3H1WA

Crystal structure of mannose 6-phosphate isomerase bound with zinc and yttrium
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
393
structure length
390
Chain Sequence
ASMQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITGETVSLRDAIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERLSQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGELLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLVLKPGESAFIGADESPVNASGTGRLARVYNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannose-6-phosphate isomerase
publication title Crystal structure of mannose 6-phosphate isomerase fromSalmonella typhimurium bound to metal atoms and substrate: Implications for catalytic mechanism
rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 118
structure length 390
sequence length 393
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01238 PMI_typeI Phosphomannose isomerase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.441.10 Mainly Alpha Orthogonal Bundle Phosphomannose Isomerase; domain 2 Phosphomannose Isomerase, domain 2 3h1wA03
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1wA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h1wA01
2PQQA 1ZZ9A 1DGRA 1RUNA 1O4TA 2VPVA 3OGJA 1HW5A 2F4PA 3EQEA 1DGWA 5KHHA 3GBFA 5LRSA 2PAMA 3FZ3A 5KHIA 1YHFA 4X6RB 5I93A 4AVCA 2OPKA 2IC1A 1RGSA 3SMHA 4KWJA 4XEZA 1UIJA 4HZFA 3CF6E 3KGLA 4EWDA 3SCGA 3SCFA 4YARA 4N9HA 1H1IA 3MYXA 1J3PA 5FPZA 3DV8A 3KGZA 1WLTA 5I0UA 4A2UA 5E1RA 2ET1A 2UY8A 3RYRA 5FCCA 2B5HA 3FE5A 4LUKA 5KHKA 4WZCA 4MGYE 3EO6A 5HI0A 4MZUA 1O3RA 4EV0A 5FQ0A 1Q43A 1VP6A 4XF3A 3QOPA 4PIZA 3WW3A 1UCXA 1ZZ6A 2MHFA 1Y3TA 1ZNPA 4H7LA 3SCHA 4I2OA 5J48A 2B8MA 3RZZA 4D7SA 1OFNA 1ZRRA 4F8AA 2PHDA 3H50A 4L11A 2WC2A 3GYDA 3E5XA 1SEFA 2O8QA 2QVSB 2BNNA 4BH9A 1I5ZA 1RL3A 4ONUA 3S7IA 2PHLA 2ZCWA 1TQ5A 3RYPA 1WGPA 4EWAA 3BB6A 4D7TA 3SXWA 2ATFA 3U11A 3BU7A 3CJXA 5JSPA 5BY5A 2OYZA 1QWRA 4I01A 2MNGA 3D82A 2XLAA 3NVCA 4QGMA 4AVAA 2IXHA 1FI2A 3WW1A 3M3IA 3WW4A 5I8TA 1CAWB 4AXOA 3U0ZA 4MUVA 2XL7A 2HKXA 3G7DA 3ACLA 1QY4A 5LEJA 1LKNA 1EP0A 2IXCA 4KL1A 4Q0PA 1LB2A 1ZRDA 3E5QA 1ZVFA 1CGPA 1Q5OA 1VR3A 1YFYA 1UD1A 5KHGA 4DINB 3H1WA 4ORFA 1ZRFA 4IEYA 2H6CA 5C6CA 4XF1A 3UKVA 4IEQA 4AQ2A 4R8HA 4YSFA 4E2QA 4LLOA 4ZU4A 4PIYA 3EJKA 2OZ6A 4FAHA 4IEXA 4E2SA 2K0GA 3E97A 2H0VA 3I59B 4XFBA 2ZKLA 3EHKA 4QGLA 1LRHA 4LUMA 1UIKA 4F7ZA 5JCTA 4META 4L2NA 3NKTA 4ZU7A 4BHPA 3RDIA 2EA7A 2N7GA 3LA3A 4MH0E 5JSRA 5KBFA 1H1MA 3UKTA 2CV6A 1CX4A 5T3NA 1QXJA 2BNMA 1NZCA 3ES1A 1CAUA 4HLTA 4Q0VA 2P17A 1UW8A 1O3QA 2QCSB 5BPXA 3RNSA 3RPQA 4XF9A 5K8SA 2KXLA 5LEKA 1CAXB 4JV4A 2PFWA 1ZRCA 4P9GA 2XHKA 3H3ZA 1ZREA 3PLQA 1DZTA 4E2GA 3NJZA 3FJSA 4OLLA 3H1YA 3ETQA 4MV2A 3PVBB 4QX5A 4UBGA 4QXKA 5E16A 4LEJA 1LR5A 1X82A 4EROA 3LAGA 1NXMA 1FXZA 3MPBA 3O14A 4O9EA 2WFPA 1SQ4A 4KU8A 1OD5A 5BUVA 4HN0A 2GC3A 4IEWA 3VHRA 3IWZA 3I54A 4Q29A 4XFIA 2Q0AA 3KMHA 4XFGA 4XF0A 4IESA 1JUHA 1J1LA 4AQ6A 4BYYA 2XLGA 1Q3EA 4Q0UA 2Y0OA 4QM8A 3S0MA 4PJYA 1O5LA 3KCCA 3OF1A 3HT2A 4XF4A 3IDCB 3E6DA 1ZZ7A 2PA7A 5JSOA 1PM7A 2XKOA 5FLHA 4LA2A 2VECA 3HQXA 3CEWA 2FQPA 4I0BA 3BALA 3USSA 3LOIA 4B29A 4IEVA 5I0SA 1OI6A 4HN1A 1CAWA 2XLFA 1O3SA 2UYAA 2CGPA 2I45A 1WA4A 1J59A 1J3QA 4N9IA 2Z69A 5LRRA 3CO2A 4MGKE 5FLIA 3ELNA 5FLJA 3NSTA 4JVAA 4XFCA 3HT1A 4IETA 3OD0A 1V70A 2QDRA 4HVQA 4YYOA 1O7FA 3DN7A 5I0TA 3M70A 3S7EA 2DCTA 1GQGA 4EWEA 2H6BA 1IPKA 5CADA 1YFXA 4I09A 1ZZ8A 4XFFA 2CAVA 2MPFA 4Q0QA 4QGNA 3FX3A 5CVRA 2GZWA 2D5FA 5D1IA 1O5UA 3IDBB 5BV6A 3CLPA 3NL1A 4LTAA 1NE4A 2D93A 3LZZA 2GAUA 1GQHA 2D40A 2IXLA 1CAXA 3H7YA 1CAVB 4UBHA 3PNAA 3BPZA 3OTFA 3CL1A 1O3TA 1FT9A 3E6CC 1DZRA 5JAXA 1YFWA 4JTOA 4I3PA 4HSLA 2BGCA 5EZWA 2GC0A 1I6XA 4OFGA 2XGXA 3H9AA 3DKWA 4MX3A 3B02A 1UPIA 2Q1ZB 2HJIA 3H8UA 1XE7A 4QM9A 3IIAA 5EFUA 4XFAA 2ET7A 3ES4A 5BXXA 4AVBA 2QJVA 2C0ZA 1EYBA 3HIFA 5C8WA 4HBNA 3KSCA 1YLLA 2EVXA 3QACA 4WVZA 1RUOA 4FBFA 1OMIA 4IEPA 4IEUA 1QXRA 2Q30A 2GH2A 3L2HA 2CAUA 1PMIA 2OZJA 3IBMA 4WBBA 3ZDSA 4R52A 1J3RA 4RD7A 4FAGA 3TNQA 3RYKA 1EPZA 3FFQA 4HVOA 4BIFA 1EY2A 1CAUB 1YUDA 2PYTA 3BCWA 4LA3A 4IEZA 2PAEA 2ETEA 3MZHA 5JR7B 4TLFA 4KU7A 2XL9A 2B9UA 1X8MA 4J1XA 4KWKA 2IXIA 2QNKA 2Q4SA 1RC6A 3MDPA 4XETA 4QMAA 1XE8A 2V09A 4MGZE 5FPXA 3UKNA 2VQAA 1SFNA 1NE6A 1J58A 1G6NA 4XFHA 2BYVE 3EBRA 4MGIE 2UY9A 3D0JA 4YRDA 2EAAA 5J7MA 4Z82A 3TNPB 4Q0SA 3ST7A 1X7NA 1IPJA 2UYBA 1ZZCA 3DL3A 5CU1A 4CYDA 5FQ0B 3R6SA 1ZZBA 5I91A 4KWLA 2GC1A 4YNIA 1X8EA 3C3VA 2BEOA 4IERA 1L3JA 3LWCA 3LA2A 5I8YA 3H3UA 4UXAA 3SHRA 1ZX5A 3ROUA 5F1RA 3FWEA 1YWKA 3I59A 4LULA 4GULA 5J3UA 3H1MA 2XKPA 3D0SA 4I0AA 2Z2SB 3FHIB 2O1QA 1NYWA 2BNOA 5I8SA 2FMYA 1XRUA 3E5UA 3NW4A 4NVPA 5FDBA 1U12A 4Z07A 1CAVA 3OCPA 4IEOA 1YFUA 3E6BA 4HMZA 2D5HA 3U10A 2K9ZA 2GU9A 2IXKA 4J1WA 5KHJA 1VJ2A 4O9GA 3WW2A 5I0RA 2GC2A 4HSJA 2OA2A 2E9QA 4HVRA 4JTNA 1Y9QA 5AVPA 4ZU5A 3I7DA 2PAKA 4X6QB 3LA7A 4FT8A 4K8FA 4I02A 4PIXA 1RTVA 3N4MA 2IXJA 3H7JA 3JZVA 2PTMA
chains in the Genus database with same CATH superfamily
