3H21A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h21A00
3MCOA 4DJFA 2H9AB 3H2EA 4O1FA 4S23A 4DJDC 3H21A 3TYCA 5JQ9A 4MWAA 4CCZA 3TR9A 1AJ0A 4S39A 3TYZA 4DJFC 4S3DA 4DJDD 3H22A 4G9PA 4NHVA 4D8AA 2VEGA 4MWAC 2Y5SA 4S3CA 4DJFD 3H2OA 1TX2A 4DB7A 2YCJA 2VP8A 4DJEA 2YCLB 3H24A 4MWAD 3V5OA 4NILA 3TYEA 2VEFA 1Q7MA 4O0QA 3H2NA 4DJEC 4S3EA 3H2FA 2DQWA 2DZBA 4O1EA 1Q7QA 1F6YA 4DJED 4PZVA 4MWAB 3TYAA 4D8ZA 3TZFA 1AD4A 2Y5JA 1TWWA 1TX0A 4MWAE 4C1NA 3BOFA 3BOLA 2YCKX 3MCMA 2Y0FA 2OGYA 3H2AA 2DZAA 4C1NB 3NOYA 3TZNA 2E7FA 4HB7A 3H23A 3H2CA 1AJZA 4S3FA 4NL1A 3H26A 3TYUA 3K13A 1AD1A 1EYEA 4S3BA 1Q85A 4D9PA 1Q7ZA 1Q8AA 1AJ2A 4S3AA 4S38A 2YCLA 2YCIX 2H9AA 3TYDA 1TWZA 3TYBA 4DAFA 4DJDA 4NIRA 1TWSA 4DAIA 1Q8JA 3H2MA 3MCNA 2BMBA
chains in the Genus database with same CATH superfamily
1N8IA 1KFJA 4HPHA 2OSYA 4R85A 4O54A 4G6CA 3KS5A 3ITYA 1H7XA 4GFSA 4KEMA 3RCYA 2RUSA 1Y5WA 4BJHA 3DG3A 4C6DA 3OZYA 3FV9A 4IMDA 1NWSA 2D73A 2BB0A 3IJ6A 3IGSA 3OODA 4U5IA 4B9ZA 1C9WA 2WHKA 5JBFA 1JZ7A 3OVPA 1QXLA 1VF8A 2FZ8A 4IJRA 1IT8A 1NVMA 1R86A 3QV8A 5I02A 2WMGA 4HBKA 4LTSA 4IFOA 1HJQA 2V5KA 2ZUSA 4AWUA 4R53A 2GJXA 2QJIA 2PWVA 4H6KA 2A3BA 3U6WA 2RDTA 3NTYA 4IUOA 5CJ5A 4GJJA 3U8GA 1XCWA 3H70A 3VILA 3XINA 2AMXA 3WX7A 3TSMA 4LVAA 4ZSUA 2QF7A 3K8LA 1BYAA 1VPXA 4C6FA 2PDWA 1SM9A 3BLPX 4RDVA 3AXIA 3DESA 4QRNA 3WJSA 3W4RA 2YXGA 3G3MA 4NI3A 1P48A 4A4AA 2YZ5A 3EEZA 1S5NA 1CEOA 5GPRA 4JQ4A 1DWHM 1JPMA 4K7VA 4NJKA 5CZ0A 3SIZA 2B4GA 4ZB5A 5EB8A 1JYXA 1O5QA 1UYQA 2PP3A 3ZJKA 1NU5A 3E9AA 3FVMA 1RP8A 2V2DA 1MDLA 3MP4A 2ACSA 5IFTA 1NFGA 3BJTA 3UCQA 4DLMA 1UWAA 4UFKA 2JBMA 3AIWA 1H61A 3TU9A 3RK8A 1UUQA 1KWGA 3QFWA 3EGJA 3CZKA 3ES8A 3IJ9A 4PMQA 5AFDA 1FDZA 4DZ5A 1PCWA 1JNDA 4A2SA 5C8BB 1XS2A 4OBTA 3EWXA 2EEXA 4G7EA 3PM6A 2EXOA 2HE5A 1OD0A 2PDUA 3O05A 2J6VA 3FSTA 5LIXX 2BDQA 2W67A 2VR5A 2PU1A 5H8MA 5E0FA 1CDGA 2IKGA 3KS6A 1NTHA 3R79A 1AVAA 2PDBA 3UCDA 4IHCA 4AIOA 4HB7A 3P0WA 1DIOA 1DWGM 2BGSA 4JTRA 5KZ6A 2WWDA 3V0SA 2EKGA 1O12A 1YYAA 1YDVA 1XLHA 4J7RA 3QPEA 4LV4A 1PX3A 4HNLA 3A47A 1W32A 3H53A 2ZQ0A 2DZVA 3ONBA 3P3BA 1F8MA 2ACQA 2XVNA 1HQTA 4PUKA 5BRQA 1Q8JA 