The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
118
|
sequence length |
393
|
structure length |
390
|
Chain Sequence |
ASMQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITGETVSLRDAIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERLSQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGELLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLVLKPGESAFIGADESPVNASGTGRLARVYNKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of mannose 6-phosphate isomerase fromSalmonella typhimurium bound to metal atoms and substrate: Implications for catalytic mechanism
rcsb |
molecule tags |
Isomerase
|
source organism |
Salmonella typhimurium
|
molecule keywords |
Mannose-6-phosphate isomerase
|
total genus |
118
|
structure length |
390
|
sequence length |
393
|
ec nomenclature |
ec
5.3.1.8: Mannose-6-phosphate isomerase. |
pdb deposition date | 2009-04-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01238 | PMI_typeI | Phosphomannose isomerase type I |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Phosphomannose Isomerase; domain 2 | Phosphomannose Isomerase, domain 2 | ||
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls | ||
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |