3H1WA

Crystal structure of mannose 6-phosphate isomerase bound with zinc and yttrium
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
393
structure length
390
Chain Sequence
b'ASMQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITGETVSLRDAIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERLSQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGELLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLVLKPGESAFIGADESPVNASGTGRLARVYNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-6-phosphate isomerase
publication title Crystal structure of mannose 6-phosphate isomerase fromSalmonella typhimurium bound to metal atoms and substrate: Implications for catalytic mechanism
rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 118
structure length 390
sequence length 393
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 3h1wA03
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1wA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1wA01
2CAVA 4Q0UA 3WW1A 5BUVA 1RTVA 1DZRA 2OZJA 2IXIA 2B5HA 2QCSB 4XF3A 2UY8A 3SCFA 2MHFA 1DGWA 4TLFA 3NKTA 5KHGA 4IEZA 3EHKA 3D0JA 5I0TA 3FHIB 3MYXA 4LEJA 1J3RA 4OLLA 1NE6A 3S7IA 3USSA 1YFWA 4LTAA 2EVXA 2Z2SB 4OFGA 3NVCA 1V70A 2WFPA 5I8SA 5JAXA 1O4TA 3FWEA 3PNAA 2XLGA 2MNGA 2PHDA 3RPQA 5E16A 2OYZA 2IXKA 3M70A 1EPZA 2IXHA 2Q0AA 2ZCWA 4QX5A 5HI0A 4JTNA 4F7ZA 2F4PA 3KMHA 1G6NA 3H7YA 1UIJA 5KHHA 5T3NA 1GQHA 2VECA 1O3RA 3H1WA 3E5QA 2GC0A 2IXJA 1O3QA 5I93A 1RC6A 5KBFA 1H1IA 4BHPA 2E9QA 1IPJA 4WZCA 4MGZE 4UXAA 4MH0E 1WGPA 2VQAA 1UW8A 3VHRA 5F1RA 2BEOA 1U12A 4I0AA 4PJYA 3I59A 4D7TA 4EWEA 4RD7A 5JR7B 3ROUA 2PTMA 1IPKA 4XETA 3LOIA 3I7DA 5FQ0B 1CAWA 3LZZA 3MDPA 1OI6A 4I02A 4IEYA 1J59A 1QY4A 1EYBA 1L3JA 2ETEA 2D93A 4PIXA 2OPKA 4YRDA 5FPZA 1Q5OA 2H6BA 4YSFA 1VP6A 4Q0QA 4Q0PA 3EBRA 4XF0A 4YNIA 3UKTA 4AQ2A 2VPVA 1LRHA 1ZZ9A 3CO2A 3KGLA 1NYWA 3I59B 3H1MA 1LR5A 1CAUB 1QXJA 3BCWA 3TNPB 5I0SA 2IC1A 2UYAA 5BPXA 5C6CA 3E6BA 3G7DA 1NZCA 4KWKA 4LA2A 5I91A 2UYBA 1CAWB 3BPZA 5FCCA 4YYOA 2Z69A 3PLQA 4J1XA 5BV6A 5AVPA 5JSPA 5FLHA 5C8WA 1I5ZA 1O5UA 4R52A 4QMAA 1EP0A 4I2OA 3WW3A 1RUNA 4LULA 4JVAA 2GZWA 4I0BA 1O5LA 4QGLA 1YHFA 3DV8A 2XGXA 4QM9A 4EROA 4HVQA 4XFGA 2PAEA 4N9IA 4EWDA 2BYVE 3L2HA 4JV4A 3CL1A 4HSJA 2GAUA 2WC2A 4FBFA 1ZRCA 1CAVA 5JCTA 3NW4A 4HN1A 4ZU7A 4ONUA 4Q0VA 3E6DA 5E1RA 1Y3TA 4MGIE 3HIFA 3ETQA 2OA2A 4XF9A 3TNQA 4L11A 1LKNA 4Q0SA 1YLLA 3OF1A 3PVBB 2D5FA 3ES4A 4HMZA 1X82A 1RL3A 1ZRFA 3LA3A 4KL1A 2BGCA 5I0RA 4HSLA 3IIAA 3QOPA 4KWJA 4ZU4A 3UKNA 4Z07A 4MUVA 4JTOA 1NE4A 4BYYA 3WW2A 1QWRA 3KCCA 1HW5A 2PQQA 4Q29A 4XEZA 4EWAA 1UCXA 1CX4A 1X7NA 4EV0A 5FLIA 3H50A 1YUDA 2HJIA 2PFWA 4IEWA 4IETA 1ZX5A 3FE5A 1O7FA 3I54A 1VJ2A 4BH9A 1PM7A 4DINB 3M3IA 2BNNA 1QXRA 2V09A 3H3UA 1X8EA 2P17A 2H6CA 3D82A 2CV6A 1UD1A 1ZZ8A 4QGNA 5KHIA 3E6CC 4LA3A 4LUKA 1CAXA 5FPXA 4HLTA 5CADA 1FT9A 1Q3EA 3GBFA 1UPIA 4IEXA 3CLPA 1SFNA 4AVAA 3EO6A 3CJXA 2K9ZA 3DL3A 3SCGA 4KU7A 3RYPA 2GH2A 2XL9A 5J7MA 3KSCA 4H7LA 1ZZCA 5BXXA 4FAHA 3FJSA 5CU1A 3FX3A 4IERA 4IESA 3DKWA 4CYDA 2MPFA 3BB6A 1CAXB 1UIKA 3IDBB 2PAMA 5KHKA 4HN0A 4NVPA 4HVRA 3B02A 3JZVA 2B9UA 2B8MA 2XKPA 2H0VA 4Z82A 3U10A 5I8YA 3H1YA 5D1IA 3SHRA 1J58A 4KWLA 4ORFA 4MGKE 3GYDA 2QNKA 4XFIA 2Y0OA 3CEWA 4HBNA 4J1WA 3N4MA 4F8AA 1JUHA 4BIFA 3HT2A 4AXOA 4FAGA 3IBMA 2Q1ZB 2GC1A 2KXLA 3LAGA 1O3SA 3OD0A 3WW4A 4LLOA 4AVBA 3H8UA 5LRRA 4AVCA 5EFUA 5LRSA 3O14A 4A2UA 1ZZ7A 1YFUA 1Q43A 4I3PA 3U11A 4B29A 1RGSA 4P9GA 1YFYA 2XLFA 4HVOA 5EZWA 2GC2A 1WA4A 5K8SA 4XFCA 2XL7A 4K8FA 5J48A 5BY5A 3NJZA 3KGZA 4O9GA 3H7JA 3RYKA 3BALA 1H1MA 3LA7A 1WLTA 3EJKA 1DZTA 3C3VA 3RDIA 2FMYA 3U0ZA 1J3PA 2PYTA 4AQ6A 4I09A 4E2QA 1ZZ6A 2IXLA 1YFXA 2Q30A 3IWZA 1CAVB 2EAAA 3ACLA 4IEPA 1RUOA 3CF6E 5CVRA 4IEUA 1XRUA 4XFBA 4XF1A 3H3ZA 4QXKA 4LUMA 3NL1A 2OZ6A 3D0SA 3E5XA 2BNOA 1ZZBA 4UBGA 1TQ5A 5JSRA 3SXWA 1YWKA 2ET1A 5FQ0A 2XLAA 3E5UA 1J1LA 3H9AA 4L2NA 2XKOA 1XE8A 2EA7A 4X6QB 1OD5A 4KU8A 4PIZA 4MGYE 4HZFA 4META 2PHLA 3RYRA 3S7EA 2QJVA 3ZDSA 2ATFA 5I0UA 2D40A 2C0ZA 3SCHA 2XHKA 3RZZA 4IEQA 4WVZA 4UBHA 4E2GA 2O1QA 4ZU5A 1CAUA 3ES1A 2FQPA 4XFAA 3FZ3A 1Y9QA 4PIYA 5FDBA 2CGPA 2D5HA 4XFHA 1VR3A 4IEVA 1I6XA 2IXCA 2ZKLA 3ELNA 4WBBA 3IDCB 3MPBA 1O3TA 2K0GA 2N7GA 2GU9A 1ZRDA 5KHJA 1DGRA 3HQXA 1CGPA 3LA2A 2GC3A 3OCPA 1OMIA 4R8HA 4MV2A 4N9HA 3E97A 5J3UA 3S0MA 4QM8A 3NSTA 1SEFA 1X8MA 4E2SA 1ZREA 1FXZA 4XFFA 4YARA 3MZHA 1PMIA 1FI2A 2ET7A 4X6RB 1NXMA 1SQ4A 4MX3A 2UY9A 3R6SA 3ST7A 2HKXA 3SMHA 1ZNPA 2Q4SA 2DCTA 1XE7A 5LEJA 4D7SA 2O8QA 5FLJA 1GQGA 3FFQA 2BNMA 4FT8A 3EQEA 3HT1A 4O9EA 5JSOA 1EY2A 1J3QA 1ZVFA 4XF4A 1ZRRA 4MZUA 3UKVA 2QDRA 2PAKA 4I01A 1OFNA 3QACA 3OGJA 5LEKA 2PA7A 3BU7A 2QVSB 3OTFA 4QGMA 2CAUA 4GULA 5I8TA 2I45A 3RNSA 3DN7A 1LB2A 3LWCA 4IEOA
chains in the Genus database with same CATH superfamily