1TPFA 4GFIA 3BCJA 1LQ2A 2OSWA 4B90A 4PRRA 3O06A 3WQ8A 4A8LA 3L0NA 3KOFA 2B7NA 3GIYA 3VNKA 1OYBA 4KS0A 2BP1A 4R9XA 1TV4A 4MZYA 3PHAA 1JDEA 3NR0A 4W5ZA 4ZSTA 3R25A 1W1IE 1B3YA 3HFYA 4D1JA 3SQMA 2VC6A 3PC0A 3IJQA 5K4XA 3AMKA 4YVXA 1JDDA 2QPUA 3BURA 5CCZA 3SURA 3W22A 1W1YA 1UKOA 2OYMA 1F6YA 1S2VA 3EZ4A 2Q71A 1A5BA 3OHIA 4YL2A 3S9IA 3PUEA 1PYMA 3EWDA 3FEMA 3PZTA 3EB4A 4Q7IA 4KKXA 1XIJA 4AZ5A 1XIHA 3CPUA 5BYWA 5DY2A 5AC4A 4YWIA 3MHGA 2I5GA 1ZALA 2HE8A 1X7IA 3QH2A 5PTDA 3WD3A 4JTEA 1EA9C 3M44A 3R8RA 4FHAA 2YBVA 5IHRA 2IMRA 1VFMA 5M03A 2QW5A 4PMVA 3ZVHA 3O16A 4M80A 1KFBA 3M0VA 4C5ZA 1F3XA 3GTXA 5E93A 1VQTA 4YTQA 1L6FA 4AUBA 3TJXA 1LOSA 1W54A 4LUYA 4AEOA 4CD7A 4P2VA 2AGKA 2DGAA 2D22A 3JVAA 4NJJA 4DBUA 4GG9A 4M7TA 4Q4RA 4NT0A 4HT3A 3FN9A 1JQXA 1FWNA 3E3HA 2BTMA 3GTNA 3AUOA 4QNWA 5DFAA 5ABEA 1QOXA 3FDKA 3HPXA 2G41A 3LPPA 3UF9A 1H3GA 1KNWA 5GNZA 1W1PA 4FLQA 3FJNA 2FLIA 3W7KA 2FPVA 2EPNA 3CWHA 3NXFA 2B0MA 4QLLA 1GKQA 1UCWA 1JRCA 1ZQ5A 2AAMA 2RHGA 1JCLA 1QOQA 5C54A 5HMEA 3SIMA 3UA4A 4QITA 4O28A 2VZSA 4HOWA 4QEEA 2WNQA 4MYXA 5RUBA 3R10A 4JIQA 1YIXA 3L68A 1TPVA 1SMAA 2CBJA 4PN2A 2EPKX 3VIGA 1E6XM 4PRTA 1V02E 4JTJA 3WQCA 3TH6A 4PMNA 3UVAA 4JTCA 3CUHA 4ZXOA 1KC7A 2WYSA 2GFTA 3BH4A 3WO8A 1V8EA 4Q8MA 4BF9A 4WY0A 4PE8A 5EKYA 2WNZA 4WHBA 1BVWA 1CLXA 3CEPA 4LGXA 1X6LA 4S39A 2ACRA 3TYZA 1UBPC 3M7SA 3DH7A 1ISYA 3WH6A 4LT9A 2BY2A 1R47A 4A3HA 3L5LA 3RXZA 1DJXA 1SR9A 1SSGA 4CLMA 2PDIA 3EXRA 3E2RA 3W73A 1ISZA 4MNJA 3M41A 2OEMA 4CD6A 5D9NA 4S2CA 5ABFA 2Y8VA 3TW9A 3T4CA 1J0IA 2P88A 3NPWA 3CHCA 1EDGA 2VQTA 2Z1KA 4RE3A 1B54A 3DC8A 1KBIA 3PZ9A 1UB3A 3WQDA 2YW4A 3ZSTA 4FB7A 3MWAA 4YPJA 5C5YA 3AXMA 1RA5A 1Q6CA 3OB8A 1XFCA 1UZ1A 1GQKA 4X63A 2FZBA 3IWPA 3G1DA 4S3BA 5FJIA 1QHOA 4PULA 3K4DA 3W00A 3G1HA 1YNQA 4S3KA 3NPUA 5AVHA 1UWQA 4A3UA 3VIMA 3DGBA 2QPXA 1W5OA 4FO4A 3QEZA 1N55A 5D2WA 4HA1A 1E1EA 3BSGA 1U83A 3WMSA 1V3JA 3UA3A 4UB9A 3H7RA 4PODA 3PPHA 4LJ3A 4ATWA 1XLIA 3S5NA 5EY5A 4AZCB 5HQMA 1OX5A 3N3MA 1AUSL 3MO4A 2PSNA 1B0IA 4FIQA 3R6IA 1K7XA 2YOCA 4AHQA 3AXKA 3O6AA 4WX2A 5FF3A 5HK4A 4QG6A 2AKZA 2CHNA 2HVMA 3N6JA 1W6TA 4FPSA 2BOGX 2BVTA 