3H1LH

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1lH00
3H1HH 1SQBH 2FYUH 3L72H 3L74H 1NU1H 3H1KH 1L0LH 1NTZH 1SQVH 2IBZH 1SQPH 2BCCH 3L75H 1SQQH 3L70H 3L71H 3CX5F 1L0NH 1NTMH 5KLVH 1BGYH 3BCCH 3H1JH 3H1LH 3TGUH 3L73H 1EZVH 1BE3H 3CWBH 1BCCH 1NTKH 1P84F 1SQXH 3CXHF 3H1IH 4U3FH 4D6TH 2A06H 1KB9F 1PP9H 4PD4F 1PPJH 1KYOF
chains in the Genus database with same CATH superfamily
3APQA 4K0KO 3M99B 3TCUA 3CSXA 3IFXA 3A2FA 4XBFA 2WPDG 1IBLO 3CYOA 1YIJV 3JATA 2B5UA 2MW2B 1NR1A 3SYPA 3STZC 1ZL8B 1SZTA 4B3RO 5CMUA 3OUFA 3OTOO 2WLIB 4EKWA 3CD6V 2HEPA 5LYJA 3G4SV 2JGDA 1Q90D 3WB1A 2DWDC 4LFBO 1FAFA 1FXHA 4PI0A 2JJ2G 4KXRA 1FXKA 2NR5A 2RCVA 4F6RA 1BE3H 1YF2A 1Q86W 5IWAO 3TK1A 5IJ0A 3BA8A 4JI5B 3H01A 5JJNB 1M56B 2XTAA 5IE9A 2IM9A 5JQGB 3OEEG 1TAEA 1XNRB 1OCOC 3CCSV 2HJDA 3P3NA 2WLJA 2EJ7A 2FB5A 3OW2U 4UCOA 3LSQA 4W4KA 2YI8A 3RYHA 3OT7A 1JPXA 1GN4A 3OMIB 2Q7EA 1R73A 3K5NA 4GLXA 3PN1A 1WAZA 3GWKC 3ZHVA 1MG1A 3KCXA 1L0LH 4NXNB 2Z3YA 1GM8A 2YEVB 3SPHA 4XDJA 4Q6GA 4BIZA 3OAAG 1M1KW 1PD3A 5J2UA 2NN4A 3RVZA 2ZIMA 3AG2C 3LSUA 1L0NH 5CA1B 3ZRWA 1LUVA 2ATKC 2ZD9A 3DXRA 4PHZA 3K03A 4B08A 2GHYA 4BIUA 1S0VA 3J7AU 1K73W 2W6JG 2F66C 2CTRA 4LFCB 1HNXO 3K79A 3CB2A 3H9VA 4LF4O 2DE0X 3FYIB 1GM7A 2PY5A 1GN6A 3AG2B 4DV1B 3OR6C 5KAIZ 3JAKB 2LW7A 1VMGA 4FVMA 4LWSB 2IH3C 1QR8A 3A0BZ 1JCHA 1QR9A 2ZCEA 2BOBC 3UT5A 1VQKV 3ZHTA 3K9AA 4UV8A 2B1IA 5LXTA 5H6RA 1N36B 4UCRA 1OHHG 4JI7O 5LL6Y 3U0ZA 3CE2A 3JD0A 4MVMA 4YY3B 4OPAA 5KA5A 5LMNO 2ZE6A 3FAVB 4RQEA 1I94B 3AK1A 1ZWIC 1DK1A 4O4IB 4GZRB 4KUMA 3EFFK 4JI2B 5LP6A 2UU9B 4I50A 3FB5C 3ZS8C 3QO8A 1F4MA 2HP8A 4UVAA 3AG3C 1SQGA 2RJZA 3DC6A 4FM2A 1FPOA 1Q8IA 3ZMTA 4JV5B 5JH7B 4JASA 1H2MA 5IYDO 5LGTA 3T1YO 3HR0A 3LDEA 2OCHA 3AG3B 1GO3F 2F4VO 3E8FA 4J9YB 2EILC 5B5EZ 1VQ8V 4L8JA 5CA0A 4DRXB 2OT5A 1IXBA 2FYUH 3KG2A 2GUZB 3NXSA 4CBCA 4DV3B 3MHSC 3E2EA 2WA4A 3T4ZA 3SPCA 2UUBB 4F4LA 4JI8B 1IXMA 2Q73A 2UUAO 3LNMB 1ENVA 5EIBC 2CH7B 4MTOA 2EILB 2QKSA 4QJFB 2X7RB 1Q82W 3UO3A 4EB6B 3OD4A 4LR3A 1XL4A 5IT9N 5BR8B 4GKKB 5K1PA 2O57A 1JR9A 5EBMC 1I08A 4LF8O 1N0JA 2IJKA 1IBMO 1IBKB 4DO2A 3WFVA 4D7SA 4LF5O 4RO2A 4U3JB 3I56V 2Z0AA 1BQ0A 4X65O 1SA0B 2V1DA 5GTHZ 4B3MO 2GTSA 4PA4A 5EIBD 1N33O 2YS8A 1VQ4V 1QVGU 4K0KB 1NR7A 5L3CA 1PNKA 3O9OA 5L3BA 1EN6A 1IBLB 2A3QA 4TUYB 1EM1A 4X1YA 4KHPO 3B4SA 2Y0PA 1NZ6A 4IT5A 5EC2C 1B04A 2BE3A 2BTQB 1BS3A 1H38A 1XREA 3OTOB 5FNVB 1KU9A 1YXBA 4WFHA 5BXZA 2YXHA 1FFTB 1XDCA 4ZHQA 3BRCA 2A9HA 3APOA 2JGUA 2CTPA 1Q3EA 3D36A 4LFBB 1K92A 5FL7G 1SQXH 1CXZB 1GRJA 1SQBH 3L74H 4TV9B 1ZAUA 4LF6O 3DC5A 2OCCC 3BAAA 4A5UB 5IWAB 3MDSA 1QVFU 1RSOA 2QWQB 4CH5A 1OCCC 4IHJB 4DV7O 3K06A 3BFRA 1SS3A 5FPRA 1DF5A 2ILMA 5JVDA 2OTLV 2KKWA 3SPGA 1HNWO 5BY1A 3H1KH 4J7JA 1AI6A 4JI4O 5KA6A 5IYZA 1I0HA 2OCCB 1GK9A 1RPOA 3CJHA 1XMOB 4FLWA 3O65A 1UPGA 1Y74B 2DYSC 2H94A 3RWRD 5IJ9B 3ICXA 3SYAA 1OCCB 3OMAB 3VQYA 2IJHA 5LA6B 1YJ9V 1YJNV 5FPOA 4QE9A 1EZVH 3BA9A 4TSFG 3SYCA 3K5MA 4GX5A 3SPIA 3CPWU 4WBNA 5CB4A 5KHHA 2P5OA 3F5TA 4I7ZB 2DYSB 3LDCA 2UXNA 3B8MA 1AJQA 1BT8A 5F2VO 4JZ2A 2HKOA 2WLNA 1R6TA 1KECA 5EC1C 3WB0A 4B3TO 1HNXB 2ZE5A 3JARA 3N2KB 1D5AA 4I0XB 2QTOA 4LF4B 1QLEC 1Q6IA 2UXCO 3Q4HB 2F23A 3P32A 1Y66A 2EIMC 1K5QA 1SF9A 1AR1B 2CTWA 1NJIW 1ORQC 1SZXA 4B7KA 1JJ2U 1L8DA 4J80A 2X6CA 1IX9A 2Q9LA 2ZNJA 1AJNA 1MSDA 3M7MX 3OGCC 2QWPB 1IDSA 3UQ8A 4JI7B 1NBMG 2EIMB 1H2SB 2V4DA 3JASA 4OGQB 1XUQA 5IY5C 5LMNB 3E89A 1W0JG 5KX5B 4LBEC 1F23A 2HHHB 1Q6UA 1XL6A 4J7KA 4CC6A 1PPJH 4AILC 2CDYA 3OUSA 4DXWA 5CA3A 4X62O 2F95B 3VQWA 2JJ1G 1TGOA 4I9QA 1AR4A 4O2BA 4OPHA 1COWG 1EZJA 1FS0G 5JQGA 1OCZC 1VQPV 3OGIB 4U3FH 4HYOA 2XAQA 3ETGA 3HB3B 4O4LB 4PDMA 3OTFA 3IGAC 2F4VB 2LP7A 4H33A 4WFEA 4GX1A 3W7UA 3ZMUA 3CCMV 4HNAB 5C8YB 3RYFB 1OCZB 2WSSG 3JYCA 5EBWC 1PP9H 2UUAB 3RVYA 1AB3A 3L72H 3N27A 3QG5A 3VOUA 5B1BC 3UCSC 5HFMA 3FX7A 4X20A 4LF9B 