3H1PA

Mature caspase-7 i213a with devd-cho inhibitor bound to active site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
246
structure length
232
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRSKTLLEKPKLFFIQACRGTELDDGIQYKAPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L2' loop is critical for caspase-7 active site formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords Caspase-7
total genus 83
structure length 232
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1pA00
4AWBA 5K20A 4NOKA 3S8EA 2K7ZA 4D3YA 1SC1A 4EHDA 3OD5A 2CDRA 4EHKA 2FUNB 4QUIA 3H0EA 3IBFA 1RWKA 2H4YA 4ZVOA 1SHLA 2H5JA 3NKFA 3R5JA 4JJ7A 4D3ZA 2QL7A 5IAEA 5IANA 1GQFA 4QU5A 4JB8A 2H4WA 2CNKA 4NOMA 4EHHA 4N6GA 4ZVRA 3E4CA 4IYRA 2HBQA 1M72A 3NS7A 3PD0A 4QUEA 5IAKA 4EHLA 2XYPA 2C2KA 1RWNA 1CP3A 3EDRA 3V3KA 1QTNA 4NBNA 4EHAA 1BMQA 3DEIA 1NMSA 4I1RA 4QULA 4FDLA 3R7NA 2FP3A 4QTYA 1RHUA 1IBCA 4NOJA 3R6GA 3UO8B 2J32A 2QL9A 5IAJA 5IABA 2AR9A 5LUAA 4DCPA 3RJMA 4QUGA 3V6MA 2HBRA 3KJNA 4D3XA 1SC4A 2H5IA 3V6LA 2H51A 5IC6A 2CJXA 1JXQA 4JQYA 2XZDA 5LUBA 1RWPA 2H54A 4EJFA 5IC4A 2DKOA 3PD1A 2C2OA 5LU8A 2J31A 3DEJA 2XZTA 1CVRA 2HBZA 4JR1A 1RHQA 2J33A 5I9TA 3H13A 4ZVQA 4AWAA 1NMQA 3R7BA 4N6NA 4PRYA 3ITNA 1K86A 3GJQA 3H11B 2FQQA 4FGUA 1RE1A 4JR2A 3H1PA 3D6FA 1SC3A 2XYHA 3DEHA 3S70A 4QU0A 3NR2A 2WDPA 2QLBA 3H11A 4HVAA 3SIRA 2C1EA 4QU8A 5IBPA 1NW9B 1KMCA 2H48A 4QUHA 4JR0A 3DEKA 5JFTA 1RHKA 5LU9A 1QDUA 4NBLA 2J30A 4ZVTA 1RHMA 5IARA 1SHJA 3P45A 4N7JA 1PYOA 1I4EB 4HQRA 4PS1A 5IBCA 3K7EA 1RHRA 1QX3A 2CNOA 4LSZA 1PAUA 4JQZA 1I3OA 5IAGA 3V4OA 4AW9A 3GJRA 4N6OA 1RWWA 4JJ8A 2H65A 3SIPA 4I1PA 1GFWA 2NN3C 4PS0A 2QLFA 3IBCA 5I9BA 1RWXA 4EHFA 2QL5A 1K88A 3D6MA 4NBKA 5IBRA 4N5DA 2QLJA 3UOAB 4M9RA 4QUDA 4QUJA 3R7SA 2C2ZA 2C2MA 5H0IA 1ICEA 1RWOA 4JJEA 2CJYA 3KJQA 3EDQA 3D6HA 3PCXA 3V4LA 1RHJA 4IEFB 3BIJA 3P4UA 3V55A 1NMEA 2Y0BA 1F1JA 1RWVA 5IASA 1F9EA 4ZVPA 4QUAA 4ZVSA 3R6LA 3R5KA 4QTXA 1I4OA 4ZVUA 2Y1LA 2XYGA 2CNLA 4DCJA 2CNNA 2P2CA 3KJFA 4PRZA 3GJTA 3GJSA 4QUBA 4NOLA 4HQ0A 3QNWA 4FEAA 4QU9A 4N7MA 4FXOA 1I51A 4DCOA 1RWMA 4EHNA 2HBYA
chains in the Genus database with same CATH superfamily
5JXIA 1GL6A 2IQIA 3UPUA 1SBNE 3FJOA 4C05A 3TZQA 5T8KC 3LU1A 4RPJA 2P8JA 4RK1A 1T6NA 5HKKA 4UNSA 4CKEB 1AK2A 1AA6A 3HFSA 3IB3A 1BO6A 3BSSA 3RG2A 1TGVA 5AVVA 5HS4A 3C6MA 1K5GA 2OC4A 1BN6A 3QQPA 4FYJA 4P6VF 2IGTA 5GAJA 4UC0A 3ROXA 3TQRA 3FG9A 4GUAA 2YRXA 3LYUA 4AZ3B 1GGHA 3GHYA 4R1NA 3KQLA 1XUOA 5H82A 2E4XA 2L17A 3PNOA 5JOQA 4UZFA 2YFQA 2GYVA 5BURA 5ICFA 3EEQA 4CMKA 1SBHA 4HTAA 3G7SA 4B6RA 4UD2A 2ODPA 4A91A 4G0WA 1XRSB 1VLHA 4C0KA 1D1QA 5F98A 2IDZA 1ISRA 4TUYA 2XR1A 4GSKA 4YP6A 1T3ZA 3INNA 3U7IA 3ZD6A 1DAPA 3FYSA 4F91B 4P84A 2XUOA 3EY9A 1SXJD 2WTUA 2N75A 1M2HA 2Q1SA 2G67A 3IT2A 3RVJA 1KH2A 1TEVA 5L7WA 3DTVA 3FYDA 3WK7A 3OH8A 3VKUA 3ZNNA 2QTNA 3PTZA 1W6UA 4E7OA 3AVPA 3PC3A 2PWBA 3G8CA 4OHVA 4WECA 1DJOA 1QRDA 3KWFA 4YRDA 5JQGA 5L6LB 1WZEA 1XLWA 3AFMA 4ND5A 1EDEA 2J67A 5TV2A 5L4NA 5IWAB 4G81A 2VHQA 2IOHA 5C8VA 4ETWA 2WWIA 1ZXBA 1NVVQ 2R96A 4AJ4A 1I3MA 3GEEA 2HU7A 3FNFA 1N5LA 4D41A 3H5AA 5CPBA 3LW7A 1OILA 1GTL1 4F3RA 3RRJA 4OJKA 1TIBA 3ASVA 1AKVA 1XZQA 5B7PA 1T6BY 3G2NA 3W78A 1PNOA 3ZKAA 3SEQA 4FZ5A 2G5PA 3IKTA 2HJHA 3L46A 3ZTWA 1T3SA 1H8HD 3KL2A 3STVA 1SXQA 3NYWA 1OXUA 1ECJA 2QNBA 2C7OA 3NRBA 1MB2A 4CIDA 2QUHA 3CLVA 3FWNA 5JS8A 3EVAA 1XBTA 2Z95A 2PX4A 5PNTA 3JAKB 2IU6A 4OXRA 1QHFA 4NWIA 5DHSA 4F5WA 1WR8A 2I62A 5TT0A 1WS6A 2LKCA 4GE3A 1FSGA 2V1XA 5CCXA 2E89A 3GPLA 1FMFA 4B2YA 5ICCA 4HDNB 4PGMA 3NVDA 2CKMA 5IBRA 1W35A 3A58B 5H83A 5BYAA 3UPTA 2BMVA 8MHTA 1XALA 3C3CA 3ILHA 2BELA 2FP4B 1KOLA 1NRJB 4ZCRA 1G5RA 3PNSA 2H11A 3L6CA 4U5XA 1VL2A 5DWVA 3VUFA 4UTVA 2EW2A 3NAMA 2VUTA 3CLTD 1MAAA 3GNQA 3SY8A 3GLKA 3PS9A 2BFMA 4X65B 2O7RA 2PANA 1MIHA 2B61A 1ETHA 1IEVA 2XGSA 3O8RA 1V8FA 4LQCA 2V58A 2CXPA 3N0XA 4UM9D 4X1OA 3UC5A 4ALLA 4CPDA 3BIWA 1P0PA 1XVUA 3D8SA 3B9RA 3HVUA 3KD2A 3K96A 3GPCA 1SVUA 1V8PA 2ETXA 3AUXA 1T36B 2E5FA 5DYIA 1DOHA 3ROQA 4ESOA 1CEXA 1EA7A 1H1LA 1P1IA 2O6HA 1F8XA 3ORFA 1SVSA 3LCCA 2PY6A 4ID9A 3ZHCA 1P5FA 2UZ4A 4E6EA 4DA6A 5AOVA 5D00A 1GJRA 1VJCA 1V37A 2AQIA 2BTQB 3HJGA 1CPYA 3G82C 1OAAA 4RSGA 4S1PA 1F2TA 3KTAB 5JLAA 2DWUA 1RE0A 2W0SA 4G85A 2BEUB 2H4YA 2VC2B 3FCAA 4IDQA 4ND3A 2FWIA 5BYJA 4NBTA 1VCNA 3NKFA 3P94A 1BU5A 2GK3A 4YCLA 1NVBA 3T3OA 2BE9A 4Z2AA 2XLBA 4LUCA 1ODCA 5K8TA 4R0VA 3G1UA 2ZBGA 4MVJE 4YYEA 3O2JA 5C9ZA 1NDHA 3H5TA 2AJLI 3KWMA 3MT0A 3L18A 1KEWA 1DC6A 2JI8A 3VPXA 2D5LA 2EL9A 1BKSB 4ALMA 3EGXA 4DNFA 1M5UA 3SDZA 4DCSA 1GPJA 2N1BA 3KX2A 4RJJA 3PD7A 4LPSA 4A2QA 3AM5A 3ND7A 2QGZA 4OHOA 4U5QA 4Q4CA 2OV1A 3FHTA 1M34B 4F56A 4JZYA 3K0AA 1GZSA 3H5RA 3QOWA 4JI4B 4Z1MA 3KEQA 1W75A 1KBOA 1TO2E 2PYDA 3HHEA 3QUBA 2VSNA 2IW1A 3GLTA 5FA5A 1OB2A 4IH4A 2NTVA 3O2QB 3OHPA 2WFZA 4S3MA 3KYDB 1DKNA 2H5EA 1ZNZA 3CQ9A 1Z6GA 3JS5A 4OL0A 4XPZA 2QUJA 4AP5A 2AFIB 1JR6A 4KK4A 4YIKA 4MWOA 3LK7A 5F52A 2EXXA 4B5LA 3CEJA 3FTDA 2HK6A 5HZKA 2PLNA 5COQA 5DWQA 4RSMA 1GZDA 3AR4A 4JR2A 2WSLA 3DKRA 3OPYI 5DI9A 