1GWJA 3VD9A 1PV8A 3P5YA 3BW2A 3FGCB 1JZ6A 4M6PA 3S2JA 5HDRA 4U2YA 5ABGA 4Z1CA 3TR2A 1V0NA 2YL6A 2GGIA 2CYGA 2FHCA 5BOOA 3LM3A 3NOEA 3C2OA 1E40A 5D38A 4HU8A 3W25A 3R13A 2OZ0A 1UHVA 4ZENA 1YPFA 3KEHA 4TUFA 2ZFAA 3QN3A 8RUCA 1NARA 1GVYA 1RK5A 5DBTA 3W27A 3R2GA 1GOQA 3L2MA 3NAVA 5CSRA 4R88A 5DANA 4YYFA 3VMPA 4GNJA 1EZWA 4XVDA 1XBVA 2WKGA 4BWLC 3W1RA 1E6NA 1YBQA 2VEPA 4GA8A 2VM8A 4OWGA 2Y7DA 1OFBA 5DRIA 3CBWA 1RHCA 4JQAA 2WZTA 4OT7A 1TYGA 1GVEA 3G1RA 1VPQA 1CW2A 2I7GA 2DZUA 4NNBA 3L67A 4R3UA 4QAIA 3PJUA 4ZCWA 1XISA 3ANYA 5AN7A 3WUGA 4I9MA 1OVDA 2C1IA 5HULA 2WVTA 3WEOA 3EMQA 4GVGA 4KRZA 4Z2JA 3ELFA 1NDVA 4GYKA 3UZYA 1WYIA 4O12A 1S1RA 3OLEA 1UG6A 1MYRA 2RDUA 3ATYA 3ONCA 3LS9A 4KW2A 1PIFA 1A3WA 1T5AA 4LB4A 3C8FA 3F5JA 1KFWA 3UXIA 1G7UA 1FVPA 4XZHA 2BXVA 2C0AA 4HU3A 1RSCA 4H9UA 5DLCA 5IRPA 3XISA 4OECA 3U57A 2WNWA 1JGMA 1YMYA 4OU1A 3NQEA 4L4OA 4Y2WA 3SCRA 4WEVX 2CZFA 3NUKA 1ITXA 2Q8XA 2CBUA 4GI4A 3TFCA 5AKQA 3MSGA 4PMDA 2HS6A 2MNRA 4H04A 5C9RA 4NUWA 1OQFA 4WF7A 1GQNA 3C2RA 1RVKA 3KHDA 2VYOA 1V6UA 3T0CA 1FWIC 1WAUA 4Z2HA 3H8AA 3S83A 2IPGA 1JZ2A 1PO9A 3VIHA 2QJHA 3E2QA 4V28A 1S2TA 4AF0B 4DF2A 3L5AA 2PWUA 3GDKA 4MPQA 1VPYA 4BWLA 3GU2A 1OGSA 3AIRA 4ML4A 3W1PA 1GOOA 3K8MA 1QNSA 3E0LA 2FIQA 4YHGA 1QK0A 4A6GA 4UR9A 3OGVA 4X0NA 1W37A 1HJUA 4W7VA 2WMFA 1RY8A 1OF8A 5BZAA 2NUYA 1H11A 2D69A 3FK4A 5BMXA 4GABA 4MJ4A 1BVNP 1KM2A 3LHWA 3S5OA 3R11A 4C6BA 3G6MA 1PBGA 2XSXA 2IXVA 3T42A 3O6CA 1XLLA 1R3RA 4N7QA 3NEVA 1JPDX 1YNPA 1QNRA 2XVGA 4AZHA 3WLHA 2PTDA 3ABOA 3OO2A 1S3TC 2I9UA 4WIWA 2KX9A 2X2GA 5IHSA 2BZNA 1LUCB 3D3FA 4HMNA 1S5TA 5FI8A 1UZDA 2PDJA 7REQB 3WIJA 1KA9F 1N2VA 1WNOA 4DWSA 3TUUA 3GXFA 5EMKA 1XD1A 2VDHA 1UD6A 4LUIA 4O1CA 2EBNA 1G1YA 1EJXC 1EWEA 1JRBA 2YDAA 3ARZA 3ARSA 1OGBA 1QU4A 5M3WA 2FGLA 4DUXA 3VDBA 1IWBA 1R8LA 3QF0A 2E5BA 1AJ2A 1YEYA 4XTIA 1EBHA 2C19A 4XBKA 5HATA 3V0UA 1V6WA 4UIOA 3SSJA 1V08A 4NIRA 4LUSB 1GQJA 3FW6A 4HK5A 3OJGA 1XXXA 3N25A 2BV9A 3P82A 5B7ZA 1B57A 2YDSA 2QMJA 3EYPA 1XG3A 3AI0A 3TP4A 4CD4A 5AHIA 3FNDA 2NZLA 3RYSA 2Z28A 3NPVA 2G3JA 4DJEA 2UBPC 3GNPA 1GVIA 2P5NA 5EL1A 4AB4A 3N9KA 1LZOA 4DY1A 4LY8A 3IS4A 