3NNMA 2CAVA 2XBO3 2VVDA 2QQNA 2A7AA 1C28A 1N1SA 1ZBA3 3I3DA 3MIBA 1QOTA 4L9BA 3T2OA 1C1LA 4FFGA 4XMIA 2DU1A 3WUCA 4C1WA 5BUVA 1RTVA 2DCZA 1DZRA 4CEWC 4FP3A 2IXIA 5C5TA 1W06A 1OURA 2JIGA 4GWMA 3SCFA 5IVEA 4XUNA 3ON7A 2MHFA 3HEIA 4YZ3A 4ZZ8A 3NKTA 1UY3A 5FYMA 4IEZA 1R64A 3VKFC 5K0UC 3S5QA 4DEQA 2P4EA 1QU0A 3MFCA 2DU0A 2XMLA 2CNAA 2VUAA 5LY2A 2XBO1 2HWF1 4XUPA 3LPFA 2ZKNA 2VNOA 3NVCA 1EV11 2BOJA 2DVBA 1V70A 1AHSA 2A3YA 4NHYA 1XYPA 1LEMA 5FYCA 5IVFA 5IWFA 2PHDA 2VXJA 3D8CA 3MHZA 4Q4W1 4K20A 5JPNB 1AR72 1W0OA 3RWKX 3WQ0A 4XIOA 1PO21 4A3ZA 3DYOA 1YI9A 4NPMA 1W03A 5A3LA 5IYYA 5CFDA 1AL22 2ZCWA 3ZXJA 5HI0A 2PN5A 3P1IA 4F7ZA 3O1MA 5FY7A 1ASJ3 2DWRA 5KHHA 1REEA 1WZXA 2WNEA 4WM7C 2VECA 5I0DA 4FFHA 2RG4A 4Z2WA 1Q56A 3E5QA 4KH9A 4UI9L 1C57A 2WS93 2J42A 3AZYA 1AJOA 4XJWA 5FMDA 2JG9C 4BHPA 1M4WA 5A3OA 3AKPA 3U14A 5LATA 4BQ5A 4A6OA 1J83A 1U12A 4PJYA 3IT8A 3OJBA 1ASJ1 5FMOL 5FKBA 1JBCA 2VQ0A 3NNJA 5FOJB 3WNPA 3POWA 5A6ZA 3JB4C 3WINE 3FN9A 3VD7A 3D5OA 5D8AA 1VBB1 2P37A 1IPKA 2WZ8A 5FBJA 5CFDB 1CAWA 3LZZA 3POBA 3WNLA 4I02A 4NAMA 3RMXA 1QNWA 1Y7BA 3WX5A 1L3JA 4RHV3 3VBOA 2ETEA 1VBE1 4RL7A 3RS6A 2GNTA 3AB0A 1W8OA 2ADEA 2D93A 3ZSJA 4L8QA 4C0BA 1DF0A 1G9AA 3W20A 1Q5OA 1WMDA 4BMBA 4YZ1A 2E7AA 4OHVA 3PDQA 1LHOA 3ZYRA 3UKTA 3PJYA 1AYM1 2VOTA 4AQTA 4BU2A 1ZZ9A 5A7SA 1W39A 2R32A 5ANNA 3GHNA 4KG8A 1BBT2 4DUVA 4HXCA 5JUVA 1YI7A 1CAUB 1TMF1 3AVSA 1XSQA 1YYNA 5A33B 1CD3G 1W8HA 1PVC3 4E27A 3VDBA 2WQZC 5I0SA 4RS5B 5D8AB 1LENA 1PK6C 4Q4Y1 5LK7B 5LK5A 1GANA 4B7KA 4KWKA 5I91A 1GWKA 3UJQA 1CAWB 1RYYA 1PMJX 5GJ6A 1GBGA 3PLQA 3VBOB 4YWAA 1IG3A 2VMDA 1I5ZA 1O5UA 4QMAA 1EP0A 3MGUA 4XUTA 4GMP1 3WW3A 4AFCA 2ZBJA 2RM22 3WQBA 1RB8G 3MIHA 3KD4A 3N9QA 3ZIWA 3T0BA 3S5AA 3AKRA 3FHQA 3PU8A 2E33A 4QGLA 4WVMA 2Y8KA 3VZJA 1R093 3C7FA 3MIFA 1X36A 1HJGA 2HWC1 4XBLA 4OCTA 4FXGB 3VBUC 1AR73 1KDKA 4HVQA 2PAEA 2NN8A 4EN8B 1PGSA 3I2OA 1NQDA 1FV3A 2BYVE 2R1BA 4NR1A 4QPGB 3AZVA 1AL23 1S55A 1RMU2 5IVVA 1OA3A 2GAUA 1HV0A 2VMHA 3LD8A 2RDQA 2VMGA 1GP5A 4WM8A 4UFKA 5DABA 5EYYA 4GWNA 4Z8BA 3ZIXA 1CAVA 5JDBA 1R091 4HN1A 4BQ3A 1R1ZA 5EQUA 3MIEA 1R082 3KT4A 2C24A 1RHI2 2ZGNA 4MGIE 3VBRA 5IK8A 2BPA2 3ETQA 1B09A 5F6LB 5C8CC 4D6RA 1GR3A 1RVF3 1LKNA 1PZ9A 2O14A 2WRAA 2RVAA 3H0OA 4XUOA 5K4LA 3GZTB 4WVMB 1RUH2 3PVBB 4AGVA 1JZ4A 2XUEA 4HMZA 2E26A 2OQ6A 1RL3A 4RGKA 5AFEA 5CFCA 1ZRFA 2FDGA 2WINB 2W9XA 3JD72 1MS9A 4I0WB 4PBPA 1Y4WA 3J7NA 2AREA 4N53A 2QDNA 1ND2B 3A4UA 4IV3C 3VL8A 2R7EB 4DXSA 3WP3A 4BYYA 3ZXLA 1Z7S1 1QWRA 3FLRA 4Q29A 1AXKA 5C4WB 3UGHA 2JIJA 3RZHA 5DN2A 4LO5B 5JXGA 1QOSA 4AFAA 4WM8B 3ZX7A 1DGWX 4EWAA 3DUIA 3OBZA 2PHXA 1S0JA 1BEV2 1RUF1 1X7NA 2WT0A 4MGTA 3FMGA 3M4FA 5F3GA 1HRI1 2GP3A 3PUAA 2HJIA 3VBRB 2WYFA 1LNSA 2VU9A 3J7HA 4IEWA 2Y6KA 3A23A 3ENRA 3FE5A 4LE4A 4QX3A 3WF4A 3NJVA 1O7FA 3PHMA 2KA3A 2WO3A 1BBT3 4RFT0 3VZNA 1WWYA 2V09A 5FO7B 4FPGA 3Q8CA 5CFCB 5HXMA 3NV3A 1S0EA 3D82A 3PIGA 2B9VA 2GNMA 3IPVA 4YGBA 2ZGPA 4B1MA 1NT0A 2ZGSA 4JGYC 5KHIA 1RUG2 1GYKA 1NCQB 4LA3A 4V1PA 3LEGA 1CAXA 1W2NA 2JDAA 4JGZC 5FPXA 3NJXA 5CADA 2JKBA 2VTXJ 1DQ5A 1H4GA 4CRQA 5IK7A 2VQTA 1UMIA 1H2LA 5A7WA 1LOBA 3LSDA 4LIUA 5FTTC 4HT1T 1JHNA 3NNLA 3LGRA 2K9ZA 3CKHA 1NY71 3DL3A 1V6LA 4O61A 3J8F1 3AP9A 4IV1A 2ZGTA 1RUJ2 1A6CA 2OXBA 3I3BA 4QU2A 2EXKA 3WF3A 2XJPA 1MQTB 1CQ9A 4GXLA 4H2AA 5ISLA 1MS0A 2YV8A 3A7QA 3I8TA 5L19A 4TZDA 1F5FA 1KQRA 4MVTA 1QJX3 3FJSA 3IPVB 1RMU3 3DKWA 3VKNA 4NHLA 5ACA2 3H8OA 2RJKA 3UJOA 4Y4YA 5EJZB 4HETA 1MS5A 1CAXB 2GNBA 2A70A 3B9IA 5FPVA 5B4NA 2SLIA 1POQA 1YIPA 2C1FA 5JI7A 2D6MA 1R083 4BQ2A 1RHI3 2WQ4A 1SLAA 4LBQA 5A7WB 4BPZA 1FMD2 3I3EA 3OUJA 2EXHA 4NVPA 3HWJA 5BNOC 5L36A 2KR2A 1S0CA 5FY5A 2B8MA 5L7OC 1QJX1 2H0VA 4Z82A 3GF6A 1LJ7A 1RUH3 4IXLA 2VH9A 3U4XA 1OUXA 2Y34A 1ODNA 3HMYA 2QNKA 2VBDA 5F5AA 4HL0A 3ZVXA 2ARBA 4QXCA 1S2KA 4Y1VA 3JD73 1TVGA 2YC0A 5F3EA 4CDWB 1QEXA 5LA2A 5BNPC 1OLQA 1W9FA 4HBNA 3QLQA 2C6SA 2RS32 3N4MA 1HB4A 5A70A 3HT2A 4WZFA 4KGQA 1WBLA 4HFSA 5DAPA 2DVAA 3VBFA 4EN7B 1QH7A 5IUQA 1N1VA 1FATA 2FDJA 2GC1A 3NNFA 4Q1RA 2LTNA 1BEV3 2ZGOA 3WW4A 1LHVA 2EXIA 2RDRA 3ZKYA 2O0OA 5E8AA 4LBQB 4AAXA 2X10A 4LLOA 4OHWA 3SITA 4QDSA 5IVJA 4LORA 5J37A 2XJQA 3A0KA 4CDQA 3WG3A 4WVVA 4YVSA 5LRRA 1SLBA 1XPWA 4G9SB 2EIGA 1PGL1 1YFUA 3DYMA 1NKGA 2J1VA 4DY5A 1RIRA 1K5JA 3O1OA 4RFRB 1U5IA 1YFYA 1FOD2 4HVOA 2XVKA 3FBMA 5EZWA 1YJKA 1RUG3 1U5ZA 1BKZA 2P2KA 1PNFA 4AHYA 5JMCA 4XXPA 4CCNA 2YY1A 3NJZA 3KGZA 4PT6A 4NIAA 1UU4A 5HCHA 3H7JA 5F32A 2DFCA 1W2AX 3BALA 4OHZA 2XH6A 2ZX1A 3KM5A 2A6WA 2A6ZA 2IVIB 3P6BA 4LE3A 1KITA 2GDFA 5IJRA 3IMMA 3KV9A 1Z78A 2DFBA 5FO9B 1S2BA 3AKQA 2GMMA 3CJIA 3OEAA 3WDTA 5JWPA 4PLNA 4HK9A 1W90A 3NRUA 4U36A 4YVSB 5HCFA 1RUJ3 1LHWA 1UAIA 2WJSA 5FY4A 2XVLA 2ZACA 1CESA 1ULCA 4NMIA 4R9AA 3ACLA 2VUDA 3CF6E 1A3KA 4Y5SA 1PGW1 2NP0A 4AFDA 3ZYBA 1XRUA 2VMEA 2W52A 3VZKA 3OBAA 1GP6A 2Y6FA 3H3ZA 4NWWA 4LNVA 4QXKA 3VV1A 5ACA3 4Q8LA 1OKQA 1ENXA 2G9ZA 4AR2A 1BK0A 2WZR3 4KWUA 1VIWB 1W9WA 4PI2A 3E5XA 3IM0A 1BYHA 1RXGA 2HH9A 5BNQA 5CFDC 2YROA 2XJTA 4YGDA 4R9BA 2EICA 2ILMA 4JRLA 1GZCA 3SXWA 1XSRA 1YWKA 2VZSA 3WQ7A 4A7ZA 2YDEA 4N43A 3WF0A 4OQ8A 1W9SA 2BDRA 4QX0A 5J1XA 3CJIB 1QDOA 2Z5WA 2RE9A 4AYUA 3ZFFB 4KGGA 1PO12 1D2QA 1QNYA 3CHXA 1S4CA 1WA6X 1HV1A 1JN2P 3K4AA 3NAPA 4L2NA 1W3VA 4X6QB 1OD5A 2HWB1 4OMCA 2VOKA 4KU8A 4AWDA 4EJRA 3MLJA 1JYNA 4QQHA 5IAXA 3HN1A 4GWIA 3VZLA 2ZGLA 5APAA 3GZUC 1MS4A 5I0UA 4AEKA 2C0ZA 3VZMA 4Q4V1 2Z42A 1Y9GA 2XR4A 3WHUA 5FJHA 2HBUA 2VQUA 