5G41A 4A6PA 1ZVVA 4QU0A 1W5TA 5HF6A 3U3RA 4BMDA 2EWWA 3NIGB 4D6PA 5T6MA 1JQ3A 3BRQA 3FSEA 1YKGA 2VZLA 5E3JA 3H8JA 1IZ0A 1DP4A 1I13A 1NSFA 4IYJA 5I7WA 1OZHA 5J40A 3PGA1 1Z0ZA 3X2EA 3DUFA 2WF9A 2G17A 1QDUA 2H29A 1NQAO 5HJEA 1SU4A 1UBFA 1NBEA 5A3QA 3V34A 4KWHA 3IUYA 1QUEA 2HWWA 3LYAA 3PGKA 3OZDA 3CW8X 5EYPA 5IAGA 2WHPB 3HB9A 4C5BA 3OU7A 4WLOA 3M6VA 5L7TA 1B0AA 1K8RA 3OM1A 3QU7A 1HNNA 1ES9A 4K6MA 2H1RA 1GAQA 3NBAA 1FC0A 2FX5A 2QD3A 2XDYA 4XRGA 3EZ9A 3EGWA 2GAFA 2NXJA 4M9RA 2V7PA 1JSRA 1KVQA 4REQA 5IVKA 2OECA 2Y1XA 1SVNA 3TI9A 2DF8A 2OCIA 1DKQA 2P9EA 4FGWA 4JJEA 4RKYA 5KAPA 1U65A 4RVDA 2HA7A 4R1PA 3TI7A 2F1OA 2PE5A 4ZTZB 1RLIA 2J5BA 3QJ5A 2VZ9A 2O14A 4IXTA 4S1OA 5C5IA 1XCBA 4G5HA 1SKBA 1ZW1A 2F2TA 1QDLB 2CXXA 5U1PA 1L5LA 4CWAA 2XGOA 5GQSA 1C30A 1II8B 2QSUA 3FHJA 1YDWA 4DC1A 4QFDA 3WRYC 1FX0B 4XDGA 3G59A 1TUBA 4BO1A 2EGGA 1AMNA 4JUDX 4JUBA 2AB0A 2VRCA 3TM4A 2XT9A 1SU6A 1U31A 3TGWA 4A4DA 4N9QA 1Y3FE 2Y0PA 2BJWA 1YONA 4D02A 2CCGA 1KH1A 4MSUA 1T1EA 4BV8A 2K7ZA 4D3YA 3D81A 1VFPA 4TLAA 3EPRA 2ZVDA 5DW0A 1OMOA 2OY0A 2XUQA 2O2ZA 2GQ0A 2GJ8A 5KWEA 1ZWKA 4RY0A 5EG5A 2QVGA 1F2TB 4LPKA 4Q4JB 3SVZA 2O8DA 1X3SA 1FJHA 3K35A 4EBFA 4Z4HA 3JWPA 4LFAB 2X19A 4HQNA 5GONB 1HY3A 3FFTA 2HHCA 5FPKA 4LJLA 1B16A 3TNLA 1U7OA 3IX7A 4P92A 2A3NA 2R6GA 3UTDA 1T36A 1YZVA 3DXXA 4JYPA 1KVUA 3CBGA 4G65A 5E6SB 2ACEA 1CR6A 3O3CA 2C2BA 4MUAA 8ATCA 1VI5A 3L06A 4RS3A 4LHXA 1Z82A 2OK8A 3MGAA 1MAWA 3R6GA 3U3MA 2ZTVA 3MWKA 4LQ4A 1WEKA 4X63A 1Q17A 2PMEA 3G2OA 4LHYA 1V43A 3I42A 2FH5B 5T41A 1RQLA 1L4BA 3BB4A 3TGLA 4R2KA 4C08A 2CJXA 2R47A 3R3SA 1PK9A 1NFFA 2C0PA 4JB0A 3R0JA 4OAPA 4B31A 1XU9A 1RSZA 2R8PA 1KYWA 2HREA 2YVKA 4LJ8A 3HDGA 3U81A 3ZNPA 1ZU4A 1QFMA 3U4CA 4KUEA 4DIKA 3LDHA 1BHSA 1VBKA 4DDWA 3DA8A 4N40A 3MCZA 4TMFA 4RVUA 3VMMA 2J85A 5A9TA 2A84A 1E3JA 5I5GA 3TW8B 3KVOA 4ODIA 4CM7A 4F4UA 4B9AA 1FDSA 3L6EA 1C1DB 1A77A 3BEDA 1JFLA 2OHJA 1MA0A 2WA2A 2XYVA 1AO3A 3EIOA 5EJIA 3S1AB 2O1SA 4GC9A 1Z8NA 3ZWCA 1VYTA 3KPWA 3KZKA 4Q21A 1A50B 2HK7A 3CNNA 3UY4A 1RPAA 3B5JA 1SN7A 1W9HA 1Z4QA 3FYCA 1NBMA 3MHPA 3QU5A 3MSXA 2YZ2A 4KWCA 5BWBA 3E3LA 4M0FA 1Z5OA 4RPIA 1V1MB 1JG1A 3E9MA 1EM8B 2AR0A 1VXOA 3N2GA 4WKOA 3THWA 3I9MA 4H35A 2VJOA 2PUJA 3IEIA 4CG0A 2I91A 1PR3A 1T4GA 4KK3A 3I5XA 4XKJA 4XTCS 4MKXA 1JB9A 1DBRA 1YJXA 1PJ4A 1RW4A 1PEKE 4TWBA 1VIYA 2PL9A 1NXOA 4NK5A 1YIDA 2QTLA 5AKKA 3LQ2A 4JDUA 3SKVA 3LW8A 5HIIA 4XSGA 3ED5A 4CEHB 4HJXA 4IBOA 3R7WA 1QK4A 2NX2A 5TVKA 5KNBH 2VTBB 4TYMA 3WLLA 1IPHA 4Z4FA 3NVKI 2WD8A 4QICA 5DRTA 1G6OA 3R44A 4TMVA 1DC7A 3QTBA 1MOZA 2YC4C 3TRDA 4NR0A 4L4ZA 5A3VA 3T8YA 3JATB 2EG5A 4K26A 4UNPA 2CMKA 4CIBA 2ZJ6A 1SXJB 4EQ6B 4IWYA 1P80A 4BNDB 2VDPB 1PLJA 3DDOA 3RVBA 4B4UA 2E37A 4YRGA 1USWA 5AT1A 1Y48E 1CLEA 3REQA 1H5UA 1T5TA 2CK3D 4GXTA 2GN0A 1X7YB 4EGCB 2X9QA 2GPTA 4HQ0A 4CHTA 5TPWB 4BE4A 4ZYVA 4BHTA 2ZS9A 1R8SA 3HDHA 2JCYA 4IDBA 4YXWA 1U04A 2GEBA 1QHYA 2XT0A 4H4DA 3A3YA 5TLSA 1BWPA 1SC1A 2IHBA 2VJMA 3IEVA 1OWLA 4QEDA 1L4GA 3IP5A 1MQSA 3HZOA 1GT91 3UWSA 4M0UA 1HTWA 2BDUA 1OLXA 5T8KA 1F5SA 1CUYA 2OHIA 3SQOA 1KFKB 2PBFA 1E20A 1NURA 4WW0A 4DRYA 3VNQA 2W6IA 2XUJA 2DBYA 4XDHA 4XGIA 3KOUA 2WZCA 5ENVA 2XKAA 4EQZA 4HBZA 5DNWA 4AJIA 2C57A 4F6CA 1KBQA 1OXSC 2YVLA 2WE8A 1G18A 4MKGA 5EJGA 5BN3B 5LYJF 2XOKD 3HR7A 4NE7A 4HD8A 4S35A 4TVOA 3O73A 5SZKB 2ZI6A 3RTEA 1V48A 2OQIA 4QTYA 3TLYA 2HJWA 1OX4A 1K27A 1YUNA 2ZE7A 3D1LA 1SPXA 2G7ZA 2J32A 4M9SA 4YP1A 4XB6B 1ZH2A 3WBJA 5KYGA 2XCTB 1GGMA 2H9AA 3CT6A 4KLCA 4X00A 5IDVA 2BM0A 5E2IA 1IN8A 5B1HA 1SHZA 2J0UB 1KJJA 2I5PO 3C5VA 3SXUA 5TMEA 3PQ5A 1G8MA 2MYNA 3TQIA 5LKRA 2QU7A 1K4MA 2VFAA 5AOCA 5CFNA 1G38A 1MJHA 3AP3A 5HQ3B 4HRXA 2YUIA 2FOLA 4KIWA 5EESA 5HKLA 1X8LA 1P61B 2VTDA 1PNQA 3C41J 3A8TA 3ENKA 2JCBA 4GPZA 3H1EA 3K0BA 4HJRA 1Z8DA 2QMUA 3AUAA 3OZVA 4HGNA 1HT1E 4L6AA 2AJBA 3VNRA 3DZKA 1RPJA 1Y9AA 5DHTA 4QDUA 5T4FA 5JVDA 2AIRA 1UCFA 1O4VA 2BBSA 2RJOA 3K53A 1N8KA 3Q9UA 2VOJA 2YMQA 4JLBA 4UUBA 2B99A 5D6OA 1G8AA 5G2OA 2XOKA 4TVBA 5ADHA 1ITZA 3DYIA 3TW0A 4M1ZA 2ZWMA 3EQ8A 3QPBA 5K0EA 2I9PA 5LA6A 2QIOA 1RKVA 2FZCA 2ZRLA 3D2AA 2CXTA 2DPHA 1YQWA 2ROQA 1R5JA 1AKRA 2Z9CA 2CMDA 3AKCA 3D2CA 3LUPA 4PO8A 5A7FA 5JJLA 3ICCA 2H7YA 4M0MA 4MGIR 3B3AA 3DS8A 5GPBA 1YUMA 1V4NA 3IOCA 5BW6B 1T91A 5AKGA 4D7AA 1KEEA 2HCTA 2XB9A 5JAQA 4RD6A 4ZAGA 5MN4A 3ZJUA 2Y1GA 5AVTA 5FWXA 4UNQA 4E51A 4H17A 5JNSA 4UVGA 1UIRA 2ZUWA 4K1LA 1VHJA 1G3UA 1ND6A 2RI0A 1GXSA 4OI4A 4BGUA 3B9BA 5FAXA 1OYVA 1VIMA 5DLQC 1V11B 2BFCB 2V6FA 1JYFA 1JWBB 1ULUA 1U6IA 3JARB 3MFYA 2VDOB 1PWYE 2GRAA 1UC8A 2ZAIA 5KUTA 2WVHA 2NP6A 1VPTA 3PWSA 2F43B 4B17A 4YRMA 3H5IA 4BNXA 3BK2A 3SHVA 1C7QA 1ZISA 2YVAA 3QKTA 4Y2SA 1CYDA 3Q88A 4NARA 1W36B 4W9NC 5FPQA 3U39A 1QYRA 5CH5A 4ZOCA 5KNCD 4K6HA 2P2GA 3MHTA 1GLGA 2JFXA 3ZLBA 3UWKA 3JQEA 1B4DA 2ACWA 4L0MA 2AN1A 1NW4A 1MT0A 3AO0B 1J07A 3TZHA 1PJLA 2Z1NA 2HTFA 5JE8A 4V0OA 4WNIA 4XVCA 5EJ4A 3HM9A 1GEEA 4EUNA 3RAPR 4DCNA 3QF7A 4HGZA 5K9ZA 3PNYA 5K8JB 4PAMA 2IW3A 2D7CA 1PO7A 2FMTA 4H1WA 2PIAA 2II6A 3PIRA 4OFWA 2QBYB 4GQBA 1DC4A 4P38A 5FFNA 1PSZA 4BB5A 2XZOA 1QORA 1D2EA 