5EYWA 3M0XA 3E38A 1WDQA 2B81A 4ZQPA 3JW7A 1XIEA 3ITGA 4RE0A 3SJ3A 3W6MA 3ZR4A 4R7WA 3ZIZA 3W2UA 3GR7A 4I3GA 4GQQA 1QW9A 1XCFA 4LV9A 4C7DA 4TXEA 4Z2IA 5FEWA 3FXYA 3CAVA 3KX6A 1Z9AA 1DWAM 1A5CA 3UW6A 4DZIA 4P8UA 3N9RA 3KVJA 4JL1A 1K4GA 3SGZA 1B3XA 4JYFA 1ZBKA 5FF2A 3W75A 3CWOX 1UD8A 2ALRA 4JY9A 1AH3A 1SJCA 2XGZA 4DRSA 1ECQA 3A22A 1RH9A 5A6JA 2ZZ3A 4B5NA 1C8QA 1HJWA 5EGRA 4F40A 5KTLA 4KCTA 1THFD 1XH1A 2OODA 3GAKA 1KBBA 5F7UA 3QVQA 1XIIA 1BWVA 2ZA2A 5AHNA 1E0UA 3H21A 5JBDA 1QI4A 5KITA 4J3TA 3DENA 1SFSA 2PGFA 4W8BA 5HWMA 3JRKA 1LP6A 1E5NA 3B40A 4LY4A 1EJTC 4QJ1A 4HKPA 1EOKA 5AC5A 4H4IA 2GVYA 3LBMA 1K8ZA 5A6AA 4H8NA 1HTIA 3TEVA 5REQB 1UIPA 2QCNA 3FXGA 3ITOA 4HJWA 1QATA 4ORMA 5GJNA 3GZAA 4K37A 4M81A 5CC6A 1QOPA 4M1BA 2RFGA 1B3WA 1XIDA 4GYPA 4LAUA 2OYKA 4OBSA 4WK9A 5IDZA 4GISA 1QR7A 4L6DA 4PR4A 3S2NA 2PBGA 5J5RA 3W86A 1EUAA 3VDGA 4C6QA 3DAQA 4Y6GA 3KZPA 2ZDRA 4E3TA 4H41A 2ZICA 3TKFA 4AZIA 3SO7A 3J7HA 1CBGA 4Z1BA 1JUBA 5HXMA 3BC9A 2R1KA 3TC3A 2IUZA 2VDIA 1GCYA 1U5HA 2HV5A 1SZEA 4DPPA 4IIDA 4O17A 2REQB 1J11A 4BQ3A 4GRSA 3W29A 4IMEA 5TIMA 5HWNA 5EA9A 3TAKA 3VOCA 1GGOA 4POCA 4TV6A 3IGUA 1Q45A 3DFHA 1XYCA 3A9BA 5EFDA 2TMDA 2ZUNA 2HQAA 3LQLA 4ZFMA 1KFLA 2X16A 1E6ZA 3SRHA 1XLCA 3T0TA 4ENLA 2ZA1A 4ZQNA 1YRRA 3H4XA 3THUA 3RLUA 3EOUA 4ZO9A 1CGWA 1C90A 4DIAA 2DZXA 4M0XA 4K3ZA 1YTKA 2Y2WA 3WNNA 5I00A 5I3DA 2PUZA 4YTUA 5F1VA 1CB2A 3L4YA 2CLKA 3KDOA 1JPIA 4JPGA 2OWCA 2I56A 1X6NA 1W9UA 1X7FA 4GKTA 4UNIA 3C61A 3M43A 3QPZA 1QBBA 3UETA 4N42A 1XLFA 4P7NA 1P0BA 5B80A 1OF6A 3KRBA 4QCEA 3HIJA 3L23A 3SECA 4EANA 3LSCA 2BXZA 5JVLA 3M5ZA 4XSMA 3ITXA 4I8YA 2XUCA 3DYOA 2UV8G 5G1MA 3CQHA 1XYLA 1JD9A 1GOIA 3KBSA 4PUNA 2V3EA 3TYCA 4TX8A 1E4NA 3CXOA 4DELA 4S3DA 2ZXQA 1B3ZA 4AEFA 2Y89A 1RALA 2GJLA 2FZ9A 3UZWA 4TR9A 5AHFA 1W2PA 5FAGA 5D2YA 3EWUA 1Q6DA 2AGTA 3O63A 4C6IA 4MB5A 3VINA 4ZR8A 2ANUA 3CUXA 3GVQA 5DXYA 4JKLA 4XKYB 3CT7A 3KTCA 4X2PA 1OYCA 3MMUA 3PWAA 5HNNA 3ZQ9A 1KB3A 1KRBC 3MUAA 3OLGA 1XSIA 1G01A 3DFTA 1ICQA 4M8UA 4IFRA 1ZNNA 3LXBA 3T05A 2OLHA 4UTLA 4CD8A 1BXNA 4HNVA 3IIOA 2ZZ4A 3WDPP 1J96A 3TJIA 1QTWA 4YWSA 1HKVA 4ZOEA 1Q6FA 1SZRA 3RCNA 