3HKBA 2XUMA 3JAWB 1FYJA 3OEHG 3SYQA 3AK2A 2WLLB 2CUGA 1GKFA 2Q8VA 2ZQMA 3KKYA 3ZHUA 3W7XA 4GKJO 2YIBD 3CCUV 1GMGA 4G27B 4J7ZA 5LMUO 5LOVA 3W7TA 4LF8B 3JAKA 1WP7A 2QWOB 5EBLC 4BAYA 2NLJC 1IBMB 3CRQA 2GTAA 2KG7B 1M9NA 3OR7C 4ZOLB 1R6NA 3QF7A 4K8XA 5H6QA 4X65B 4X8AA 1MOFA 4B3MB 3DGEA 2EBOA 5JCOC 5EK0A 3ZN0A 5KMGA 3SYOA 4ASUG 3ASOC 2IBZH 4IYIA 5EYPB 3FAVA 1SQFA 1EBOA 5TISZ 1DGSA 1HNZB 4NYKA 5FLXN 1MMMA 3K08A 4LNUB 1M56C 5J2TB 3F5WC 3ASOB 1AR5A 3CXCU 3QO7A 5IYCO 4K8ZA 2JS3A 4DV5O 4UUJC 4RQFA 1N32O 1LUWA 4O2AA 3CX5F 4KL1A 4LF6B 4OX9O 3K3WA 2EX3A 4JTDB 1WA8B 3H1IH 5JH7A 2HFEC 1TUBA 1AJPA 4ZIBA 1NQTA 1QLNA 1F7YA 4NXMO 1HNWB 3ETEA 1HP8A 3GWOA 3TXQA 4WFAV 4JI4B 2PYLA 4DRXA 1KKDA 2GUZA 3IJ4A 3LNNA 3JCUZ 4GCZA 4NTWA 4DV2O 4KP4A 4O4JA 3ABLB 3WB2A 4YJ2A 1KYOF 4DR4O 1QQCA 3W7SA 1R1BA 3E86A 2W0FC 2CH7A 3ABUA 1Q81W 2X6BA 1L1FA 2K9PA 4XDLA 1TVKA 2QGNA 5KHJA 1R3JC 2L35A 1M4UA 4BR6A 4MTXA 5KUMA 5E1AC 3KZIZ 3K04A 4FLVA 5DEDA 1VARA 4JZGA 5H2FZ 3THOA 4PA3A 2LFSA 1HWYA 2Y69C 1NTZH 4B3TB 2RMKB 3U11A 2H8PC 4LFAB 1S76D 2OIEA 2YSUB 2ZT9B 2UXCB 3FB7C 4J9ZB 3BABA 3HKDB 3C3SA 1NTMH 4U3JA 1K7DA 5HFLA 1BCCH 1VQLV 1P84F 3TJTA 4D6TH 4P30A 4U7OA 2Q4PA 4MW8A 3JD1A 4PA7A 2PI4A 2Y69B 5EZYA 2CGNA 3JAMN 2BCCH 1JVMA 2Y0IA 1BZKA 4JYAO 4I55A 4DR3O 3S3WA 3SDLA 3W7WA 1BHAA 1IURA 5H5NA 4BIOA 4JI6O 5FNVA 2UXBO 1K8AW 1W59A 1AILA 3JALA 5BZBA 5BMVB 1Y6XA 1Y76B 4BW5A 2BSKA 3RW0A 3ZMZA 4JYYA 5B1AB 3RFRA 1FD9A 1VQ9V 3U10A 1N4CA 3ETQA 1JA8A 4X62B 3IC7A 4IIJA 3E83A 3ZRXA 1YEWA 2XAJA 3RYIB 3G6BA 1JX9A 4BW9A 1PV0A 2UXDO 4NVPA 2WAMA 4WF9V 3F7YC 1SESA 4ZI7A 4X1IA 1KP2A 2EINC 3SGIA 2CK3G 4PDVA 3CCQV 1WB7A 1RP3B 1Y74A 1BL8A 4QPJA 3H1LH 4DR2O 1GM9A 3EHBB 1FXKB 3A0HZ 2HLDG 5E79Z 1VQOV 2QKAA 2YC0A 2R9AA 3ZBHA 5IJ0B 1YHQV 1MZFA 1YTFB 4ZKIA 4RUEA 4JTAB 2EINB 3OFNG 4EFBA 2W6IG 4O4HB 4TQFA 3HKEA 1VP7A 3ABMC 1GN2A 4PDLA 2RDCA 3JD3A 1MA1A 4AQYO 2JS5A 2LFRA 1WB8A 5J9PC 3B09A 5GONB 2B1GA 1YTFD 5IYBO 4CS2A 2Q7GA 4I0XA 2YICA 4GKJB 4NR1A 5LMUB 1YJWV 3Q4HA 2QEXV 2OTJV 1YCIA 3ABMB 5KHGA 3AEIA 2ARHA 1YITV 1VQ7V 4H37A 3DXRB 1KQSU 2AZ2A 4X1KA 2ODMA 2R9RB 1FFXB 1F51A 3R66A 3FFQA 3RYCA 4DR7O 2F43G 2DWEC 3MD0A 1NH2B 1I5YA 4WFBV 1NT2B 1XHXA 2CE4A 2QTSA 3LDDA 1RPRA 4IYHA 4JI0O 1MSWD 4UCTA 1R3IC 5A2QN 3CC7V 3QVNA 1KKCA 2ETNA 2BOCC 4X66O 4B3RB 1SQPH 4J42A 2K1EA 4JYBA 3UT5B 4XDKA 1NH2D 1K4DC 4DYLA 2YIAA 3ZHRA 1XOUA 1K97A 1VF5B 3J80N 3OM3B 2KQXA 3E35A 4R7CA 4Z1MG 5LP6C 5A9GA 3JCZA 4DV5B 2KB1A 3K57A 1N32B 4OX9B 1VQ6V 2QJ1A 3F7VC 1VF6C 2R72A 3CS5A 4J10A 1J95A 4R8CA 1JOYA 4O4LA 3D3IA 1ZLZA 3CCRV 1VQ5V 1KUQA 5LP6B 5GW7A 2P90A 3STLC 5KUKA 1WN7A 1K34A 3ZMVA 3RYFA 4DV2B 1AP5A 4DV4O 4JGSA 4DR6O 3NR7A 4FLUA 3WU2Z 4FFKA 2YIBA 3K0GA 2CGOA 3C90A 2N04A 2P6JA 4MVRA 3G67A 4IL6Z 4EFEA 1ZTEA 3H1JH 3TGUH 4DK0A 3JAWA 1U97A 1N34O 2VWKA 5LHIA 3PJSK 1RFYA 2DQ0A 1IZ3A 1SETA 3DTUB 4FFBB 4MVUA 2P67A 3BEHA 5CA0B 1KC8W 3HKCB 4UCSA 2E3CA 4MW3A 4LH7A 1I7FA 4CS3A 1HR0O 4N21A 1W0KG 3LSSA 4FK5C 1J5EO 3SJCC 1M90W 1VQMV 2KG7A 3CEIA 4LP8A 2E76B 1Z5VA 3FB8C 1GAXA 5L3FA 5AG2A 2W0XA 1T5EA 4FMTA 2JDIG 2JVDA 3CRAA 2JEXA 1I5XA 2Q68A 1PNMA 4P9PA 4LF7O 1RM1C 4DUYO 5EYPA 4JYAB 2WA3A 3IC9A 4LH6A 3B2EE 4DR3B 2MK3A 4PJ0Z 1ZL8A 2DW4A 1O9HA 1PL0A 1WJZA 4Q20A 1B6QA 2KSDA 4MVZA 4MTGA 5CBHA 2HVJC 2WLIA 2JIZG 4NKGB 4JYCA 3L9DA 2JK5C 5J2TA 1ZUQA 1RM1B 5ITZB 3K58A 4B7EA 4MS2A 4DK1A 4UFZA 2R9IA 4GX0A 4N23A 1X4TA 2GDSA 4X1YB 4QE7A 1VIBA 3AG4B 1WA8A 1E1QG 1I94O 2NNUA 2GBOA 3JSNA 3ZN1A 3L73H 1S5LZ 1OZ0A 3C3TA 4FPPA 4CH4A 3SJAC 2QKCA 4ZHQB 2A06H 2D3OW 3T1YB 1S5JA 1S77D 2GV9A 1K9MW 4MVSA 5D5QA 1HDJA 3T1HO 3LUTB 2PYJA 3N2GB 3BVOA 4DR2B 2FTKA 2E5LO 5D5PA 4PDRA 4YIOA 4QPKA 1B3QA 2P22C 4FLYA 4JV5O 1KP3A 1Y67A 4P9OA 1RSOB 1YVWA 4FM1A 1GTOA 2YEVA 4AI8A 4OXSA 4HBNA 2YXYA 4FZ0A 5JVDB 1FKAO 5CA1A 4HAMA 3BPZA 5IYZB 3I55V 3D8CA 5DECA 4AQYB 4UB8Z 