1H2BA 1T0UA 1ULZA 2VXCA 4QG7A 2OCLA 3W4IA 1QVRA 3T4PA 1JIVA 2CV2A 1BGVA 2JGKA 3TVDA 1AZSC 4DKJA 3FTCA 2ZI4A 1EYZA 3R6DA 1HURA 4UD6A 4G9GA 4EL0A 5J2TA 3IOBA 3IPRA 3WRVA 5EJ7A 5FV7A 1RBQA 2OXTA 2C7PA 1CUDA 4DBLE 2H2AA 3LBNA 3ZCSA 1HPLA 4UE2A 2OQVA 3M34A 3HYTA 1NW7A 1Z16A 3G5LA 4X1IA 5FBWB 2O2CA 1WXGA 2CFCA 2IIBA 3P2EA 2H7CA 3KSAC 2XBMA 1ABEA 2ZWOA 4Y2VA 5ENDA 2DBVO 1G16A 1YS6A 2VA9A 4KXWA 3OQJA 5JDCC 1ULSA 1D6NA 3F4KA 2DFNA 3UM9A 2B5WA 1Z4IA 2JFPA 4UOEA 1ZSNA 4LRUA 2WUWE 1Q21A 1DEAA 1N7GA 4GI3A 1JG6A 2C2GA 3D5QA 3Q8MA 1N32B 3QENA 1UC9A 5ES3A 3EHDA 4AP9A 1VI6A 2CVHA 2H3EA 4R3WA 1L7RA 5ER9A 4IKEA 3KQQA 5T57A 3IP6A 4OJNA 4HNHA 2G9NA 3RC3A 1S2IA 4FFSA 2TECE 1BQEA 2WUFA 3SYNA 5L4LA 1FFCA 4IW3B 3H3XA 3MWGA 3T7SA 3FTNA 5AW8A 1ZVMA 1CC1S 4NQRA 2QJFA 4BNGA 4ZICA 4V0SA 1JWAB 4Q7JB 1NVUQ 2JLYA 4MRMA 1CJVC 2VF4X 1GCIA 3GJQA 4A0RA 5H9WA 2ZRNA 3DO5A 4QVGA 4CMBA 3Q8KA 1JBQA 2O5CA 3IURA 4FN4A 4BLVA 4PGFA 1QIGA 1L7XA 1A5TA 2VP9A 5JG7A 2Q1WA 3K0AB 1E7SA 1HTBA 2WILA 2Q1UA 3NVMB 7AT1A 5L53A 3COVA 5FEMA 2P9JA 2EC5A 5AW1A 1BXGB 2O3QA 1KNXA 4ARVA 1DS6A 1PYOA 3PFFA 1QH8A 1R66A 3U2QA 1KO7A 1CZUA 2REQA 4Z9FA 2PSEA 1I3CA 2VWQA 1N8TA 2HFJA 3HCRA 4IRXA 2I71A 2XMSA 2P75A 5EEGA 1VTKA 1LD3A 3C6BA 3LCVB 3P0JA 4HUJA 1C9MA 4MWCA 5D01A 1T3LA 5A7GA 2W8BB 4IILA 4DG9A 3H9UA 3KKOA 1NA5A 4UDOA 5TQJA 4EP1A 4L9SA 1P0IA 4W1QA 4QEKA 4NKRA 3MJRA 4PHGA 2J08A 2OO5A 2V7QD 1BS9A 5LQUA 4IIYA 3KE9A 4KJXA 2JFHA 2PSDA 1R0LA 1M67A 2JIQA 2W71A 3A06A 3H1FA 3OMXA 2ONZA 4L50A 1DQPA 4PCVA 5JT1A 3SLGA 4M83A 5C7YA 3ORHA 1NBAA 4MVYA 4I5DA 4E30A 4K6CA 1H3FA 2C9CA 1ZHOA 2ZIXB 3ODGA 3UCFA 4OKSA 5TIIA 4D5EA 1E3QA 3IMCA 1C9KA 4N82A 2XTNA 1KMNA 3PXDA 2RJNA 4O29A 2CXOA 3D8UA 3G8BA 4OU5A 1L1FA 3HCPA 4NYMQ 5J5AA 4N47A 2P7IA 2W6PA 2QQGA 3PZBA 2AI1A 3W6UA 4DEYA 5JNWA 5CG2A 4KX5A 5K0SA 4U6QA 3OFKA 2PEYA 2WJ4A 3ICWA 1GT6A 1W34A 1ISSA 1V9CA 3ABSB 3HVHA 3MK31 1XX6A 4FHEA 4OOFA 2HEGA 1AURA 4QJBA 4BCCA 1NV9A 2PUHA 2PQMA 3RJ5A 1OAOA 3RAFC 1U28C 1ZOLA 2Z3ZA 1D8AA 2NQ2C 4QATA 3PFHA 1OE0A 5B5SA 2HPAA 2JGJA 3RSFA 1E1CA 2XGGA 1XKQA 3EZ7A 3GA0A 4MRSA 4DQXA 4RHXA 1W5AA 2AOXA 4J0EA 3T7EA 1BFDA 3LWDA 2MTBA 4M7PA 3DAOA 1XL0A 1WQ3A 1SKYE 5FTWA 4YAJA 4ZAZA 1X0XA 5MN5A 2AHRA 5B6IA 2ANCA 3FPHA 1BMQA 1HDGO 1JBKA 1GAJA 2WTEA 2XQJA 4IUCS 4UCQA 5CCDA 3ZY2A 5IDXA 3BFVA 4HAWA 4K7JA 3O4VA 1FDTA 2GXUA 4LMPA 4A0SA 3MFQA 1TU3A 2Q1YA 3OJWA 1IJEA 1ZI9A 2HCRA 2J9GA 3IAS1 4HMPA 4RQUA 1Z6QA 2ZU6A 5JDCA 4F96A 1AGNA 3VC3A 1I2DA 4RU1A 3IEKA 4M3NA 2C04A 3Q2OA 1T35A 2PG3A 4XX0A 4J1SA 5B1YA 4I0WB 4YRZA 3E7PA 3GRUA 2ZYUX 4C4YA 3U7GA 3DPIA 3DE4X 4JBLA 3U7EB 1GZHB 1XKXA 1JILA 1BRMA 4C3VA 4ZRDA 1KYIA 2IUEA 2P3LA 2KX7A 3U44B 2HHLA 4RZQA 4TTQA 3GVPA 4AZ0A 1VG1A 1XCPA 2XCSB 3ITNA 5TE9A 3RSCA 3HO8A 2AZXA 2CJWB 3SKXA 3WIVA 5C8YF 3EXEA 4FGZA 3RU9A 1V8OA 3QLUC 4LMRA 4IH9A 3NWBA 1FTQA 3SIRA 4Q1AA 5HRUA 4DZRA 1YBVA 2OZLB 1L9KA 3WQQA 1PR1A 4PNHA 5C81A 2QX9A 3LQKA 3ID6C 1ADCA 3C7TA 4KUHA 4ZQIA 1G20A 2C2XA 4N7JA 1OLOA 4M9XA 2R5FA 3F3YA 4DGQA 2EU8A 4OQYA 1BXGA 4KC0A 4LSZA 3VR5D 1J20A 1NBMD 2WZBA 3PHGA 5REQA 2GZ1A 1S6YA 1ZL0A 5IU6A 1ZN8A 3A6GA 3KFVA 3IPXA 3MQ2A 1W19A 1MJNA 4Q9KA 3SXJA 3W6NA 3ZLVA 4WA7A 3DBLA 3MINB 4MVJF 3LVRE 2X9VA 4ENRA 1P5JA 3CC8A 1TEHA 3AKEA 3B1FA 4MVJI 1EFVB 2I54A 5NULA 4NG4A 2GN6A 5K3BA 2H59A 1ZCZA 3TFOA 1UXGA 1V7ZA 4GE0A 1BEUB 2ZLBA 1EQ2A 4GWLA 5LZ5A 3KZXA 1DKPA 3UG6A 3AERA 1QYVA 1XSEA 2Z08A 1MPXA 4MRNA 1YFLA 2JGIA 5IASA 1QIMA 2V7GA 3LQ4A 4EEXA 4H3VA 2ZAOA 1MC1A 1PG0A 1QTIA 2GERA 2CL5A 5TPZA 3UV7A 2Q8NA 2CNNA 2I76A 2NAPA 2ZKIA 4Y7DA 5AK5A 6Q21A 1HKHA 5LWQA 4YAWA 1IHXA 5FRDA 3ZZUA 2FPIA 5DO9A 4I2NA 5BW4A 5JASA 2VF5X 2MYPA 4H7IA 4UE3S 2NPOA 1FSSA 1NNLA 1P45A 1QCYA 2OQRA 2QD5A 4IOMA 2ZRQA 4OX9Y 2G88A 3LKBA 4HPWA 5KC8A 5LJIA 1ETUA 1E5VA 1OXXK 2P9BA 1RYYA 2CDRA 4CXMA 1J2YA 4ZDWA 2OZEA 5AJTA 2QV0A 3I2HA 4R1TA 1FJ2A 3A4IA 4DJFC 3FDXA 2IEBA 2GWHA 4X1YB 1O5TA 1GEGA 5JSHA 2UZ1B 4JQSA 4M76B 1AMOA 5HXAA 2VSQA 3KHSA 5EKSA 3RW9A 3H75A 3D8RA 2C2YA 3Q7EA 4N0EA 4TZ6A 3IE0A 1J0XO 2F3PA 2W4QA 1M6EX 3TTSA 4BFYA 1FP6A 1W93A 4KTVE 2B8NA 3NYRA 3QQ5A 1LZKA 4MVJM 1XRNA 1XZCA 1IOLA 2J3QA 3BGIA 1AKEA 1T5OA 2ATIA 3JAWB 3TPFA 2ZJBA 3NOQA 4IFBA 4PYJA 1SQ0A 2B4QA 4LOJA 4W8GA 3TE7A 3GQBA 3PUHA 1QO0D 1CVLA 1ZH8A 5DKFA 1GPWB 3B53X 1OW3B 1B1CA 4X62B 4BAGA 1XTQA 2YWXA 1SOMA 1YA4A 4FQ5A 2I22A 4KXXA 1AUQA 3CSSA 1FTNA 2Y6VA 3CUEF 3ZHYA 3EXIA 1UIMA 3HN7A 3QY9A 4OD0A 4RW0A 4TSFD 4YJ2F 5EUMA 3TLAA 3TTYA 2QM0A 4BJ5A 1LDMA 4EZIA 5K05A 2BGGA 2BPOA 4DTIA 3N2KA 5HCIA 4ES6A 2BUAA 3DOHA 1JG4A 4WXYB 3GRAA 4JI3B 3RNLA 3OSZA 2X5KO 2O52A 2GK7A 3SNHA 1I8TA 1E3LA 1UZUA 4ZTBA 1E2DA 5LOVA 3PQ2A 2XCOA 1MUUA 1HFWA 1RI3A 1T4DA 1XEAA 2PSHA 3FPKA 3KKKA 3U3JA 4KODA 3MPOA 4WOBA 1WTAA 3DJYA 4Y2PA 1FBNA 3PNBA 4YAKA 5B7GA 4W7IA 3RUHA 1HDRA 1TVMA 2VLBA 2DB3A 2H57A 4CLOB 1UAYA 3MGGA 3ABRB 3HEMA 3HMKA 4AS1A 1DRWA 2RK3A 4QBIA 4DDTA 5B7QA 1BHQ1 2QUZA 5DLDA 1HEYA 1C3XA 1RMTA 2WF5A 4GEKA 3IXLA 3QEJA 5TF4A 3ROTA 4DMHA 3FOEC 1EFKA 1I36A 1IM2A 2I4RA 3QV1A 4BL5A 2SKEA 3DM9B 3SJAA 2VQSA 4ZI2A 3ER6A 2C29D 4R1QA 