3MLKA 4W6WA 1WCUA 2DFCA 2ZEXA 4XIKA 3IPVA 5F2SA 1VBA1 3M8LA 4OHVA 4BA6A 1VB4A 3NNJA 4LK7A 2F4PA 3EQEA 5F3IA 4M01A 1DGWA 2GNDA 3V0AA 3ZXEA 4QX3A 1GQPA 1PO12 2ZGNA 3AK0A 1QJY2 4M3CF 1UMIA 3OEAA 1YHFA 3I2IA 2D6MA 4FPJA 4X6RB 2QZ3A 1C8M3 4CXXA 2IC1A 1RGSA 4CCKA 4MADA 4KWJA 4WZFA 2DBNA 1FNYA 2VMCA 4XEZA 4M3CB 4AE2A 4CEYA 5I0DA 3POEA 4JRAA 5GLWA 1VMHA 3T4VA 1KS5A 3KCXA 5D8AA 4AYUA 2NQYA 1V6KA 3LB9A 3MLJA 3A7QA 2W5FA 1QH7A 4YLZA 4NAOA 1QDOA 5EJZB 1RUG1 1EAH1 4RS5A 4UW6A 4BE3A 1ZBA2 1H2MA 2WL1A 3MPPG 1OC1A 1POV1 1YQ5A 1V6LA 2VTFA 4XDQA 5FPZA 3WG4A 3DV8A 4LO5B 3GM8A 4NWWA 1AL21 1S0IA 1W2UA 2AENA 2ET1A 2VO5A 5A7WA 4UYBA 3WG2A 4BLIA 4AK3A 1IPSA 4QXCA 5CZKA 1QJFA 3VBUB 4C1WA 1D4VB 3D5OA 3LFIA 2G9FA 4EV0A 5FQ0A 1Q43A 2XJVA 3J7NA 1V6MA 2FDJA 4KGQA 5E6HA 4AAPA 1LOCA 2FZ1A 3O1OA 3WW3A 2ZGSA 1W0PA 5ISLA 1ZNPA 3B7MA 3I97A 1WLWA 3SCHA 2WINB 4J25A 1W8TA 4B1MA 4I2OA 5J48A 1YEWA 3LD8A 3VZJA 4NAMA 2WNUB 4BISA 3TB0A 5JZGB 1GANA 1OFNA 5FXWA 1ZRRA 1LOEA 3NV1A 1S2BA 1DQ0A 4TTGA 2WFF1 2A1XA 2VL4A 2WC2A 3AZWA 3SKVA 1J83A 3ZYRA 1JU3A 5FPBA 4CU7A 5IYYA 5DXDA 4UOJA 2WS92 1VRBA 2Y34A 1D7PM 4HPKA 5DAXA 5BV6A 3FN9A 4COUA 4PHZA 1W6MB 5J37A 2PHXA 4ONUA 3S7IA 1AX2A 3Q9OA 3V56A 2PHLA 2JG9C 2R063 1FPN1 2ZCWA 2XONA 3OPZA 4CXYA 1PVXA 1LHWA 3I3QA 5C33A 4QXHA 1AJKA 1OKQA 1N3PA 3QBQA 3KZ4C 3BB6A 1S4CA 5C4WA 3B5LB 4XJWA 1S0FA 4MXWB 5LATA 1W9SA 1QGLA 3OPTA 2D7FA 2PXJA 4CDQA 2RS33 1W06A 3BU7A 5BY5A 4LBQD 1QWRA 1W6PB 4LHNA 1MS3A 3LFMA 4K21A 1OLME 5J96B 3V0BA 1GP6A 1SZBA 3W58A 1S0BA 2IXHA 2R041 2X05A 2HWD2 1PGL2 5FBZA 5FUIA 4ZZ8A 5ACA1 3PURA 4GJYA 4E8DA 1FI2A 2HBUA 2DCYA 3M3IA 3OY8A 1MR5A 1OOPC 2BW8A 3N9QA 3U0ZA 3B9CA 4RYDA 2J1UA 2XL7A 2HKXA 4PLMA 5JUVA 4GJZA 1DF0A 1QF3A 5FMDA 1H6XA 1LGCA 3FHAA 4NPMA 5EQUA 4QHZA 3IM0A 4FOWA 1SLIA 4WV8A 3VGIA 1EP0A 1ASJ3 1LB2A 1JHJA 1RVF3 4XBNA 3VBHB 1YFYA 3K75B 4YM2A 5A7OA 4TN7A 4DINB 1HV1A 3H1WA 3BVCA 4ORFA 1F2NA 3VLBB 1HKDA 4LE4A 4IEQA 4N8MA 5F2WA 2JICA 1NG0A 4LLOA 4XZUG 3EJKA 3I3BA 3WP6A 1PNFA 4NPLA 2VMHA 3AB0A 5IK5A 4JQTA 1PGW1 2H0VA 2XG3A 2GSYA 5IVJA 4IQPA 2RVAA 1OQDA 1IKQA 3KV9A 1N1VA 5IW0A 3AX4A 3Q8EA 4DXZA 2G19A 1NCRA 2YBPA 1RXFA 5FV3A 4L2NA 4CCMA 4BQ3A 3O1PA 2V4AA 3SISA 3RSJA 3T0BA 4TLGA 4ZU7A 4FPKA 3TBDA 2CU5A 4BHPA 4DIQA 3S5AA 1IS4A 1KQRA 3RDIA 3LA3A 1WCKA 2D97A 2N7GA 1R1A3 2VH9A 2XH6A 1H1MA 4MH0E 4XQWA 2Z5WA 4UI9L 3WDXA 1CX4A 1XSQA 5FY5A 3ACHA 3PVNA 3HBZA 4RHV1 2IFRA 1JUIA 1IG3A 4MVTA 3GALA 2VUDA 1CAUA 4QXBA 3NKGA 5FAXA 3TWIA 1QQP3 3JD72 1KGYA 1TME2 4R9CA 3WDYA 1O3QA 1VBD3 1XNAA 1ULEA 4A3XA 5K8SA 3W20A 2JG8C 4JV4A 3ABZA 4P9GA 3WQ1A 1BK0A 4P9WA 4DXSA 1RUE3 1DZTA 5CYYA 3HNMA 4E4ZA 3WDUA 4DUXA 1HJFA 2WZR3 4GMP1 3ATGA 5JI9A 1JH5A 5K0UB 1F35A 1NOVA 2BOJA 1NA1A 2ZGRA 4LORA 3ETQA 4KBZA 3VBOC 1CZSA 3RRDA 3PVBB 3HQRA 2TBVA 1F8VA 4QXKA 3O0XA 3OBTA 3JBG2 5E16A 4CXWA 2A73B 1M4WA 4Q4Y2 5IVEA 4AVVA 5L9BA 1W6QB 3AYDA 3PIGA 1HX6A 1S0CA 2XJTA 3LAGA 4K1YA 2JKBA 5FZMA 3ENRA 3VB9A 3POWA 2YGMA 4L8QA 2JG9B 4N53B 1JHNA 2WFPA 1S0GA 4X8PA 2AEZA 4HN0A 3SH4A 4CUGA 2WR9A 5APAA 5FY9A 1I9RA 5CA6A 3KB5A 1KFXL 4AGVA 4COVA 4XYXA 3H8XA 4NO4A 4XF0A 4A42A 4IESA 4OHXA 5FY4A 4AQ6A 3M3EA 2NMNA 5F37A 4DMIA 4CP9A 2GN3A 1S1AA 2R0HA 3ZMNA 2EICA 4LBQA 1VPHA 5LK7B 3H0OA 2BU9A 1DCSA 4PJYA 4Y5Z0 4NRQA 3OF1A 5HPOA 1E57A 2EF6A 3ECQA 3IDCB 1S55A 1VBA3 4P00B 1V9U1 1WBLA 5JSOA 3C8XA 1LEDA 2XKOA 1OA2A 3WQBA 4XUNA 4COWA 1U5YA 2FQPA 1DBNA 3NRUA 3SQOA 2G4IA 2B9VA 1X33A 3BALA 4I0BA 4Y20B 2YYOA 3ZXJA 4COZA 4XABA 1PX4A 1DYPA 2ZEZA 5FTTC 3VBSB 4ASMB 2F17A 2RDSA 2P3YA 5CB7A 4W4ZA 1O4YA 1IQDC 3AC0A 4QKBA 5FZBA 4XIOA 1CAWA 3MFAA 1DLCA 2FMDA 4EZ4A 2HWC2 2RM23 3T2OA 5FY0A 3ZYJB 3KV6A 4DFSA 5C9AA 4ARYA 2CGNA 2CY6A 3ILRA 3HQUA 1RUC3 3CNAA 2CL2A 3HNYM 3HR9A 4YFZA 1RUG3 1EAH3 4F83A 1WA4A 5KXCA 1AXYA 1VB2A 1A6CA 2XOMA 5CNAA 5F3EA 1J59A 5FXVA 2HBTA 1RUH2 1AR61 2PLV1 3AYAA 3VL8A 4BQ4A 2HH9A 2P4EA 1D4M2 2E51A 5T5PA 1H9PA 4GAZA 4A7ZA 4EE2A 2QQPA 3ZFEB 2GP5A 4QX8A 1S0JA 1UQXA 1W2NA 4LIUA 1PZ8A 4Q1PA 3TN91 1NCQB 4YVSB 3BKZA 1B35C 2W87A 1F15A 5FMOS 3ZYGA 5FOBB 3ZIXA 5LY1A 3BTYA 4TWTA 5AFBA 1VRH3 1JZ3A 4QU2A 3S7EA 2KA3A 4CDUC 1GQGA 4WM8C 3AL5A 2R32A 5A3TA 3ZKYA 2H6BA 4BZ4A 4DY5A 3Q8FA 4QPGC 3IN9A 4DEQA 4A4AA 4BLJA 5AC93 3VBUA 3WD5A 4LMFA 3GHMA 1A3KA 4XFFA 2MEV3 3ILNA 5JIAA 1LOBA 4LOSA 4DUVA 3OEBA 4BQXA 2JJ6A 2W08A 4QGNA 3TOJA 1Y9GA 2TUNA 4I30A 5FYVA 3PDQA 5CVRA 4DXRA 1WMXA 2GZWA 2QQNA 1QNWA 2DWRA 4R9AA 4A3ZA 3WNOA 2UU8A 2ZGPA 4NRPA 2C24A 3NL1A 4BK5A 2NZ9A 1IS6A 4KQ7A 1GQHA 1FPN3 1XU1A 3VBRB 2ARXA 2D98A 2D43A 3H7YA 4QKFA 1CAVB 5JOWA 1HQNA 4M3CA 5L36A 3RZKA 1LNSA 5ABJB 3GCXA 3NNMA 1GNHA 1WW7A 3MF6A 4BM8A 3T1MA 5A33A 4R9BA 3KHBA 1C8M2 1JYIA 1JZ5A 2YC2A 4JTOA 1UOGA 3PU8A 1YRZA 3JXSA 1V6IA 4OFGA 2XGXA 4HXCA 3SEEA 2CDOA 3H9AA 3WOGA 3WX5A 2R043 3DKWA 5F32A 4MX3A 5HXVA 5HV4A 3IT8A 4L97A 2HJIA 5DABA 4FOYA 5DG2A 3IDEA 1F4AA 2RMU1 3AYEA 3HBKA 4RGGA 1STMA 1WUVA 5A7QA 1O4ZA 1AR91 3UK9A 1RJ8A 3VKFC 1KFUL 1PO21 5FZ6A 1JN2P 4Y1VA 3HIFA 5C8WA 4HBNA 3SITA 4NUBA 1YLLA 3T08A 2XJQA 5F3GA 1W8FA 1OMIA 2XJPA 3VZNA 3I2HA 5F9TA 3MIDA 3IPVB 1WW6A 5F5AA 2GH2A 3AJZA 1R1ZA 1W0OA 5GZDA 2OZJA 5JZGA 1FX5A 2QQUA 1CONA 3PUIA 3AKPA 4RD7A 4M0HA 1EUUA 3AP4A 3ZR5A 3V0AB 1Z78A 3K3NA 3S6PA 5CFCC 4K8RB 2PYTA 1ENQA 3CU7A 4LA3A 1GZ9A 1W3VA 3EB7A 