3CRRA 1SKVA 3ABTA 3VQXA 5KLVH 2VQEO 2YDEA 5CN0A 1E79G 1QHTA 4MVQA 1R6KA 4ICGA 3HKDA 4D7TA 3B8NA 3FD9A 4B3SO 4MVOA 4UCUA 2N05A 2ADPA 4LC1A 4WBNB 1ZX3A 4LWSA 5CB4B 1PNLA 3QO5A 4LF5B 2P7TC 3D3QA 4DR5O 4NTYA 5L3DA 1NTKH 2ITCC 4QNHB 4DR7B 4U7NA 2UXXA 1MZEA 3FB6C 1N33B 3ETDA 4P2ZA 4RWUA 4NB5A 2RNBA 2EIJC 4E2LA 4JI0B 2Q69A 1ZSPA 4KHPB 4YJ3B 2ZDIC 2ZR2A 3WG7B 1JFFB 2D2CB 3IAYA 1Y4MA 4X66B 3BCCH 2CAZC 1Y76A 4LCUC 4O4IA 2LW1A 4R50A 4DV6O 1G4YB 3RT3C 5GTIZ 4UCVA 2EIJB 3BHPA 4I5SA 3JASB 1AI5A 1K33A 1EN4A 3RYIA 1OJHA 1ROPA 3E22B 3VQVA 3ABLC 1CP9A 3K5LA 4DV7B 3DSQA 4WFFA 3R65A 5KHKA 1WNSA 1LR1A 1B06A 2PI5A 3BY6A 2G38A 3RN4A 4I4TB 5K1XA 4TV8B 2PZSA 2QDOA 4MTFA 4DV4B 4DR6B 4O2BB 2YIDA 2IU3A 2Q67A 3UKMA 3JD4A 5L3GA 5C93A 4O4HA 3ZRVA 1XQ8A 2R70A 2WWWA 1N34B 2OIGA 1XMQO 2WLMA 3OMNB 5KAFZ 2X0LA 4EB6A 1XMOO 3CXHF 5GONA 1YDXA 1NVPB 1M5IA 1V9PA 2HR3A 3H1HH 1HR0B 4K3AA 1WPXA 1OCOB 1W2BU 3T1CA 1J5EB 4PA9A 1P4RA 4CZZA 3QTCA 3GVMA 3RBZA 1FXVA 2P06A 2Q6AA 2ZIOA 4X20B 3HKBB 3K9SA 3A8TA 3UO2A 4JI3O 1YZBA 1PKXA 1FFXA 1SA0A 2LGWA 1NVPD 1PL4A 5CBGA 2F93B 1KBHA 1PM9A 4Z1VA 4LF7B 4F6EA 4YIPA 3AG1C 4UVCA 2ZXWC 4QGPA 5LOVB 2QM8A 4DUYB 2Y4TA 4TUYA 4UVBA 5B1AC 2A0LA 1XI1A 3ZCCA 1IVSA 1D2DA 4YHHO 2BTQA 1OCRC 2FMLA 4KFMA 2PTMA 4PD4F 2IW5A 1UJWB 1SERA 4IGGA 2EZPA 3AG1B 4GYCB 2ZXWB 4DV0O 1US6A 2XASA 5B1OA 1FJGO 3M8AA 2QR4A 5KMGB 3ZEDA 4DUZO 4TV9A 2YXLA 3ZIAG 4HZ3A 4YXWG 1OCRB 2HJFC 3JATB 1JMKC 1BQZA 4R6ZA 4K35A 2LJ2A 2OWOA 1N8RW 1FXKC 4IHJA 2VS0A 1SQVH 1KD1W 2HHHO 3P3PA 1OV9A 4FJCC 1XHZA 3E8HA 5LYJB 2PGGA 2ZR3A 2JGDB 1A32A 1N0NA 4X64O 4JTCB 1DLBA 4WFGA 1EN5A 1WLEA 2Q0OC 4JAAA 3T1HB 2RQ6A 3MAQA 4O2AB 1VF6A 5IJ9A 2E5LB 3CCJV 3CCVV 4CS4A 1WP8A 2C2AA 4F6RB 5LA6A 1TUEB 1P49A 1TUBB 2VQFO 2RN9A 3L70H 1JJOA 3G71V 3CCEV 3HPLC 4G2KA 4MT8A 1SC5B 4FFBA 3B40A 3HKCA 4DW1A 3RYHB 4DR1O 3CC2V 2IH1C 1QCEA 3K59A 1AROP 2UUCO 2LQTA 4O4JB 4YJ2B 2DJVA 5DN6G 2VQEB 1O9GA 3N2KA 2HVKC 4ZBMA 1MNGA 2FKXA 3B77A 1F4NA 4LF9O 2EZOA 4PA6A 4B3SB 5H9CA 2QA4V 3JD2A 1TVKB 1M57C 5J2UB 3ZRWB 2XT9A 4TQDA 4JI1O 1R3KC 4DR5B 1QBZA 2ZE8A 1XEQA 3CCLV 1Q7YW 2XNDG 2JRIA 1X59A 2ZM6O 1S3JA 5LGNA 2WLKA 2X6AA 2OYQA 1M57B 1V55C 2YI9A 5LGUA 4ABMA 1AP6A 5KX5A 1XILA 1Q5OA 1G1XB 3E8GA 1Q6HA 1BSMA 3J81N 2CTQA 1HNZO 5EZYB 4W4LA 1XNQO 5ITZA 4DV6B 1BHBA 5B3SC 5LXTB 2QM4A 4JAUA 5IDJA 1V55B 2DYRC 4QIWF 4G28B 4I55B 4RAIA 1AI4A 1CPYA 1GN3A 3SJBC 1DF4A 2A7WA 3SPJA 5LHGA 1URFA 1DTOA 3JALB 5B3SB 2EIKC 1BGYH 3ZX6A 4GUNA 2DOSA 2BSKB 4EEQA 3S3XA 3EVKA 2DYRB 4GX2A 3MHHC 4NXMB 4I50B 3L75H 2IJIA 3N2GA 1S72V 2GSMB 4CC5A 2IJJA 2QSAA 2VRZA 3I5DA 4HNAA 1G8MA 2FL4A 5C8YA 4IIJB 1P7GA 1THZA 2L6LA 5B1NA 4AHCA 4JI5O 1H2KA 3CC4V 2QM7A 4DR4B 1NI8A 4JPRA 4FM0A 2EIKB 2QE7G 1XNRO 2EULA 4ZI7B 4X1IB 4FZ1A 1XMQB 4TWKA 4NTXA 3FKSG 3UM7A 3T4DA 2E74B 1K3EA 2WLLA 1Q43A 1M93A 5DM6V 4J11A 3ZMSA 3TXSA 4H0LB 1GH6A 3FYEB 3KCYA 2F1MA 2BTOA 3CMAV 4NXNO 3AK3A 4CH3A 2LO1A 3AG7A 4UXNA 2N74A 2V7QG 2Q0AA 1K5SA 1HW7A 1K4CC 4WCEV 3ML0A 4X89A 4ZOLA 1R3LC 3HKEB 4JI3B 2XAHA 1G6UA 1H2GA 3ZJZA 1QNMA 2PF4E 2M6YA 2AW9A 1AI7A 4LFAO 4LFCO 4UV9A 3P30A 1LNQA 3CRCA 2M7WA 4MSWC 1S5HC 5CBFA 4DV1O 1P7BA 1E1RG 2Q7HA 3CHXA 2A79B 4YJ3A 4X9QA 1JFFA 3CRMA 2B9ZA 5LBQA 4YHHB 3T2MA 1KMIZ 4BWAA 4JI6B 2UXBB 3AG4C 5JCOA 4X1KB 4FIPC 4LNUA 2ITDC 4DW0A 2QWNB 1QLEB 3RYCB 3K5OA 2P4VA 4DV0B 2WLHA 4RUFA 4UB6Z 1N36O 1FJGB 2XAGA 4YY3O 2ZDIA 2AZ0A 4DUZB 3G80A 4PELA 1QU7A 3D36C 2H3OA 3ABKC 1H2LA 2XHBA 1AVMA 3E22A 1YI2V 5JJJB 3SR2C 3JSLA 3SJQC 2AHZA 3OE7G 4JAVA 5LHHA 1EFRG 4C7UA 2XAFA 2ZE7A 4TT3G 1H8HG 2UXDB 4TOIA 2LGQA 1WPBA 4E4EA 4PV1B 2QWRB 4JI2O 2UU9O 2Z5UA 1YSCA 1MABG 2IU0A 4PI2A 5IY5B 1VF7A 4X64B 4I4TA 2Y4UA 4TV8A 3ABKB 3E8BA 2AGAA 5B66Z 1H2NA 2ZINA 4GT1A 2Q5ZA 3K0DA 2YUAA 4J41A 2DMXA 2ZKOA 3CWBH 3RGBA 1JQ0A 5JWPA 2VQFB 5KHIA 2VWJA 4Z2WA 1NS1A 2XOKG 2AHYA 3ZHQA 1NU1H 2ZNIA 1XBLA 3ASNC 4L87A 2ADQB 2AXTZ 4DV3O 4DR1B 3CMEV 1D5NA 3CJHB 2UUCB 3X2QC 4FLTA 2UUBO 1NKDA 4JI8O 2DN9A 2PUSA 2Y48A 4I9WA 4H44B 3QNEA 3TETA 1UFIA 3ASNB 4H13B 1TA8A 3VBBA 1Z5WA 4FLXA 1VEWA 2HG5C 1SQQH 4CH6A 1CEZA 3L71H 5JJEB 2DQ3A 4JI1B 1Z2GA 3WG7C 3X2QB 2EJRA 2E75B 1BMFG 1V54C 3CP1A 5BR8O 4GKKO 1U96A 5B1BB 1VQNV 2ZM6B 1SRYA 3JARB 5L3EA 4FLZA 1IBKO 4JF3A 3G6EV 3ZRSA 3A0RA 2JEUA 4X88A 5BMVA 3EXAA 2P4KA 1V54B 3ZHSA 1H8EG 1KB9F 3GB7C 1XNQB
chains in the Genus database with same CATH topology
3H1HH 1SQBH 2FYUH 3L72H 3L74H 1NU1H 3H1KH 1L0LH 1NTZH 1SQVH 2IBZH 1SQPH 2BCCH 3L75H 1SQQH 3L70H 3L71H 3CX5F 1L0NH 1NTMH 5KLVH 1BGYH 3BCCH 3H1JH 3H1LH 3TGUH 3L73H 1EZVH 1BE3H 3CWBH 1BCCH 1NTKH 1P84F 1SQXH 3CXHF 3H1IH 4U3FH 4D6TH 2A06H 1KB9F 1PP9H 4PD4F 1PPJH 1KYOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H H;  1SQB H;  2FYU H;  3L72 H;  3L74 H;  1NU1 H;  3H1K H;  1L0L H;  1NTZ H;  1SQV H;  2IBZ H;  1SQP H;  2BCC H;  3L75 H;  1SQQ H;  3L70 H;  3L71 H;  3CX5 F;  1L0N H;  1NTM H;  5KLV H;  1BGY H;  3BCC H;  3H1J H;  3H1L H;  3TGU H;  3L73 H;  1EZV H;  1BE3 H;  3CWB H;  1BCC H;  1NTK H;  1P84 F;  1SQX H;  3CXH F;  3H1I H;  4U3F H;  4D6T H;  2A06 H;  1KB9 F;  1PP9 H;  4PD4 F;  1PPJ H;  1KYO F; 
#chains in the Genus database with same CATH topology
 3APQ A;  4K0K O;  3M99 B;  3TCU A;  3CSX A;  3IFX A;  3A2F A;  4XBF A;  2WPD G;  1IBL O;  3CYO A;  1YIJ V;  3JAT A;  2B5U A;  2MW2 B;  1NR1 A;  3SYP A;  3STZ C;  1ZL8 B;  1SZT A;  4B3R O;  5CMU A;  3OUF A;  3OTO O;  2WLI B;  4EKW A;  3CD6 V;  2HEP A;  5LYJ A;  3G4S V;  2JGD A;  1Q90 D;  3WB1 A;  2DWD C;  4LFB O;  1FAF A;  1FXH A;  4PI0 A;  2JJ2 G;  4KXR A;  1FXK A;  2NR5 A;  2RCV A;  4F6R A;  1BE3 H;  1YF2 A;  1Q86 W;  5IWA O;  3TK1 A;  5IJ0 A;  3BA8 A;  4JI5 B;  3H01 A;  5JJN B;  1M56 B;  2XTA A;  5IE9 A;  2IM9 A;  5JQG B;  3OEE G;  1TAE A;  1XNR B;  1OCO C;  3CCS V;  2HJD A;  3P3N A;  2WLJ A;  2EJ7 A;  2FB5 A;  3OW2 U;  4UCO A;  3LSQ A;  4W4K A;  2YI8 A;  3RYH A;  3OT7 A;  1JPX A;  1GN4 A;  3OMI B;  2Q7E A;  1R73 A;  3K5N A;  4GLX A;  3PN1 A;  1WAZ A;  3GWK C;  3ZHV A;  1MG1 A;  3KCX A;  1L0L H;  4NXN B;  2Z3Y A;  1GM8 A;  2YEV B;  3SPH A;  4XDJ A;  4Q6G A;  4BIZ A;  3OAA G;  1M1K W;  1PD3 A;  5J2U A;  2NN4 A;  3RVZ A;  2ZIM A;  3AG2 C;  3LSU A;  1L0N H;  5CA1 B;  3ZRW A;  1LUV A;  2ATK C;  2ZD9 A;  3DXR A;  4PHZ A;  3K03 A;  4B08 A;  2GHY A;  4BIU A;  1S0V A;  3J7A U;  1K73 W;  2W6J G;  2F66 C;  2CTR A;  4LFC B;  1HNX O;  3K79 A;  3CB2 A;  3H9V A;  4LF4 O;  2DE0 X;  3FYI B;  1GM7 A;  2PY5 A;  1GN6 A;  3AG2 B;  4DV1 B;  3OR6 C;  5KAI Z;  3JAK B;  2LW7 A;  1VMG A;  4FVM A;  4LWS B;  2IH3 C;  1QR8 A;  3A0B Z;  1JCH A;  1QR9 A;  2ZCE A;  2BOB C;  3UT5 A;  1VQK V;  3ZHT A;  3K9A A;  4UV8 A;  2B1I A;  5LXT A;  5H6R A;  1N36 B;  4UCR A;  1OHH G;  4JI7 O;  5LL6 Y;  3U0Z A;  3CE2 A;  3JD0 A;  4MVM A;  4YY3 B;  4OPA A;  5KA5 A;  5LMN O;  2ZE6 A;  3FAV B;  4RQE A;  1I94 B;  3AK1 A;  1ZWI C;  1DK1 A;  4O4I B;  4GZR B;  4KUM A;  3EFF K;  4JI2 B;  5LP6 A;  2UU9 B;  4I50 A;  3FB5 C;  3ZS8 C;  3QO8 A;  1F4M A;  2HP8 A;  4UVA A;  3AG3 C;  1SQG A;  2RJZ A;  3DC6 A;  4FM2 A;  1FPO A;  1Q8I A;  3ZMT A;  4JV5 B;  5JH7 B;  4JAS A;  1H2M A;  5IYD O;  5LGT A;  3T1Y O;  3HR0 A;  3LDE A;  2OCH A;  3AG3 B;  1GO3 F;  2F4V O;  3E8F A;  4J9Y B;  2EIL C;  5B5E Z;  1VQ8 V;  4L8J A;  5CA0 A;  4DRX B;  2OT5 A;  1IXB A;  2FYU H;  3KG2 A;  2GUZ B;  3NXS A;  4CBC A;  4DV3 B;  3MHS C;  3E2E A;  2WA4 A;  3T4Z A;  3SPC A;  2UUB B;  4F4L A;  4JI8 B;  1IXM A;  2Q73 A;  2UUA O;  3LNM B;  1ENV A;  5EIB C;  2CH7 B;  4MTO A;  2EIL B;  2QKS A;  4QJF B;  2X7R B;  1Q82 W;  3UO3 A;  4EB6 B;  3OD4 A;  4LR3 A;  1XL4 A;  5IT9 N;  5BR8 B;  4GKK B;  5K1P A;  2O57 A;  1JR9 A;  5EBM C;  1I08 A;  4LF8 O;  1N0J A;  2IJK