1VKHA 1SXIA 3DTTA 2FX2A 2XBLA 5JECA 2A0FA 3U9LA 1PG5A 1SKAA 1GTVA 1IDN1 1U1IA 4BO9A 3LV8A 3DV2A 4N6OA 2BHNA 3O4IA 1WMAA 4DG5A 1WCIA 2F1KA 3F3MA 5K0FA 5KMGB 2CUZA 2XRYA 3NANA 1RQ2A 4QNRA 4QXQA 1KI3A 2WKQA 5I8WA 2PWZA 2QN2A 4HRYA 1LJ8A 1QGYA 1YVUA 1MX5A 2A9QA 2VP4A 5E8JA 3SS9X 4EZBA 1QHHA 2AN4A 3NHKA 4YA6A 3V4VB 4EX6A 5HWSA 2RB5A 2O3JA 1I1QB 4V1CI 1JA9A 3WQHA 5BR8B 5H3CA 1XD9A 1QP8A 3K9CA 1GUFA 1TTHA 3PV0A 3DEYX 3KYJB 4KGZA 4XIGS 2XECA 4HRVA 4F60A 4V03A 4UJ3A 3KDSE 3TD6A 4B73A 5F2NA 4P2BA 5BNWA 1I24A 4NABA 2GCIA 1BW9A 3WMEA 5F4ZA 4AY5A 1HLFA 1QJCA 1T0PA 3NJRA 4LV8B 1MDFA 3R76A 2PKQO 4DQ0A 4CKWA 4JEIA 1A9OA 1J1ZA 1KEUA 2DT5A 2GK4A 3WKDA 4QM6A 2IL1A 2ORYA 4BX0A 3C87A 4FXOA 3HFRA 4HZUA 2JGRA 3M82A 5BSMA 2QVXX 4B8WA 1UAAA 4DL9A 3HP4A 1OFVA 3H2ZA 4ZEWA 4EELA 4ECAA 4MV1A 5CJPA 4CEJB 1W2GA 3QHQA 2ZVPX 1CEQA 3V8NA 2UU9B 5TEVA 1K7XB 2HJGA 4HH4A 2MSNA 3H2HA 3H5NA 4ZVMA 4MQFB 2B7LA 4V02A 3ABOB 3WMFA 4U9IS 3I0MA 4DLSA 1MHTA 3VVCA 1Z4KA 3ZWOA 4CLXA 1C9JA 4BFTA 1EFLA 3HKDB 4EHJA 3DOUA 2RGDA 5A0VA 5EZSA 2HT6A 1W88A 4G5YA 5EWLB 2JF0A 2X4DA 2AE2A 1RC0A 4L6IA 4REQB 1GPYA 4G9EA 4QTZA 4KGDA 4X20B 1AG9A 3DQPA 4NU5A 3TLGB 7REQA 5IF9A 3O93A 4O63O 5BVHB 2HT1A 4O4JA 1KU0A 5ALTA 1X1CA 4FGLA 4IAOA 4WNAA 2YC2C 4QPNA 2J87A 5KIAA 2B7BA 4N8SA 1PW5A 2TMYA 4RLFA 3RKRA 5IJAA 4A26A 2Z98A 3CSUA 5CX1B 2QJTA 3Q3GE 1DKMA 1NN5A 3EAFA 4L7VA 4UM5A 3QVXA 2XMZA 3H3FA 2WWRA 4E5NA 2HHJA 3EMBA 2IEZA 5IJ9B 1ZAKA 4NYIR 3WFZA 3QVJA 1XEWX 5THQA 4NPHA 3AJ9A 2FE1A 4ZGBA 3IERA 5EJ6A 3UK2A 1RDFA 3SVLA 2ZUCA 4GS5A 1ONNA 4CEHA 5I5EA 1X7WB 4R69A 2HA0A 3LA8A 3REGA 4ZOLF 3TL6A 2VK2A 1P5ZB 2IYQA 3GLHE 3L1KA 2VIIA 3Q41A 4BMZA 4DQKA 3CSDA 3N2NA 4BATA 3OA0A 4G41A 1H0HA 1NOIA 4XXHA 4H08A 1I0ZA 1DRKA 1LPAB 4BQEA 2DM6A 2GD2A 5AM1A 3T7IA 5CDFA 2QORA 3W77A 4DSZA 2EFGA 3BJEA 1J8MF 3H7IA 5TMBA 2IZOA 3CH6A 2NOAA 3N3BC 2C1ZA 4QPCA 5CB4A 3IAEA 5JAOA 1IMJA 4HN4B 1T9HA 1IOZA 3GUVA 2WJIA 3F2IA 3O4RA 3L9XA 1J56A 3F4BA 4Q19A 1OXBB 4UU1A 4D9IA 3ASYA 2DLCX 1CY6A 1QXSA 421PA 2WYVA 1KZ7B 3NPAA 3PFWO 4ZVVA 3WLKX 1Q7GA 1V16A 3EZ2A 4KQGA 4KQXA 4LVUA 5LPNA 5GADl 1TVKB 3IRUA 3UK6A 3I3SR 1Y5RA 2LDBA 3E3OA 3ZWNA 5B3KA 3TRIA 1F9AA 2FWAA 2I34A 1MQ8B 4Z3KA 1F0YA 1A1VA 2PX6A 1SQSA 1FCJA 2XUZA 5K51A 1LNSA 4CLDA 1CU1A 4BEWA 2CFSA 3EVGA 1HH4A 1U0OC 1NDUA 2H00A 4JGIA 4QO7A 3WP1B 2JATA 5E2AA 3QHPA 1T34A 3NHUA 2QT9A 1ODJA 3A6KA 3B1XA 4KDFA 2GX6A 3F49S 2NSDA 2BY4A 1W9MA 3I1IA 3LXXA 4C4ZA 4WFKA 1K4KA 1MA3A 4AWBA 2G9ZA 3R75A 3L3BA 2ESRA 1HE8B 4AZTA 2FPWA 4FYVA 1DV2A 2OD2A 1T1JA 4P93A 3MRTA 4UQPA 2X2PA 1X1DA 5IX8A 5IK2D 1MAVA 1GPLA 3KUCA 3VPAA 3DT8A 1IE3A 3FZEA 2QZPA 5DSZA 3EXAA 3ZWMA 1D9ZA 2P6NA 5CK4A 1X1QA 3JQ6A 4PZAA 5I7AA 2IU4A 2ZYGA 1QQBA 3EPHA 4D79A 4ZT3A 3P52A 4RKWA 2X41A 1OPXA 2V8BA 3HV2A 4YMSA 4URFA 3LBAA 4IXNA 3C48A 1U2GC 1QZTA 1XJQA 4INJA 4K1XA 3QIAA 2HN9A 3WWCA 2JIPA 1IZ7A 1E2EA 3QXJA 2A1UB 3T7JA 3TTVA 1FNNA 4EY3A 3TLGA 1UDBA 3NLLA 2HSEA 7REQB 3T3MB 2V6JA 4DIFA 4S12A 4UVIA 1TYBE 4HEHA 5FI0B 3GJ0A 1QS0B 1LBEA 4IFIA 1XPRA 5CT6A 3JZDA 4PO1A 4RTKA 1AKMA 2P41A 4G24A 3N8IA 4MQFA 4CQMB 1D4OA 5M3BA 1KR2A 2GAAA 4IJ5A 3UK7A 2Y77A 1B93A 2ZROA 4ZYLA 3BMOA 1E2BA 3PE3A 1ZH0A 3C6YA 5JCXA 2EJBA 2MSCB 2PMCA 5FYQA 5LDHA 2OLEA 3KSUA 4J0FA 5BV8A 2IXFA 2YZ7A 4MUNA 5AI9A 2PZJA 3DXFA 4FDMA 4GMGA 2FOXA 1S8OA 3I4CA 4O4LF 4D57A 4AU1A 1ACLA 1O03A 2MSEB 4P3NA 3RANA 2XQGA 3WFJA 2BGLA 2C4KA 4FKZA 2GILA 2OL4A 3VM6A 3EASA 4DBLC 3JR3A 4PLGA 3O3MB 2AYZA 4ZAYA 3G9XA 3C0KA 2Z5FA 1D7AA 3DAYA 3DTVB 2I67A 1BFKA 4G5GA 1NBOA 5E7JA 1O9BA 5JO9A 1R15A 1ATIA 3LT0A 4A03A 2NWQA 2RKWA 3DDNA 4EUSA 3T1YB 3MGKA 3R40A 4D4LA 3J80A 2PH7A 3IR6A 2B1GA 4PYMA 2OV4A 3ER8A 2WJYA 2FJUA 2GM9A 3B3FA 5DBIA 4QSHA 1IBMB 3KJEA 2P5UA 1M1XB 5AJWA 3BWEA 3R7SA 1MQAA 3QE9Y 2H4XA 3I04M 2GBLC 2NZUG 3PEUA 3ZEAA 1GNQA 2ST1A 1LC0A 3PE6A 2OB2A 2FGJA 1D0IA 3EGCA 1I2AA 3FD8A 3PPVA 4RYLA 4AD8A 2VHCA 4Y2GA 1VSTA 4F0JA 4YRIA 1L8XA 1WXWA 4DIMA 5IZ4A 1QNLA 3OE1A 4JLVA 3RF6A 4CKCA 1MO2A 1T6YA 4UUPA 1GL7A 3GBPA 4AM8A 4KAJA 4RHTA 2YN0A 2KBEA 4C88A 4KACA 1M8JA 3QY0A 3KQUA 4E4TA 2GM5A 2WG2A 2WNIA 4RVNA 4CF7A 1USIA 4TQ9A 1E2MA 3A9RA 5DYYA 2W9XA 1V71A 3OKAA 2A94A 2W2VA 2VP6A 3PXCX 4WLNA 4FEGA 2JEOA 2R86A 1Y1RA 3ZR4B 1R4ZA 3BTVA 3L8HA 2IKSA 4DDVA 1E58A 1K1EA 2LV8A 3BHIA 3NDJA 4E5YA 1CFZA 1ESEA 3OUTA 4JMLA 4RLSA 1DQZA 5IT0A 1FXWA 2Q3JA 1XMIA 3COZA 3FWKA 1K7YA 1R88A 4N49A 5CW1A 1JIJA 2PUVA 2NU9B 2QLLA 4R54A 4JXZA 2CLEB 5ALYA 2Q9BA 2X8JB 5HKBA 4U0JA 2YOHA 3F46A 4J7XA 3P9PA 4WEOA 1OXTA 3LUCA 4N5IX 4WN3A 4C7OB 1N5RA 1VSQA 3NTLA 5FBKA 5I3ZA 1DBPA 1O0CA 3P4XA 3THYA 2I0FA 3RM3A 1C30B 4BNTA 3GXOA 3QNMA 2P0EA 2FSIA 3U4QA 1P2GA 3ICOA 2D5AA 3C5CA 3UB2A 1QG2A 2CY0A 1OH8A 2YN2A 3TTTA 2OBLA 3HTXA 2YRWA 4MRVA 4W9NA 4C7XA 3NETA 1URPA 4LEIA 2HXGA 1CUSA 1FSFA 3LLVA 5DXAA 3ZHRA 5DHRA 3PPWA 2KYRA 5DHQA 3L8EA 9GPBA 3UYLA 4PFSA 5U4XA 4EGAA 4NXNB 3PQDA 4CTOA 1KJNA 2HRRA 3G23A 1R10A 3R9XB 4JY7A 3DT9A 4UPDA 1Q92A 2I2WA 3FXAA 3TM5A 2XT6A 1NMQA 2X15A 4LDZA 2FX3A 2G1AA 1VJGA 4MARA 4Q3LA 4Q3EA 3K4PA 5CJJA 5B30A 4GZLA 5EYPB 1VGRA 1R0YA 