5A6KA 1XYBA 1EX1A 3I6RA 4AZCA 3AMGA 2VRKA 3VKDA 5FJJA 4AC1X 3U2CA 1JR1A 5AC8A 1F3TA 3ZT5A 3OZMA 2ZZ7A 3F4WA 2CLLA 4WRHA 5A6SA 3OTRA 3CEUA 2J9XA 2WJFA 3WK3A 1LBLA 1XC4A 3IGHX 4C6CA 4R7OA 3WF2A 3NDOA 3ZR6A 2WC4A 1KBKA 4ML9A 1EGMA 3BAWA 2VELA 4MMWA 4ZQRA 2QDDA 3T0DA 1PHQA 4HOXA 3M6DA 3STCA 4F66A 3LMZA 1I8JA 3DI1A 4P7RA 5G2IA 4S3JA 1LBMA 2A85A 4GZIA 1FWEC 4PRWA 2Z1VA 5GQBA 2QR6A 1KTCA 3TA6A 1HKWA 1DJQA 1N82A 4OGZA 4S3EA 1XSJA 3QTGA 4CVWA 1C3FA 2QZRA 1XYMA 2DP3A 4GGHA 3ICJA 1S5WA 1BRLB 4JN7A 3VTRA 4MSSA 5AZ0A 5M2FX 1WBJA 3KBWA 4A35A 1VZWA 4EE9A 3HPSA 4ROPA 3TZNA 5C71A 2GUUA 3KXQA 4JCLA 3OLIA 3HGOA 3BXWA 1BQCA 2IKIA 2X40A 4YS1A 2EAWA 5G2HA 2Y70A 1B2YA 1MXDA 1E71M 1H1YA 9RUBA 2DIJA 3NQDA 3V0TA 4HU0A 1F73A 1Z8AA 4HP5A 4ZBCA 1AL7A 4E4FA 4GWEA 2WSKA 2PODA 5TAOA 2NVAA 3GFXA 8CGTA 4J3SA 4HJFA 5D33A 3VGHA 2A0NA 4FOJA 1MI3A 1UR1A 3T4WA 2X30A 1RCQA 3SZ8A 1WXYA 3I65A 4NRSA 1LRQA 1NH6A 3WL1A 1FHUA 3IJIA 1KM3A 3A12A 3LTPA 3KCJA 5H91A 1UC4A 1E0WA 4UOQA 5IOBA 4HMEA 1YPXA 1KTBA 1EJVC 4RPPA 4LB3A 4UTWA 4URIA 1P6WA 3UP8A 3VPLA 2WSYA 3U5YA 1R87A 3R43A 2NQLA 4ADUA 1X8CA 1OC7A 2Y0FA 5A8MA 3WD1A 2PWDA 3WQPA 4OIFA 4JTGA 4PUEA 2E3ZA 2CEQA 2LLEA 5KZMA 3P61A 3VZXA 1JDFA 2O4QA 1ML1A 4O8RA 2PGEA 3N9SA 2PLJA 2PI6A 2TODA 5LNVA 1DJGA 1CXLA 4B4HA 4GYJA 3WLPA 5DEZA 4NZ5A 1Y5XA 1W9PA 2VZUA 3EA3A 3GVGA 1US3A 4FLSA 2P76A 4HSHA 4JNZA 1RAKA 1ZJIA 2CESA 4MGGA 1Q4NX 2QUNA 3C2FA 3VXGA 1QAPA 1H0IA 2Q09A 2ZTJA 3IRSA 4L9XA 3W71A 1O5RA 2CERA 3IGXA 5D2VA 1H1ZA 2DIEA 3VE9A 5HMDA 4UTUA 1W56A 2ZC8A 1LJYA 3TTSA 1LDCA 3IK4A 4I7UA 2Y61A 2YCLB 1VJSA 3E74A 2V67A 2I1OA 2XN2A 3RPTA 2XSBA 1FRBA 3SCWA 7ODCA 3G24A 1TJ2A 1UR2A 1XICA 3DZ1A 3QSTA 1OC5A 4M19A 4M6QA 1FH7A 2WJZA 2Z2BA 4IJBA 4JS3A 2C18A 3KTXA 2AL2A 2R1PA 2E09A 3I7RA 5CSYA 5B7YA 1DORA 3W3OA 4B5SA 4C90A 3UJEA 3OVRA 1XKJA 1M1BA 1AW1A 3LUTA 3C6CA 4H19A 3E96A 4GVFA 1N8FA 2O0TA 4GQ0A 1JL8A 4B5UA 1VFFA 5DX7A 2H90A 1F07A 2I5IA 3TWAA 4U4MA 4DNMA 2OT0A 1FWDC 3BV4A 3CYJA 4FF5A 3U5UA 2GUBA 2D20A 1BEUA 1O60A 5FJTA 3QY8A 1D3GA 4HK6A 1S5MA 3KBVA 2NXIA 3QYQA 4V1YA 4GUFA 3EX1A 2WM1A 4YMZA 3SCQA 1LG2A 3PBYA 4FNPA 3FHQA 1V3MA 