A;  1IBM O;  1IBK B;  4DO2 A;  3WFV A;  4D7S A;  4LF5 O;  4RO2 A;  4U3J B;  3I56 V;  2Z0A A;  1BQ0 A;  4X65 O;  1SA0 B;  2V1D A;  5GTH Z;  4B3M O;  2GTS A;  4PA4 A;  5EIB D;  1N33 O;  2YS8 A;  1VQ4 V;  1QVG U;  4K0K B;  1NR7 A;  5L3C A;  1PNK A;  3O9O A;  5L3B A;  1EN6 A;  1IBL B;  2A3Q A;  4TUY B;  1EM1 A;  4X1Y A;  4KHP O;  3B4S A;  2Y0P A;  1NZ6 A;  4IT5 A;  5EC2 C;  1B04 A;  2BE3 A;  2BTQ B;  1BS3 A;  1H38 A;  1XRE A;  3OTO B;  5FNV B;  1KU9 A;  1YXB A;  4WFH A;  5BXZ A;  2YXH A;  1FFT B;  1XDC A;  4ZHQ A;  3BRC A;  2A9H A;  3APO A;  2JGU A;  2CTP A;  1Q3E A;  3D36 A;  4LFB B;  1K92 A;  5FL7 G;  1SQX H;  1CXZ B;  1GRJ A;  1SQB H;  3L74 H;  4TV9 B;  1ZAU A;  4LF6 O;  3DC5 A;  2OCC C;  3BAA A;  4A5U B;  5IWA B;  3MDS A;  1QVF U;  1RSO A;  2QWQ B;  4CH5 A;  1OCC C;  4IHJ B;  4DV7 O;  3K06 A;  3BFR A;  1SS3 A;  5FPR A;  1DF5 A;  2ILM A;  5JVD A;  2OTL V;  2KKW A;  3SPG A;  1HNW O;  5BY1 A;  3H1K H;  4J7J A;  1AI6 A;  4JI4 O;  5KA6 A;  5IYZ A;  1I0H A;  2OCC B;  1GK9 A;  1RPO A;  3CJH A;  1XMO B;  4FLW A;  3O65 A;  1UPG A;  1Y74 B;  2DYS C;  2H94 A;  3RWR D;  5IJ9 B;  3ICX A;  3SYA A;  1OCC B;  3OMA B;  3VQY A;  2IJH A;  5LA6 B;  1YJ9 V;  1YJN V;  5FPO A;  4QE9 A;  1EZV H;  3BA9 A;  4TSF G;  3SYC A;  3K5M A;  4GX5 A;  3SPI A;  3CPW U;  4WBN A;  5CB4 A;  5KHH A;  2P5O A;  3F5T A;  4I7Z B;  2DYS B;  3LDC A;  2UXN A;  3B8M A;  1AJQ A;  1BT8 A;  5F2V O;  4JZ2 A;  2HKO A;  2WLN A;  1R6T A;  1KEC A;  5EC1 C;  3WB0 A;  4B3T O;  1HNX B;  2ZE5 A;  3JAR A;  3N2K B;  1D5A A;  4I0X B;  2QTO A;  4LF4 B;  1QLE C;  1Q6I A;  2UXC O;  3Q4H B;  2F23 A;  3P32 A;  1Y66 A;  2EIM C;  1K5Q A;  1SF9 A;  1AR1 B;  2CTW A;  1NJI W;  1ORQ C;  1SZX A;  4B7K A;  1JJ2 U;  1L8D A;  4J80 A;  2X6C A;  1IX9 A;  2Q9L A;  2ZNJ A;  1AJN A;  1MSD A;  3M7M X;  3OGC C;  2QWP B;  1IDS A;  3UQ8 A;  4JI7 B;  1NBM G;  2EIM B;  1H2S B;  2V4D A;  3JAS A;  4OGQ B;  1XUQ A;  5IY5 C;  5LMN B;  3E89 A;  1W0J G;  5KX5 B;  4LBE C;  1F23 A;  2HHH B;  1Q6U A;  1XL6 A;  4J7K A;  4CC6 A;  1PPJ H;  4AIL C;  2CDY A;  3OUS A;  4DXW A;  5CA3 A;  4X62 O;  2F95 B;  3VQW A;  2JJ1 G;  1TGO A;  4I9Q A;  1AR4 A;  4O2B A;  4OPH A;  1COW G;  1EZJ A;  1FS0 G;  5JQG A;  1OCZ C;  1VQP V;  3OGI B;  4U3F H;  4HYO A;  2XAQ A;  3ETG A;  3HB3 B;  4O4L B;  4PDM A;  3OTF A;  3IGA C;  2F4V B;  2LP7 A;  4H33 A;  4WFE A;  4GX1 A;  3W7U A;  3ZMU A;  3CCM V;  4HNA B;  5C8Y B;  3RYF B;  1OCZ B;  2WSS G;  3JYC A;  5EBW C;  1PP9 H;  2UUA B;  3RVY A;  1AB3 A;  3L72 H;  3N27 A;  3QG5 A;  3VOU A;  5B1B C;  3UCS C;  5HFM A;  3FX7 A;  4X20 A;  4LF9 B;  3HKB A;  2XUM A;  3JAW B;  1FYJ A;  3OEH G;  3SYQ A;  3AK2 A;  2WLL B;  2CUG A;  1GKF A;  2Q8V A;  2ZQM A;  3KKY A;  3ZHU A;  3W7X A;  4GKJ O;  2YIB D;  3CCU V;  1GMG A;  4G27 B;  4J7Z A;  5LMU O;  5LOV A;  3W7T A;  4LF8 B;  3JAK A;  1WP7 A;  2QWO B;  5EBL C;  4BAY A;  2NLJ C;  1IBM B;  3CRQ A;  2GTA A;  2KG7 B;  1M9N A;  3OR7 C;  4ZOL B;  1R6N A;  3QF7 A;  4K8X A;  5H6Q A;  4X65 B;  4X8A A;  1MOF A;  4B3M B;  3DGE A;  2EBO A;  5JCO C;  5EK0 A;  3ZN0 A;  5KMG A;  3SYO A;  4ASU G;  3ASO C;  2IBZ H;  4IYI A;  5EYP B;  3FAV A;  1SQF A;  1EBO A;  5TIS Z;  1DGS A;  1HNZ B;  4NYK A;  5FLX N;  1MMM A;  3K08 A;  4LNU B;  1M56 C;  5J2T B;  3F5W C;  3ASO B;  1AR5 A;  3CXC U;  3QO7 A;  5IYC O;  4K8Z A;  2JS3 A;  4DV5 O;  4UUJ C;  4RQF A;  1N32 O;  1LUW A;  4O2A A;  3CX5 F;  4KL1 A;  4LF6 B;  4OX9 O;  3K3W A;  2EX3 A;  4JTD B;  1WA8 B;  3H1I H;  5JH7 A;  2HFE C;  1TUB A;  1AJP A;  4ZIB A;  1NQT A;  1QLN A;  1F7Y A;  4NXM O;  1HNW B;  3ETE A;  1HP8 A;  3GWO A;  3TXQ A;  4WFA V;  4JI4 B;  2PYL A;  4DRX A;  1KKD A;  2GUZ A;  3IJ4 A;  3LNN A;  3JCU Z;  4GCZ A;  4NTW A;  4DV2 O;  4KP4 A;  4O4J A;  3ABL B;  3WB2 A;  4YJ2 A;  1KYO F;  4DR4 O;  1QQC A;  