1YMVA 3BX1A 1THGA 3FKSA 1OZAA 1SVMA 4G1CA 2Q49A 4B32A 4BVJA 3ZDDA 1NLFA 3DMNA 3DUWA 3OCZA 4GH5A 3ORRA 2YL2A 1NW3A 3GAMA 4ICIA 4AUEA 1KMCA 3VISA 4NBUA 5IUJC 2XF8A 3CRVA 3R8XA 2V7BA 1KAHA 1R8XA 2CZQA 2GAIA 2VUUA 3G0DA 3QE3A 5DI3B 4M8KA 1PAUA 1BN7A 3F4LA 1MZPA 3T7KA 2Q3EA 2C9BA 2ZXFA 2AMJA 4QO8A 3MIZA 1K66A 3BXEA 3VH3A 2ECKA 3W0LB 4H31A 3HACA 1OGJA 2KPOA 3B6EA 2JLCA 2CDCA 2QY9A 4YDSA 1NVVR 4Y2QA 3HZRA 2GTIA 4OJTA 4WDRA 3SFZA 2FI1A 4BYMA 4WNCA 3HR8A 2AG5A 2NSLA 2C4HA 3L7KA 1OC4A 3NEJA 3SMQA 1IVNA 1LLCA 4H18A 2R84A 4JLSA 3RTGA 2PUFA 4Z4GA 1EMDA 3OKFA 1U4NA 1DLIA 2QB5A 2Q5QA 3FKSD 3VYWA 3EG5A 2OHOA 4YJHB 4XWKA 4K40A 4HPJB 5FHRA 2WZQA 4IEFB 4K9MA 5EXDA 3W3AA 3UG7A 1X7XA 3CUVA 4PICA 4L28A 5K8LA 3RBZA 4JLNA 1SCIA 3GJ3A 2FN7A 1OV6A 3AL3A 3ESXA 2RH4A 3AUSA 2D1QA 4FQ8A 4ZU6X 5FWXB 1SVLA 3MLBA 4HC4A 1NN0A 1TECE 3ZVMA 4QYTA 2JGMA 3WXMA 1M83A 1EA5A 1FMLA 1U3DA 2A59A 2V7XA 4QBFA 1K6MA 1E4EB 1JT9A 3NTVA 4LZWA 4KH1A 1OAOC 4RELA 2O2DA 1D6SA 3TKAA 3UA4A 3NHSA 3NHWA 2P35A 4QHSA 3JQGA 3NEAA 4TT8A 3UW1A 1C8KA 1ISFA 1E92A 2WPDD 3SD7A 4BNWA 3BSYA 3TZLA 3UHFA 1IIRA 1FRZA 2GRJA 2FW7A 4LC1A 2FLWA 3MW8A 1U0JA 3ORSA 4PC3A 4TKLA 5CM8B 5B3JC 2I9KA 1IN6A 3BD7A 1FVOA 1B0UA 1USVA 4X60A 1GRQA 3ZC3A 1P3Y1 5B2EA 5FL3A 4BFSA 1PEYA 1E1LA 3O8DA 4A2WA 4L8LA 2SKCA 1QX4A 4WJZA 2GN9A 1GRVA 3ZD9A 1YB7A 2XYPA 3OPYB 4FYHA 4HLUA 5JDIA 1U1EA 1JL3A 2QMEA 2P77A 1X94A 3MF4A 5DX1A 5G40A 2BFPA 3CNEA 4WBSA 2COKA 4PTLA 4Z0HO 4FXPA 5IUNC 3RKUA 3RT7A 3IEUA 5C35A 3UV3A 2FPGB 2PXAA 3PBKA 2PX2A 5JSKA 3KQNA 1GTMA 4D9BA 5LUAA 1DE0A 2ZUBA 3LDUA 4JBGA 3QFSA 1YR7A 2H2HA 2NTJA 5H8WA 1MCZA 1C2YA 2IYZA 3NWJA 1CUUA 4HYYA 1QE0A 2HJSA 3HBNA 1GA4A 3HV0A 4RNDB 4AJOA 4LZLA 5D2CA 4EY5A 1C9NA 1U99A 2KM1A 2BP7B 1PZMA 1T0IA 3OCCA 1M8PA 3OAAA 4I5FA 2C2OA 2K2WA 4J4BA 1P31A 1NZJA 1RYBA 5JCJA 1MG0A 1EXMA 1F6BA 5CVVA 1UJ6A 2QYHA 3GZNB 3NX4A 4XEHA 1J8YF 2OCXA 2IPOA 1SB8A 3QNUA 4XI9A 3OWXA 4ZVQA 1N4AA 4D98A 2FWNA 4E08A 5ALQA 4DYDA 2VSXA 2R7AA 4ZZ3A 1ZD4A 4JKIA 4WESB 1TUIA 2Y8EA 3GFGA 3H1PA 4AJJA 4TS1A 2LWIA 1K2WA 3BIOA 1YZHA 2IXTA 4XJXA 2ZE6A 4PFQA 5DNEA 5C7OO 3ERCA 2MCFA 4IIVA 4YC7A 1ZFNA 1Z2EA 3FNHA 1RVV1 3GCDA 5BSHA 4WK2B 5ANRB 3DMYA 1SUAA 3ZI4A 4CIXA 2QXUA 5IDYA 2F00A 2X7JA 2HF2A 1S0UA 2CWWA 4ZC8A 1H9CA 1G4UR 4B3BA 1AQYA 4OA8A 3M6AA 1GA1A 4W8OA 1JHAA 2O5VA 4GYJA 2QUBA 1KI4A 4E2XA 3TCKA 3KAKA 3ZZNA 4MS1B 1KXJA 1R4MA 1GQ2A 2PNFA 4M1QA 2J9RA 3VBEA 3DOOA 3D8NA 4I4NA 3DVRX 3RGGA 3PNMA 4LJ6A 3DUFB 1P4GA 5K2OA 5T67A 1E9CA 5H0IA 4KVFA 3DMPA 1TD1A 2ZYIA 4CEIB 4LRTB 5G4KA 3W6ZA 3NDIA 1UXOA 5AYVA 5HRCA 4GD3Q 4FPXA 1DJPA 1MB0A 2GHIA 3E27A 4C6TA 3ZJVA 5AI0A 1AT1A 1KP9A 1MVOA 1IB6A 1OKKD 1RFLA 1ZGZA 2A86A 2GD6A 4A8JA 2Y05A 3STHA 2A92A 2VQDA 3RQSA 1GZ3A 1YS4A 4YPOA 5HKOA 2LR0A 3O95A 2O3UA 1YS1X 1X0VA 1H0RA 4H59A 4CG3A 4PXAA 3I6IA 4MROA 1CRPA 1GYPA 3OM8A 4OK3A 2WWTA 4D8TA 1KQPA 3A27A 3HBJA 1H3NA 4P7BA 3T6KA 1C8BA 1WXQA 1S8FA 4XIFA 3OM9A 3WKAA 3GY0A 4PYOA 1BTOA 5D3QA 5CAEB 3EWIA 2BRUC 3G0BA 3OZIA 4GX2A 4PLVA 3JAMA 4FMCF 3UT6A 4ZIRB 4B48A 2FUNB 2VDWB 4QUIA 1L5RA 1PN3A 2CBXA 2CLLB 1NG1A 3E15A 3TQOA 4AUNA 2Q5LA 1NKSA 4CMEC 4F1JA 3OZCA 4KQFA 6GPBA 4BMVA 4WCFC 4ND8A 5E3IA 5IAEA 2VPYA 1JDBB 5DIZA 2JGLA 4F6RB 3M89A 4MUFA 1W0KA 4HAVA 3FUUA 3PQ4A 5FYDA 1XPUA 4J9UE 3PQ7A 2R1TA 5ILOA 3D3KA 2XCUA 3G2HA 2FGKA 4C3UA 2QTVA 4R51A 4AS3A 3WGMA 5TVGA 3WHLA 1H2EA 4QGAA 4E09A 1QZ3A 2ZCVA 4G0ZA 4MXDA 2E48A 2GLTA 1Y89A 3DOIA 5JCOC 1MIOB 1DINA 1QKJA 2AN3A 1Z08A 3ACDA 3AR7A 5CIQA 1DKOA 3VO1A 1Z2AA 2Y4OA 1VL1A 4LCBA 4E5KA 2O23A 3IUBA 4F3KA 5L3SA 1KDYA 2ABWA 3BF7A 5IZCA 1Y6JA 3S1SA 1P7WA 2VDUE 5ALZA 3OLYA 1Y80A 3O6VA 1KJ8A 1QGDA 3GRZA 1FU8A 3DT6A 3M1YA 2PA0A 4ILKA 2G80A 4NMXB 2Z09A 3WOHA 4D46A 3HI4A 4TTTS 2BTEA 3OF5A 2ILTA 8ADHA 3HR4A 2PD3A 2P2YA 4R2MA 5AP9A 3Q4GA 3K1AA 1C3OB 3A32A 4F46A 5BXQC 1ZUIA 1M6WA 1NXWA 2VDMB 3MMZA 1KYTA 2X23A 3R7BA 1XRLA 2Y71A 3ZJ4A 3VNBA 1BG6A 2JAXA 3QELA 4L78A 4CTJA 3B7WA 3LP5A 4S2UA 2DT8A 1S3FA 3IV7A 1QO0A 2P1DA 1U8AA 4KITB 3GVHA 4BBAA 5IDQA 1A8IA 2HD4A 1ZM2A 3JVVA 1SWWA 5EE5B 3DTYA 3RU2A 2CXRA 1SHJA 3NFYA 3WHIA 2WM3A 1JQDA 1Z75A 3HCBA 3HUTA 2RHRA 4PFKA 1FUKA 2FZ4A 1QIHA 2YV1A 1DI0A 4EMUA 2NQTA 1YL7A 2OESA 3OF2A 4GXQA 4YJGA 1P1JA 2X7XA 2KE5A 4JJ8A 2XWPA 2FWPA 1YRLA 4ZFNA 3ABQB 1WDWB 4O2BA 2FSPA 3D4NA 4UOQA 2F64A 1NQOA 5HMLA 4Q1VA 4GI1A 3V2HA 3E7DA 2FMFA 4EG1A 3CNQS 1J6UA 1FMJA 3QYAA 3CLRC 4RGYA 3W7AA 1RWOA 4DLVA 4RL4A 4ZDKA 3LOUA 4UVDA 2NXEA 3GJ5A 1Z7BA 4HB0A 3SM3A 3PJRA 3DNMA 1U6JA 2C82A 1M6HA 3D3JA 1ZC3A 1PBTA 2R8EA 1LTKA 4KXQA 5JZOA 1KEEB 1QG6A 3PQCA 4CIWA 2XUAA 3AUUA 2GFQA 4DLUA 4M89A 1R9JA 2IV7A 2YXLA 4R01A 3GIWA 3MT7A 3OLQA 1SQ6A 2EIXA 4FE3A 3PGXA 3DO6A 2D2VA 4D9HA 3EEOA 2GCNA 3TLMA 3OHMA 4R3UC 1K68A 3MMPA 1P3JA 2IZ7A 3KKMA 3MOGA 5CVTA 5KHOC 2D2FA 3C3AA 3M9XA 3UWDA 5C4IA 2YHBA 4JC0A 3CUUA 7GPBA 3KJHA 4F3CA 1A8PA 2JJ8A 1OC2A 1Z12A 3QG1A 2ZW9A 5IVDA 5KJ6A 2ZRDA 4TUYB 4H27A 2BL4A 1YCHA 2AI2A 3FYUA 5H59A 1I7NA 3E9QA 5AR1A 1CUCA 2PT7A 4KMOA 2J46A 5MDHA 1R4NB 1W59A 1W4LA 2O4CA 3AR9A 3I1YA 4GX5A 2DCUA 4B3RB 2QKYA 1M2EA 