1W6MA 3KVAA 4BQ1A 3C2UA 4QQOA 3VD4A 2B7YA 2WWUA 5JR7B 1JYXA 1ENSA 4MYEA 2XPJA 2W91A 2Q1FA 5BNPA 4CEYB 2A6WA 4J1XA 2QNKA 3LEIA 1RC6A 3MDPA 2Q8EA 5FYSA 4Y5SA 1XC6A 2BZDA 4E4DX 3OUHA 4MGZE 1F31A 3CZJA 3D3AA 2DTWA 2R062 4X8NA 1FATA 4XFHA 3RZHA 1OURA 4N43C 4MGIE 3J26N 1JOPA 1YI7A 5FYTA 5T55A 2ZA9A 3RFRA 5C5UA 1A8MA 5L73A 4K6BA 4PDWA 2RHPA 2VOKA 1V6NA 2AGSA 2RS32 3K51A 3I8TA 1DU3D 4XCAA 3GCWA 1L7RA 3UYJA 3GXUA 2FD8A 1JYVA 1W8HA 1ULGA 3SKJE 3KWVA 2ID4A 5FQ0B 5EYXA 4UT5A 4GMP3 1HQWA 3AZYA 3M1HA 4RSUA 2ZPXA 4RR3C 4OUSA 3WR0A 3DF0A 4EQVA 5C3SA 1KD7A 2CGOA 4WVWA 3UJQA 3ASIA 1HB1A 2BEOA 4IERA 1PZ9A 4XE9A 5GLTA 3AMQA 2VMIA 4A44A 3LA2A 4MG2A 3H3UA 1ASJ2 1FV2A 1RVF2 3A4UA 3DUIA 2VUAA 4M0NA 3O1MA 3SHRA 1ZX5A 3ROUA 5LY2A 2DDUA 5FFOC 1YWKA 4Z92B 4HONA 4XPVA 3H1MA 1AXKA 4NHLA 4Q26A 4AEMA 4L0PA 1O8SA 1WD4A 2CHHA 4IGPA 4IE4A 4J6GA 3WNPA 5A3PA 5BNOC 4LT5A 1H4GA 1CIYA 1ZRIA 2W3JA 2RJKA 2D3SA 4KMQA 1DLLA 2VMGA 1XNBA 4ISRA 5C4WB 4QHBA 1JYNA 3RMXA 1U12A 1HDKA 2L9LA 4Z07A 4LBJA 1RUI1 4EYUA 5JXJA 3HOBA 1Y4WA 2ILMA 1V9U3 3MIHA 3OCPA 1YFUA 1QJX3 3PVOA 5JR2A 4HMZA 1SCRA 2P6CA 4IE6A 4NIIA 1Y7BA 1R1A2 1CVNA 2IXKA 1NKGA 1AZDA 1ULCA 4J1WA 4PF1A 5LBBA 1OUXA 1E5HA 5I0RA 4N7IA 2JDPA 1MVEA 4DRRA 4HANA 5FZIA 1UZZA 1OSGA 2TEPA 1QQP2 3T2QA 2QQVA 5JIUA 4W8JA 5DDJ1 5KC6A 3GZUC 1VBD2 4P9XA 2VZ3A 3NQHA 4FT8A 4I02A 4PIXA 3N4MA 2OKXA 2IXJA 5IVVA 3H7JA 1UD1A 1RUE2 3FBYA 3JZVA 3OGRA 3AMHA 4FSJA 2WZR2 2PQQA 1AR63 2BJSA 2OX0A 2Y6KA 1ZZ9A 3RMYA 4CP1A 2JG9A 5HCFA 3ZVXA 3J9SA 4QPIC 5F3CA 1RUNA 3OGJA 3ACIA 1HW5A 3HN3A 3TN93 4CE8A 4BMBA 3I3MA 1C3HA 1PIV1 3GBFA 4XVHA 3T09A 4GXLA 1XXNA 2GN7A 1NY72 4EZHA 2PAMA 1QOTA 3BIEA 4MHUA 3T0AA 1ND2C 3AKQA 4OI0A 5EYYA 5FZ0A 3WHUA 2PHRA 3MV01 2VW2A 1W9WA 4HZFA 3A22A 2NP0A 4CDWC 2FDKA 1DGWX 1WMDA 5LBEA 4N9HA 1UXXX 1W99A 4Y5TA 3AVSA 5BNNC 1JU4A 1H1IA 1WW4A 4QB1A 3ZFGC 5IAXA 1W28A 5FIXA 2RS51 1UOFA 5FUPA 4AQSA 1D0GA 1D2SA 5FRAA 3RZJA 1T2XA 3P3NA 1N47A 2BGOA 4XHBA 3O5SA 3KGZA 1XPWA 1VBA2 3MLLA 1W8UA 4D8MA 1RUJ1 4XCBA 4V2WA 1I3HA 1NXD1 3RYRA 4WM7C 3KM5A 1FOD1 5IHRA 5FP8A 2B5HA 3EMRA 1LULA 3DPRB 3FE5A 1D0HA 5FYIA 3ZXGA 1WW5A 4IL7A 3EO6A 4MGYE 1NA1B 1AF9A 2Y0IA 4MZUA 1H2KA 2R1BA 2EXHA 2A70A 2FBEA 2B39A 3CBNA 5C3QA 4B1LA 5FMBA 3OOXA 2XVKA 1FMD1 1AHSA 1Y3TA 4UAPA 4IXLA 3GJAA 3ZYFA 2QUOA 4H7LA 1DFQA 2Y6FA 1XNTA 1VMFA 3H42B 5FJHA 3UESA 2RM22 2WAOA 1G86A 3BTAA 2PN5A 3OYWA 3WDVA 4NIGA 1BYHA 2VY0A 4KG8A 4F8AA 1ULPA 3ZFEA 1RUC2 4LHKA 4Z2AA 3K3OA 2PHDA 3H50A 2YV8A 4L11A 1RUG2 1EAH2 3CDZB 5FP4A 4IV3C 2O8QA 1UY4A 2BNNA 4LKFA 4FP2A 1AR93 2KR2A 2O0OA 4BH9A 2BBAA 2W95A 1I5ZA 4CP9B 4OMDA 2GMPA 2LROA 3JB4C 5JPMB 4LBQB 1PHMA 2P3IA 2J1AA 4TSVA 5A80A 3WDTA 1NT0A 3PHMA 2YPDA 4S2GA 5D2AA 1TQ5A 1WGPA 3IB3A 1DQ2A 4EWAA 1JYTA 1FYUA 1VBC1 3H3LA 1K12A 1VRH2 3POIA 2GH8A 2ZZJA 3R0RA 2JB4A 3SXWA 4GZ9A 3UV9A 2JG8A 2VZPA 3U11A 3N35A 4BU2A 2D6OX 4XHXA 1VAVA 1QH6A 2XLAA 3NVCA 5AC92 5G04L 1AR81 5ANNA 5FO9B 2MEV2 3WNNA 4QPWA 2J1SA 3VBOA 2WO1A 4E9KA 3J8F1 4B3NA 1CAWB 4AXOA 2JDAA 2AEYA 1JW6A 3HVDA 5CFDC 2XVGA 3ACLA 1TMF1 5ABJA 5F5CA 5C9AB 3MO4A 1BVVA 2YU2A 4GD4A 1LKNA 4QPIB 5L9RA 4Q0PA 1ZRDA 3WINE 1YQ8A 1IGOA 1KXGA 3E5QA 3FBMA 3ZR6A 4AHZA 1FPN2 1VR3A 5FYMA 4CCEA 3FUQA 2RS12 2GNBA 4XF1A 1UOJA 2ZBJA 2C26A 2C9AA 3PTYA 2VNOA 4AQ2A 3HJRA 3BPSA 1FAYA 2WNVC 1QHDA 2E7TA 4PIYA 2VNGA 1G9BA 1UMHA 1N3OA 3GZAA 1PGSA 3E97A 1SHWB 4Q4X1 4YG0A 4FCAA 5GZFA 1EV11 2HWE3 4OVEA 3ZSEA 1UWWA 1HXS3 2R042 3AJYA 4CSWA 5C3OA 1RB8G 3VKLA 5C8CC 4LUMA 2ARAA 5B4NA 2QQOA 3ZFGB 4E4SA 4OMCA 3NKTA 1NQJA 2J1RA 1ONAA 2X8KA 1UF2C 2CV6A 1OKOA 2OIIA 5J1XA 1VAMA 3UL2A 3KLSA 5HCHA 5EWSA 2RE9A 4H7MA 2ZAHA 1UO9A 5A7PA 1JI6A 3KHCA 1H0BA 2WN2A 4PCRA 5GALA 5DZGA 3ETPA 3PUQA 3ES1A 4BOWA 3MBWA 5HBAA 4Q0VA 1AXZA 5IUQA 4CRQA 4XW3A 1UKRA 3WP5A 1Z7S1 4NIDA 5CKMA 3OSDA 2C9KA 5FZ8A 4DS0A 5LEKA 1BEV1 1SMVA 3IAPA 3POSA 3LKJA 1R64A 1PGW2 2XHKA 4JHZA 4UFHA 3ORJA 2Q8OA 5C3RA 2EXJA 1LU2A 1BBT1 3NJZA 4P08A 5A33B 3FJSA 4BB3A 1GZTA 5E8AA 3AVRA 4ZY9A 2DUPA 4S2DA 2VTXA 4TYSA 5FPAA 4YW3A 4MV2A 5C71A 4QX5A 2FCTA 1B35A 1ZBE1 2XQXA 1OF3A 1X82A 2JX9A 5DAWA 1G9DA 3AZXA 4JDMA 4U2AA 2AC1A 4CDUA 3BTZA 1ND3C 3O14A 4U36A 2DVFA 1MS4A 4O9EA 4QPGA 5IK4A 4KU8A 1CIWA 1OD5A 1WKYA 2GC3A 1PVC1 4QB2A 3TEZA 4Z1VA 2NLRA 2G9ZA 1K3IA 2WKKA 4Q29A 4YWAA 5DDJ3 3OD4A 3KF3A 5CG9A 1AR73 1JUHA 2D3PA 2ZABA 4XJ9A 3ZFFB 1APNA 1TZOA 2ZKNA 3LE0A 3WCSA 4NROA 3OB8A 2B4KA 3KVBA 5IK7A 2Y0OA 5LA1A 4QM8A 3VD7A 3MI8A 4YGCA 2A6VA 3U1XA 2W1WA 4OI2A 1AUYA 2VE1A 4Y22A 3OGSA 5FLHA 4LA2A 5CFDB 2V4VA 2RJLA 1MQTC 5A3NA 4ZZ5A 2OQ6A 2D44A 2VBPA 4QX0A 4AQTA 5FPVA 4A41A 2JDZA 2P34A 3USSA 4XOGA 3S30A 4B29A 1LECA 2YHJA 2YBSA 1W2OA 5BNPB 5I0SA 2HWF3 4MGSA 5EJ3A 2FCVA 3K4ZA 4AEDB 4HN1A 1NLRA 2XLFA 1JYCA 1Q8OA 4RA0A 1R091 1VBE1 2UYAA 1LEMA 4LE3A 3WF2A 2ARCA 1JXNA 4TXWA 1JTZX 4Q4V2 1BVP1 2BVBA 2LRPA 2I45A 4DOUA 4FTEA 3CJIC 4P9YA 3JUUA 5EPAA 4IDZA 3VHNA 3TRSB 4NIHA 2XBO1 3ZN4A 3T2TA 1A34A 4PDWB 4JGZC 2CWSA 3CO2A 1YQ2A 1SDDB 3ON7A 4WVMB 5A3OA 1V9U2 4XFCA 4OCTA 1QJX2 3HT1A 3OD0A 2WA3A 4AVTA 5T50A 1FOD3 3LEKA 4XJUA 4BK4A 2VM9A 1H6YA 2ZX2A 4DEVA 3NV2A 4NIAA 4FVVA 1AX1A 3DN7A 3I3EA 1X36A 4XTPA 3VHPA 2BQPA 