3W7S A;  1R1B A;  3E86 A;  2W0F C;  2CH7 A;  3ABU A;  1Q81 W;  2X6B A;  1L1F A;  2K9P A;  4XDL A;  1TVK A;  2QGN A;  5KHJ A;  1R3J C;  2L35 A;  1M4U A;  4BR6 A;  4MTX A;  5KUM A;  5E1A C;  3KZI Z;  3K04 A;  4FLV A;  5DED A;  1VAR A;  4JZG A;  5H2F Z;  3THO A;  4PA3 A;  2LFS A;  1HWY A;  2Y69 C;  1NTZ H;  4B3T B;  2RMK B;  3U11 A;  2H8P C;  4LFA B;  1S76 D;  2OIE A;  2YSU B;  2ZT9 B;  2UXC B;  3FB7 C;  4J9Z B;  3BAB A;  3HKD B;  3C3S A;  1NTM H;  4U3J A;  1K7D A;  5HFL A;  1BCC H;  1VQL V;  1P84 F;  3TJT A;  4D6T H;  4P30 A;  4U7O A;  2Q4P A;  4MW8 A;  3JD1 A;  4PA7 A;  2PI4 A;  2Y69 B;  5EZY A;  2CGN A;  3JAM N;  2BCC H;  1JVM A;  2Y0I A;  1BZK A;  4JYA O;  4I55 A;  4DR3 O;  3S3W A;  3SDL A;  3W7W A;  1BHA A;  1IUR A;  5H5N A;  4BIO A;  4JI6 O;  5FNV A;  2UXB O;  1K8A W;  1W59 A;  1AIL A;  3JAL A;  5BZB A;  5BMV B;  1Y6X A;  1Y76 B;  4BW5 A;  2BSK A;  3RW0 A;  3ZMZ A;  4JYY A;  5B1A B;  3RFR A;  1FD9 A;  1VQ9 V;  3U10 A;  1N4C A;  3ETQ A;  1JA8 A;  4X62 B;  3IC7 A;  4IIJ A;  3E83 A;  3ZRX A;  1YEW A;  2XAJ A;  3RYI B;  3G6B A;  1JX9 A;  4BW9 A;  1PV0 A;  2UXD O;  4NVP A;  2WAM A;  4WF9 V;  3F7Y C;  1SES A;  4ZI7 A;  4X1I A;  1KP2 A;  2EIN C;  3SGI A;  2CK3 G;  4PDV A;  3CCQ V;  1WB7 A;  1RP3 B;  1Y74 A;  1BL8 A;  4QPJ A;  3H1L H;  4DR2 O;  1GM9 A;  3EHB B;  1FXK B;  3A0H Z;  2HLD G;  5E79 Z;  1VQO V;  2QKA A;  2YC0 A;  2R9A A;  3ZBH A;  5IJ0 B;  1YHQ V;  1MZF A;  1YTF B;  4ZKI A;  4RUE A;  4JTA B;  2EIN B;  3OFN G;  4EFB A;  2W6I G;  4O4H B;  4TQF A;  3HKE A;  1VP7 A;  3ABM C;  1GN2 A;  4PDL A;  2RDC A;  3JD3 A;  1MA1 A;  4AQY O;  2JS5 A;  2LFR A;  1WB8 A;  5J9P C;  3B09 A;  5GON B;  2B1G A;  1YTF D;  5IYB O;  4CS2 A;  2Q7G A;  4I0X A;  2YIC A;  4GKJ B;  4NR1 A;  5LMU B;  1YJW V;  3Q4H A;  2QEX V;  2OTJ V;  1YCI A;  3ABM B;  5KHG A;  3AEI A;  2ARH A;  1YIT V;  1VQ7 V;  4H37 A;  3DXR B;  1KQS U;  2AZ2 A;  4X1K A;  2ODM A;  2R9R B;  1FFX B;  1F51 A;  3R66 A;  3FFQ A;  3RYC A;  4DR7 O;  2F43 G;  2DWE C;  3MD0 A;  1NH2 B;  1I5Y A;  4WFB V;  1NT2 B;  1XHX A;  2CE4 A;  2QTS A;  3LDD A;  1RPR A;  4IYH A;  4JI0 O;  1MSW D;  4UCT A;  1R3I C;  5A2Q N;  3CC7 V;  3QVN A;  1KKC A;  2ETN A;  2BOC C;  4X66 O;  4B3R B;  1SQP H;  4J42 A;  2K1E A;  4JYB A;  3UT5 B;  4XDK A;  1NH2 D;  1K4D C;  4DYL A;  2YIA A;  3ZHR A;  1XOU A;  1K97 A;  1VF5 B;  3J80 N;  3OM3 B;  2KQX A;  3E35 A;  4R7C A;  4Z1M G;  5LP6 C;  5A9G A;  3JCZ A;  4DV5 B;  2KB1 A;  3K57 A;  1N32 B;  4OX9 B;  1VQ6 V;  2QJ1 A;  3F7V C;  1VF6 C;  2R72 A;  3CS5 A;  4J10 A;  1J95 A;  4R8C A;  1JOY A;  4O4L A;  3D3I A;  1ZLZ A;  3CCR V;  1VQ5 V;  1KUQ A;  5LP6 B;  5GW7 A;  2P90 A;  3STL C;  5KUK A;  1WN7 A;  1K34 A;  3ZMV A;  3RYF A;  4DV2 B;  1AP5 A;  4DV4 O;  4JGS A;  4DR6 O;  3NR7 A;  4FLU A;  3WU2 Z;  4FFK A;  2YIB A;  3K0G A;  2CGO A;  3C90 A;  2N04 A;  2P6J A;  4MVR A;  3G67 A;  4IL6 Z;  4EFE A;  1ZTE A;  3H1J H;  3TGU H;  4DK0 A;  3JAW A;  1U97 A;  1N34 O;  2VWK A;  5LHI A;  3PJS K;  1RFY A;  2DQ0 A;  1IZ3 A;  1SET A;  3DTU B;  4FFB B;  4MVU A;  2P67 A;  3BEH A;  5CA0 B;  1KC8 W;  3HKC B;  4UCS A;  2E3C A;  4MW3 A;  4LH7 A;  1I7F A;  4CS3 A;  1HR0 O;  4N21 A;  1W0K G;  3LSS A;  4FK5 C;  1J5E O;  3SJC C;  1M90 W;  1VQM V;  2KG7 A;  3CEI A;  4LP8 A;  2E76 B;  1Z5V A;  3FB8 C;  1GAX A;  5L3F A;  5AG2 A;  2W0X A;  1T5E A;  4FMT A;  2JDI G;  2JVD A;  3CRA A;  2JEX A;  1I5X A;  2Q68 A;  1PNM A;  4P9P A;  4LF7 O;  1RM1 C;  4DUY O;  5EYP A;  4JYA B;  2WA3 A;  3IC9 A;  4LH6 A;  3B2E E;  4DR3 B;  2MK3 A;  4PJ0 Z;  1ZL8 A;  2DW4 A;  1O9H A;  1PL0 A;  1WJZ A;  4Q20 A;  1B6Q A;  2KSD A;  4MVZ A;  4MTG A;  5CBH A;  2HVJ C;  2WLI A;  2JIZ G;  4NKG B;  4JYC A;  3L9D A;  2JK5 C;  5J2T A;  1ZUQ A;  1RM1 B;  5ITZ B;  3K58 A;  4B7E A;  4MS2 A;  4DK1 A;  4UFZ A;  2R9I