4ENWA 1TK9A 2K6GA 1EUYA 3ICEA 1N3LA 1B2LA 1NBIA 1T2DA 1T13A 3QI7A 4XUCA 4NV3A 1TAUA 4Z6KA 2R5WA 2QSYA 3E5MA 1M8GA 2H1IA 1OX4B 3FVQA 1SA0B 1MABA 2FVXA 2E6UX 2OAGA 3CMMA 2GM3A 4LYYA 4IWNA 1SD5A 4YAUA 1ZP6A 2Q3CA 2SBTA 2PKCA 1QM5A 1YGYA 4RPCA 1KGDA 1QH1B 4YP5A 5BSEA 4MLCA 5BWNA 5KX5F 1IM8A 2VDRB 4FSXA 5D1NA 1JFVA 3R3VA 3DCJA 5CLLA 3WV5A 1ZZGA 4BGEA 1AN0A 4ZT2A 4E5PA 1CUJA 3HMQA 4CMAA 1LQTA 1WP4A 2Q2NA 3EGDA 4ZMRA 3HJAA 4K3UA 5CB0A 1D6MA 2EFJA 3RAGA 3W06A 1X74A 3F7TA 4ZK6A 4F97A 2BEJA 2HIHA 1A5AB 1ECBA 2Y27A 3H65A 4P80A 1P7VA 2VDWA 3SC4A 4RIFA 3UT5B 3ZNQA 5A2QA 3K6RA 2HX1A 2PH3A 4WACA 3PZRA 1XK7A 4UEOA 3SC3A 1EQAA 1NWCA 3MJEA 2CSXA 2W6MA 2XUGA 5FUWA 3SHTA 4W4TA 4L27A 4J1TC 1FXSA 1W85A 4GZ5A 1XTIA 2DWPA 2A5DA 2BR5A 3H1AA 1JLLB 1VBMA 1D07A 1YFKA 2X6RA 4HAYA 4QQNA 5E6UB 1Z07A 1EB9A 2O8NA 3HB0A 4MIOA 3CZRA 3SOPA 4F2WA 4EY4A 2IUYA 4U0KA 5B6PA 5CCEA 2XEDA 3AEKB 3OEEA 5CLGA 1I4EB 2V4ZA 4BDTA 1BFUA 2FSHA 3IE2A 1ZN7A 4DYVA 1RMQA 1XN1A 3EFHA 4JNCA 1KY3A 4R83A 1ESNA 2WJJA 1NBME 3TTXA 4CM9A 3GWZA 4DDHA 2JIZA 5GTDA 3W3ZB 5EIEA 2ZYWX 1FW6A 1D7OA 4XRRA 1LSJA 3ZY3A 3ZUGA 5LD2B 1HEUA 3EXEB 3WOVA 1KHHA 3W7VA 5FB3A 3HGTA 1BIFA 2DFTA 4XWTA 1DAOA 1ZSYA 4P4SA 1U3FA 1Z6YA 4CR6A 1JR4A 5I8ZA 2W00A 3V4LA 1PLKA 4AIIA 4MULA 4C0QC 4XIJA 1N5DA 1FU4A 1GU0A 1RZRA 1EX7A 5FPPA 3V55A 1YJQA 3NNDA 2CUTA 1DKRA 4JFRA 2CEKA 5D5PA 5HKAA 2JHCA 3G9UA 4IGFA 4RK7A 1GLVA 3HWWA 4N48A 3M4YA 4ZCIA 3CZ5A 2A0XA 1G21E 1DBQA 2HLDA 4PRZA 4YJKA 5EKDA 1FF9A 1MO4A 3A1VA 3B5IA 4KDRA 1SR8A 1P3DA 3ETNA 4QDJA 1FQKA 5GOZA 4AJ2A 3ZD7A 1TYDE 1USKA 4HPXB 2AJ8A 2HQRA 4BS9A 2YFKA 5DNCA 1XTJA 3EGVA 3WSTA 1J0DA 2CZCA 4L0DA 3TRHA 3JRXA 2J9FA 2FWBA 1WMBA 2Q5OA 4MQ4A 3WLMA 2C54A 2FB9A 3LD9A 3CGGA 4FFRA 3TR6A 4NFSA 4B4DA 2WWYA 3DAGA 3DDUA 4PQYA 3OKCA 2Q0HA 1DFGA 2WEKA 5BWOA 1RXWA 1JA0A 4X95A 3NGXA 4HQ6A 4IOJA 3TW6A 2PGNA 5JRJA 4YX9A 2HPHA 3JD4A 5GJCA 2XTAA 3IR5A 1Z5PA 4MI1A 4QFMA 4M0CA 3NT4A 1PJTA 1VKNA 1RRVA 3KR2A 4LYJA 4GPBA 5J4HA 3Q0EA 1KQGA 3CVVA 4EMSA 2Z6UA 5ALEA 2W2TA 1ATZA 3E9ZA 3IQHX 5EE3A 2WV9A 2C20A 3KHUA 4LRWA 5EE9A 4MIYA 5BN1A 3U61B 3H0KA 3PQ6A 2P9YA 3DE5X 3O3OB 4I7EA 2AG6A 2QR5A 1ZUNA 3PYXA 1R0SA 2D3WA 4RD3A 3PJFA 3W34A 4DN6A 1UBCA 1Y4AE 4CGZA 1NRXA 3FDIA 1AU9A 2QTGA 4FFVA 4LXGA 1IY1A 4IV0A 5LP6B 3K0EA 3L6UA 4C21A 2DKOA 4G01B 1IEQA 2WG0A 3WGOA 1R6XA 1F17A 1E1RA 3M5DA 1IFXA 2D0PB 3ETHA 5EIAA 2VTEA 4JENA 2BKVA 2AFIE 2ARKA 2RONA 3EC7A 3HUEA 3R5HA 3COYA 1QQAA 1KS9A 1BW9B 1DCMA 3QW2A 5KQMA 5JXGA 3DBOB 4NZOA 1ZX1A 3A1CA 4FFNA 2D5IA 2EBWA 5CA1B 2WHRA 3OY7A 3G2PA 3W2IA 3TVTA 3W1EA 1J90A 5B4UA 4BV2A 3N5KA 4AB1A 2O57A 2XMBA 4XJVA 1RAGA 5F7XA 1V2HE 3ZGXA 4P81A 4R81A 4XYEA 5JPIA 2D5BA 1A9RA 2J45A 2OV2A 4ZVTA 3QVOA 1QH8B 1U90A 3C24A 3I5AA 3U7JA 3FUTA 5KWSA 4HVTA 5GM2A 2ONKA 3O8CA 4JQZA 3SSNA 5DIFA 1IY2A 1OU0A 1X15A 1GLNA 1DUIA 3JYPA 2FCAA 2W2XA 2RHLA 3M1IA 5IK2A 4AC9A 1VA4A 3BD8A 4PS0A 4WBXC 1A88A 1F48A 1LXCA 4P3XA 3P0IA 5FIUA 2A8YA 3Q6MA 5J23A 5L4SA 4NBKA 1DFHA 4IO1A 1POWA 2X86A 5HFAA 3AL0C 1XGKA 3OEED 5E4FA 3KP1A 3L8FA 4EYEA 1BCRB 1SEPA 4JLMA 3H2KA 4KQMA 3BWMA 4N4AA 4JQOA 3EULA 4JI0B 1D2NA 1QFZA 2BHSA 2WMDA 4AWXA 4I4TA 3ROKA 4CLRB 1P2UA 3NOOA 4DANA 3S27A 5I9NA 1UBOS 1YXMA 3QZUA 2AS0A 5KYWA 1P7ZA 1MX1A 1YT5A 1SO8A 4OREX 5AXCA 1W5EA 3SN6A 3EPKA 1ZBQA 1VHTA 4WH0A 3RYTC 1K6XA 3UGTA 4RO0A 3RRYA 2AN9A 4GHWA 5BNFA 3VI3B 4LY0A 3VZDA 1IZ8A 2WJPA 3SF0A 1Q2UA 1GQRA 2ZIAA 2JFNA 4OMUA 4M7RA 1NI4A 1FNCA 2E2WA 3K5WA 4FCCA 4V0MA 5AK6A 5EIHA 1RBZA 2NZVG 2R6R1 3HU5A 3CLRD 3EXHA 3IMKA 1TZBA 3K2IA 4K2HA 3U1VA 3KIPA 5IJ0B 1NVAA 3N59A 3VPFA 3BM5A 4QOIA 5ALIA 4BFVA 4CQMD 1YB1A 5CHEA 4C20A 1R74A 3H84A 4NDAA 5IANA 2QSJA 5F35A 4RPHA 2ERCA 1Q7CA 3NM6B 1Y33E 2JAUA 2ZBFA 3K9NA 3OIDA 4FBLA 4J0QA 3ILXA 1ZKDA 3KZ1E 4ZOAA 2IY9A 4PCUA 2DWCA 3F1LA 5FCDA 2Q6OA 3QKUA 1XWWA 5FD8A 2B9VA 4J0CA 1JE0A 4Q01A 3LGSA 2VBIA 1XTTA 3B60A 3ASZA 4YMIA 4D4KA 5A5DA 4FOTA 1OI4A 1TRHA 4PRKA 5K4AA 5IJZA 1WPQA 2ZWPA 2PZEA 1WNTA 1G8YA 2NO6A 2CMFA 2LD4A 2P9FA 3GJ7A 3M81A 5CLIA 3AVUA 5EKTA 3N2KB 4HAOA 5IG2A 5DF1A 1JP7A 2ISCA 1BVYF 4U3JA 3AKYA 4AXBA 3MB8A 1AK9A 2HSJA 1M33A 2I4LA 3BULA 3DMFA 3F1KA 3GT4A 4K6FA 4AAYA 2K7FA 1E63A 3P9YA 3WWYA 2XNDA 1TJPB 5FR2A 3GFQA 3FOAA 2EDAA 3V9AA 2IE8A 3Q7IA 4WZBA 1YJBA 1XXHE 4WUTA 2GXAA 1GWNA 1YI8A 4ZXFA 1A9QA 2ZVQX 3EVBA 3GXBA 2PZ8A 4HGQA 4QJ5A 5CPFA 3ZS8A 2CUKA 3BB3A 3VKGA 3ANMA 3VKWA 2UZAA 5D3MB 4AKIA 5JXWA 3RRBA 1O6BA 3SR0A 1NVGA 1RE1A 4YJ3A 5IS2A 7YASA 2QLNA 3LLSA 1FDUA 1WPRA 5LDDC 2O8BB 2EBHX 1S2LA 1UEXC 3KV3O 4X3PA 3G2QA 3H4TA 2AWOA 4LDRA 2OYRA 1SPBS 4GVPA 3T1VA 4ZHQF 4I19A 4TOIA 1GR0A 1ESZA 3ZTYA 3O8OB 2ERYA 3FCOA 2O8VA 3EXHB 2AV6A 4ZXPA 1BXKA 1N7JA 1W1UA 2HNBA 1UBTS 2ZUSA 4HDRB 4YDRA 1WY7A 1JAXA 2PT5A 2ZBDA 3DHVA 1NQWA 3Q5DA 2PM8A 2PZLA 4JT9A 4AN1A 3A1SA 4E5SA 5BV0A 3IO3A 1GQOA 4G0XA 5BNIA 1U8XX 2JLZA 1XU7A 2H2WA 2IOYA 3AZQA 1KNQA 4OGWA 2ZIFA 3ZWDA 4RX1A 1KP2A 1PFYA 2DP4E 3BA6A 3NCTA 4EZEA 2LCFA 1S3GA 5BPFA 1WMFA 1QGUA 4XWAA 2Y1WA 1G66A 1JU9A 1R50A 1TT5A 1XKTA 4LNUB 4ARSA 3DZJA 4BNJA 5JJBA 3FUCA 3X1XA 4B43A 2B36A 