3B01A 4IEQA 2WBKA 3OPWA 4Y5TA 2V4VA 5FY8A 4RS5C 5D8AC 3THDA 1SCSA 2WAOA 1UMHA 1QHDA 3ES1A 1UY4A 2XQXA 1Q8QA 5KWRA 4LLFA 3V0BA 2BFUL 2R062 3FZ3A 1QKQA 2ORZA 5FDBA 2CGPA 2ZEZA 4HONA 5F39A 4EN9B 3IIIA 3VBOC 2C26A 3OGRA 1VRH2 2ZKLA 3IDCB 4FTEA 1DCSA 1DBNA 4P5YA 2W1WA 3A21A 4NPRA 2Q1MA 2D6KA 2GU9A 3NAPB 5JOYA 3SQOA 2MEV1 4M3CF 5A3TA 2IUWA 3AMPA 3HQXA 1C8NA 1MZ6A 4S2DA 4C8DA 4DXTA 5F3CA 1MZFA 3CNAA 4GIQA 3LA2A 1JZ5A 1GZ9A 2ZHLA 4QHZA 3BKZA 1HLCA 1REDA 5J3UA 4YZ4A 3WNXA 3C7EA 1ULFA 3CQOA 3B69A 5CISA 4QPGC 1HJFA 1AXYA 3BIEA 1V00A 5A3UA 5CKQA 1HQNA 1VBA2 4HG6B 4X6RB 4AVSA 1ACCA 1NZIA 1NXMA 1QJY3 1SQ4A 2BU9A 1F8VA 5DZEA 3VKLA 3MUZ1 4NRPA 5JMOA 2HKXA 5FZEA 3O12A 4P9LA 4AQSA 1JZ8A 3VDDA 3ILFA 2YFZA 4GKYA 2WQ8A 3WOGA 3OY8A 2DUPA 3T2PA 1GQGA 3FFQA 2GP5A 3W5NA 4Q5OA 2F6BA 3EQEA 4O9EA 2PXJA 1G86A 5FMBA 5JSOA 1QJU2 1S0IA 2A6VA 1QJY1 4TTGA 1SDWA 2AEYA 3GXUA 4TLGA 5A1LA 2PAKA 3N9MA 4FP2A 3R0RA 4I01A 1OFNA 1ND2C 5FY9A 5IVBA 4IDZA 2ZJCA 1MR5A 3WLUA 4S2FA 1UWWA 4PDWA 2W5FA 1JYVA 1W99A 5B2GB 5A7OA 2DURA 3HQUA 2J1UA 4GULA 4CCKA 2HBTA 4BK4A 5C4WC 2RJLA 5KXBA 2VZ3A 3OGGA 4WM8C 4GD4A 3SKJE 5JZGA 1YC61 3J4UH 5C33A 1U0AA 3THPA 1TME2 2A73B 2R30A 4BXSV 3I2KA 2P3KA 1PO13 4MGSA 4Q0UA 3VBRC 3OY8B 1VALA 3ZFGB 2ZX2A 1JYCA 2RS12 1K3IA 2OZJA 2B5HA 4L92A 1SZBA 3FUQA 4YG3A 4YG6A 5FYYA 5CA6A 1DLCA 4FO9A 5CAZA 3H42B 2CHHA 1OVSA 3IKWA 2JENA 4FFIA 1NOVA 3PJQA 3BTXA 1CX1A 5CFCC 3EHKA 3D0JA 1QH6A 1DQ4A 4CXWA 3FHIB 2WZEA 1CZTA 1POV3 2BVBA 5LWBA 4XDPA 1B35B 4UWDA 1J3RA 1NE6A 2Y6HA 1COV2 1L7QA 1YFWA 4FPHA 4K21A 4LTAA 3D4KA 1NCQC 4PDWB 3J7LA 3SLIA 4Q1PA 4LIVA 3NV4A 5FZAA 3T3YA 1DYPA 2WDBA 1BQPA 2ZMLA 4Q26A 4WVWA 1JZ3A 4BISA 1HRV3 2D6PA 3VGIA 3FWEA 4NAOA 2QQJA 3SC7X 3BI3A 4X8PA 4YFWA 3RPQA 1I9RA 2DYCA 3LIHA 2OYZA 2VR4A 1SBEA 2SBAA 5DAWA 5LA1A 3H8XA 4O65A 3TN92 1MVEA 1HB3A 3ITQA 1MQTC 2GMEA 3SEPA 4LQRA 3KMHA 1G6NA 1UPSA 4OYUA 3DYPA 3ZM8A 3JBG1 3MV11 3AZZA 3ZN5A 1ULGA 1GQHA 1FX5A 2ZABA 4DIQA 3H1WA 1HRV1 4CDUB 1QJZA 3R4SA 4URAA 4Y20A 4RGGA 5DAVA 5I93A 2Y0IA 5M0TA 1RC6A 1ZBE3 3OBTA 4KBBA 2WNUA 2ZA9A 4QKDA 1H1IA 1VBA3 3HNBM 5FK8A 4AFBA 1KS4A 3HVDA 3VBHB 4MGZE 3MEPA 4UXAA 5T52A 1W6NB 1YCIA 2F4LA 1LAJA 1WGPA 2VQAA 1H9WA 1UW8A 5F1RA 2WNVB 4B7EA 2WT1A 1D0HA 2ZOEB 2BJSA 3B3QE 1TZOA 3R4DB 1J84A 2FCVA 5FP8A 1XNDA 4AHWA 1XU2A 2ENRA 1UZZA 4MXVA 4ASLA 1RUC1 2PMWB 1RUD1 1PIV2 2PTMA 2YFUA 1ZBE1 3LOIA 3I7DA 4EQVA 1QJU3 1MS3A 3MDPA 2ZGQA 1WCQA 4CDXB 1SCRA 1PZ8A 3LF7A 1EYBA 5DDJ2 1JS9A 4CDWC 2YG0A 5L9VA 3LE0A 2OPWA 4B4PA 4QHBA 3DPRA 4ITCA 3V64A 1SBDA 4FPYA 1CONA 3AP7A 5FPZA 4CU9A 5JLVA 4Y20B 3MV01 1W9TA 4P9XA 1KFXL 4MXWA 3DECA 4EN6B 2RMU2 1IZ3A 1O91A 3N9OA 4RQPA 4BK5A 1LRHA 1QGLA 4DS0A 1AYN1 3ZYHA 2ZX4A 1TME3 3KGLA 3M3CA 3WNNA 1PZ7A 2PHFA 3H1MA 2ZHMA 3HNYM 4IE0A 1GOFA 3BCWA 2JDHA 1Y43B 2RS13 5A6QA 2WFF1 5BPXA 2GN7A 3E6BA 3G7DA 3GALA 1UY0A 2XJVA 3KQRA 2HLEA 3B94A 4CP1A 5FCCA 5SV5A 1OF4A 4OVEA 4J1XA 2WN2A 1OA4A 5BV6A 2TNFA 5JSPA 3W5MA 3DPRB 3PURA 5FLHA 3BN6A 5C8WA 3POSA 5EHDA 3ETPA 4A3XA 2OQ7A 4NHMA 4D7YA 1C1FA 1DQ1A 1VBB2 2XJSA 4JVAA 3AP5A 3FLTA 4MXWB 4M01A 1JH5A 1HXS2 4Y22A 4I0BA 1O5LA 2R042 1BMV1 1U5XA 1DZQA 5FR3A 2WA3A 4B3NA 3LKJA 4BQ1A 1ZRIA 2DBNA 1VBE2 2XGXA 3OYWA 2A5ZA 4E4DX 2FDKA 1VBD2 3LFMA 3K3OA 5E6HA 1QJEA 1KDMA 4YZ5A 2VZVA 2ZGUA 4YVSC 3ZFEA 3ZYIB 5LB6A 2D6OX 4DEVA 5IVYA 4NHKA 1MEC1 2FDFA 2JDYA 3N9LA 3ME2A 4IGPA 4XZPA 1AR91 1O59A 4GZ9A 5J98B 3EYPA 1UU6A 4ONUA 2D6NA 1TMF2 3E6DA 1W0NA 4Q0VA 5E1RA 3WV6A 4COYA 2C9AA 3HIFA 2WWUA 3QH6A 4XF9A 1UZ0A 1V6IA 2VG9A 4BIOA 5FYIA 4L11A 4Q0SA 1D4M2 2RS53 1DQ2A 4XQWA 4Y22B 1QQP2 1YLLA 3PVNA 4Q4X1 4XJ9A 2PELA 4JDNA 3HPNA 1YRZA 1X82A 2DVDA 4NIIA 1ZBA1 3AFKA 4KL1A 2J1EA 4LPLA 3IIAA 3ZXKA 3ZXEA 4ZU4A 1DU3D 2E6VA 1VPHA 2R0HA 3UKNA 4Z07A 1PIV3 3CJIC 4MUVA 4JTOA 3ZFFC 1UYXA 1BVVA 3ZFEB 2YHJA 1IOAA 3KCCA 1NCRA 2WL1A 2PQQA 3TYJA 5DDJ3 3W9AA 4PQ9A 4XEZA 2WABA 2RS51 1IG0A 1CN1A 1UCXA 4NRQA 2P3JA 3LDBA 2W08A 3HBKA 2H0BA 3MIDA 1YUDA 2VTXA 3K75B 3AJYA 1NQJA 5FBZA 2RMU3 4CU8A 5K9YA 3ZXDA 4IETA 1WUVA 4NRMA 1OSGA 1H2NA 4IE6A 1VJ2A 3GZEA 1PM7A 4BH9A 4FXKB 3PIJA 5DMYA 5JOZA 4JAAA 3TEZA 4LBKA 3H3UA 5T55A 3ORJA 1X8EA 5FZDA 2H6CA 5TSWA 4CU6A 4OUSA 2FDIA 1ZZ8A 5A7QA 1DHKB 1VE0A 3M2MA 3EMRA 3NAPC 5LBBA 2X29A 1NCRB 2WYSA 3HN3A 4P02B 4W6WA 1XYOA 1WW5A 4YM0A 4YPJA 2VY0A 3BOWA 4UW4A 3VKMA 2UWAA 2QQPA 4UFJA 1AX0A 2WS91 3QH7A 3ATGA 3AYDA 5F2SA 3SNMA 2VULA 4UYBA 1S1AA 1CJPA 3BUCA 3CJXA 1HXS3 1AZDA 2GH8A 1CR7A 2R043 4KU7A 4QQ2A 4UFMA 5CNAA 2P6CA 3RYPA 2NM1A 2ES3A 4XUQA 1H8VA 2G19A 2JB4A 3SKVA 1VBD3 4H7LA 5FP3A 3VHOA 4Y1ZA 4URTA 2NZ9A 4XPVA 3AMHA 1HRI2 1BZWA 1VB2A 1W2TA 4IESA 4IL7A 5T5OA 4XABA 4YM1A 4CYDA 1SACA 4AE2A 5JR2A 1UZYA 1W2OA 2MPFA 3AYEA 2Q1FA 4H7MA 4RHV1 4KNCA 4OHXA 2AH2A 3VDCA 2YYOA 4YW3A 1UY1A 3O1PA 5G04L 2OUJA 4P9YA 1DDLA 4RA0A 4YM3A 4R4ZA 2UWBA 4IGOA 2YPJA 1W04A 5KHKA 4HN0A 1FNZA 1OXCA 4M3CE 1STMA 1D4M3 4M00A 4Y3OA 4ET7A 5I8YA 3W21A 5FUIA 3U10A 5GLWA 4YFZA 3RSJA 3N7MA 1W0PA 3VHPA 3K3NA 4DNYA 2QQVA 4GQ7A 2R16A 2QQIA 2PQSA 1PVC1 4GB32 2JDKA 4ARXA 3N7LA 1HX6A 3GBGA 2ZZJA 4F8AA 1GLHA 3MI8A 4DMIA 4AI0A 2D7FA 1TE1B 3ZFGC 3J8F2 4CCMA 