1Q8SA 2OXBA 5FZ9A 3USUA 3ZSLA 1IPKA 1FMD3 5F5IA 5FYYA 5CFCA 2WZPP 3LOBA 2NYYA 3N36A 2IVJA 5T5OA 3WQ7A 5JOYA 1KS4A 1AVBA 1RUD3 4LHLA 1ZZ8A 4YW6A 5FYBA 1RMU3 3PJQA 2ENRA 3ZO0B 3GHNA 2VMFA 4YGEA 3WNKA 5LZ6A 5H9SA 1OA4A 5FZGA 4UFLA 4YZ2A 2ZAAA 3AMPA 5LA2A 2ZGKA 3F2ZA 3HAGA 2VZUA 3WP4A 1TVGA 5D1IA 2EALA 4W65A 2VQ0A 5A32B 4LTAA 3N9OA 4GIQA 1NE4A 3WV6A 2VZQA 1AR62 1JZ6A 2P2KA 2BP6A 4AI8A 3U78A 4LBMA 4N43A 1C57A 4LR4A 5FP3A 5F6LB 3IZOA 1CAXA 5DZEA 1PNGA 4XTMA 5H9QA 3QH7A 5E89A 4FPEA 3H8OA 2UURA 1VBC3 4DB5A 3Q8BA 5GZCA 5DG1A 1O3TA 1FT9A 1WCSA 3E6CC 2W9XA 5T52A 4PBPA 4I3PA 1QOOA 2QQMA 5KC5A 1ALYA 3C7HA 5CKQA 4C91A 4WVVA 3B02A 1UU5A 4RR3A 3SLIA 3R4UA 2I2SA 2DCZA 4IV1C 5F8PA 4XFAA 5FXZA 3FLTA 2XWJB 3DPRA 3ES4A 5BXXA 4AVBA 1YCIA 2QJVA 3NNLA 1TMF3 4IE7A 4AGGA 3ZIWA 2Y60A 3MICA 4MXVA 3SEPA 5FR3A 2DU0A 1NLQA 1UY2A 4XZPA 3QACA 4P5YA 1OPMA 2EVXA 3RG0A 1OVSA 5IJRA 4SLIA 5FKCA 1W8NA 1C4RA 2YG0A 4IEPA 1I5PA 1QXRA 1JZ2A 1W6NA 1OPOA 4HL0A 5FZFA 1CX1A 3M3CA 1C5HA 3L2HA 3IBMA 2QZ2A 4AF9A 4WBBA 2RR13 2VZOA 4R52A 1GYKA 1VBB1 5FP7A 2WNOA 1N1YA 5FZCA 4FAGA 2YDEA 5HV0A 4DY3A 4HVOA 5M0TA 3WLUA 1YI9A 1EY2A 2A6YA 4Q4X3 1EV13 2QQIA 2VXRA 2Y6JA 3BCWA 2YROA 2PAEA 1CZTA 5A6YA 4K1ZA 2EXKA 3Q8AA 4A7YA 1Y9MA 2WS91 1LOGA 1X9PA 3LGRA 1RINA 4RQPC 1UU6A 2HEWF 1QMJA 4S2HA 4TLFA 4KU7A 1LOFC 1YXWA 2XL9A 3OBAA 2B9UA 1OBNA 3DCQA 2Q4SA 1AR92 1OOPB 2GDFA 1COV1 3NV3A 4Y1ZA 3NJYA 1S2EA 5JXGA 1F5FA 4ZPIA 1SFNA 2E7QA 1J58A 2VMEA 1CZVA 2VZRA 4FFHA 4CDXC 4FTBA 4KI5M 1GMMA 3WVJA 5L9VA 3D0JA 2EAAA 3URFA 1R081 3W21A 1Z7S3 2ZGTA 2HWD1 1SFYA 3TNPB 4Q0SA 4ZS3A 1WD3A 1X7NA 1BEV3 3QH6A 4ET7A 3JQWA 4PI2A 4AI3A 2X5IC 3DL3A 1IZ3A 3PVEA 5CU1A 2NN8A 3VBFC 4CYDA 3OG2A 5B4XA 1BBT3 2KM2A 4QPIA 3FFZA 5A3WA 1JOBA 1MZFA 1W03A 5C5TA 1OXCA 4KWLA 3ZPOA 4CUBA 5IVYA 1TG7A 2ADDA 4XUQA 1POV3 4GWIA 2GC1A 4LBOA 1MZEA 3OYWB 4YNIA 1H30A 2P5BA 3O0WA 1K42A 3GGLA 4XACA 2XJRA 1AL23 2WJSA 2JDUA 1ND2A 5F7UA 4UXAA 5GZEA 1DHKB 4CU9A 4GMP0 2DCJA 5F1RA 4G9SB 1YIFA 3T4HB 2B45X 2GMEA 3KT1A 3VKOA 3WXPA 3O1TA 4GULA 3T30A 4AVSA 5J3UA 5GLUA 4N90A 4B7EA 4I0AA 1WBFA 2Z2SB 3ZFGA 3FHIB 2W68A 2O1QA 2EAKA 2A3WA 1BQPA 2ZMNA 3E5UA 3NW4A 4FOQA 2CYFA 5FY1A 3BN6A 2HWE2 1HXS2 2JG8B 4FPOB 2J42A 2EIBA 3RVHA 2WFF3 4WM7A 2AH2A 2VCCA 3E6BA 2HYKA 1FV3A 2E33A 5BYNA 4FPCA 5IAVA 5FZKA 5HCAA 1MS1A 3VBOB 4XXAA 1V0AA 2GU9A 4GKYA 1VJ2A 2W52A 3JD71 3WT3A 2E9QA 3LSEA 4XILA 4JTNA 3UGGA 2JDKA 4FOVA 4ZU5A 3I7DA 3WEZA 2PAKA 5IVCA 4YZ5A 3DYMA 1W2TA 2WZEA 5LK5A 1V00A 3AXDA 3WF3A 3B00A 4YZ4A 3D4KA 3LCPA 3ZDVA 4AI0A 5EJ1B 3AP5A 4QQPA 2ZGLA 3LA7A 4BXFA 4K8FA 4IV3A 1MS8A 4QDSA 4RGAA 3IMMA 5EHDA 2FDFA 1VIWB 4JGYC 4LLFA 5ACA3 3N9LA 5FLIA 4LOTA 3U37A 4ZXEA 1G9FA 4RQPB 2Z4FA 3R05A 4A6SA 1DGRA 3C7FA 5D21A 4AGRA 1O4TA 5FYZA 4G3YC 5C70A 4RL7A 3AYCA 3THCA 4BXSV 2WDBA 5GKAC 5FZHA 4FPLA 3P5BA 4K7JA 4E8CA 5KHHA 3SC7X 3LIHA 1XYNA 4R4ZA 1O59A 5LRSA 3FZ3A 4A6OA 5KHIA 5KR7A 4YG6A 3ZFFA 5I93A 4AVCA 2OPKA 4FO9A 3HWJA 3LPGA 4CDXB 1UIJA 3HPNA 3CF6E 4EWDA 3AMNA 3SCGA 5DDJ2 4EN9B 3SCFA 1AR72 4AFBA 2J7MA 2PHTA 1Q56A 3DEMA 4QHOA 3BTXA 5CFDA 2X5IB 3HN1A 3MYXA 4QD2A 1E5RA 1W8WA 1J3PA 4G4FA 5DQ0A 3I2GA 1DQ5A 4DPNA 3IIIA 1XYOA 1C5IA 3DKQA 4P9LA 2BFUS 2YFZA 4P9JA 3GZTB 4ISQA 4NMIA 1ZYBA 2UY8A 4AEDA 1QJU1 5FCCA 2J1VA 4LUKA 4Y3OA 4WZCA 5JI7A 2E31A 5F39A 4RHV3 5HI0A 5J36A 2WN3A 2DVGA 2PELA 1OH3A 1H8TC 2WNVA 2HWC1 3ZX7A 1MS9A 1W8OA 1B35B 1FNZA 2Y64A 3QOPA 5FMOL 2Z79A 3THPA 3ZXLA 4PIZA 2HWF2 2JDNA 4RFRB 4D94A 4F3JA 1AYN1 1ZZ6A 2MHFA 5FK7A 1VLNA 3OGVA 1HB4A 1LHUA 1RJ7A 2ES3A 3FUOA 4BPZA 4CDUB 5C8CA 4WM8B 4HG6B 3RZZA 1UX6A 4PT6A 4QPGB 4WVMA 1RUH1 1UXZA 1NZIA 2JE8A 2OUJA 4EN0A 1OFSA 3P6BA 3MW2A 5JMOA 2TNFA 4C1XA 1D4M1 4BQWA 1F4HA 3GYDA 1SEFA 4W6XA 2QVSB 4JKMA 3MV11 4AAXA 1SDWA 2VNVA 1C1FA 1RL3A 3T1LA 5CISA 3MW3A 1LHNA 2VMDA 1LENA 4GA9A 2R30A 1E5SA 2DFBA 5IFTA 1FOD2 4LBLA 4YVWC 3RYPA 3AP7A 1AX0A 3LF7A 1W05A 5EV7A 3QLQA 3HD8B 2OS2A 4Y22B 3ZXDA 4EN7B 1VBB3 3CJXA 3DXUA 4KH9A 4IGQA 3SH5A 5JSPA 4AR2A 2VZ1A 2OYZA 1QOSA 1FMD2 4B8EA 2A5ZA 3D82A 4AVAA 5IVBA 2LUWA 3TAYA 2VC9A 1RUD2 1W2AX 1RMU2 4K40A 5A32A 3WW1A 3N7JA 3AZZA 4YW7A 1KRIA 1C28A 5I8TA 4JGYB 4GWNA 3OGGA 3ACFA 4QQHA 4P14A 4AG4A 1POQA 2D3RA 1COV3 1ND3A 1H2NA 1YIPA 4LBNA 3F95A 4KL1A 5SV5A 1ZVFA 3NNFA 1E5IA 2W0XA 1CGPA 1AJOA 2JE9A 1DZQA 3ZXFA 1C8M1 4DXTA 3WY6A 3LIGA 1ZRFA 4D0QA 4ZHNA 1R083 1VBC2 5TSWA 2DTYA 5DAQA 4YSFA 3KT7A 2WSVA 2D6PA 1QDCA 2WZ8A 2CSGA 4ZU4A 5A1AA 5FUNA 3ZMOA 2YUEA 2JDHA 4IEXA 4E2SA 1GWMA 5DUVA 1UYPA 4C0BA 3I59B 4LBKA 2WT0A 2ZKLA 4XFBA 3EHKA 1QU0A 3WSOA 1LRHA 3N9PA 1UIKA 2ZX1A 2YC4A 3USUB 4CCCA 4GWMA 3B93A 4META 5CFCB 2GNMA 3W5NA 4OQ8A 1MQTA 1MZ6A 5FPUA 2P3JA 3ALQA 2RDNA 1VE0A 4GWJA 1W90A 1DDLA 2PLV3 2A75A 1BKZA 5JSRA 4AI9A 5KBFA 3UKTA 2X10A 1BMV1 4GB31 2BGPA 1XBFA 1H8VA 2B42B 5FKBA 3O0VA 4YGBA 5T5LA 2VZVA 2BWAA 5AFEA 4Q4W1 1NZCA 3LDBA 4HLTA 1JMUB 3RZMA 2DVAA 3WF0A 2IFWA 3THDA 1PM4A 2P17A 1NX9A 1UW8A 2BERA 2J1EA 2JD9A 5GLVA 3VD3A 5BPXA 1LHVA 1SLAA 2RR12 3RPQA 4N43B 3JB8A 4XF9A 3CJIA 2KXLA 3ZYHA 3W5MA 1CAXB 1NUKA 3AKSA 4QX2A 2PFWA 1ZRCA 5L7OC 3MIGA 3Q8CA 4JGZA 2FDHA 2VVEA 4Q4X2 3MIBA 1W04A 3PLQA 1OOPA 1EV12 1OVPA 