A;  4GX0 A;  4N23 A;  1X4T A;  2GDS A;  4X1Y B;  4QE7 A;  1VIB A;  3AG4 B;  1WA8 A;  1E1Q G;  1I94 O;  2NNU A;  2GBO A;  3JSN A;  3ZN1 A;  3L73 H;  1S5L Z;  1OZ0 A;  3C3T A;  4FPP A;  4CH4 A;  3SJA C;  2QKC A;  4ZHQ B;  2A06 H;  2D3O W;  3T1Y B;  1S5J A;  1S77 D;  2GV9 A;  1K9M W;  4MVS A;  5D5Q A;  1HDJ A;  3T1H O;  3LUT B;  2PYJ A;  3N2G B;  3BVO A;  4DR2 B;  2FTK A;  2E5L O;  5D5P A;  4PDR A;  4YIO A;  4QPK A;  1B3Q A;  2P22 C;  4FLY A;  4JV5 O;  1KP3 A;  1Y67 A;  4P9O A;  1RSO B;  1YVW A;  4FM1 A;  1GTO A;  2YEV A;  4AI8 A;  4OXS A;  4HBN A;  2YXY A;  4FZ0 A;  5JVD B;  1FKA O;  5CA1 A;  4HAM A;  3BPZ A;  5IYZ B;  3I55 V;  3D8C A;  5DEC A;  4AQY B;  4UB8 Z;  3CRR A;  1SKV A;  3ABT A;  3VQX A;  5KLV H;  2VQE O;  2YDE A;  5CN0 A;  1E79 G;  1QHT A;  4MVQ A;  1R6K A;  4ICG A;  3HKD A;  4D7T A;  3B8N A;  3FD9 A;  4B3S O;  4MVO A;  4UCU A;  2N05 A;  2ADP A;  4LC1 A;  4WBN B;  1ZX3 A;  4LWS A;  5CB4 B;  1PNL A;  3QO5 A;  4LF5 B;  2P7T C;  3D3Q A;  4DR5 O;  4NTY A;  5L3D A;  1NTK H;  2ITC C;  4QNH B;  4DR7 B;  4U7N A;  2UXX A;  1MZE A;  3FB6 C;  1N33 B;  3ETD A;  4P2Z A;  4RWU A;  4NB5 A;  2RNB A;  2EIJ C;  4E2L A;  4JI0 B;  2Q69 A;  1ZSP A;  4KHP B;  4YJ3 B;  2ZDI C;  2ZR2 A;  3WG7 B;  1JFF B;  2D2C B;  3IAY A;  1Y4M A;  4X66 B;  3BCC H;  2CAZ C;  1Y76 A;  4LCU C;  4O4I A;  2LW1 A;  4R50 A;  4DV6 O;  1G4Y B;  3RT3 C;  5GTI Z;  4UCV A;  2EIJ B;  3BHP A;  4I5S A;  3JAS B;  1AI5 A;  1K33 A;  1EN4 A;  3RYI A;  1OJH A;  1ROP A;  3E22 B;  3VQV A;  3ABL C;  1CP9 A;  3K5L A;  4DV7 B;  3DSQ A;  4WFF A;  3R65 A;  5KHK A;  1WNS A;  1LR1 A;  1B06 A;  2PI5 A;  3BY6 A;  2G38 A;  3RN4 A;  4I4T B;  5K1X A;  4TV8 B;  2PZS A;  2QDO A;  4MTF A;  4DV4 B;  4DR6 B;  4O2B B;  2YID A;  2IU3 A;  2Q67 A;  3UKM A;  3JD4 A;  5L3G A;  5C93 A;  4O4H A;  3ZRV A;  1XQ8 A;  2R70 A;  2WWW A;  1N34 B;  2OIG A;  1XMQ O;  2WLM A;  3OMN B;  5KAF Z;  2X0L A;  4EB6 A;  1XMO O;  3CXH F;  5GON A;  1YDX A;  1NVP B;  1M5I A;  1V9P A;  2HR3 A;  3H1H H;  1HR0 B;  4K3A A;  1WPX A;  1OCO B;  1W2B U;  3T1C A;  1J5E B;  4PA9 A;  1P4R A;  4CZZ A;  3QTC A;  3GVM A;  3RBZ A;  1FXV A;  2P06 A;  2Q6A A;  2ZIO A;  4X20 B;  3HKB B;  3K9S A;  3A8T A;  3UO2 A;  4JI3 O;  1YZB A;  1PKX A;  1FFX A;  1SA0 A;  2LGW A;  1NVP D;  1PL4 A;  5CBG A;  2F93 B;  1KBH A;  1PM9 A;  4Z1V A;  4LF7 B;  4F6E A;  4YIP A;  3AG1 C;  4UVC A;  2ZXW C;  4QGP A;  5LOV B;  2QM8 A;  4DUY B;  2Y4T A;  4TUY A;  4UVB A;  5B1A C;  2A0L A;  1XI1 A;  3ZCC A;  1IVS A;  1D2D A;  4YHH O;  2BTQ A;  1OCR C;  2FML A;  4KFM A;  2PTM A;  4PD4 F;  2IW5 A;  1UJW B;  1SER A;  4IGG A;  2EZP A;  3AG1 B;  4GYC B;  2ZXW B;  4DV0 O;  1US6 A;  2XAS A;  5B1O A;  1FJG O;  3M8A A;  2QR4 A;  5KMG B;  3ZED A;  4DUZ O;  4TV9 A;  2YXL A;  3ZIA G;  4HZ3 A;  4YXW G;  1OCR B;  2HJF C;  3JAT B;  1JMK C;  1BQZ A;  4R6Z A;  4K35 A;  2LJ2 A;  2OWO A;  1N8R W;  1FXK C;  4IHJ A;  2VS0 A;  1SQV H;  1KD1 W;  2HHH O;  3P3P A;  1OV9 A;  4FJC C;  1XHZ A;  3E8H A;  5LYJ B;  2PGG A;  2ZR3 A;  2JGD B;  1A32 A;  1N0N A;  4X64 O;  4JTC B;  1DLB A;  4WFG A;  1EN5 A;  1WLE A;  2Q0O C;  4JAA A;  3T1H B;  2RQ6 A;  3MAQ A;  4O2A B;  1VF6 A;  5IJ9 A;  2E5L B;  3CCJ V;  3CCV V;  4CS4 A;  1WP8 A;  2C2A A;  4F6R B;  5LA6 A;  1TUE B;  1P49 A;  1TUB B;  2VQF O;  2RN9 A;  3L70 H;  1JJO A;  3G71 V;  3CCE V;  3HPL C;  4G2K A;  4MT8 A;  1SC5 B;  4FFB A;  3B40 A;  3HKC A;  4DW1 A;  3RYH B;  4DR1 O;  3CC2 V;  2IH1 C;  1QCE A;  3K59 A;  1ARO P;  2UUC O;  2LQT A;  4O4J B;  4YJ2 B;  2DJV A;  5DN6 G;  2VQE B;  1O9G A;  3N2K A;  2HVK C;  4ZBM A;  1MNG A;  2FKX A;  3B77 A;  1F4N A;  4LF9 O;  2EZO A;  4PA6 A;  4B3S B;  5H9C A;  2QA4 V;  3JD2 A;  1TVK B;  1M57 C;  5J2U B;  3ZRW B;  2XT9 A;  4TQD A;  4JI1 O;  1R3K C;  4DR5 B;  1QBZ A;  2ZE8 A;  1XEQ A;  