3GU1A 2VFDA 1QW7A 1EP1A 2JGQA 2X7VA 4OZOA 4BF7A 4UR7A 4MWAC 5DMNA 3GC4A 3KAOA 3REQB 4QAWA 2BY0A 3M64A 3P60A 4LQ1A 4PMUA 5CGTA 3GDRA 2CLPA 2IKHA 1CZ1A 3DERA 3B8TA 4QDWA 1RY0A 2E9LA 3K1DA 2L5HA 4W93A 4PSRA 4O10A 5AYBA 3EPOA 5HA7A 1GKRA 3AHXA 2F8QA 1OK4A 1FOBA 1G94A 5AC7A 2E7FA 1XKYA 4QROA 3RRXA 3MMWA 5M5DA 3VU2A 1O1ZA 4IF2A 4IX2A 1W3HA 3VABA 4LSBA 4IMAA 2CHRA 2J77A 5C7HA 5I3JA 2WLZA 4A29A 3MUZ1 4E8GA 4NASA 4FX8A 2VZOA 1SUXA 5A95A 4UNLA 3HO8A 3N19B 7XIMA 2IQTA 1B5TA 1EGVA 2AAAA 4FNUA 3O1NA 3S5ZA 2FB2A 3CK5A 4DJFC 4IG2A 1DJNA 4W4QA 5FJPA 4UCGA 2RDWA 1SW0A 3KWSA 1QFEA 3LHTA 2XPKA 5JXQA 2FGBA 2PGRA 1L0PA 3WL0A 4GNKB 3C0QA 4ERAA 1LRNA 1ZZMA 3OIHA 3OW1A 3HMCA 3RRAA 3G2GA 2NW0A 3TV8A 4AG0A 1B9BA 1P0KA 1TZ9A 1DIEA 3N2TA 1VHNA 4QGCA 1OZQA 5IFPA 5AECA 3NQGA 7TIMA 1VFUA 1YPIA 1XD0A 3OU8A 2WMIB 5FA5A 2VVSA 1WDDA 4GMEA 3TC6A 3WDJA 5HBFA 4O52A 2PP0A 1R6WA 3ABRA 1QK2A 2J6XA 2WZEA 1JPKA 3KHJA 3BLEA 2VRJA 2REQA 3VIJA 1IGWA 3RJYA 4KERA 4M7SA 5BXRA 1UR3M 3WF0A 1DWJM 4WCJA 3WLTA 2P53A 1A3XA 4HIBA 3UY7A 1A4MA 4UTFA 4NF7A 4LUJA 3MHUA 2G96A 2PDFA 4IPNB 5ECUA 4ORIA 2WOQA 1ZU8A 2E9MA 4GC4A 1NDZA 3NZGA 2XYLA 6PTDA 1GOKA 3O3RA 4AY8A 3PN8A 6XIAA 4HVXA 5A5WA 3Q65A 1KV8A 3V3WA 5LNRA 1LF1A 3MI2A 4LVBA 4US5D 1G67A 5A3HA 4EPEC 3HG3A 3W7OA 3U2OA 1XLBA 2NV9A 4L80A 3AIVA 1RD5A 1YXYA 2VEGA 2Y8UA 1H7RA 3KUMA 3JR2A 3EPNA 3H4WA 2ZE3A 2AQWA 1BD0A 5LZLA 4NKCA 2O4MA 3N29A 5K2ZA 3T08A 4A8IA 3UZXA 3H2FA 2DQWA 1VFHA 1SU5A 4MTVA 5E09A 4QP0A 3W72A 2RJGA 1TA3B 3FAWA 2W27A 5I09A 4YIWA 1UP0A 1ZBCA 1E1CB 4LYPA 4WY0F 2YL5A 2Y7EA 4F48A 4NZ4A 4YCOA 2O9OA 1U2YA 3PFMA 3UJ2A 3Q4DA 3VK5A 2J62A 1PKNA 1K9TA 4ASTA 2WVUA 3SN0A 3WENA 4REQA 5E70A 4B3KA 3D46A 2AKMA 2GDQA 2QEZA 5DT7A 4XAPA 3NQMA 3QSRA 4CNPA 4DM1A 4K1WA 4XKYA 1XR2A 1W8GA 2BMBA 3NDZA 2PB1A 4MY8A 4RUBA 1TPH1 1TMQA 3GXNA 2ZTKA 2GSEA 2OG9A 3W6LA 1FH8A 3S8HA 2JEPA 3CUGA 4HOZA 5FF7A 3OVQA 1ZS2A 3FYPA 4CEXC 5CC3A 2IKJA 4JTQA 3H24A 2DZSA 4K1GA 3OHMB 2Z6IA 5I06A 4ADSA 1CIUA 2J8FA 2PTWA 3MBFA 1XH0A 3TQKA 2C7FA 3KOXA 3O6YX 2F9RA 5FOOA 1FY6A 3PS7A 2YDRA 2XVKA 2PDLA 4GK8A 2YL9A 2HCVA 2PDKA 4KEUA 4QDPA 4HYRA 3CHEA 4E8DA 