4E2GA 1H2LA 1OLMA 4KBBA 5LBFA 4OLLA 1XE0A 1XJAA 1JOJA 1UKGA 1Q8VA 3H1YA 3I2KA 3GF6A 1LJ7A 3WQ0A 2YU1A 1OLQA 1OHFA 4QAWA 4LEJA 2BVVA 4XMAA 4RR3B 2OQ7A 3R4DB 4EROA 3U14A 1PK6C 2YMZA 4XJZA 1NXMA 1FXZA 3MPBA 3IKWA 4BMEA 1UZWA 2F4LA 2LW8A 1SQ4A 3PUAA 4QX1A 5BUVA 4YVWB 5FP9A 4IUGA 4FFGA 5FZOA 4ASLA 3V64A 2BRTA 1U0AA 1RUF1 4IEWA 3GBGA 1CJPA 4UFMA 5JVVA 1WMFA 4AHWA 4YW5A 3BYWA 5DAPA 3I54A 3KV5A 4XFIA 3I3DA 3KMHA 3I49A 1Z7S2 4OHZA 1LOAA 4BYYA 2IZWA 5E88A 2JECA 4AFDA 1BEV2 1GR3A 1W6NB 4XJ8A 5B2GB 2NPIA 2XLGA 4YG3A 3RJRA 2HEVF 4Q0UA 2H0BA 2YFUA 4LNVA 5BNOB 1O5LA 3KCCA 4W6YA 1BBT2 4FPYA 4C0HA 1QNYA 3HT2A 3WG3A 2RMU3 1DGLA 3E6DA 4FXGB 2P3KA 1GUIA 2PA7A 4CPBD 1PM7A 4OI1A 4RGKA 4EN6B 1UNBA 3PJYA 2K46A 2Y6LA 2BV4A 1DG6A 1PO23 1SFPA 1WWYA 2QTWB 1XNCA 4CUAA 1AL22 5SV8A 3LOIA 4IEVA 3C7GA 4P5HA 3LPFA 4LO8A 4RN5A 4NPRA 1OI6A 2YC0A 2LS6A 4URTA 2ZHLA 1BLZA 1CQ9A 1UOBA 3ZN6A 5DUWA 2V5DA 1AYM1 5IWFA 1O3SA 3NV4A 5FYHA 3HEIA 3RZGA 2BBVA 2NM1A 3AMMA 4IV1A 5A6XA 3APBA 4GH4C 4QB6A 4O65A 1K5JA 2Y8KA 2VXJA 2QQKA 1J3QA 4N9IA 2JB8A 3JQXA 2Z69A 2Q8CA 5LRRA 4DQAA 4QU1A 4GKXA 2WLQA 1R1A1 4D6RA 4CCJA 5FLJA 2WFF2 4JVAA 3FC0A 3EXUA 1N1TA 3WHTA 1V70A 2YXSA 1QJU3 4A45A 2JXAA 4HVQA 5DMYA 1QEXA 2R7EB 3N7LA 5FZAA 2GP3A 1W3XA 1YJKA 4AWDA 2JDMA 1CJDA 3T3YA 4L99A 5CKNA 2ZEYA 1QQP1 3B3QE 3M70A 1BCXA 1HJGA 1Q8PA 1REEA 1VBD1 3ME2A 4O61A 4EWEA 2FZ2A 1AYN3 1ULDA 2VUCA 2WNUC 5CADA 5JOZA 1LU1A 1SLCA 4YZ1A 2BTVC 1ND2B 2BDRA 2YZ4A 3AZVA 4I09A 1H4HA 2JENA 4FPFA 4JZRA 2ADEA 2PHWA 2CAVA 1RUE1 4L92A 1GOGA 3R4SA 1DIWA 4RQPA 1LOFA 5GJ6A 3FX3A 3GJBA 2E6VA 4H3WA 3T2PA 4AFAA 3POJA 4JX0A 5H9PA 4CDWB 2D5FA 2XXZA 1O5UA 3IDBB 3B69A 4OI4A 1D2QA 3CLPA 3DGTA 4RFT0 3ZXAC 5ACA2 5BNNB 3O1SA 3KQ4B 3LZZA 2WO3A 4UF0B 1LTEA 1NY71 4UFJA 2VZTA 4M4PA 1RITA 2VR4A 2R071 4K20A 2D40A 2PHUA 4ES8A 4CDXA 4QDQA 1V6OA 1BHGA 1SCSA 2ZHMA 1EUTA 2IVIB 3OBRA 1PK6B 4UBHA 4LIVA 2VQTA 4UW3A 4C8DA 3PNAA 4MO3M 3BPZA 3PTRB 1EPWA 2C6SA 3OTFA 4WM7B 2I07B 3I4IA 3ITQA 4XAAA 2CNAA 3PUSA 4PQ9A 4ZS2A 3VD9A 1HRV1 1YFWA 2QBXA 2X5IA 5CBLA 2BGCA 3MIFA 4AFMA 4DUWA 1I6XA 5FXXA 3J4UH 5DAVA 2DVBA 3DECA 2XB6C 1WCDJ 1C1LA 3HNBM 3A0NA 3UGFA 1LHOA 3H8UA 1XE7A 1PMHX 1MEC1 3IIAA 3POBA 2ET7A 3JCIA 1RUI3 1SBDA 3W9AA 1PX3A 2E53A 3VBHC 3D8CA 1HN1A 4IV3B 2GNTA 4BQYA 4CUCA 3KSCA 3POFA 4WVZA 4FBFA 2E26A 4CPBA 2W94A 2WQZC 2Y6HA 2Q30A 4CZSA 4NHMA 4WM8A 4RHV2 1JZ7A 4CCNA 1GWLA 2CAUA 2VULA 2Z42A 4CCOA 1G9CA 3ZDSA 1UL9A 1N1SA 2RM21 3CQOA 3KV4A 2DVDA 2V5YA 4YZ3A 3TNQA 3WNLA 2X29A 1X50A 5FREA 2Q5TA 3RYKA 1RHI1 2ORXA 2VBDA 1EPZA 2XR4A 3CZUA 3FFQA 1RUC1 1YUDA 2VBBA 5HXMA 1XOYA 3BU0A 3IAQA 3MZHA 4I3GA 1HLCA 4GH4B 2RV9A 2EIDA 2PQSA 3H8RA 1ENRA 2J1TA 4R4XA 1GBGA 2AREA 1OA3A 1SBFA 5FBJA 5FWJA 2HWB1 4BQ5A 1X8MA 4YW1A 4KWKA 3RGBA 2VZSA 2YGLA 1HN0A 5LA9A 1L7QA 4XETA 4QMAA 4GB33 5ANQA 1UYZA 2QDNA 4AEKA 5FPXA 3UKNA 1VRH1 3INAA 4AZZA 1PIV3 1NE6A 3J7MA 1CR7A 1G6NA 1S2KA 1C8NA 1HRI1 2EIEA 4Q4W3 1XSRA 1YYNA 2UY9A 5J7MA 3C7EA 5AC91 1BJQA 2AUYA 1VBB2 1ACCA 2MEV1 3ST7A 4QDRA 4CEWC 4LKEA 1HB2A 4JGYA 3AP9A 4E27A 2UYBA 2JDYA 1KITA 4FXKB 4CU8A 3VZLA 5K0UC 1GICA 1BK1A 2WNVB 2WRAA 2ZX0A 3PMSA 3M3OA 3R6SA 1ZZBA 2WO7A 2RS53 5I91A 3VD5A 3WP3A 2WUHA 2X09A 4QPYA 3CIHA 3GBWA 4Z2WA 4XURA 3O1UA 5C8CB 1WMEA 2A7AA 4MGQA 1VALA 1X8EA 4N53C 5JOXA 4IW3A 1OD3A 2VCAA 4NHKA 1L3JA 2RS11 1COV2 1SPPA 3G6JB 3J7LA 1GZWB 1RUJ3 3MIEA 3NO8A 4SBVA 3ZKUA 5I8YA 4JKLA 3FL7A 1LODA 4Q2FA 1LGBA 1ODNA 2XDVA 2I74A 2JEMA 2WQ8A 5FZ4A 4MOAA 3PIJA 3FWEA 3I59A 1QIQA 1RUF3 2OUHA 4LULA 1L7LA 2YPJA 3A21A 5K4LA 1R082 2XKPA 1POV0 1UZYA 3D0SA 2WAAA 5JLVA 1XNKA 5FYUA 1NYWA 2BNOA 4UWDA 5DUUA 2FMYA 5HCBA 2E32A 3FLRA 5T54A 3BODA 4GQ7A 2ZHNA 5FDBA 1UAIA 3VDDC 2W1QA 4ATFA 1YNAA 1MZ5A 2ZOEB 3MFCA 4H2AA 4B4RA 3O1VA 1H9WA 1OT5A 2A3YA 2JWPA 1CPMA 4IEOA 2VAUA 3K77A 4W50A 1JBCA 1WLCA 2B46X 3LDKA 3VBSC 1DQ4A 2PLV2 1PO11 1H8TA 3OPWA 1QJY1 3NJXA 5KHJA 1AL0G 4O9GA 3WF4A 1YC61 1ZM1A 3WW2A 4AI2A 2GC2A 2YB7A 1QXPA 3TN92 3MW4A 1WA6X 3I2DA 2WWSA 4XUTA 5AVPA 3W59A 4PF5A 3CKHA 1GU3A 1ND3B 4INDA 4X6QB 1AYM3 5A6QA 5GLZA 5IVFA 4P9IA 4MSVA 2OT7A 5C3PA 1G9AA 2RDQA 2A71A 1REFA 2Y38A 4OYUA 3KQRA 4OZXA 2ZGUA 2ZHKA 5BNQA 3OBZA 3VUOA 3KCYA 1SLLA 3PUHA 1RTVA 4QQ2A 1AR83 3WF1A 1ZBA1 2C5DA 4NR1A 5J98B 4MHRA 5A7NA 3ZFEC 3J8F3 4FTSA 1IS3A 1GZCA 1NCQC 1W9TA 2BWCA 2RG4A 2VW0A 4YVSC 2VUJA 5AVAA 2VNRA 5IT6A 2VPVA 5ERLA 1XB9A 4YVWA 1W6OA 3UETA 1KJRA 1SLTA 2V72A 1GKBA 3VZOA 1UX7A 3ZM8A 3ZYBA 3FLPA 4K3UA 1UZVA 4YPJA 1H1AA 2UWCA 5IK8A 3KT4A 4LXLA 1MQTB 4H55A 5A3MA 4ES9A 1DYKA 1NLSA 1GP5A 2WQ4A 3QD6A 5KXDA 1GSLA 4JHTA 4KGGA 3ZOIA 2XWBB 4A7KA 4XDPA 2VOVA 3SMHA 5BNOA 2WA4A 5FZDA 3KGLA 1GNZA 4AI1A 4JKKA 3VDBA 4YARA 4CEWB 3N9NA 1S0EA 1MS5A 4KG0A 4D6SA 4E4HA 3KD4A 1US2A 3QCWA 5T5JA 2WT2A 1CD3G 1HQLA 4AL9A 1J1TA 5FPLA 5GZGA 1JODA 2XQRA 5A3LA 1UY0A 2Y26A 3CJIB 3VBRC 2C1FA 3NAPC 1WLTA 4DZGA 5I0UA 2RMU2 1HB3A 4A2UA 5E1RA 4JGZB 5ABJC 2R073 3FHQA 5KHKA 5DUXA 4JRLA 1PO22 3MF9A 4YW4A 2CTVA 4CU6A 2WO2A 1O3RA 4YW2A 1VP6A 3O7OA 4XF3A 4Q27A 4ZXKA 2VD7A 1XQNA 4HKLA 1HRV3 2G9GA 4Q4V1 1UCXA 2QE3A 2XJUA 2A6ZA 2LM3A 2ZMKA 3IDAA 3AL6A 3ILFA 2FDIA 3BOPA 1A78A 1PGL1 3UT0A 4AOCA 3M2MA 