3CCL V;  1Q7Y W;  2XND G;  2JRI A;  1X59 A;  2ZM6 O;  1S3J A;  5LGN A;  2WLK A;  2X6A A;  2OYQ A;  1M57 B;  1V55 C;  2YI9 A;  5LGU A;  4ABM A;  1AP6 A;  5KX5 A;  1XIL A;  1Q5O A;  1G1X B;  3E8G A;  1Q6H A;  1BSM A;  3J81 N;  2CTQ A;  1HNZ O;  5EZY B;  4W4L A;  1XNQ O;  5ITZ A;  4DV6 B;  1BHB A;  5B3S C;  5LXT B;  2QM4 A;  4JAU A;  5IDJ A;  1V55 B;  2DYR C;  4QIW F;  4G28 B;  4I55 B;  4RAI A;  1AI4 A;  1CPY A;  1GN3 A;  3SJB C;  1DF4 A;  2A7W A;  3SPJ A;  5LHG A;  1URF A;  1DTO A;  3JAL B;  5B3S B;  2EIK C;  1BGY H;  3ZX6 A;  4GUN A;  2DOS A;  2BSK B;  4EEQ A;  3S3X A;  3EVK A;  2DYR B;  4GX2 A;  3MHH C;  4NXM B;  4I50 B;  3L75 H;  2IJI A;  3N2G A;  1S72 V;  2GSM B;  4CC5 A;  2IJJ A;  2QSA A;  2VRZ A;  3I5D A;  4HNA A;  1G8M A;  2FL4 A;  5C8Y A;  4IIJ B;  1P7G A;  1THZ A;  2L6L A;  5B1N A;  4AHC A;  4JI5 O;  1H2K A;  3CC4 V;  2QM7 A;  4DR4 B;  1NI8 A;  4JPR A;  4FM0 A;  2EIK B;  2QE7 G;  1XNR O;  2EUL A;  4ZI7 B;  4X1I B;  4FZ1 A;  1XMQ B;  4TWK A;  4NTX A;  3FKS G;  3UM7 A;  3T4D A;  2E74 B;  1K3E A;  2WLL A;  1Q43 A;  1M93 A;  5DM6 V;  4J11 A;  3ZMS A;  3TXS A;  4H0L B;  1GH6 A;  3FYE B;  3KCY A;  2F1M A;  2BTO A;  3CMA V;  4NXN O;  3AK3 A;  4CH3 A;  2LO1 A;  3AG7 A;  4UXN A;  2N74 A;  2V7Q G;  2Q0A A;  1K5S A;  1HW7 A;  1K4C C;  4WCE V;  3ML0 A;  4X89 A;  4ZOL A;  1R3L C;  3HKE B;  4JI3 B;  2XAH A;  1G6U A;  1H2G A;  3ZJZ A;  1QNM A;  2PF4 E;  2M6Y A;  2AW9 A;  1AI7 A;  4LFA O;  4LFC O;  4UV9 A;  3P30 A;  1LNQ A;  3CRC A;  2M7W A;  4MSW C;  1S5H C;  5CBF A;  4DV1 O;  1P7B A;  1E1R G;  2Q7H A;  3CHX A;  2A79 B;  4YJ3 A;  4X9Q A;  1JFF A;  3CRM A;  2B9Z A;  5LBQ A;  4YHH B;  3T2M A;  1KMI Z;  4BWA A;  4JI6 B;  2UXB B;  3AG4 C;  5JCO A;  4X1K B;  4FIP C;  4LNU A;  2ITD C;  4DW0 A;  2QWN B;  1QLE B;  3RYC B;  3K5O A;  2P4V A;  4DV0 B;  2WLH A;  4RUF A;  4UB6 Z;  1N36 O;  1FJG B;  2XAG A;  4YY3 O;  2ZDI A;  2AZ0 A;  4DUZ B;  3G80 A;  4PEL A;  1QU7 A;  3D36 C;  2H3O A;  3ABK C;  1H2L A;  2XHB A;  1AVM A;  3E22 A;  1YI2 V;  5JJJ B;  3SR2 C;  3JSL A;  3SJQ C;  2AHZ A;  3OE7 G;  4JAV A;  5LHH A;  1EFR G;  4C7U A;  2XAF A;  2ZE7 A;  4TT3 G;  1H8H G;  2UXD B;  4TOI A;  2LGQ A;  1WPB A;  4E4E A;  4PV1 B;  2QWR B;  4JI2 O;  2UU9 O;  2Z5U A;  1YSC A;  1MAB G;  2IU0 A;  4PI2 A;  5IY5 B;  1VF7 A;  4X64 B;  4I4T A;  2Y4U A;  4TV8 A;  3ABK B;  3E8B A;  2AGA A;  5B66 Z;  1H2N A;  2ZIN A;  4GT1 A;  2Q5Z A;  3K0D A;  2YUA A;  4J41 A;  2DMX A;  2ZKO A;  3CWB H;  3RGB A;  1JQ0 A;  5JWP A;  2VQF B;  5KHI A;  2VWJ A;  4Z2W A;  1NS1 A;  2XOK G;  2AHY A;  3ZHQ A;  1NU1 H;  2ZNI A;  1XBL A;  3ASN C;  4L87 A;  2ADQ B;  2AXT Z;  4DV3 O;  4DR1 B;  3CME V;  1D5N A;  3CJH B;  2UUC B;  3X2Q C;  4FLT A;  2UUB O;  1NKD A;  4JI8 O;  2DN9 A;  2PUS A;  2Y48 A;  4I9W A;  4H44 B;  3QNE A;  3TET A;  1UFI A;  3ASN B;  4H13 B;  1TA8 A;  3VBB A;  1Z5W A;  4FLX A;  1VEW A;  2HG5 C;  1SQQ H;  4CH6 A;  1CEZ A;  3L71 H;  5JJE B;  2DQ3 A;  4JI1 B;  1Z2G A;  3WG7 C;  3X2Q B;  2EJR A;  2E75 B;  1BMF G;  1V54 C;  3CP1 A;  5BR8 O;  4GKK O;  1U96 A;  5B1B B;  1VQN V;  2ZM6 B;  1SRY A;  3JAR B;  5L3E A;  4FLZ A;  1IBK O;  4JF3 A;  3G6E V;  3ZRS A;  3A0R A;  2JEU A;  4X88 A;  5BMV A;  3EXA A;  2P4K A;  1V54 B;  3ZHS A;  1H8E G;  1KB9 F;  3GB7 C;  1XNQ B; 
#chains in the Genus database with same CATH homology
 3H1H H;  1SQB H;  2FYU H;  3L72 H;  3L74 H;  1NU1 H;  3H1K H;  1L0L H;  1NTZ H;  1SQV H;  2IBZ H;  1SQP H;  2BCC H;  3L75 H;  1SQQ H;  3L70 H;  3L71 H;  3CX5 F;  1L0N H;  1NTM H;  5KLV H;  1BGY H;  3BCC H;  3H1J H;  3H1L H;  3TGU H;  3L73 H;  1EZV H;  1BE3 H;  3CWB H;  1BCC H;  1NTK H;  1P84 F;  1SQX H;  3CXH F;  3H1I H;  4U3F H;  4D6T H;  2A06 H;  1KB9 F;  1PP9 H;  4PD4 F;  1PPJ H;  1KYO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...