2XJRA 3FFZA 4OI2A 5H9QA 4LBNA 4QD2A 1K42A 1DGLA 2VNGA 5E89A 4LR4A 1V6JA 2E32A 2PHRA 4G4FA 3O1VA 3PUSA 4RSUA 1PVXA 2D3RA 1DQ6A 3H8UA 2ZTNA 3QD6A 1B35C 4FPLA 4LBQD 1C8M2 4TYSA 1O6UA 4P00B 4ATEA 2HWE2 5EFUA 2R49A 4CSWA 5IFPA 3TAYA 2V4AA 1R1A2 1ZZ7A 4PDWC 3AX4A 3U11A 4OI0A 3AL5A 4ZPIA 5DUXA 1AR71 2HEWF 1RGSA 3N35A 3ZLIA 4DRVA 4E8CA 3KV6A 1VAKA 2CDPA 2VBPA 3C7OA 4CVUA 1IGOA 1DYOA 4S2GA 4JKLA 3UYJA 1AL21 5D21A 4Z1VA 5FPAA 2LM3A 4CXXA 1I5PA 4K8FA 5JOXA 1OKOA 2C5DA 5J48A 1AXZA 5FZ6A 1SLCA 4O9GA 4Z92B 1ND3A 3OBRA 3KVBA 2QQOA 4AGGA 3ZN6A 3U78A 1XJAA 3G6JB 2YBSA 3AP6A 1J3PA 4AQ6A 3BYWA 4I09A 4ES8A 4OI4A 3WCSA 2BW8A 1RVF1 5DUVA 2Q30A 1G9DA 2A6YA 1CAVB 3ZMOA 3GZAA 3Q8EA 1I3HA 3N9PA 5EWSA 3RJ2X 4QQOA 1RXFA 3VBHC 2WNVC 5BYNA 4LKDA 4TN7A 2AENA 3RZGA 2EF6A 4AZZA 1OH4A 2K46A 3MPPG 4XF1A 1WLDA 5EV7A 1CVNA 5A3NA 4PHZA 4QPYA 4W6XA 3ECQA 3MUY1 3U07A 3U37A 2V5DA 1ND3B 2ZMNA 4BDVB 2BNOA 2D43A 1ZZBA 4UBGA 3ZN6B 1H2KA 4N53B 2Q8DA 4CDXC 3ALQA 2ZX3A 5C3RA 5JSRA 1HQLA 1IS6A 4SBVA 1XOYA 5FQ0A 1ONAA 3H9AA 1A78A 2ARCA 3MW3A 4QPIA 1ULEA 4LHLA 2XKOA 4CP0A 1XE8A 1BBT1 1K5MA 1H4HA 2QKDA 3FLPA 1CZVA 2E7TA 4PIZA 2RM23 4LHKA 2DCYA 3KVAA 1DIWA 1EAH2 1O8SA 4YW2A 4GB33 4D69A 4NIGA 3KCYA 2ATFA 2VOXA 2D40A 4YW7A 1C3HA 4E4HA 3N7KA 2D44A 5CKNA 3RZZA 1FAYA 2E63A 1V9U2 3J26N 3PVOA 3AMMA 5FXXA 3AC0A 1LHNA 1SFPA 3U75A 4DB5A 4QX8A 3WG1A 1LOGA 3AKTA 2VZPA 5D2AA 2YC4A 4PIYA 3VN4A 2D5HA 4K8RB 4M3CA 4XFHA 2BOIA 4AK3A 2LRPA 2W68A 4IEVA 1I6XA 5DPNA 3ELNA 4WBBA 3DPRC 4XW3A 3RFRA 1ST8A 1O3TA 2HWE3 4UT5A 2ZGKA 3VHNA 2K0GA 1R1A3 1WLCA 3ZYPA 1CPMA 4QPIB 2XDVA 1K5MB 1PX4A 4JX0A 5C70A 3O1TA 2BUKA 4MOAA 2WUHA 4AGRA 2GC3A 4M4RA 2ZAHA 1RMU1 1LCLA 2RR12 4IV1B 5FZ8A 5AC92 1SBFA 3NSTA 1SEFA 1WCSA 1X8MA 2YMZA 2WSVA 1XNTA 4E2SA 3MZHA 1W8UA 3OGVA 4JQTA 3RGBA 3EB7A 2CWMA 4B8EA 1PMIA 4A6SA 5A7NA 2HWB2 1T6GC 2P3YA 1R081 2F17A 3UV9A 1RHI1 4Q2FA 2G9GA 3K48A 4M3CB 3GBWA 3PVEA 3Q8FA 3ST7A 3KCXA 1RUH1 1XE7A 4OUMA 3NNGA 2O8QA 4CCCA 5FMCA 3JD71 1DFQA 2OW4A 1GMMA 4PF1A 5C3OA 5ABJA 2VAUA 3T2QA 3MBWA 1J3QA 3B93A 1F31A 1ZRRA 3JQWA 5EYXA 1IPSA 2QDRA 5T5JA 5HPOA 4FI9A 5FZHA 3FC0A 3QACA 1LOFA 5FZ0A 2AACA 5LEKA 1H6YA 3BTAA 4LO4B 2V72A 3ZFEC 1BEV1 2FZ1A 1KS5A 5F7UA 3WP4A 3ZPYA 2ZEYA 2C4XA 4DRRA 5A1FA 3M7AA 4FPEA 3RNSA 1POV0 1H30A 3DN7A 4QX1A 4K40A 4XZUG 4Y26A 5JXJA 2R072 3VBFB 2OIIA 3A0NA 4Q27A 1O4ZA 1SHWB 4GA9A 4BLIA 5T54A 4YW1A 1A8MA 2BQPA 2ADDA 1VBC2 2JEMA 1EAH3 3PUHA 2QCSB 4CCJA 3J9SA 4CDQB 2AUYA 4CEWA 2CYFA 3KV4A 1DGWA 4TLFA 1JYXA 1RUG1 3WXPA 5I0TA 1V9U3 4LEJA 3N3HA 4OLLA 3UGGA 3USSA 1HN1A 4LT5A 2HWD2 4PI0A 3L2YA 1C5HA 2Z2SB 3LEIA 4CCLA 1NCRC 4N90A 5FP7A 2VZTA 2PLV2 4C91A 2VZRA 3K77A 2GNDA 2WFPA 3KF3A 5FPLA 5JAXA 1AUYA 2B46X 1AR82 3M3OA 3PNAA 1RUJ1 2MNGA 3TEYA 3VD4A 4BE3A 3AZWA 5GKAC 2VZUA 1GSLA 3IZOA 3T08A 2E31A 3H3LA 1FMD3 1D0GA 2IXKA 3LEMA 3M70A 4KQ7A 1AR62 1S2EA 2IXHA 1GNYA 2Q0AA 4OI1A 1OH3A 5T5PA 1HB1A 1H0BA 4JCKA 4JTNA 4DXZA 1T2XA 4W4ZA 2RR13 5FUNA 5GLZA 2JG8A 3NO8A 1UIJA 4AEDA 5ACA1 1GUIA 5AC93 4JKKA 4AI1A 5LA0A 5DG1A 2WZR1 1UF2C 1FYUA 3DXUA 3IDEA 4ATFA 2ZHNA 2IXJA 4IW3A 1RINA 2W2IA 2WLQA 3F2ZA 3KZ4C 2E9QA 2RS33 3U1XA 1OD3A 2WWJA 1FMD1 3CZJA 1W05A 5GLVA 4JKMA 2GN3A 4W50A 2OVUA 3I59A 3AJZA 4D7TA 4EWEA 3Q8BA 3O1UA 1JYWA 4UW3A 5HCBA 4CPBD 1O4YA 1F15A 1FPN2 2NYYA 3M1HA 3M3QA 4LO7A 2KM2A 4XETA 3APBA 4N43B 2Q8OA 5B4XA 3UL2A 2RS31 2BBVA 1OI6A 5FRAA 4GJYA 4COVA 1QY4A 3K4ZA 4WV8A 4AHZA 1J59A 3B7MA 3NKGA 3I97A 2JG8B 3UK9A 2GALA 5FMOS 3WP5A 4AEDB 5JOWA 4O7XA 2VXRA 1SFYA 1YO8A 3OD4A 4BQ4A 1FOD3 2X05A 2W95A 2W3JA 3D6EA 2CWSA 2PHTA 4Q0PA 1VLNA 3EBRA 4XF0A 4XJ8A 4AFMA 4MG2A 1BVP1 1UOGA 1S0BA 1QDCA 2VPVA 5FXVA 1PMHX 5C9AA 5FWJA 1GZTA 3SH3A 3ZXGA 1IKQA 2E53A 3WDWA 1RUE2 3JBG2 5JPMB 1NYWA 2QZ2A 3I59B 3IMNA 3POJA 4V2VA 2NQYA 1JYIA 3DF0A 1BJQA 1SPPA 4CCEA 4A45A 1HDKA 3INAA 1QXJA 2JB8A 3V0BB 2WKKA 4L99A 1E5SA 1VBC3 4YW4A 5C5UA 2E51A 2XOMA 1FOD1 5C6CA 2J1TA 1NZCA 2YUEA 3PTYA 4LA2A 4LHNA 1OBNA 2W87A 3BPZA 2IFRA 3GJAA 4XVHA 4YVWA 4CCOA 3ZXAC 3O7OA 2BWAA 2B39A 5AVPA 3POEA 3PU3A 2B7YA 3HR9A 4FPCA 3KS7A 4R52A 2HWD3 4UW5A 2JKXA 1PHMA 2EXJA 5IHRA 1RUNA 2VBBA 2VC9A 2WWSA 3O1SA 3LOBA 1DGRN 1TNRA 4FPJA 4LULA 4XIKA 4W65A 1WMFA 1WW6A 1JW6A 1W8TA 3FL7A 2PLV3 4FOQA 1PM4A 1HN0A 1BLZA 5H9SA 1YHFA 5C9AB 3DV8A 5G05L 3RVHA 4AEMA 3JQXA 4FPKA 1E5IA 4NUBA 2I74A 1N47A 4JQRA 4QM9A 4COWA 4EROA 5KXEA 4XFGA 4FSJA 1SPPB 3Q9OA 1EUTA 1SLLA 4N9IA 1T6BX 4BWOA 4YZ2A 1AR63 3L2HA 3CL1A 4QT6A 4AW7A 2IFWA 1I1EA 3WG2A 3ZXFA 1VMJA 4MO3M 4RYDA 1DQ0A 2AC1A 2PHWA 3VDDB 2JX9A 2WC2A 4P9WA 4Y33A 4YVWB 5JCTA 2O8OA 3C7HA 1HB2A 3O5SA 3U4SA 5KXCA 3UNPA 4ZU7A 1WW7A 4MYEA 1RUI2 3KT1A 2W1QA 4D94A 5HV4A 4PF5A 1WCKA 3GGLA 4MHUA 1L7LA 4LJHA 1ND3C 2XONA 4CU7A 1UOJA 2JXAA 3OF1A 1W6PA 4QKFA 2YC2A 2BERA 2VUCA 4N53C 3ZKUA 5C8CA 1PO11 1W6QA 1YQ2A 4NROA 4UFLA 4P9JA 2XXZA 3P5BA 3WR0A 3GDBA 4HOOA 4HSLA 1FPN3 1VMHA 2R063 4KWJA 4AVTA 5GZCA 3LDKA 1URXA 5FZ9A 3HAGA 4DUXA 1OF3A 2RDSA 5FXWA 1VRH3 1NE4A 4XJAA 4QKNA 2P5BA 5JZGB 5FY0A 3WW2A 3HD8B 1O3QA 1GKBA 1QJFA 1A34A 1HW5A 2YGMA 1UYYA 5GALA 2JD4A 1JOBA 2Y6LA 4IV3A 4NIHA 5GM0A 1QIQA 3LDRA 5FZ4A 5EPAA 1POV1 