ H;  3H1K H;  3L72 H;  1L0N H;  1EZV H;  3L71 H;  3L70 H;  3H1J H;  3L73 H;  1SQQ H;  4U3F H;  1SQP H;  3CX5 F;  3H1I H;  5KLV H;  1NTM H;  1P84 F;  3H1H H;  3CWB H;  1NU1 H;  1SQB H;  3CXH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...