2B8MA 4D7SA 2ZACA 5LBCA 2WBKA 4GALA 5F6KA 5FZOB 3WNXA 3CMGA 5K7PA 1MEC3 2DU1A 1UN1A 4HKOA 4MLOA 2QQLA 3E5XA 3M7AA 1QJX1 4FPGA 3VDDB 4PLOA 3BUCA 3VN4A 4DNYA 3K4DA 2XMLA 4LITA 4HETA 1K5MC 4LHSA 1QJZA 2PHFA 4JQRA 3ZN5A 3AKTA 1U5IA 1ZA4A 1K45A 3UJOA 1ZBE3 3VZKA 1QJU2 5IATA 4PLNA 2FDGA 5LA0A 4OHWA 1UPSA 1VMJA 1REDA 1TE1B 4LK6A 5FZ7A 1MACA 1US3A 2D6NA 3I2JA 3P1IA 4Q1RA 2VVFA 5FMCA 5FWEA 3VKNA 2ATFA 3WCRA 4D7YA 4D7TA 4DO0A 2ARBA 5L7OA 1I1EA 1PVC3 1RHI3 3TEYA 2KD7A 1AYN2 4CDWA 1DYOA 4I01A 2OW4A 2MNGA 2DF7A 4QGMA 3JU9A 3RS6A 5FY7A 4AHXA 2AZ5A 3KS7A 4NRMA 5BNNA 4D69A 1O91A 4QT6A 5GM0A 5FZLA 2VOXA 4CEYC 1BXHA 4HFSA 2BOIA 5LW9A 2VGDA 4UF0A 4AFCA 3U4XA 2O8OA 5D8AC 3ZN6B 3WW4A 5A70A 2ZGOA 2W92A 2C4XA 2G1MA 4MUVA 4LO7A 2HWB3 4LO4B 1PK6A 4NHXA 4RS5C 2JKXA 1WLDA 3G7DA 2P6HA 1QY4A 4HOOA 4IV1B 2D6LX 4Y26A 1JZ8A 2VU9A 5LEJA 4FP3A 2IXCA 4JCKA 5FO8B 3UNPA 1O8PA 4N7UA 1Q5OA 4FQZA 2W2IA 4M4RA 4Y1XA 3N9MA 1HRI3 3K46A 5KHGA 4BDVB 4S2FA 2ZMLA 3B01A 4IEYA 2H6CA 1TME1 5C6CA 3UKVA 1J84A 1ZA7A 3PL0A 4UFIA 4R8HA 3L9JT 1N3QA 3MGUA 4E2QA 2JIJA 5EXOA 4B4PA 5LWBA 5DN2A 1XYPA 4Y4RA 2Q8DA 3B94A 2OZ6A 4FAHA 1JYWA 3RWNA 1R093 1IS5A 1VAKA 2K0GA 1VBE3 1CWPA 2XVLA 1G7YA 4QGLA 1GOHA 2LTNA 2QQWA 4F7ZA 1Z0HA 5JCTA 3U07A 2DUOA 2HYXA 4IE5A 3A23A 4QX7A 2R6QA 1T6BX 2JIGA 2SLIA 2XBO3 1W39A 3JBG1 4QKDA 4UW4A 3VDCA 4ATEA 1RUI2 4ARXA 2W46A 2ZEWA 4Q4Y1 4Z8BA 2EA7A 3NAPB 1YO8A 2RS13 4JDNA 4FI9A 2P37A 3T0DA 5T3NA 4LQRA 1QXJA 2BNMA 4UFKA 1UYYA 1LGNA 4CP0A 1GP4A 1GV9A 1XNDA 2R16A 2AACA 1O6UA 4V2VA 3J7HA 4GH4A 2QCSB 3IMNA 3RNSA 2EIGA 5C4WC 1BZWA 2ZJCA 4CDQC 2DUQA 5J09A 3H3ZA 1ZREA 2YBKA 4PBOA 3VHOA 4XUPA 3RI8A 3U4SA 1UMZA 1UY3A 1CN1A 3VBFB 3DYOA 4UBGA 4YM1A 5FYCA 4M00A 3X29B 4ZONA 2PMWB 1LR5A 3PU3A 1PO13 4LKDA 3S57A 4FPHA 4XQ4A 1QJY3 1K5MB 3RQ0A 2ZXQA 1BMV2 1Q8QA 4GB32 5EP9A 2YY1A 2VVDA 2WNUA 3DYPA 1PIV2 2W47A 3VHRA 3IWZA 4Q4W2 1W9FA 2Q0AA 4LPLA 4XFGA 3I2FA 3ZLIA 1J1LA 4Y4YA 4IGOA 1Y43B 1ZBA3 1Q3EA 1XU2A 4OUMA 4L9BA 2DV9A 1UY1A 3S0MA 1GFF2 4OUEA 2FCUA 1GZWA 4XF4A 2E7AA 5D8AB 1ZZ7A 2RS52 1OF4A 3GZEA 4MXWA 4D3WA 2VECA 3HQXA 1NCRC 4RS5B 1GOFA 4XDOA 3CEWA 1W6PA 4ITCA 4YM0A 2Q1MA 2O14A 1YQ6A 3SNMA 2XUMA 4CTEA 1RUJ2 1CESA 2WABA 1GLHA 3I2OA 5A7WB 2QQJA 1M06G 1GWKA 5A3UA 1RUF2 1RXGA 4NHYA 3N3HA 5L19A 3MHZA 2W39A 1UYXA 3WZ1A 2HWE1 2CGPA 1HXS1 4C90A 4H14A 4LKSA 1DGRN 2RJ2A 3UGHA 2CDPA 3P3PA 2WYFA 3EYPA 3VL9A 1W8ZA 4NN0A 4P02B 3VBHA 3MEPA 2WS93 3V65A 4MGKE 4MGTA 1MPXA 3ELNA 3DPRC 1TNRA 5JXHA 3CHXA 3NSTA 3ZSMA 1NA1C 2A3XA 4IETA 3LEGA 2QDRA 4HK9A 4NJ4A 1W0NA 1PMJX 3POGA 4BWOA 5C7GA 1OLRA 4HPKB 1O7FA 4XMIA 5FJKA 4YYOA 1ST8A 3VDAA 3WNMA 2QKDA 5I0TA 4XXPA 2XUEA 5DZFA 2DCTA 4UW5A 2P1BA 5K9YA 1HV0A 4Q4V3 2D6KA 3AM2A 3N7MA 4XAEA 1SPPB 1YFXA 1AYM2 4Y24A 4PQQA 2HWD3 3OJBA 3ZPYA 2VOWA 2MPFA 4Q0QA 5CEHA 2OPWA 2DCKA 2VQUA 2Y6GA 4Y1UA 4CDQB 3BI3A 1U5ZA 1F5JA 1AR82 3K4AA 3V0BB 3D6EA 2GALA 3ZSKA 1YQCA 2WLPA 3J8F2 5FZ1A 3TEXA 1NQDA 2D93A 5FO7B 5LB6A 5A7SA 2GAUA 3OY8B 3RI9A 1TEIA 2IXLA 1CPNA 3O1RA 1TMF2 4YM3A 1U5XA 2ZX3A 3N7KA 3WUCA 3RJ2X 2BFUL 1S0DA 3DXTA 4QWNA 3VZMA 1T6GC 2HLEA 4B4QA 2IWGB 2R49A 4V1PA 4OULA 4CEWA 3CL1A 1OQEA 2A6XA 2VOTA 1SLBA 5G05L 2DYCA 4D6QA 2E63A 3TEWA 1DZRA 5JAXA 2IUWA 5K0UA 1AR71 3VKMA 3L2YA 1H8TB 4HSLA 3HMYA 3AFKA 1MVQA 2R1DA 2GC0A 5EZWA 3ZYIB 2R0FA 1IG0A 3AP6A 5JPNB 1W9YA 3WUDA 1UPIA 2Q1ZB 3E1F1 1KDKA 1W6QA 2UWBA 3OUJA 1GNYA 4QM9A 4NE9A 5EFUA 4XBLA 1URXA 4FFFA 5C9AC 3LQCA 1LESA 4N53A 3TYJA 3POYA 1ODMA 2C0ZA 1EYBA 3ZXKA 3O12A 2W1UA 4CA9A 1RYYA 1JS9A 2VTXJ 4XC9A 4CVUA 2WNEA 5IFPA 3S5QA 1RUOA 1NCRB 2R061 2R072 1WZXA 2WSUA 2HWF1 4IEUA 3VV1A 3JD73 4AHYA 2RDRA 1TME3 1PMIA 1V6JA 1W6OB 2FHRA 1J3RA 3THTA 2RS31 3M3QA 1UZ0A 4JAAA 5A6ZA 1HRV2 2UWAA 4BIFA 1IQAA 2ZGQA 1OQ1A 4HKWA 1P8JA 2F6BA 3VDDA 1QJEA 1CAUB 3MUY1 4NWVA 3RZLA 4FFIA 4IEZA 2VCBA 3VBUC 2ETEA 3LEMA 4DRVA 2WIIB 1A8DA 1ULOA 4Y20A 4YFWA 2EXIA 1MEC2 3BIWE 3A0KA 3M4FA 3VBSA 4QKNA 3JBG3 2XHNA 4OHYA 2ZZQA 1OH4A 4CCDA 2Y33A 1ENXA 2IXIA 2ZS6B 4Q4Y3 2ERFA 1G8WA 1UU4A 4OQ9A 4ASKA 1IKPA 4Q5OA 1IOAA 1XE8A 1ASJ1 2V09A 1ULFA 4M3CE 1RVF1 4BQ2A 2VQAA 2BPA2 1ZBE2 4BIOA 5EIYB 1LCLA 4KWUA 2BYVE 5FK8A 3EBRA 3AXEA 4YRDA 4URAA 3ACGA 1SBEA 2JE7A 2XJSA 4AW7A 3PMEA 3K48A 3NNGA 1RUD1 3U75A 4Z82A 2ORZA 1B09A 1RMU1 5CG8A 3RWKX 1PVC2 1IPJA 1SG3A 1RHI2 1MS0A 1ZZCA 5F5QA 4HT1T 5FOJB 1NCQA 4YVSA 2JD4A 5JWPA 5FZEA 4LJHA 2LALA 5FY8A 4COYA 5A1FA 2HWB2 1RIRA 3C3VA 4I0WB 4XBQA 2QFEA 4Y33A 1DP0A 3LWCA 4PI0A 3GNEA 1IHMA 4BJ0A 3NJVA 1DQ1A 3WDWA 2ZGMA 2ZTNA 3MUZ1 3GDBA 3LDRA 1TNFA 2BUKA 3SH3A 1F9KA 4FQ4A 3K2OA 2OVUA 2K2SA 1OUSA 1PZ7A 1HRI2 2SBAA 4XUOA 3ZFFC 2HWC3 4CCLA 4B7KA 2VG9A 4XQDA 5JZGC 2V73A 4AEJA 4TZDA 1WCQA 3FMGA 1SACA 3NMBA 4JC1A 2WWJA 5I8SA 1DQ6A 2AR6A 5KXEA 1XRUA 3ZSJA 3WG1A 1R092 1VBE2 4NVPA 3OUIA 2VCMA 2WYSA 1JZ4A 1YJLA 3VBRA 1RUH3 2AYHA 3NAPA 5JXIA 1LAJA 2WT1A 2WZR1 1CAVA 4QQLA 1HIXA 1X9TA 5DPNA 5L7OB 1D4M3 3LSDA 5H9RA 2J22A 2ZX4A 4EJRA 2XBO2 2NMOA 5CAZA 3ZYPA 2GMMA 5KXBA 4Q8LA 2D5HA 3U10A 2CWMA 5BNPC 1NAEA 2X53S 4CP2A 2K9ZA 4K9SA 4LO6B 4BCUA 4AEDC 3KF5A 5A1LA 3BOWA 4HSJA 1KEXA 2OA2A 3AKRA 4JDOA 4ZKTB 4HVRA 2RR11 3C7OA 1Y9QA 4NOTA 4HK8A 5JMCA 3NWKA 4R9DA 2VJXA 3B9IA 4O7XA 4Q8KA 5KWRA 4IE0A 2W1SA 4Y1YA 5JDBA 4OZOA 4EN8B 4YGDA 3AFGA 2DURA 3VBFA 4PDWC 3BGAA 2DBIA 2VW1A 4XJAA 1QKQA 5CIRA 4KNCA 1KJLA 1KDMA 5LCWL 5LASA 2HEYF 5FZ3A 2PTMA 1K5MA