3LLCA 3UOAB 2HB6A 3JPWA 1UEIA 4FJ0A 4YJ3F 3IL2A 1HV8A 4IV5A 1YCFA 1YDGA 4ZO4A 3VMFA 5GZ3A 4GPAA 4EW2A 4O4IF 3JW8A 1NPYA 1SNYA 5KNLA 4DADA 3HNPA 3KV1A 4ZHQA 4DMUB 2PS1A 1Z0JA 3EUFA 4UNIA 2XH8A 3D9QX 3SAJA 1SHUX 4TV8F 3SHQA 1OZ0A 2KS6A 2NU6B 3DE1X 2Q5JA 3FWHA 4J8PA 4JCCA 1IL0A 3TL3A 1R0BA 1Z2CA 4GEGA 2XDWA 1BX3A 1K6JA 2VWHA 3VR4H 1YRWA 4EB6A 3TWOA 4J7CA 2QV7A 1KJIA 4Z8XA 4XGQA 4O0MA 4XQ0A 2WF8A 2XRMA 5TPZD 4DTCA 2RIRA 4Q1BA 2VK4A 4Z53A 3ZGYA 3CJQA 5LIPA 1FRQA 1RTTA 2UUAB 5AKYA 3T9CA 2QRKA 1V4BA 2UZ3A 1Y3HA 4ITUA 4ZRMA 1YFJA 4RE6A 4GKKB 3QXSA 1UC4B 2OZLA 2H0RA 1P7YA 2C5LA 3RSZA 4AZWA 2KLBA 3RUAA 5JQGB 5BUQA 4YWJA 4BFCA 1QAQA 2XXBA 1BJTA 4O4IA 3AUJB 3KPUA 4AJNA 4JUIA 3HI6A 3FFXA 5IAKA 4BKUA 4TN5A 5EP4A 4UHBA 5A62A 3NHLA 1D0VA 4KE9A 4R8MA 3JVEA 4RMIA 3P9RA 5J59A 4CTMA 1K5HA 4FYKA 4MEBA 3IP9A 4PINA 5L95A 2A7XA 4NG5A 1Z6ZA 2C97A 2HIGA 3N53A 4N7RA 1H4SA 5KOJA 4A0HA 4QXAA 2V6BA 1ZL2A 1II9A 2PGIA 4IOLA 4R40A 4X8OA 1BHO1 3ETGA 5KAMA 3UNXA 4X6UA 2XA1A 3K6SA 1Q1GA 4ESEA 2XMDA 3HCCA 5AHKA 3ECSA 4YRRA 1N2CE 1PJRA 4Y0NA 1KRHA 1UH5A 3V1LA 3V6LA 1APBA 4IWXA 3QPAA 4LHVA 3IT0A 5CMLA 4C7VA 1Z4MA 1BWRA 2FZWA 4LZJA 4YJ3B 5HK8A 1OTYA 2OUKA 2RH9B 3CRW1 5SYAA 1ZVKA 2B4AA 1M9NA 2ORIA 1XZJA 4J4HA 4URUR 2JBWA 2IU3A 4MUGA 5TQ2A 3RRZA 1RHQA 4H3SA 1CP2A 2GESA 2J0VA 3K3PA 4KO1S 4OLFA 4XW2A 3EQZA 3UJ7A 2PR2A 4Z8YA 1AHPA 4GKBA 3R5XA 4NZMA 5BT8A 4L0QA 4EGJA 5FTKA 1AS3A 1TIKA 3GJ4A 4OLBA 4P5EA 3B36A 2VYND 1NHWA 3PXUA 3A14A 3AYXB 1DIBA 3QU2A 4MCIA 3HB4X 2V0NA 3H4MA 1XFAA 1P5HA 4Q4HA 4Q02A 3A3NA 3AM1A 1WD7A 3FFWA 4G1MB 4NC9A 2QVCA 3NIBA 5F5XA 2X40A 5ILGA 3USCS 4F6LA 3NBXX 3SF8B 1V1MA 2A88A 3A3KA 2FMHA 3G6KA 1T3HA 4NICA 1PJAA 2ON6A 2M6LA 1ODFA 3WLOA 1MOQA 4QVKA 4CFYA 3BA1A 3BRWA 4Y1RB 1FFXB 2DGDA 1D5CA 1XROA 2NV0A 2NIPA 4UUAA 1AHHA 5ALKA 1JFSA 1YQDA 1Z88A 3EQ6A 4HZIA 3DDHA 2VWGA 4L2IA 5FBVB 1JVSA 2FXVA 3UJBA 3L9WA 4MV7A 4DM7A 1J9ZA 2CXUA 1PZNA 2BCEA 3LCUA 2RKOA 3NHBA 2O8CB 3IEPA 4BRSA 3DD1A 2FFAA 3T3HA 2AEJA 3WJ1A 3D6HA 4BNIA 2DLNA 1L0BA 4U7PB 3V2IA 4P4SB 3BMCB 1OX5A 4Y9TA 4OQXA 2QZ4A 3ZZ0A 3CY6A 2DHCA 4UAUA 1WOMA 5LQJA 1NKTA 3ESBA 1UP4A 1XPJA 1MG5A 3KJFA 2H1SA 2FEMA 1KRWA 1LVHA 3C3KA 3DULA 3E7XA 5EPEA 5K3DA 3VSEA 3DVAB 1FMCA 3EVTA 3WICA 4ERNA 1N2IA 3DBRA 1P1BA 2YCBA 4DQDA 3U7FB 1LH0A 2RAVA 2A6PA 3OPVA 3OQ1A 4H6XA 4JVOA 4QQRA 1EPUA 4BFXA 4CFSA 2F3QA 4US0R 3KG2A 4UTOA 4LF5B 2XUKA 3VR1A 4EKYA 5JVDF 2HDHA 2COUA 1HE1C 5EQFA 1ZG3A 1LW6E 3VNUA 1JEQB 2CXSA 4QYXA 4RQAA 4X90A 1I6MA 4ZVOA 1LPPA 3CCBA 2JIDA 3HL4A 2CD9A 2Q7DA 3ACCA 2FQYA 3W05A 4O0LA 1ESCA 3NRCA 2H9IA 3L49A 3FHCB 4PIPA 1NUTA 2XCRB 1M72A 5ALGA 1XV5A 2VNKA 1MFZA 3FX2A 4J07A 4FDVA 1RWNA 2G28A 3STYA 3RC7A 1L5WA 4ENUA 3PNKA 4ZOEA 2C2HA 1JFTA 1Y7IA 3UKDA 3EQ2A 5LMZA 1CEYA 3PQ3A 3NDPA 4O4JB 3Q8LA 3I8SA 1YQTA 3AHFA 1RRMA 1VL0A 3RBVA 3ZQJA 1PCXA 2D3TA 4Z9AA 5JUWA 2QAJA 9LDTA 1QV7A 1SC4A 3VPHA 5EWLA 3PA6A 2B4RO 1QP4A 2PU5A 3HKDA 1YQUA 1EP2B 5FTMA 5LUBA 4AZVA 1RWPA 4ZEMA 4TV8A 5KX5B 1DZIA 4Q66C 4NPCA 1E6WA 2RHDA 2XUPA 3BXFA 2BZSA 2CHUA 4Q4AA 4YP0A 2PUCA 2V3CC 4L9AA 2EP5A 4MKRA 1I7SB 1JKJA 5KYXB 1YA8A 4YECA 4Y6RA 2JNWA 3E8SA 2OHVA 4ZOQI 1K86A 2GJ9A 3ND9A 4KPUB 1VHWA 3FB4A 2ORWA 3INTA 2Z83A 5HUQA 1EBUA 3L7NA 4WLVA 2RBKA 3IVRA 4Z99A 3Q7PA 2D2EA 2Q46A 1PT6A 2PFGA 2QZ9A 1VCHA 3JD1A 5IBPA 3WLPA 5CXSA 1CZNA 3GV0A 3CIFA 3JRNA 4OHBA 3SQMA 3F9RA 2TMDA 2WM9B 4EB0A 3O7MA 2HYIC 4DWJA 5KOHB 1D4FA 1RXUA 1NMYA 1PGPA 1YACA 2EP8A 3LQ1A 1RHRA 4FWIB 3S2GA 3GUHA 5FUBA 1RD4A 1W30A 1WXDA 2I65A 2O07A 4MDHA 4NZZA 2RC5A 1ACJA 1IIBA 2FEKA 1K06A 3A4TA 3PUJA 1NVDA 2PKYX 2IX9A 4C0AC 2B5OA 5TMPA 5BSGA 4KUGA 2NO7A 4N8EA 4M8SA 1L5HA 2AFHA 3O91A 4PZZA 3LRPA 2N46A 4C07A 5LL6P 4W8HA 1T4BA 1JR3E 2AJCA 4UUOA 4W82A 1ZRSA 1CY8A 3UBMA 4EAQA 2AFIA 1P2BA 5LB2A 3LT4A 4JVSB 3OESA 3NHFA 4LKOA 5LA6B 2H31A 2VOEA 5KSOA 1NIJA 1N1EA 2YX1A 4FFLA 1LRLA 1IG0A 3HL0A 4QAJA 5I47A 4RTRA 5AI8A 3PITA 3UFXA 1P74A 4ZDJA 4EITA 4F4HA 4LNHA 2BDTA 3JQRA 2OT3B 1JMKC 5HF9A 1QVVA 2NMVA 1BKDR 5IKOA 1QPZA 2OSVA 2YMPA 3D64A 4RENA 4COKA 2OTCA 1ORVA 4K6KA 3V1KA 1NV8A 4MGKR 1N1MA 2VHEA 5ELLA 2W43A 2CNDA 2WYHA 3GW8A 1JZQA 1MX9A 3MUEA 1VE3A 3HGQA 5DBEX 3CWZA 3W4JA 5BNZA 1ZIOA 5F1YA 4JXXA 5H5JA 5D7BA 2PRKA 1KFCB 5LZ2A 2C77A 4NZNA 1TU4A 3LCRA 1DAEA 4QAQA 2VQEB 2BYTA 1DHTA 1U4SA 1ISHA 4LJSA 4AQDA 2AOTB 4J0HA 1SEVA 1AKWA 3VDXA 4D0SA 5CFPA 5ALDA 3SBDA 2AKAB 1OF1A 2PWYA 4GBED 4IJWA 3PD0A 3E0XA 1G8GA 1SXJE 1FDWA 1FNSA 2VPQA 2WI8A 3KXKA 1PX2A 2VRNA 3QMMA 1DSSG 3IBYA 2VBGA 3JQQA 1HFKA 4PANA 4XH9B 4AVYA 4DIOA 4Z0PA 1E0DA 3C8HA 4I1RA 3E61A 4DS3A 2N47A 2WD9A 2Y76A 3ELYA 3GYBA 3WGLA 3D1JA 4DQVA 3QUSA 4ESVA 3PX2A 1YL6A 3JD0A 4NYMR 1A8UA 3GQBB 5EHXA 4IQGA 4MIEA 3HUFA 3LA6A 4ZT4A 3T12A 4PRLA 3HM2A 3L4KA 1ENOA 1V3UA 4EUEA 2JZCA 1MVNA 5FNVF 2VJBA 3L4JA 4B3MB 2VA8A 1A2KC 1XTKA 3VYTB 3QPDA 4KR7A 1V5IA 3JQDA 4IGEA 5LZ4A 3PC8A 6PFKA 1OBFO 3Q9LA 5K8UA 5KVSA 1XZLA 3HCEA 4OHRA 4IDHA 2WJWA 1UMCA 2FNAA 4KEAA 3SBEA 3I0ZA 4WGFA 3D0OA 1NLMA 4GAEA 2JB9A 3A9CA 4M99A 5BR7A 1V95A 1Z56C 1ILWA 2WAAA 4KDEA 2ES4A 4DLYA 2CCKA 2Q3LA 