5F5CA 4EV0A 2FBEA 1V6MA 4OUEA 2VM9A 1XQNA 4EE2A 2DUOA 3ZMNA 2R061 4CCDA 1N3QA 2VW1A 2FHRA 3KV5A 1E57A 4LKEA 5ANQA 2PFWA 5AVAA 4DFSA 1VRH1 3OPZA 3CMGA 4AVVA 2Y60A 1GWMA 3I54A 5DZGA 3VL9A 1W6PB 4XDQA 1AX2A 3RI8A 2YGLA 2JDUA 4Y1UA 2CDOA 4JZRA 2P17A 2LUWA 2Y6JA 1X33A 1UD1A 2ZGMA 1W8FA 5DAQA 3WDXA 1SLIA 3ILRA 3MLLA 3HOBA 1F4AA 4QPIC 5FP4A 4EZHA 4BB3A 1UOFA 3E6CC 1K5MC 2FCUA 2P3IA 1BHGA 3ABZA 4LUKA 1SMVA 1VRBA 4HLTA 4YLZA 3AXEA 2XBO2 2HWF2 1FT9A 4Q8KA 3WSOA 3T0AA 2WIIB 1NA1A 3R05A 1OQ1A 4IEXA 5F5QA 3CLPA 3WDUA 1VBA1 2TBVA 1SFNA 4IV1C 1EV12 2IVJA 4AVAA 3EO6A 2NPIA 3ILNA 1JXNA 3OGSA 1QF3A 4LHSA 2VVEA 2K2SA 2GH2A 3KB5A 4Q4W2 1OOPA 4J6GA 5J7MA 3Q8AA 2VOWA 4ASKA 4D0QA 3B9CA 3PL0A 2QFEA 1PO22 2WNUB 2XWBB 4G3YC 5BXXA 4FFFA 2JDZA 4FAHA 3WZ1A 1W28A 1U5YA 3WNMA 3FX3A 4IERA 1QJU1 1UY2A 4M0NA 2Q8CA 1QMJA 2W0XA 4BQWA 4FOWA 2DBIA 4BZ4A 3BB6A 2QQKA 4A44A 1UIKA 3BIWE 1JTZX 3IDBB 1NA1B 4XAEA 2VGDA 1IQAA 5A6YA 2EIEA 3CDZB 4W6YA 4XXAA 3RG0A 5DZFA 3B02A 2JD9A 5CKMA 4Y1YA 2XWJB 3A22A 3H1YA 5EJ3A 1ASJ2 4IE4A 4JHZA 4ORFA 1TME1 4MGKE 3GYDA 5BNOA 3VLBB 2VOVA 1COV3 5L7OA 1OOPB 4IGQA 1WBFA 4XFIA 1LULA 4K3UA 1JODA 4IE7A 3BPSA 1YXWA 2RS11 2Y0OA 4AG4A 4LBLA 1MVQA 5FP9A 4J1WA 2ZEXA 4RQPB 4XMAA 3V56A 3VBFC 3B00A 1X9PA 3K2OA 2R6QA 3JUUA 5FYUA 1OHFA 3W59A 3MW4A 3PTRB 1F4HA 3TRSB 4BIFA 3RRDA 4E9KA 1UYZA 3M3EA 4FAGA 5FYBA 2JDMA 3CU7A 1LTEA 2XPJA 4LITA 2HEYF 2KXLA 1NXD1 2WNOA 1O3SA 4CDQC 3OD0A 4D6QA 4PBOA 3TN93 1IS4A 3VD5A 1XNKA 3KT7A 4AVBA 5JIAA 1AYM2 1LOFC 2VW2A 4AVCA 4C90A 5IW0A 1G7YA 3O14A 4A2UA 1YIFA 2YXSA 3ACGA 2W1SA 4XCAA 3T2TA 5HXVA 3WT3A 5FOBB 1JUIA 5EIYB 3KLSA 2AYHA 4LOTA 1REFA 2A3XA 2XLFA 2VVFA 4Q4Y2 4UW6A 1TNFA 1XB9A 4CP9A 4OZOA 2GC2A 1WA4A 4E8DA 4PQQA 1W6MA 1LOCA 4XFCA 2DTYA 4ZXEA 3WF1A 2FDHA 1ENQA 2WZPP 2LALA 5F8PA 2QZ3A 1ENSA 1BXHA 3OYWB 3JXSA 4BLJA 2HWF3 1H1MA 1IHMA 1OT5A 2B45X 2X09A 3LA7A 3C3VA 1ULOA 1X50A 2FMYA 4BQXA 2UU8A 1EV13 1PVC2 2HEVF 1W8WA 4I3GA 1A8DA 4XDOA 1UN1A 1GOHA 1ZZ6A 1MS1A 4AL9A 1TG7A 2X53S 4FPOB 1UXZA 3BU0A 1QXPA 4V2WA 2HWC2 2EAAA 4Q4W3 5GZFA 2CL2A 4IEPA 1RUOA 4QB1A 5LASA 2E7QA 1PO23 3O0WA 5CVRA 2DVGA 4AI9A 5GZEA 4IEUA 4KI5M 4LBJA 5EJ1B 1PIV1 3GJBA 5JVVA 5HBAA 2DCJA 2VZ1A 3LIGA 4CP9B 1H2MA 4LUMA 4CUCA 1W6MB 1Q8VA 2ZAAA 3QBQA 4B4QA 3ZYGA 1XC6A 5DDJ1 1UO9A 4HK8A 4BJ0A 5KC5A 2XHNA 3SISA 1R092 4ZS3A 2OZ6A 3D0SA 3VB9A 3O1RA 1OLMA 4N43C 2VE1A 1GZWA 1X9TA 1TQ5A 3POFA 1V6NA 2CGOA 4E4ZA 2JG8C 4AEDC 1CPNA 2RMU1 2XLAA 3WY6A 5F6KA 5FIXA 1DG6A 4A7KA 5LY1A 3POGA 5L9BA 1VB4A 4QX7A 4RR3A 2EA7A 2X5IA 4U2AA 3VKOA 2R1DA 1VMFA 4OULA 3N7JA 1LESA 1UZVA 1VBB3 1WD4A 4HZFA 4META 3I4IA 3RJRA 3C8XA 3OUHA 4MGQA 1Z7S2 4NPLA 2QJVA 2RHPA 5FYTA 2ZPXA 1RVF2 2W94A 3WCRA 3SCHA 1VBE3 5IATA 3NJYA 4E2GA 4ZS2A 1RUF2 3ZOIA 1CAUA 2FQPA 3ZSEA 2D3SA 5A33A 5GZGA 5IAVA 1GZWB 4IUGA 2XUMA 4LK6A 4P14A 2D6LX 4RS5A 5CYYA 1AYM3 4AOCA 5A1AA 1F5JA 1HXS1 4AAPA 2IXCA 3LQCA 2R041 4EZ4A 3MPBA 2JDNA 4AI2A 4PCRA 4NOTA 4XC9A 3RMYA 1GWLA 1LOEA 1GU3A 3AL6A 1TMF3 4RR3B 2X5IB 2BGOA 5KHJA 1VBD1 4XILA 1JOJA 2BFUS 3I3MA 1LOAA 4BOWA 3IAQA 5C9AC 4Q4Y3 1RITA 1WKYA 3OCPA 1S0FA 4R8HA 3JU9A 4MV2A 3WG4A 1QQP3 3JB8A 3I2HA 3K4DA 4LXLA 4N9HA 4IQPA 3TOJA 5FPUA 2XJUA 3S0MA 3ZN4A 4LMFA 1FXZA 4XFFA 4YARA 5H9PA 1GQPA 1BK1A 4BCUA 2CGNA 4GMP3 5CIRA 4GKXA 3DCQA 5A6XA 2ET7A 4D3WA 2V5YA 4XURA 4QPGA 1YQ5A 3FBYA 4MX3A 4SLIA 3VDDC 1V6OA 4Z2AA 4YVWC 1NY72 2BV4A 1W8ZA 5GLTA 1RJ7A 2D98A 5IVCA 1D4M1 3MFAA 1ZNPA 3TEXA 1E5RA 5CBLA 1QQP1 1S0GA 2DCTA 3V0AA 4MLOA 2HWC3 2ZXQA 1JU3A 2QBXA 5LEJA 4D7SA 5FLJA 1LGNA 3LEKA 4DY3A 2BNMA 1SLTA 2I07B 4FT8A 4JDMA 4K9SA 4LOSA 4LBMA 4QKBA 5H9RA 2ZS6B 1NAEA 2VNVA 3ZSLA 3C2UA 3T1LA 3LCPA 4XF4A 4ZONA 3OUIA 2BP6A 2EALA 3B5LB 4MZUA 4Y1XA 4H3WA 2B42B 1N1TA 3IDAA 3ZPOA 3AMNA 3MICA 3OGJA 4HKLA 3BU7A 5JZGC 2QVSB 3OTFA 1W9YA 2VO5A 4QGMA 1ND2A 2R0FA 4NWVA 2EIBA 2I45A 5CG9A 1DP0A 1KXGA 3T4VA 1JOPA 1QJX2 1LB2A 3SH5A 1FNYA 2ID4A 4IEOA 5C4WA 4XQ4A 4A4AA 4RN5A 3V0AB 3WW1A 1KJLA 1J1TA 2Y26A 5CB7A 3HNMA 3POIA 4NHXA 2UY8A 3GCXA 4XF3A 4OMDA 4S2HA 1UL9A 1Z7S3 4QB6A 5KHGA 4BMEA 3PMEA 1YQ6A 2J7MA 2NMOA 5DG2A 4DOUA 3MYXA 1RUF3 3S7IA 2EVXA 5FZIA 1SDDB 1HRI3 1LHUA 3T4HB 1H6XA 4OFGA 2BBAA 3WUDA 4CA9A 4NIDA 3PUIA 4HKWA 2J1RA 2WA4A 1WMEA 1NCQA 2VNRA 5I8SA 1O4TA 1AF9A 3VBSA 1PGL2 2QUOA 2XLGA 4CDUA 1CIWA 4M4PA 1N3OA 4UFHA 5FPBA 1QOOA 5E16A 3BTZA 3KWVA 1EPZA 3GCWA 2WO7A 5A80A 5J96B 1TEIA 4QX5A 1C4RA 3LFIA 4XTMA 2F4PA 2WR9A 4GH4A 3MO4A 3H7YA 4QDQA 1IQDC 1H8TA 1KFUL 2WNUC 3F95A 5FWEA 5T3NA 1O3RA 1MQTA 4I30A 3TWIA 2GC0A 1YQ8A 1Z0HA 4XOGA 3T1MA 1H1AA 5IK5A 1W6OA 2G1MA 1IPJA 4WZCA 5GLUA 5KXDA 1CIYA 5FZBA 4MH0E 5FY1A 3VHRA 2BEOA 3J8F3 4I0AA 1NA1C 1E5HA 5FFOC 3VUOA 3VBSB 1KGYA 3C7GA 4RD7A 2P1BA 3PUQA 5JR7B 3ACIA 1ZA7A 1PGW2 3ROUA 3WEZA 2QQMA 5FZ7A 1MPXA 2RM21 4YM2A 5F5IA 3S57A 4UF0A 4GB31 5FQ0B 2VW0A 2VL4A 1C8M3 3GM8A 4IEYA 4K1YA 2ARXA 4E4SA 4PLOA 1OOPC 5C3QA 3OG2A 4GH4B 1AL0G 4FCAA 1WD3A 3VDAA 3UETA 2JJ6A 1H8TB 2WSUA 4PIXA 3FHAA 1XNAA 1LODA 2OPKA 3I2IA 4KBZA 4RQPC 4YRDA 3SEEA 3V65A 2A71A 4CDWA 2H6BA 4CEYA 1VP6A 4YSFA 1G9FA 1W3XA 4Q0QA 4YNIA 3WVJA 5BNNA 1W6OB 2NMNA 1ZA4A 4AQ2A 4COZA 3AK0A 