chains in the Genus database with same CATH topology
3MLKA 4W6WA 2DFCA 4XIKA 3IPVA 1VBA1 3M8LA 4OHVA 4BA6A 1VB4A 2F4PA 3EQEA 4M01A 1DGWA 2GNDA 3V0AA 3ZXEA 1PO12 3AK0A 2ZGNA 1QJY2 4M3CF 1YHFA 2D6MA 4FPJA 4X6RB 2QZ3A 1C8M3 2IC1A 1RGSA 4KWJA 4WZFA 1FNYA 4AE2A 4XEZA 4M3CB 4CEYA 4JRAA 5GLWA 1KS5A 3KCXA 5D8AA 4AYUA 2NQYA 1V6KA 3LB9A 3MLJA 4YLZA 1QH7A 4BE3A 1QDOA 1RUG1 1EAH1 4RS5A 4UW6A 1ZBA2 1H2MA 2WL1A 3MPPG 1POV1 3WG4A 1V6LA 5FPZA 4XDQA 3DV8A 4LO5B 4NWWA 1AL21 1S0IA 1W2UA 2AENA 2ET1A 4BLIA 3WG2A 4AK3A 3VBUB 1D4VB 3D5OA 4EV0A 2G9FA 5FQ0A 2XJVA 1Q43A 1V6MA 4KGQA 1LOCA 2FZ1A 3WW3A 2ZGSA 1W0PA 1ZNPA 3B7MA 1WLWA 3SCHA 2WINB 4I2OA 5J48A 3VZJA 5JZGB 2WNUB 3TB0A 1GANA 1OFNA 1ZRRA 1LOEA 3NV1A 1S2BA 1DQ0A 2WFF1 3AZWA 2WC2A 3ZYRA 5DXDA 2WS92 4HPKA 5J37A 5BV6A 1DDLA 4COUA 1W6MB 2PHXA 4ONUA 3S7IA 1AX2A 3Q9OA 3V56A 2PHLA 2JG9C 2R063 1FPN1 2ZCWA 3OPZA 1PVXA 1LHWA 5C33A 1AJKA 1OKQA 1N3PA 3QBQA 3KZ4C 3BB6A 5C4WA 3B5LB 4XJWA 1S0FA 4MXWB 1QGLA 2D7FA 4CDQA 2RS33 3BU7A 5BY5A 4LBQD 1QWRA 1W6PB 4LHNA 1MS3A 4K21A 5J96B 3V0BA 3W58A 1S0BA 2IXHA 2R041 1PGL2 2HWD2 5FBZA 5ACA1 1FI2A 2DCYA 3M3IA 3OY8A 1MR5A 1OOPC 2BW8A 3U0ZA 3B9CA 2XL7A 2HKXA 4PLMA 1DF0A 1QF3A 1LGCA 3VGIA 4CTEA 3IM0A 4FOWA 1SLIA 4WV8A 1EP0A 1ASJ3 1LB2A 1RVF3 4XBNA 3VBHB 1YFYA 4YM2A 4DINB 1HV1A 3H1WA 4ORFA 3VLBB 1F2NA 1HKDA 4LE4A 4IEQA 2JICA 1NG0A 4LLOA 3EJKA 3WP6A 1PNFA 2VMHA 3AB0A 5IK5A 1PGW1 2H0VA 2XG3A 2GSYA 4IQPA 1OQDA 1IKQA 1N1VA 3AX4A 4DXZA 1NCRA 4L2NA 3SISA 3RSJA 4ZU7A 4FPKA 3TBDA 4BHPA 1IS4A 1KQRA 3RDIA 3LA3A 1WCKA 2D97A 2N7GA 1R1A3 2VH9A 2XH6A 1H1MA 4MH0E 4XQWA 2Z5WA 3WDXA 5IT6A 1CX4A 3PVNA 3HBZA 4RHV1 2IFRA 1JUIA 4MVTA 3GALA 1CAUA 5FAXA 3NKGA 3TWIA 1QQP3 3JD72 3WDYA 1TME2 4R9CA 1O3QA 1VBD3 4A3XA 1ULEA 5K8SA 2JG8C 4JV4A 4P9GA 3WQ1A 4P9WA 1RUE3 1DZTA 4E4ZA 3WDUA 2WZR3 4GMP1 3ATGA 5JI9A 1JH5A 5K0UB 1NOVA 1NA1A 2ZGRA 3ETQA 3VBOC 3RRDA 3PVBB 2TBVA 1F8VA 4QXKA 3O0XA 3OBTA 3JBG2 5E16A 2A73B 1M4WA 4Q4Y2 4AVVA 1W6QB 3AYDA 1HX6A 1S0CA 2XJTA 3LAGA 4K1YA 2JKBA 3ENRA 3POWA 2YGMA 4L8QA 2JG9B 4N53B 1JHNA 2WFPA 1S0GA 4X8PA 4HN0A 3SH4A 5CA6A 1I9RA 3KB5A 1KFXL 4AGVA 4COVA 4XYXA 4NO4A 4XF0A 4IESA 4OHXA 4AQ6A 3M3EA 2NMNA 4DMIA 2GN3A 1S1AA 2R0HA 3ZMNA 4LBQA 5LK7B 3H0OA 4PJYA 4Y5Z0 3OF1A 1E57A 2EF6A 3ECQA 3IDCB 1S55A 1VBA3 1V9U1 1WBLA 5JSOA 1LEDA 2XKOA 1OA2A 4COWA 1U5YA 2FQPA 1DBNA 2G4IA 4I0BA 1X33A 3BALA 4Y20B 2YYOA 3ZXJA 4COZA 1DYPA 5FTTC 3VBSB 4ASMB 5CB7A 1O4YA 4XIOA 1CAWA 3MFAA 2FMDA 2HWC2 2RM23 3ZYJB 4DFSA 5C9AA 2CGNA 2CY6A 3ILRA 1RUC3 3CNAA 2CL2A 3HR9A 1RUG3 1EAH3 4F83A 1WA4A 5KXCA 1AXYA 1VB2A 1A6CA 1J59A 5CNAA 1RUH2 1AR61 2PLV1 3AYAA 3VL8A 5T5PA 1D4M2 2E51A 1H9PA 4A7ZA 2QQPA 3ZFEB 1S0JA 1PZ8A 4Q1PA 3TN91 1NCQB 4YVSB 1B35C 3ZYGA 5FMOS 5FOBB 3ZIXA 4TWTA 5AFBA 1VRH3 4QU2A 3S7EA 2KA3A 4CDUC 1GQGA 4WM8C 2R32A 4DY5A 2H6BA 4BZ4A 4QPGC 3IN9A 4BLJA 5AC93 3VBUA 3WD5A 3GHMA 1A3KA 4XFFA 2MEV3 3ILNA 5JIAA 1LOBA 2JJ6A 2W08A 4QGNA 3TOJA 2TUNA 4I30A 5CVRA 2GZWA 1QNWA 2DWRA 4R9AA 2UU8A 2ZGPA 3NL1A 2NZ9A 1IS6A 4KQ7A 1GQHA 1FPN3 1XU1A 3VBRB 2ARXA 2D43A 2D98A 3H7YA 5JOWA 1CAVB 5L36A 1HQNA 4M3CA 5ABJB 1GNHA 1WW7A 3MF6A 4BM8A 3T1MA 5A33A 4R9BA 1C8M2 1JYIA 4JTOA 1YRZA 1V6IA 4OFGA 2XGXA 3WOGA 3H9AA 3WX5A 2R043 3DKWA 4MX3A 5HXVA 3IT8A 4L97A 2HJIA 4FOYA 5DG2A 3IDEA 2RMU1 3AYEA 4RGGA 1WUVA 1O4ZA 1AR91 3UK9A 1RJ8A 3VKFC 1KFUL 1PO21 1JN2P 4Y1VA 3HIFA 5C8WA 4HBNA 3SITA 1YLLA 2XJQA 1OMIA 2XJPA 3VZNA 5F9TA 3MIDA 3IPVB 1WW6A 2GH2A 3AJZA 1R1ZA 1W0OA 5GZDA 2OZJA 5JZGA 1FX5A 1CONA 3AKPA 4RD7A 4M0HA 3AP4A 3V0AB 1Z78A 3S6PA 5CFCC 2PYTA 1ENQA 3CU7A 4LA3A 1GZ9A 1W6MA 4BQ1A 3C2UA 4QQOA 2B7YA 5JR7B 1ENSA 4MYEA 2XPJA 5BNPA 4CEYB 2A6WA 4J1XA 2QNKA 1RC6A 3MDPA 4E4DX 4MGZE 1F31A 2DTWA 2R062 4X8NA 1FATA 4XFHA 4N43C 4MGIE 3J26N 1YI7A 5T55A 2ZA9A 1A8MA 5L73A 4K6BA 4PDWA 2RHPA 2VOKA 1V6NA 2AGSA 2RS32 3K51A 3I8TA 1DU3D 1ULGA 5FQ0B 5EYXA 4GMP3 1HQWA 3AZYA 3M1HA 4RSUA 2ZPXA 4RR3C 4OUSA 3WR0A 3DF0A 1KD7A 2CGOA 4WVWA 3UJQA 3ASIA 2BEOA 4IERA 1PZ9A 4XE9A 5GLTA 3AMQA 2VMIA 3LA2A 3H3UA 1ASJ2 1FV2A 1RVF2 3A4UA 3DUIA 2VUAA 4M0NA 3SHRA 1ZX5A 3ROUA 5FFOC 1YWKA 4Z92B 4XPVA 3H1MA 1AXKA 4NHLA 4Q26A 4AEMA 1WD4A 5BNOC 4J6GA 4LT5A 1H4GA 2RJKA 2D3SA 1DLLA 2VMGA 1XNBA 4ISRA 5C4WB 4QHBA 3RMXA 1U12A 1HDKA 4Z07A 4LBJA 1RUI1 2ILMA 1V9U3 3MIHA 3OCPA 1YFUA 1QJX3 3PVOA 4HMZA 1SCRA 1Y7BA 1R1A2 1CVNA 2IXKA 4J1WA 1AZDA 1ULCA 5I0RA 4N7IA 1MVEA 4DRRA 4HANA 1UZZA 1OSGA 2TEPA 1QQP2 5JIUA 5DDJ1 5KC6A 3GZUC 1VBD2 4P9XA 4FT8A 4I02A 4PIXA 3N4MA 2IXJA 3H7JA 1UD1A 1RUE2 3FBYA 3JZVA 3AMHA 4FSJA 2WZR2 2PQQA 1AR63 3RMYA 4CP1A 1ZZ9A 2JG9A 5HCFA 3ZVXA 3J9SA 4QPIC 1RUNA 3OGJA 1HW5A 3TN93 4BMBA 1C3HA 1PIV1 3GBFA 4GXLA 1XXNA 2GN7A 1NY72 2PAMA 1QOTA 1ND2C 3AKQA 4OI0A 5EYYA 3WHUA 2PHRA 2VW2A 4HZFA 2NP0A 4CDWC 1DGWX 1WMDA 4N9HA 5BNNC 1H1IA 1WW4A 3ZFGC 2RS51 4AQSA 1D0GA 1D2SA 5FRAA 3P3NA 1N47A 4XHBA 3O5SA 3KGZA 1VBA2 3MLLA 1RUJ1 1I3HA 1NXD1 3RYRA 4WM7C 3KM5A 1FOD1 2B5HA 3FE5A 1LULA 3DPRB 