3OCUA 5AK3A 3RDPA 4GOJA 1AXEA 2C1EA 3DLTA 3P97A 4O2BF 5B4TA 5K7SA 1R9GA 4OFBA 2QGNA 2LNDA 4NBLA 4B79A 1I3LA 2VKQA 1CZHA 4MWGA 4UUMA 1ZNWA 2GEJA 1HE4A 2R6DA 3PNPA 4HV4A 3GLGB 1KYYA 1ZGAA 2BSAA 2RG1A 4KQIA 5FP0A 3N2EA 4QODA 3AETB 3A1WA 4LIPD 4X71A 1ZCJA 1GG9A 3LAWA 2OV3A 4QFBA 3REQB 1T6XA 3E9DA 4LI3X 2EVWX 4J29A 4FCWA 3ZVNA 2QXTA 3DCYA 1FYWA 1RWXA 2CNWA 5BPHA 1LSUA 4A8JB 5K0CA 2AKEA 3GLUA 2C9MA 3V7FA 3BK1A 3RIYA 1DAIA 4K6OA 2JJMA 1J8FA 4QUDA 5LP6F 1H2AS 4HDSA 1UBJS 2FW0A 1G8PA 1GN9A 2MSKA 2OYSA 3ZW9A 4ND6A 4G07A 3SBOA 2E85A 2YWDA 3TJRA 4PLCA 1EH5A 2QQ5A 3OUZA 1G1MA 1ZQ1A 3ZTTA 1W2WB 5FAKA 4DB4A 4JUAA 1BVRA 3HZHA 1C4WA 6NULA 3W79A 4N3GA 4ED9A 3BAZA 1ZCFA 3CCFA 3W5DA 1TF2A 1CD5A 5GGXA 1O57A 3OC6A 2PZFA 3SYKA 2R8RA 4AECA 3PEYA 1NW5A 2AEMA 2EKQA 2XITA 4I8IA 3RYIA 2KW5A 2VUHB 2PZGA 5H80A 3L0SA 1NX6A 2FF5A 4LXTA 4V0NA 1BX1A 1Q91A 4CDMA 2DUWA 5IXSA 3QEAZ 3B1ZA 1PX0A 3BE5A 4DJEC 1GN8A 3HDVA 3N2GB 4FNAA 4EUFA 5EIBD 1PL6A 2GFIA 3RQIA 1M6YA 4UFNA 4EG0A 1E64A 5A2GA 2GNOA 1W7AA 5JH7B 3EXG1 3O26A 3SP1A 1J2UA 2I3DA 3D43A 2JJ1D 4L3OA 2J6BA 4PBTA 2ODTX 3SI7A 4JV5B 1U0TA 1HT0A 2NTYC 3O47A 4HSGA 2UXCB 1DDOA 4NSNA 1DMRA 2Q6VA 1Y3DE 1YBHA 3S1AA 4BP9A 3A2NA 4P32A 3P9ZA 1RLOA 2WABA 1U2EA 3FLEA 3IDQA 3KLOA 5AI6A 5DX8A 4CKEA 4J1QA 4NMWA 4ZAXA 3VHQA 3EDRA 9MHTA 4TPKA 4FFPA 2L19A 1Q44A 2ZJ7A 3R24A 1NULA 4I3FA 3E3MA 1VB5A 2A3RA 3I1FA 3WGVA 1JQLB 1DBIA 1Z25A 3KR0A 1AGXA 3NC1C 4JFAA 2FN4A 1DAGA 2FOIA 4ZV9A 2PUDA 1GYQA 4FVTA 1DKUA 1FRNA 1ESMA 2FFBA 4KN9S 4KYTA 4J7AA 5J9FA 2E87A 3QP9A 1M74A 2XRZA 5CVJA 3PFNA 3KWJA 4JL5A 1ACMA 2XQKA 1KTVA 2QVLA 13PKA 4P4TA 2W7TA 1WQ4A 2P4EA 1MJ5A 1FY2A 2D5CA 3M5WA 4OEHA 1PG2A 1UK7A 5CH3A 1F60A 3DZGA 3BD9A 3YASA 1XT6A 3K1AB 1BE8A 3I8OA 4A27A 2YUTA 4NE9A 2B3TA 4BQFA 5CA0B 4PZPA 5A6SA 2PGJA 1KQ3A 4CHGA 1EUQA 5IEBA 1W4CA 4GKJB 4R9VA 1Y9DA 2NUAA 1YRBA 2PA3A 2XMCA 3OPXA 4BDSA 1X39A 1XZKA 3JALA 1SUWA 3ZXYA 2REXB 3L7JA 1QUFA 5L7YA 3I01A 4WLFA 5BOVA 1R3UA 4BQRA 1P73A 1PFKA 4O4LB 5LQRA 5DISB 2RSLA 3QLEA 4B3CA 4UFPA 2QENA 1V25A 4NAHA 3JQ7A 4I1PA 4WEQA 3SZOA 5IKMA 3SQNA 1K0UA 1G98A 1EVZA 1SG0A 5ECYA 1EX6A 5DLEA 5ADUS 1HE3A 5IJWA 3T5PA 4MLPA 1BYUA 3L77A 3PRKE 3HYNA 2YWFA 3QVLA 4AN0A 1DEHA 1XR3A 2QEQA 3HKEA 3C4VA 4XJSA 3HU1A 3VC7A 1EZZA 3F9IA 1L7QA 4JJFA 1JEYB 1I5OA 2Q1TA 4QLOA 2AKYA 2EJUA 3SFVA 2CL6X 2QVYX 4K28A 2P40A 4Y9SA 4BNUA 2ZJAA 2UXBB 5J2UF 2X5JO 3CR8A 5F7ZA 3NOVA 2IZ5A 4R7ZA 4DA9A 3IAM1 2RKBA 1ID8A 1RKQA 5T4HA 3LUGA 4TGLA 2QN6A 2MJLA 3TQTA 2X9GA 4HFRA 5SY6A 2REQB 5CAEA 1T2AA 1O0BA 3GRCA 1DAFA 3AERB 3IUMA 1J33A 3TIGA 4BO6A 1JR2A 2WP8J 2QTRA 1ND5A 2PGOA 4JOBA 2E6KA 2OO7A 5IP5A 3UKOA 3WL3A 4DCJA 4DA8A 4HMQA 2M6KA 3WB0A 3DVQX 4Y8VA 3H83A 1W5BA 2HJVA 5FLKA 1VMDA 3RRNA 4R2XA 5JANA 3A6ZA 4OM8A 4D9FA 1TE2A 3R3UA 2RK4A 4QUHA 5DBHX 1LK7A 1V0JA 4IDGA 2PVSA 1RJFA 4QXRA 3MPUA 3ZHUA 3MINA 1GV1A 4DT1A 3LX4A 3VSBA 4KFTA 1HQKA 1T1IA 2PNJA 1JEQA 2VYVD 3KOYA 4N8DA 3DE2X 5LMCA 2ZJ2A 2O2YA 3ESRA 4KBFA 4PHHA 3T3IA 4OQFA 1N2BA 4MCHA 2Z2ZA 3M6MD 1HWYA 3Q15C 3WADA 1E2KA 3QJGA 1JHXA 4IHAA 1GPMA 1QYXA 2A9FA 1K8YB 3PHLA 5DVZA 5A04A 2Z04A 1G17A 1B8PA 4V0RA 1NVWQ 1LTQA 1ZLXA 2B92A 1Q57A 3MUNA 4Q1DA 3OPQA 3WG9A 4Y2JA 4N41A 2HGSA 2O9JA 3ETDA 4KZKA 2C88A 2IDMA 3LTNC 5A0FA 1QR6A 1VGQA 2H92A 3U4HA 4NOJA 2C4UA 3PC4A 1BMFD 2A0YA 2WMNB 3L8YA 3QK7A 4MMYB 4RLHA 2J5QA 1YMQA 5EIXA 4J2TA 5CR9A 5JCZA 5BMVA 3MD0A 1DC8A 1ODLA 3HC7A 3U44A 1OLUA 1WW8A 1Y4ZA 1U2RA 5DK4A 3JV7A 1QP7A 3Q2KA 2XGJA 4DEVA 621PA 1L7NA 4RYDA 2FPMA 2BFWA 4HN9A 4N54A 5T4BA 5LQMA 4TTSA 3WQBA 2NUAB 2JZOA 4G25A 3CRZA 3EJ6A 1NAIA 4K0RA 3EK2A 4UTRA 3U40A 4V1CB 2Z2XA 3O1IC 1NNEA 1USGA 1O3YA 4RNCA 2QMZA 3BH7A 3RTBA 2BGMA 1X42A 2DUJA 2VQ6A 3SJ7A 3TOVA 1DXYA 2FPSA 1MW8X 2Z4TA 3P0HA 2J0SA 5EXTA 4OSPA 1S9HA 3PICA 2JD1A 2OGTA 4E12A 2QBYA 4N65A 1JZTA 2ZRMA 2X0IA 4QYWA 3REFA 4MUBA 3U26A 2BOVA 4XDZA 3I5UA 3IT3A 2D1FA 2OD7A 3LZDA 4UBKA 2R6FA 4JMPA 2JJQA 3AHDA 2AF3C 1DJNA 3LCMA 3A6LA 5JJKA 2EW1A 3WLAA 1TX4B 2VSYA 2RGNC 4PF1A 5TC4A 1AMUA 3II6X 1GDDA 1Q0TA 1DL5A 1A8SA 2A5JA 1IHOA 2INGX 1TDJA 3BF8A 3E58A 3LC1O 4HQRA 4ZCTA 3EUEA 3FFBA 4XUDA 1I3OA 3E03A 4NFYA 4UBLA 4UHDA 4CRWB 1MJGM 2AC4A 2UUOA 3P9XA 2V5VA 1GHTA 2P1RA 3EG9A 4IP0A 4KO4S 4KO8A 1DRVA 5EERA 3MN1A 5EXSA 1T2VA 1DX9A 2NT3A 3CNOA 3O8QA 1TYCA 3OOWA 4EABA 1B8VA 2VPWA 2CLOB 4BWGA 3WV4A 3VR3D 2C92A 3IOMA 3LQFA 1AF7A 3ANXA 2A58A 4HG2A 3LZCA 3VZCA 2F90A 1GXSB 3LTEA 2DXIA 3VU0A 3VR6A 5CBPA 5JS1A 2X0FA 2H85A 3MQFA 4QOEA 4RH1A 4JI7B 2A9OA 2AK2A 2DTEA 1RHJA 4C0WA 1QLWA 1AHIA 2F4NA 1SCQA 3T7DA 4KXNA 2JA2A 4YO7A 4U7WA 4L8YA 3SZUA 3BT7A 3NBQA 1GU1A 2I8LA 2JL1A 2MDTA 4MPRA 1L5NA 3IJ5A 4JL6A 1YF3A 5L3RA 2O50A 1WHTB 1XF9A 3MIIA 4HXEB 1E2JA 4GLLA 3U3OA 4RMNA 4CN8A 3ZDAA 1SFRA 2FYTA 4JX8A 3I2YX 2AK3A 4Z86A 1TW3A 3O2NA 4A2CA 4YPVA 2JK0A 3DWIA 4OGFA 4I4IA 4ALNA 3DTNA 1DX6A 1JDPA 3BTOA 1BD3A 1HK7A 4PPNA 5B1DA 2ZIZA 4EVQA 3E5RA 2FVYA 3FPLA 4EVIA 1F8GA 2GI4A 2H1VA 4MGYR 4G1UC 1TKRA 3QWHA 3GFSA 2HPZA 4AP6A 1J00A 2NM0A 3X1DA 3FNRA 1F7VA 4G4SO 4QHYA 2X8AA 4OLJA 1NXXA 5EKXA 1Y1TA 3UAOA 4MGZR