5FF0A 1K7EA 4J1OA 1A5KC 4W84A 3GG8A 1SO4A 3KFTA 3VA8A 5H8UA 2XFRA 1PX4A 3S2MA 3LI1A 1KRMA 3H2AA 3ZWSA 3GLCA 4MB1A 1P0EA 3AIBA 3BAIA 3M16A 3VKJA 4QLJA 1C8VA 2PZ0A 2VC7A 3PF3A 1ME9A 3DHDA 1U1UA 1UBSA 3QMTA 2R14A 1SQ7A 3KCOA 5FESA 1XLMA 3WJWA 3VAVA 1OCBA 1OABA 2YXXA 1VFSA 3CUIA 3B8SA 3G1SA 2ZIDA 4FAMA 4PTXA 2J9ZA 1S2UA 3GWQA 3QGKC 4LRSA 3I7SA 4B5VA 4DJDC 3L21A 1AQMA 3HPFA 1V93A 3O0KA 1ODZA 1QJWA 3M9YA 4JD4A 1BRLA 7A3HA 4I9AA 3PULA 1W3LA 4PFMA 1JPHA 4BEQA 2OYLA 3TLLA 1WZMA 2KZHA 2BX7A 5G2WA 4IXXA 2ZXAA 2CLOA 4D6CA 1TPUA 5LIKX 3S2CA 4IWWA 3ORWA 4B4FA 1XI3A 5XINA 1EFZA 4ROQA 1I1WA 3L66A 1ZAJA 4MVAA 4J27A 4PSPA 4H7ZA 1XIGA 2HROA 3STGA 3UWUA 3GXMA 1TPDA 1X1ZA 3RGTA 4NJHA 4MJMA 3CZLA 4KQNA 2RJHA 3L4WA 1OX4A 1CXHA 1W3IA 4FNRA 3C5QA 2QCCA 3H23A 2PZNA 3PUGA 1RQBA 3HA1A 4NAFB 1OD8A 3K4AA 3LGEA 4IMFA 4K38A 5IDIA 3K13A 3BL3A 1WCGA 2QUMA 2A3HA 1HGWA 4C6EA 4S3AA 4ILSA 4AC7C 4BCEA 2H9AA 2OOFA 4KGLA 1LWHA 1LT8A 3NNTA 2OX4A 1XUZA 3LGDA 4O1FA 3TMLA 1AH4A 3WQ4A 4US6A 5LA1A 2Y4SA 3W7JA 3OQ8A 1HUVA 2CCRA 2VFIA 3B9DA 3AZTA 4JEJA 1O6IA 2ZUUA 3GG0A 4LAZA 3NZRA 5D8ZA 3IJ7A 3L65A 5C2CA 2GQAA 3MYOA 3NL5A 4Z1AA 5MHBA 5LSMA 1TWDA 3CPRA 1L8NA 3ZT7A 5LXXA 4PUJA 1I2NA 4MNKA 2CPUA 1XF0A 2XWEA 2C8NA 1J93A 2QGYA 1US2A 3A64A 4FX7A 3IJLA 1QVBA 3LLFA 3VIOA 1BG4A 3QKEA 2GJXB 1P4CA 2WVSA 4DBDA 3HGRA 3QR0A 4F3HA 1J01A 3LA4A 2E40A 4M3PA 2WO5A 5HUPA 3ISIX 4GUHA 5AYIA 4QG9A 1UUOA 1D3CA 3GW0A 4NG3A 2ZX9A 1F7BA 1R9YA 3GNRA 3UWYA 1OFOA 2DDXA 5K3VA 3U7BA 1HZYA 2YCLA 3HQPA 1OBAA 3S6OA 4D8LA 2V5DA 2XIJA 5CC7A 4JTIA 1N8WA 3PY2A 1K77A 3L4UA 1FWRA 2V82A 5BOEA 4JHMA 1C9DA 3EXTA 3RM8A 4QIUA 2X2YA 1G9HA 2E6FA 3BICA 3OPSA 2YFNA 2WZHA 1H49A 4M1RA 1XLAA 1ZLPA 1QPRA 4HYWA 5LNSA 1TX2A 3CMGA 5HANA 3AS0A 1ZCOA 5T9CE 3V1HA 3XIMA 2IQ0A 3WJZA 3CYVA 1SW7A 2X09A 3JZEA 3LPGA 6TIMA 1CGYA 5AVNA 3SSZA 3WBAA 2IPFA 4NSBA 3FJ4A 4PMJA 3WH9A 1XW8A 4ZEPA 4Q6XA 1FHLA 1QPNA 1Q4WA 3M0LA 1LWJA 3W7PA 1LM1A 2DZTA 1TQXA 5KZDA 1I2PA 5GVJA 1OFRA 4DUWA 1QWKA 1A3HA 1KXTA 3LHUA 2ZWZA 2PD9A 4G7EB 2JKAA 2OGYA 3WUBA 3AU6A 1B4EA 3ATZA 1EC9A 4UOJA 4PMZA 4X9SA 1O5XA 1IGSA 2HPIA 3RF9A 3B8WA 1EO5A 4KF1A 