3ZXGA 1D0HA 1WW5A 4IL7A 3EO6A 4MGYE 1NA1B 1AF9A 2Y0IA 4MZUA 1H2KA 2R1BA 2EXHA 2A70A 2FBEA 2B39A 2XVKA 1FMD1 1AHSA 1Y3TA 4IXLA 2QUOA 4H7LA 1DFQA 2RM22 1G86A 3BTAA 2PN5A 3OYWA 3WDVA 1BYHA 2VY0A 4KG8A 4F8AA 3ZFEA 1RUC2 4LHKA 2PHDA 3H50A 2YV8A 4L11A 1RUG2 1EAH2 4IV3C 2O8QA 2BNNA 4FP2A 1AR93 2O0OA 4BH9A 1I5ZA 2GMPA 3JB4C 5JPMB 4LBQB 1PHMA 2P3IA 4TSVA 3WDTA 3PHMA 4S2GA 1TQ5A 1WGPA 1DQ2A 4EWAA 1FYUA 1VBC1 1VRH2 2GH8A 2ZZJA 3R0RA 3SXWA 3UV9A 2JG8A 3U11A 3N35A 2D6OX 4XHXA 1VAVA 1QH6A 2XLAA 3NVCA 5AC92 1AR81 5FO9B 2MEV2 3VBOA 4E9KA 3J8F1 4B3NA 1CAWB 4AXOA 1JW6A 5CFDC 2XVGA 3ACLA 1TMF1 5ABJA 5C9AB 1BVVA 1LKNA 4QPIB 4Q0PA 1ZRDA 3WINE 1IGOA 1KXGA 3E5QA 3FBMA 4AHZA 1FPN2 1VR3A 3FUQA 2RS12 2GNBA 4XF1A 2ZBJA 2C9AA 3PTYA 2VNOA 4AQ2A 1FAYA 2WNVC 1QHDA 2E7TA 4PIYA 2VNGA 1G9BA 3GZAA 1N3OA 1PGSA 3E97A 4Q4X1 4YG0A 4FCAA 5GZFA 1EV11 2HWE3 4OVEA 3ZSEA 1HXS3 2R042 3AJYA 1RB8G 3VKLA 5C8CC 4LUMA 3ZFGB 4E4SA 3NKTA 1NQJA 1ONAA 2X8KA 1UF2C 2CV6A 2OIIA 1VAMA 3UL2A 3KLSA 5EWSA 2RE9A 4H7MA 2ZAHA 1H0BA 4PCRA 5GALA 5DZGA 3ES1A 4BOWA 5HBAA 4Q0VA 1AXZA 5IUQA 4CRQA 4XW3A 1UKRA 3WP5A 1Z7S1 5LEKA 4DS0A 1BEV1 1SMVA 3POSA 3LKJA 2XHKA 1PGW2 2Q8OA 2EXJA 1LU2A 1BBT1 3NJZA 5A33B 3FJSA 5E8AA 2DUPA 4S2DA 4TYSA 4YW3A 4MV2A 4QX5A 1B35A 1ZBE1 1X82A 2JX9A 1G9DA 3AZXA 4JDMA 4U2AA 4CDUA 1ND3C 3O14A 4U36A 2DVFA 1MS4A 4O9EA 4QPGA 5IK4A 4KU8A 1CIWA 1OD5A 2GC3A 1PVC1 4Z1VA 2NLRA 5CG9A 2WKKA 4Q29A 5DDJ3 3OD4A 1AR73 1JUHA 2D3PA 2ZABA 4XJ9A 3ZFFB 1APNA 2ZKNA 3WCSA 5IK7A 2Y0OA 4QM8A 3MI8A 4YGCA 2A6VA 4OI2A 1AUYA 4Y22A 5FLHA 4LA2A 5CFDB 2RJLA 1MQTC 2D44A 4AQTA 2JDZA 2P34A 3USSA 4XOGA 3S30A 4B29A 1LECA 2YHJA 5I0SA 5BNPB 2HWF3 5EJ3A 4AEDB 4HN1A 1NLRA 2XLFA 1JYCA 1Q8OA 4RA0A 1R091 1VBE1 2UYAA 1LEMA 4LE3A 1JXNA 1JTZX 4Q4V2 1BVP1 2BVBA 4DOUA 2I45A 4FTEA 3CJIC 4P9YA 3JUUA 3VHNA 3TRSB 2XBO1 3ZN4A 3T2TA 4PDWB 4JGZC 2CWSA 3CO2A 4WVMB 1V9U2 4XFCA 1QJX2 3HT1A 3OD0A 2WA3A 4AVTA 5T50A 1FOD3 4XJUA 2ZX2A 3NV2A 4FVVA 1AX1A 3DN7A 3VHPA 1X36A 4XTPA 2BQPA 1Q8SA 3USUA 3ZSLA 1IPKA 1FMD3 5CFCA 2WZPP 3LOBA 2NYYA 3N36A 5T5OA 3WQ7A 5JOYA 1KS4A 1AVBA 1RUD3 4LHLA 1ZZ8A 1RMU3 3PJQA 2ENRA 3ZO0B 3GHNA 4YGEA 5H9SA 1OA4A 4YZ2A 2ZAAA 3AMPA 2ZGKA 3WP4A 3HAGA 5D1IA 2EALA 4W65A 2VQ0A 5A32B 4LTAA 4GIQA 1AR62 1NE4A 3WV6A 2P2KA 4AI8A 4LBMA 4N43A 1C57A 4LR4A 5F6LB 5DZEA 1CAXA 1PNGA 4XTMA 5H9QA 3QH7A 5E89A 4FPEA 2UURA 1VBC3 4DB5A 5GZCA 5DG1A 1O3TA 1FT9A 1WCSA 3E6CC 5T52A 4PBPA 4I3PA 1QOOA 5KC5A 1ALYA 4C91A 4WVVA 3B02A 1UU5A 4RR3A 3SLIA 3R4UA 2I2SA 2DCZA 4IV1C 4XFAA 3FLTA 2XWJB 3DPRA 3ES4A 5BXXA 4AVBA 1YCIA 2QJVA 4AGGA 1TMF3 3ZIWA 3MICA 4MXVA 2DU0A 4XZPA 3QACA 1OPMA 2EVXA 3RG0A 4SLIA 1C4RA 4IEPA 1QXRA 1W6NA 1OPOA 4HL0A 3M3CA 1C5HA 3L2HA 3IBMA 2QZ2A 4AF9A 4WBBA 2RR13 4R52A 1GYKA 1VBB1 4FAGA 1N1YA 2YDEA 4DY3A 4HVOA 3WLUA 1YI9A 1EY2A 2A6YA 4Q4X3 1EV13 2VXRA 3BCWA 2YROA 2PAEA 4K1ZA 2EXKA 4A7YA 2WS91 1LOGA 3LGRA 4S2HA 1RINA 4RQPC 1UU6A 2HEWF 1QMJA 4TLFA 4KU7A 1LOFC 1YXWA 2XL9A 2B9UA 2Q4SA 1AR92 1OOPB 2GDFA 1COV1 3NV3A 4Y1ZA 1F5FA 1SFNA 2E7QA 1J58A 4CDXC 4FTBA 3WVJA 3D0JA 2EAAA 3URFA 1R081 1Z7S3 2ZGTA 2HWD1 1SFYA 3TNPB 4Q0SA 1WD3A 1X7NA 1BEV3 3QH6A 3JQWA 4AI3A 2X5IC 3DL3A 1IZ3A 3PVEA 5CU1A 2NN8A 3VBFC 4CYDA 1BBT3 2KM2A 4QPIA 3FFZA 1MZFA 4KWLA 1POV3 4LBOA 2GC1A 4YNIA 1MZEA 3OYWB 1H30A 3O0WA 2XJRA 1AL23 2WJSA 1ND2A 4UXAA 5GZEA 1DHKB 4GMP0 2DCJA 5F1RA 4G9SB 1YIFA 2B45X 2GMEA 3KT1A 3VKOA 3WXPA 4GULA 4AVSA 5J3UA 5GLUA 4N90A 4B7EA 4I0AA 1WBFA 2Z2SB 3ZFGA 3FHIB 2W68A 2O1QA 2EAKA 2A3WA 1BQPA 2ZMNA 3E5UA 3NW4A 4FOQA 2CYFA 2HWE2 1HXS2 2JG8B 4FPOB 2WFF3 4WM7A 2AH2A 3E6BA 2HYKA 1FV3A 5BYNA 4FPCA 5HCAA 1MS1A 3VBOB 4XXAA 2GU9A 4GKYA 1VJ2A 2W52A 3JD71 3WT3A 2E9QA 3LSEA 4XILA 4JTNA 4FOVA 4ZU5A 3I7DA 2PAKA 4YZ5A 5LK5A 1V00A 3AXDA 3B00A 4YZ4A 3D4KA 3LCPA 4AI0A 3AP5A 4QQPA 2ZGLA 3LA7A 4K8FA 4IV3A 1MS8A 4RGAA 1VIWB 4JGYC 4LLFA 5ACA3 5FLIA 1G9FA 4RQPB 3R05A 1DGRA 4AGRA 1O4TA 4G3YC 4RL7A 3AYCA 5GKAC 4FPLA 4K7JA 5KHHA 1XYNA 4R4ZA 5LRSA 3FZ3A 5KHIA 4YG6A 3ZFFA 5I93A 4AVCA 2OPKA 4FO9A 3HWJA 4CDXB 1UIJA 3CF6E 4EWDA 3AMNA 3SCGA 5DDJ2 4EN9B 3SCFA 1AR72 4AFBA 2PHTA 1Q56A 5CFDA 2X5IB 3HN1A 3MYXA 4QD2A 4G4FA 1J3PA 4DPNA 1DQ5A 1XYOA 1C5IA 4P9LA 2BFUS 4P9JA 3GZTB 4ISQA 1ZYBA 2UY8A 4AEDA 1QJU1 5FCCA 4LUKA 4WZCA 5JI7A 5J36A 4RHV3 5HI0A 2DVGA 2PELA 1H8TC 2WNVA 2HWC1 3ZX7A 1MS9A 1B35B 1FNZA 5FMOL 3QOPA 3ZXLA 2Z79A 3THPA 4YFZA 4PIZA 2HWF2 4D94A 4F3JA 1AYN1 1ZZ6A 2MHFA 1VLNA 1LHUA 1RJ7A 2ES3A 3FUOA 4BPZA 4CDUB 5C8CA 4WM8B 3RZZA 1UX6A 4QPGB 4WVMA 1RUH1 2OUJA 4EN0A 1OFSA 3MW2A 2TNFA 4C1XA 1D4M1 3GYDA 1SEFA 4W6XA 2QVSB 1SDWA 1C1FA 1RL3A 3T1LA 3MW3A 1LHNA 1LENA 4GA9A 2R30A 2DFBA 1FOD2 4LBLA 4YVWC 3RYPA 3AP7A 1AX0A 5EV7A 3QLQA 3HD8B 4Y22B 3ZXDA 4EN7B 1VBB3 3CJXA 4KH9A 5JSPA 3SH5A 2OYZA 1QOSA 1FMD2 4B8EA 2A5ZA 3D82A 4AVAA 2LUWA 3TAYA 1RUD2 1RMU2 4K40A 5A32A 3WW1A 3N7JA 3AZZA 1KRIA 1C28A 5I8TA 4JGYB 4GWNA 3OGGA 4QQHA 4P14A 4AG4A 2D3RA 1COV3 1ND3A 1H2NA 1YIPA 4LBNA 4KL1A 5SV5A 1ZVFA 2W0XA 1CGPA 1AJOA 2JE9A 1DZQA 3ZXFA 1C8M1 3WY6A 1ZRFA 1R083 1VBC2 5TSWA 2DTYA 4YSFA 3KT7A 2WSVA 2D6PA 1QDCA 4ZU4A 3ZMOA 2YUEA 4IEXA 4E2SA 5DUVA 4C0BA 3I59B 4LBKA 2WT0A 2ZKLA 4XFBA 3EHKA