2OKXA 4L97A 2L9LA 4R9CA 5A3WA 1C8M1 3CO2A 5L9RA 1XU1A 2DTWA 2HWE1 1Y9MA 1LR5A 1R1A1 4CUAA 2WZR2 2DF7A 4FVVA 1JZ7A 5FZ3A 3TNPB 4NN0A 1ENRA 4D8MA 3DXTA 5FZKA 4LO8A 1JI6A 1NLSA 3RZMA 2IC1A 2DVFA 2UYAA 3I2DA 3N9NA 3DGTA 4UF0B 4AI8A 4GALA 2UYBA 5ERLA 2ERFA 3ZYJB 2Z79A 5A32A 4Q4V2 3RI9A 4YYOA 1UX6A 3SH4A 1OPMA 2Z69A 3AZXA 3O0VA 3HJRA 3VZOA 4LK7A 4CUGA 4I2OA 3J7MA 4CEYB 3RZKA 1ULPA 2JE9A 4ASMB 1WLWA 4FOVA 4XBQA 2HYKA 3CBNA 5FYHA 5BNNB 1OQEA 4P9IA 2GZWA 3AYAA 3OSDA 3W58A 1IKPA 4ZKTB 3BVCA 1C5IA 1MZEA 1GFF2 3KHBA 3USUA 4L0PA 2VMFA 5J36A 2MEV2 5LA9A 4PLMA 4ISRA 4BM8A 2OT7A 5FK7A 4EWDA 5E88A 1HKDA 2UWCA 4JV4A 4HSJA 4HPKA 4TSVA 5A3PA 5IK4A 1NUKA 3RZJA 1OA2A 2ZX0A 3UGFA 1K12A 2DUQA 3I2JA 2QQWA 5A32B 1ULDA 3TB0A 4CP2A 1UYPA 4QB2A 3RZLA 3LB9A 4FBFA 1ZRCA 2WN3A 3NW4A 4LKFA 1NG0A 2W91A 5A3MA 3H8RA 1Y3TA 1ZYBA 2VCBA 4CZSA 5ABJB 2OA2A 3TNQA 2XB6C 3I3QA 5FUPA 3AKSA 5IFTA 1OPOA 2D5FA 1KEXA 2IZWA 3ES4A 2AEZA 4YGCA 1N3PA 1JYTA 3LA3A 3USUB 2BGCA 3GNEA 1K45A 4K7JA 3QOPA 4XACA 5K0UA 4AF9A 1IS5A 4NJ4A 1EAH1 4N8MA 3FUOA 1LGCA 1RJ8A 1QJY2 4F83A 2W46A 1XXNA 2CSGA 1GOGA 4HPKB 3ZFFA 2G4IA 1CX4A 1V9U1 2DDUA 3MF6A 1MS8A 5KBFA 5FLIA 5CZKA 3H50A 4FTSA 3NV1A 3ACHA 3O0XA 1OVPA 1UMZA 4CEWB 4H55A 1ZX5A 3AP4A 4ZZ5A 2YBKA 2BRTA 4UAPA 2VD7A 4XTPA 2YU2A 3M3IA 2AGSA 3VD3A 4DINB 2BNNA 1JU4A 1QXRA 4DZGA 2HWB3 2Q8EA 2C9KA 1G9BA 3VD9A 4WM7A 2JWPA 5K0UB 3OOXA 4ZXKA 2CV6A 4YGEA 2ZGRA 2XVGA 3K46A 2VCMA 2JG9A 3L9JT 3M8LA 1V0AA 1UQXA 1D4VB 4QGNA 4QWNA 4P5HA 4RR3C 3WP6A 2OUHA 2X5IC 4Q4V3 2RR11 2WLPA 4MSVA 4A42A 5AC91 3POYA 1EUUA 3OB8A 2B4KA 1JMUB 1VAMA 1DLLA 2QE3A 4BQYA 2IWGB 4ZHNA 5F9TA 1HQWA 1Q3EA 2J1SA 3GBFA 3JCIA 3MIGA 5A7PA 1UPIA 2KD7A 4HANA 4XHXA 3T09A 2G9FA 3WD5A 4DQAA 5FO8B 2JE8A 3I49A 1DYKA 1LGBA 1HIXA 3LSEA 3SCGA 2BVVA 1H9PA 4CUBA 4EYUA 3DKQA 5K7PA 5HCAA 2XL9A 4DXRA 1F35A 3KSCA 2MEV3 3E1F1 3WF2A 1JZ2A 1MACA 4WM7B 1ZZCA 1W8NA 1GICA 1XBFA 2YBPA 5CU1A 1XNCA 1MZ5A 1CWPA 2JG9B 4P08A 5HV0A 2R073 1UX7A 4F3JA 3P3NA 2WO2A 1XNBA 2ARAA 3IAPA 4QPWA 2VUJA 1HRV2 1Q8PA 2EIDA 2W47A 2PHUA 1OUSA 3WNKA 1YEWA 3CZUA 4UOJA 4QX2A 5AFBA 5DUUA 3ZO0B 3EXUA 4XJUA 2W39A 3KHCA 2PAMA 4BXFA 4GJZA 5LBEA 4HVRA 3JZVA 2JICA 3HBZA 2GSYA 5FJKA 2B9UA 1UNBA 4LO6B 4R9DA 5L73A 1PK6A 2XKPA 5FKCA 5D1IA 1UKRA 3SHRA 1J58A 1UU5A 2J22A 4KWLA 2R071 3BODA 4H14A 2FD8A 4GAZA 3WNOA 2ZMKA 3AVRA 3ZSMA 4QXHA 1RUC2 4C1XA 2XQRA 1RUD2 2QTWB 3CEWA 2Y33A 1VBC1 1ZBE2 5LW9A 2V73A 5FZOA 2FCTA 1JUHA 2VCAA 3TBDA 5F37A 5EXOA 4Y4RA 4X8NA 1AR83 4AXOA 2BGPA 3AM2A 3PMSA 4BA6A 4DPNA 1ALYA 1KRIA 3IBMA 2DCKA 2Q1ZB 4CTEA 5FZGA 2ZZQA 3LAGA 1P8JA 1ZM1A 3ZFGA 2HWD1 1NX9A 3VBUA 3KF5A 3NQHA 4QXBA 5FYVA 1F9KA 5FZCA 2PLV1 1AYN2 2RDNA 4JHTA 4FTBA 3ASIA 4XJZA 5FREA 1PK6B 2VCCA 5LRSA 1AR81 2YZ4A 1Q43A 4I3PA 5FZFA 4B29A 1F2NA 3RQ0A 5DAXA 1B35A 2FZ2A 2RV9A 2BWCA 2P6HA 4YG0A 2EAKA 4P9GA 2WFF2 4AI3A 1W2UA 2BTVC 2RJ2A 4N7UA 4Y5Z0 4DUWA 1IS3A 1APNA 1AR61 5K8SA 2TUNA 5FZOB 1US3A 2XL7A 3NV2A 5FYZA 4ARYA 5BY5A 5FZ1A 1GV9A 2JDPA 2VTFA 3RYKA 4KMQA 5FYSA 4D6SA 5IT6A 1FV2A 5F2WA 1CJDA 2CU5A 3I2FA 1WLTA 1DZTA 3EJKA 4JRAA 3RDIA 1ODMA 2Y38A 2WT2A 2CY6A 1OLRA 2ORXA 1EPWA 3R4UA 5FZMA 3U0ZA 2PYTA 1G8WA 3VBUB 1LECA 3S6PA 4R4XA 4E2QA 4K6BA 2NLRA 3OPTA 5F3IA 1BMV2 2LS6A 3LPGA 1V6KA 3BGAA 3IB3A 2IXLA 1YFXA 2JE7A 4FPFA 3IWZA 4XYXA 5JXIA 4MHRA 4QQPA 2A3WA 3UT0A 3WHTA 1GP4A 1CZSA 4QDRA 3OEBA 1N1YA 4XCBA 5FXZA 1KD7A 2WAAA 4ZY9A 1M06G 1FPN1 3ZR5A 1JHJA 4UFIA 5JIUA 2VJXA 4GWJA 1VAVA 5J09A 3VBHA 5FV3A 4XFBA 1LEDA 1W6NA 4N7IA 3VBSC 3BTYA 5JXHA 3X29B 1MEC2 1OC1A 3NL1A 4CDUC 1RUE3 3JBG3 2WNVA 5C3PA 3DEMA 4XHBA 4W8JA 4CPBA 1AR92 4QHOA 4YW5A 5C8CB 2TEPA 1W6QB 4LBOA 2OX0A 1UXXX 2UURA 4TWTA 1KJRA 4XE9A 2Q5TA 4GH4C 2ET1A 4Y24A 4CE8A 2D3PA 3THCA 2YU1A 1H8TC 2X8KA 4K1ZA 3E5UA 5T50A 4Q4X2 4CDXA 1J1LA 4RGAA 4IV3B 3P3PA 4JGYA 1RUE1 4NO4A 1ZBA2 1OLME 4JGZA 3S30A 1RUC3 4MGYE 1AX1A 1RUD3 1US2A 2QQUA 4QQLA 5DXDA 4LKSA 5KR7A 2PHLA 3T30A 3RYRA 3WDVA 2YB7A 3AMQA 3S7EA 3ZDSA 4HKOA 3AYCA 1OQDA 3MLKA 3AFGA 2RS52 2XHKA 3ZSKA 5KC6A 2LW8A 4WVZA 4YW6A 1YQCA 4UBHA 2O1QA 4ZU5A 4NE9A 4XFAA 1WW4A 1YJLA 5C3SA 1Y9QA 3GHMA 3QCWA 4OZXA 1VR3A 3CIHA 2GMPA 1GNHA 1Q8SA 3MF9A 5JI9A 1AYN3 4C0HA 3K51A 1UOBA 2W1UA 2Z4FA 4XBNA 1O8PA 4GMP0 4ISQA 1WCUA 3WQ1A 4CEYC 5C71A 2D97A 4FQ4A 4XAAA 4JGYB 5GZDA 1RUI3 2N7GA 3T0DA 1ZRDA 1AJKA 5C7GA 4M0HA 1DGRA 2Y6GA 5BNNC 5LZ6A 1YNAA 1SG3A 4JGZB 5CG8A 1CGPA 2WFF3 1WMXA 3ZYFA 3N36A 1OMIA 3AXDA 2VMIA 1JZ6A 3E97A 2QQLA 2ZHKA 4QM8A 5FAXA 1G9CA 1GNZA 2WO1A 4JC1A 1L7RA 1S0DA 3THTA 2AZ5A 4OQ9A 3URFA 1ZREA 1AVBA 5DUWA 1NLQA 4AHXA 4XQDA 2WS92 2VZOA 4FOYA 1XE0A 2YPDA 1Q8OA 1FI2A 1RUI1 2A6XA 2J1AA 5FZLA 4B1LA 4OHYA 1PX3A 3I2GA 2FMDA 3KQ4B 4JDOA 4DO0A 3HQRA 1UKGA 5BNPA 2UY9A 3NMBA 2I2SA 4QU1A 3IN9A 3R6SA 5I0RA 3TEWA 2JECA 3SMHA 2Q4SA 4ES9A 5LBCA 5SV8A 5EP9A 1BCXA 1D2SA 4MADA 5ABJC 4J25A 2P34A 1COV1 4A7YA 3RWNA 2DV9A 1NLRA 3D3AA 4TXWA 1OFSA 1D7PM 1XYNA 2W92A 3HT1A 2A1XA 3MW2A 4COUA 2ZEWA 4IE5A 3ZDVA 1LU1A 1EY2A 1ZVFA 4QAWA 2LROA 4INDA 1MEC3 4FQZA 3NWKA 3UKVA 4B4RA 4RHV2 2AR6A 3ACFA 4A41A 5BNOB 1AR93 1WCDJ 5DQ0A 4CXYA 3UESA 2VMCA 1LU2A 5T5LA 5L7OB 2VZQA 1PNGA 2PA7A 2BZDA 2A75A 2CAUA 2Y64A 4KG0A 5CEHA 3TN91 1UZWA 5LCWL 3ZR6A 5I8TA 2OS2A 3BOPA 5LBFA 2CTVA 3WDYA 5BNPB 2HYXA 2XG3A 4Q4X3 3LWCA 4EN0A 4AEJA
chains in the Genus database with same CATH topology
2CAVA 2XBO3 2VVDA 2A7AA 1C28A 1N1SA 1ZBA3 3MIBA 4L9BA 1QOTA 1C1LA 4XMIA 3WUCA 2DU1A 4C1WA 5BUVA 1RTVA 2DCZA 1DZRA 4CEWC 4FP3A 2IXIA 4GWMA 3SCFA 2MHFA 4YZ3A 3NKTA 4IEZA 3VKFC 5K0UC 1QU0A 3MFCA 2DU0A 2CNAA 2VUAA 2XBO1 2HWF1 2ZKNA 2VNOA 3NVCA 1EV11 2DVBA 1V70A 1AHSA 2A3YA 1XYPA 1LEMA 2PHDA 3D8CA 4Q4W1 5JPNB 4K20A 1AR72 1W0OA 3WQ0A 4XIOA 1PO21 1YI9A 5A3LA 5CFDA 1AL22 2ZCWA 3ZXJA 5HI0A 2PN5A 4F7ZA 1ASJ3 2DWRA 5KHHA 1REEA 2WNEA 4WM7C 2VECA 4Z2WA 1Q56A 3E5QA 4KH9A 1C57A 2WS93 3AZYA 1AJOA 4XJWA 2JG9C 4BHPA 1M4WA 3AKPA 1U12A 4PJYA 3IT8A 3OJBA 1ASJ1 5FMOL 1JBCA 2VQ0A 5FOJB 3POWA 3JB4C 3WINE 3D5OA 5D8AA 1VBB1 2P37A 1IPKA 5CFDB 1CAWA 3LZZA 4I02A 3RMXA 1QNWA 1Y7BA 3WX5A 1L3JA 4RHV3 3VBOA 2ETEA 1VBE1 4RL7A 3RS6A 2GNTA 3AB0A 2D93A 3ZSJA 4C0BA 5CBLA 4L8QA 1G9AA 1DF0A 1Q5OA 1WMDA 4BMBA 4YZ1A 2E7AA 4OHVA 1LHOA 3ZYRA 3UKTA 3PJYA 1AYM1 4AQTA 1ZZ9A 1W39A 2R32A 3GHNA 4KG8A 1BBT2 1YI7A 1CAUB 1TMF1 1YYNA 5A33B 1CD3G 4E27A 1PVC3 2WQZC 5I0SA 4RS5B 5D8AB 1LENA 1PK6C 4Q4Y1 5LK7B 5LK5A 1GANA 4B7KA 4KWKA 5I91A 3UJQA 1CAWB 5GJ6A 1GBGA 3PLQA 3VBOB 1I5ZA 1O5UA 4QMAA 1EP0A 3MGUA 4GMP1 3WW3A 4AFCA 2ZBJA 2RM22 1RB8G 3MIHA 3KD4A 3ZIWA 3AKRA 4QGLA 4WVMA 3VZJA 1R093 3MIFA 1X36A 2HWC1 4XBLA 4FXGB 3VBUC 1AR73 1KDKA 4HVQA 2PAEA 2NN8A 4EN8B 1PGSA 1NQDA 1FV3A 2BYVE 2R1BA 4NR1A 4QPGB 3AZVA 1AL23 1S55A 1RMU2 1OA3A 2GAUA 1HV0A 2VMHA 2VMGA 5EYYA 4WM8A 4GWNA 4Z8BA 3ZIXA 1CAVA 5JDBA 1R091 4HN1A 1R1ZA 3MIEA 1R082 3KT4A 1RHI2 2ZGNA 4MGIE 3VBRA 5IK8A 2BPA2 3ETQA 1B09A 5F6LB 5C8CC 1GR3A 1RVF3 1LKNA 1PZ9A 3H0OA 3GZTB 4WVMB 1RUH2 3PVBB 4AGVA 4HMZA 5AFEA 1RL3A 5CFCA 1ZRFA 2WINB 3JD72 4I0WB 1MS9A 4PBPA 2AREA 4N53A 2QDNA 1ND2B 3A4UA 4IV3C 3VL8A 3WP3A 4BYYA 3ZXLA 1Z7S1 1QWRA 3FLRA 4Q29A 1AXKA 5C4WB 4LO5B 1QOSA 4AFAA 4WM8B 3ZX7A 1DGWX 4EWAA 3DUIA 2PHXA 1S0JA 1BEV2 1RUF1 1X7NA 2WT0A 3FMGA 3M4FA 1HRI1 2HJIA 3VBRB 2VU9A 4IEWA 3ENRA 3FE5A 4LE4A 1O7FA 3PHMA 2KA3A 1BBT3 4RFT0 3VZNA 2V09A 5FO7B 4FPGA 5CFCB 3NV3A 1S0EA 3D82A 2GNMA 3IPVA 4YGBA 2ZGPA 2ZGSA 4JGYC 5KHIA 1RUG2 1GYKA 1NCQB 4LA3A 4V1PA 1CAXA 4JGZC 5FPXA 5CADA 2JKBA 1DQ5A 1H4GA 4CRQA 5IK7A 1H2LA 1LOBA 3LSDA 5FTTC 4HT1T 1JHNA 3LGRA 2K9ZA 1NY71 3DL3A 1V6LA 3J8F1 3AP9A 4IV1A 2ZGTA 1RUJ2 1A6CA 4QU2A 2EXKA 2XJPA 1MQTB 1CQ9A 4GXLA 1MS0A 2YV8A 3I8TA 5L19A 4TZDA 1F5FA 1KQRA 4MVTA 1QJX3 3FJSA 3IPVB 1RMU3 3DKWA 3VKNA 4NHLA 5ACA2 2RJKA 3UJOA 4Y4YA 4HETA 1MS5A 1CAXB 2GNBA 2A70A 3B9IA 2SLIA 1YIPA 5JI7A 2C1FA 2D6MA 1R083 1RHI3 2WQ4A 1SLAA 4LBQA 4BPZA 1FMD2 4NVPA 2EXHA 3HWJA 5BNOC 5L36A 1S0CA 2B8MA 5L7OC 1QJX1 2H0VA 4Z82A 3GF6A 1LJ7A 1RUH3 4IXLA 2VH9A 3U4XA 3HMYA 2QNKA 3ZVXA 4HL0A 2ARBA 4Y1VA 1S2KA 3JD73 4CDWB 2YC0A 5BNPC 1OLQA 4HBNA 3QLQA 2RS32 3N4MA 3HT2A 4WZFA 4KGQA 1WBLA 4HFSA 3VBFA 2DVAA 4EN7B 1QH7A 5IUQA 1N1VA 1FATA 2GC1A 4Q1RA 2LTNA 1BEV3 2ZGOA 3WW4A 1LHVA 2EXIA 2O0OA 5E8AA 4LBQB 4LLOA 4OHWA 3SITA 5J37A 2XJQA 3A0KA 4CDQA 3WG3A 4WVVA 4YVSA 5LRRA 1SLBA 4G9SB 2EIGA 1PGL1 1YFUA 4DY5A 1RIRA 1U5IA 1YFYA 1FOD2 4HVOA 2XVKA 3FBMA 5EZWA 1YJKA 1RUG3 1U5ZA 1BKZA 2P2KA 1PNFA 4AHYA 5JMCA 4XXPA 2YY1A 3NJZA 3KGZA 1UU4A 3H7JA 2DFCA 3BALA 4OHZA 2XH6A 2ZX1A 3KM5A 2A6WA 2A6ZA 4LE3A 1KITA 2GDFA 1Z78A 2DFBA 5FO9B 1S2BA 3AKQA 2GMMA 3CJIA 3WDTA 5JWPA 4PLNA 4HK9A 4YVSB 4U36A 5HCFA 1RUJ3 1LHWA 1UAIA 2WJSA 2XVLA 2ZACA 1CESA 1ULCA 4R9AA 3ACLA 3CF6E 1A3KA 1PGW1 2NP0A 4AFDA 1XRUA 2W52A 3VZKA 4NWWA 3H3ZA 4LNVA 4QXKA 3VV1A 5ACA3 4Q8LA 1OKQA 1ENXA 2WZR3 1VIWB 3E5XA 3IM0A 1BYHA 5BNQA 5CFDC 2YROA 2XJTA 4YGDA 4R9BA 2ILMA 4JRLA 1GZCA 3SXWA 1YWKA 3WQ7A 4A7ZA 2YDEA 4N43A 3CJIB 1QDOA 2Z5WA 2RE9A 4AYUA 3ZFFB 4KGGA 1PO12 1D2QA 1QNYA 4L2NA 3NAPA 1HV1A 1JN2P 4X6QB 1OD5A 2HWB1 4AWDA 2VOKA 4KU8A 4EJRA 3MLJA 4QQHA 3HN1A 3VZLA 2ZGLA 3GZUC 1MS4A 5I0UA 4AEKA 2C0ZA 3VZMA 4Q4V1 2Z42A 3WHUA 4IEQA 3B01A 4RS5C 5D8AC 1SCSA 1QHDA 3ES1A 1Q8QA 5KWRA 4LLFA 3V0BA 2BFUL 2R062 3FZ3A 1QKQA 5FDBA 2CGPA 4EN9B 3VBOC 1VRH2 2ZKLA 3IDCB 4FTEA 1DBNA 4NPRA 2Q1MA 2D6KA 2GU9A 3NAPB 5JOYA 2MEV1 4M3CF 3HQXA 3AMPA 1C8NA 1MZ6A 4S2DA 1MZFA 3CNAA 4GIQA 3LA2A 1GZ9A 2ZHLA 1HLCA 1REDA 5J3UA 4YZ4A 3WNXA 1ULFA 3B69A 4QPGC 1AXYA 1V00A 1HQNA 1VBA2 4X6RB 4AVSA 1NXMA 1QJY3 1SQ4A 1F8VA 5DZEA 3VKLA 2HKXA 3O12A 4P9LA 4AQSA 3VDDA 3ILFA 4GKYA 3WOGA 3OY8A 2DUPA 1GQGA 3FFQA 2F6BA 3EQEA 4O9EA 1G86A 5JSOA 1QJU2 1S0IA 2A6VA 1QJY1 1SDWA 2PAKA 4FP2A 3R0RA 4I01A 1OFNA 1ND2C 2ZJCA 1MR5A 3WLUA 4S2FA 4PDWA 5B2GB 2DURA 4GULA 5C4WC 2RJLA 5KXBA 3OGGA 4WM8C 5JZGA 3J4UH 5C33A 1U0AA 3THPA 1TME2 2A73B 2R30A 2P3KA 1PO13 4Q0UA 3VBRC 3OY8B 1VALA 3ZFGB 2ZX2A 1JYCA 2RS12 2OZJA 4YG6A 2B5HA 4L92A 4YG3A 3FUQA 5CA6A 4FO9A 5CAZA 3IKWA 2JENA 1NOVA 3PJQA 5CFCC 3EHKA 3D0JA 1QH6A 1DQ4A 3FHIB 1POV3 2BVBA 1B35B 1J3RA 1NE6A 1COV2 1YFWA 4K21A 4FPHA 4LTAA 3D4KA 1NCQC 4PDWB 3SLIA 4Q1PA 3NV4A 1DYPA 1BQPA 2ZMLA 4Q26A 4WVWA 1HRV3 2D6PA 3VGIA 3FWEA 4X8PA 4YFWA 3RPQA 1I9RA 2DYCA 2OYZA 1SBEA 2SBAA 3TN92 1MVEA 1MQTC 2GMEA 3KMHA 1G6NA 1UPSA 3JBG1 3AZZA 3ZN5A 1ULGA 1GQHA 1FX5A 2ZABA 3H1WA 1HRV1 1QJZA 3R4SA 4Y20A 4RGGA 5I93A 1O3QA 2Y0IA 1RC6A 1ZBE3 3OBTA 4KBBA 2WNUA 2ZA9A 5KBFA 1H1IA 1VBA3 4AFBA 1KS4A 3VBHB 4MGZE 3MEPA 4UXAA 5T52A 1W6NB 1YCIA 1WGPA 2VQAA 1H9WA 1UW8A 5F1RA 2WNVB 4B7EA 2WT1A 1D0HA 2ZOEB 3B3QE 3R4DB 1XNDA 4AHWA 1XU2A 2ENRA 1UZZA 4MXVA 4ASLA 1RUC1 1RUD1 1PIV2 2PTMA 1ZBE1 3LOIA 3I7DA 1QJU3 1MS3A 3MDPA 2ZGQA 4CDXB 1SCRA 1PZ8A 5DDJ2 1EYBA 4CDWC 4B4PA 4QHBA 3DPRA 4ITCA 3V64A 1SBDA 4FPYA 1CONA 3AP7A 5FPZA 5JLVA 4Y20B 4P9XA 1KFXL 4MXWA 4EN6B 2RMU2 1IZ3A 1O91A 4RQPA 1LRHA 1QGLA 4DS0A 1AYN1 2ZX4A 1TME3 3KGLA 3M3CA 1PZ7A 2PHFA 3H1MA 2ZHMA 3BCWA 1Y43B 2RS13 2WFF1 5BPXA 2GN7A 3E6BA 3G7DA 3GALA 2XJVA 3KQRA 3B94A 4CP1A 5FCCA 5SV5A 4OVEA 4J1XA 1OA4A 5BV6A 2TNFA 5JSPA 3DPRB 5FLHA 5C8WA 3POSA 4A3XA 4NHMA 4D7YA 1C1FA 1DQ1A 1VBB2 2XJSA 4JVAA 3AP5A 3FLTA 4MXWB 4M01A 1JH5A 1HXS2 4Y22A 4I0BA 1O5LA 2R042 1BMV1 1U5XA 1DZQA 2WA3A 4B3NA 3LKJA 4BQ1A 2XGXA 3OYWA 1VBE2 4E4DX 2A5ZA 1VBD2 1KDMA 4YZ5A 2ZGUA 4YVSC 3ZFEA 3ZYIB 2D6OX 4NHKA 1MEC1 3ME2A 4XZPA 1AR91 5J98B 1UU6A 4ONUA 2D6NA 1TMF2 3E6DA 4Q0VA 5E1RA 3WV6A 4COYA 2C9AA 3HIFA 3QH6A 4XF9A 2VG9A 1V6IA 4BIOA 4L11A 4Q0SA 1D4M2 2RS53 1DQ2A 4XQWA 4Y22B 1QQP2 1YLLA 3PVNA 4Q4X1 4XJ9A 2PELA 4JDNA 1YRZA 1X82A 2DVDA 1ZBA1 3AFKA 4KL1A 3ZXKA 3IIAA 3ZXEA 4ZU4A 1DU3D 2E6VA 2R0HA 3UKNA 4Z07A 1PIV3 3CJIC 4MUVA 4JTOA 3ZFFC 1BVVA 3ZFEB 2YHJA 1IOAA 3KCCA 1NCRA 2WL1A 2PQQA 3TYJA 5DDJ3 3W9AA 4PQ9A 4XEZA 2RS51 1CN1A 1UCXA 2P3JA 2W08A 2H0BA 3MIDA 1YUDA 3AJYA 1NQJA 5FBZA 2RMU3 5K9YA 3ZXDA 4IETA 1WUVA 1OSGA 1H2NA 1VJ2A 4BH9A 1PM7A 4FXKB 5JOZA 4JAAA 4LBKA 3H3UA 5T55A 1X8EA 2H6CA 5TSWA 4OUSA 1ZZ8A 1DHKB 3M2MA 3NAPC 2X29A 1NCRB 4W6WA 1XYOA 1WW5A 4YM0A 2QQPA 2VY0A 3BOWA 4UW4A 3VKMA 2UWAA 1AX0A 2WS91 3QH7A 3ATGA 3AYDA 3SNMA 2VULA 1S1AA 1CJPA 3CJXA 1HXS3 1AZDA 2GH8A 1CR7A 2R043 4KU7A 4QQ2A 5CNAA 3RYPA 2NM1A 2ES3A 1H8VA 1VBD3 4H7LA 3VHOA 4Y1ZA 4URTA 2NZ9A 4XPVA 3AMHA 1HRI2 1BZWA 1VB2A 4IESA 4IL7A 5T5OA 4YM1A 4CYDA 1SACA 4AE2A 1UZYA 2MPFA 3AYEA 4H7MA 4RHV1 4KNCA 4OHXA 2AH2A 2YYOA 4YW3A 2OUJA 4P9YA 1DDLA 4RA0A 4YM3A 4R4ZA 2UWBA 2YPJA 5KHKA 4HN0A 1FNZA 4M3CE 1D4M3 4M00A 5I8YA 3U10A 5GLWA 4YFZA 3RSJA 3N7MA 1W0PA 3VHPA 4DNYA 4GQ7A 2R16A 1PVC1 4GB32 3N7LA 1HX6A 3GBGA 2ZZJA 4F8AA 1GLHA 3MI8A 4DMIA 4AI0A 2D7FA 1TE1B 3ZFGC 3J8F2 2XJRA 3FFZA 4OI2A 5H9QA 4LBNA 4QD2A 2VNGA 1DGLA 5E89A 4LR4A 1V6JA 2PHRA 4G4FA 4RSUA 1PVXA 2D3RA 1DQ6A 3H8UA 2ZTNA 3QD6A 1B35C 4FPLA 4LBQD 1C8M2 4TYSA 4ATEA 2HWE2 5EFUA 2R49A 3TAYA 1R1A2 1ZZ7A 4PDWC 3AX4A 3U11A 4OI0A 5DUXA 1AR71 2HEWF 1RGSA 3N35A 4DRVA 1VAKA 1IGOA 4S2GA 1AL21 4Z1VA 5JOXA 2LM3A 4K8FA 2C5DA 5J48A 1AXZA 1SLCA 4O9GA 1ND3A 3OBRA 4AGGA 3ZN6A 3G6JB 3AP6A 1J3PA 4AQ6A 4I09A 4ES8A 4OI4A 3WCSA 2BW8A 1RVF1 5DUVA 2Q30A 1G9DA 2A6YA 1CAVB 3ZMOA 3GZAA 1I3HA 5EWSA 3RJ2X 4QQOA 3VBHC 2WNVC 5BYNA 2AENA 2EF6A 3MPPG 4XF1A 1WLDA 5EV7A 1CVNA 4W6XA 4QPYA 3ECQA 3U07A 1ND3B 2ZMNA 2BNOA 2D43A 1ZZBA 4UBGA 3ZN6B 1H2KA 4N53B 4CDXC 3ALQA 2ZX3A 5JSRA 1HQLA 1IS6A 4SBVA 5FQ0A 1ONAA 3H9AA 1A78A 3MW3A 4QPIA 1ULEA 4LHLA 2XKOA 4CP0A 1XE8A 1BBT1 1K5MA 1H4HA 2QKDA 3FLPA 2E7TA 4PIZA 2RM23 4LHKA 2DCYA 1DIWA 1EAH2 4YW2A 4D69A 4GB33 3KCYA 2ATFA 2VOXA 2D40A 1C3HA 3N7KA 2D44A 3RZZA 1FAYA 2E63A 1V9U2 3J26N 3PVOA 3AMMA 1LHNA 4DB5A 3WG1A 1LOGA 3AKTA 4PIYA 3VN4A 2D5HA 4M3CA 4XFHA 4AK3A 2W68A 4IEVA 1I6XA 3ELNA 4WBBA 3DPRC 4XW3A 1O3TA 2HWE3 2ZGKA 3VHNA 2K0GA 1R1A3 1WLCA 3ZYPA 1CPMA 4QPIB 1K5MB 2BUKA 4AGRA 2GC3A 2ZAHA 1RMU1 1LCLA 2RR12 4IV1B 5AC92 1SBFA 3NSTA 1SEFA 1WCSA 1X8MA 2YMZA 2WSVA 4E2SA 3MZHA 2CWMA 4B8EA 1PMIA 2HWB2 1T6GC 1R081 3UV9A 1RHI1 4Q2FA 2G9GA 3K48A 4M3CB 3GBWA 3PVEA 3ST7A 3KCXA 1RUH1 1XE7A 4OUMA 2O8QA 3JD71 1DFQA 2OW4A 5ABJA 1J3QA 3B93A 1F31A 1ZRRA 3JQWA 5EYXA 2QDRA 5T5JA 3FC0A 3QACA 1LOFA 5LEKA 3BTAA 4LO4B 3ZFEC 1BEV1 2FZ1A 1KS5A 3WP4A 3ZPYA 4DRRA 3M7AA 4FPEA 3RNSA 1POV0 1H30A 3DN7A 4K40A 4Y26A 2R072 3VBFB 2OIIA 3A0NA 4Q27A 1O4ZA 4GA9A 4BLIA 5T54A 4YW1A 1A8MA 2BQPA 1VBC2 2JEMA 1EAH3 2QCSB 3J9SA 4CDQB 2AUYA 4CEWA 2CYFA 1DGWA 4TLFA 1RUG1 3WXPA 5I0TA 1V9U3 4LEJA 3N3HA 4OLLA 3USSA 4LT5A 2HWD2 3L2YA 1C5HA 2Z2SB 1NCRC 4N90A 2PLV2 4C91A 2GNDA 2WFPA 5JAXA 1AUYA 2B46X 1AR82 3M3OA 3PNAA 1RUJ1 2MNGA 4BE3A 3AZWA 5GKAC 1GSLA 1FMD3 1D0GA 2IXKA 3M70A 4KQ7A 1AR62 2IXHA 2Q0AA 4OI1A 5T5PA 1H0BA 4JCKA 4JTNA 4DXZA 5GLZA 5ACA1 2RR13 2JG8A 3NO8A 1UIJA 4AEDA 5AC93 4AI1A 5DG1A 2WZR1 1UF2C 1FYUA 3IDEA 2ZHNA 2IXJA 1RINA 2WLQA 3KZ4C 2E9QA 2RS33 1FMD1 5GLVA 2GN3A 2OVUA 3I59A 3AJZA 4D7TA 4EWEA 4UW3A 5HCBA 1O4YA 1FPN2 2NYYA 3M1HA 3M3QA 4LO7A 2KM2A 4XETA 3APBA 4N43B 2Q8OA 3UL2A 2BBVA 2RS31 1OI6A 5FRAA 4COVA 1J59A 1QY4A 4WV8A 4AHZA 3B7MA 3NKGA 2JG8B 3UK9A 2GALA 5FMOS 3WP5A 4AEDB 5JOWA 2VXRA 1SFYA 1YO8A 3OD4A 1FOD3 3D6EA 2CWSA 2PHTA 4Q0PA 1VLNA 3EBRA 4XF0A 4XJ8A 4AFMA 1BVP1 1S0BA 1QDCA 2VPVA 5C9AA 3SH3A 3ZXGA 1IKQA 2E53A 3WDWA 1RUE2 3JBG2 5JPMB 1NYWA 2QZ2A 3I59B 3IMNA 1JYIA 2NQYA 3DF0A 1BJQA 1HDKA 3INAA 1QXJA 3V0BB 2WKKA 4L99A 1VBC3 4YW4A 2E51A 1FOD1 5C6CA 1NZCA 2YUEA 3PTYA 4LA2A 4LHNA 3BPZA 2IFRA 4YVWA 3ZXAC 3O7OA 2BWAA 2B39A 5AVPA 2B7YA 3HR9A 4FPCA 3KS7A