4H8UA 1W1B1 5FSEC 3BG5A 3W23A 1AMYA 3B04A 1K8YA 3VNDA 2VVNA 1SJAA 4QS5A 2Z7GA 1IE7C 3NM1A 3TK7A 2G5WA 4FXRA 4DUVA 1MQQA 2Z2UA 3A23A 4V2XA 1B3VA 3REQA 3IPWA 1J6PA 2YCIX 3VKAA 2V9DA 4Y8FA 2OVLA 2HDJA 3EX3A 1P1XA 3W85A 2I14A 1VCGA 4KCUA 4UR8A 4C7FA 2PPGA 4ZO8A 5EMYA 2PDHA 3RIKA 3L9CA 2I5QA 3LHVA 1AW5A 2XTKA 2E5DA 3HG4A 1NY1A 5HUOA 1SFTA 4OKDA 1BGGA 3CL6A 3M6YA 2A7PA 4D8AA 3SUTA 2F2KA 1AQ0A 4KEVA 3MJYA 1D9EA 4PA8A 4N6EA 1K3UA 3CASA 5I6SA 1A49A 4CNSA 2G37A 1E4LA 4Q8NA 2C91A 3SADA 1Z89A 4GIYA 1H7OA 4J3WA 3DHPA 2J7GA 2HNHA 1ITUA 3WDIA 4RPQA 4PC8A 4QJ5B 3W1QA 3FA5A 1XCXA 1CGXA 4XZBA 2D3NA 1TWWA 1RBOB 5FSDC 2FPTA 2XH7A 5FKYA 3TE9A 1N7KA 1TVLA 4EF9A 2OQYA 1J9YA 4XIMA 3QV6A 1SVDA 3NQ2A 3OA5A 3TMQA 5HMFA 5AB3A 1HL8A 4C6PA 4JY8A 1H50A 4IOTA 1WAWA 4MDPA 1KR0A 3KLKA 3RR4A 3WFLA 1XC6A 1DXFA 4PBEA 2FTWA 3RMEA 4JX6A 4DYJA 2WPBA 3UWQA 4DNHA 3C0SA 4IQLA 1IEWA 3QPYA 3LDVA 3KTSA 1XPYA 4U28A 1MFVA 7PTDA 1A5SA 4LBSA 3W2MA 4TVUA 4ZE5A 3R7MA 3VGDA 2VHLA 4N2YA 1LQAA 2OTDA 3V35A 2R8WA 4HNCA 3ARYA 3FAXA 1HL9A 3ZOAA 5D09A 3OVGA 4HSNA 2Z27A 4FLRA 3VD5A 2PEVA 1OFQA 1X8FA 3G0SA 5CGQA 5J8LA 1M68A 5CBIA 5CBBA 4Z08A 1K6WA 2TPSA 2ZBTA 3BZJA 2PFHA 4FLOA 3CO8A 2DH3A 9XIMA 3W70A 5LKYA 1OEPA 3SFWA 1Q63A 4RE4A 3F2BA 5FEXA 5LIYX 1TV8A 4NYUA 4B92A 5GJMA 1M03A 4M51A 2X7WA 3M0YA 2ZVIA 1W5QA 5C2GA 5JH1A 4RZ6A 4TO8A 4YVVA 1JNEA 2DIKA 3UR7A 1W3TA 2XSAA 3DKLA 5BXSA 3N17A 4JQ1A 1ZJBA 3M5YA 3R8GA 3ITVA 3N2OA 1VBUA 2HK1A 2OZTA 3UZ5A 3NDYA 4UFHA 2A7RA 4JKKA 4Q8UA 1QT1A 1FCUA 3GG1A 4PMXA 1IQ8A 3O15A 1BQGA 5F4XA 4AIBA 1JCYA 4XZMX 2WKLA 3PWGA 3BJFA 3N11A 2JKPA 2O7SA 1TA3A 1R3QA 2G3NA 5XIMA 1TMHA 4E8CA 4LCSA 3MPGA 4K8EA 4DQWA 3I3DA 1KW1A 4LX4A 4MYAA 4E4PA 2HNEA 4R33A 4DO6A 3QMRA 1LWIA 1QNQA 4EKJA 3W9ZA 2QNEA 2VEKA 3V5OA 3W7NA 4RZBA 4JKMA 1M3UA 1FQ0A 1TWIA 1KM1A 3Q67A 4OQVA 1MWOA 1KCLA 1MEIA 3WNKA 1OADA 1UPPA 4C1KA 3GH5A 4PCSA 1Q7QA 1HJSA 2QIWA 4HNOA 3E0WA 1GYNA 2QLYA 1Q66A 1F6PA 3P5ZA 3VGBA 5A2BA 1GKPA 3AS2A 4H6EA 4IP5A 1R7AA 1UWTA 4FS9A 1IT0A 1UH2A 4FP1A 3LZ3A 3IANA 1W31A 3F5LA 5A6MA 3AZRA 3W7IA 3EA1A 3NM3A 1PWMA 1G69A 1POKA 2UY5A 3POHA 2PCEA 1FKXA 1TTJA 3DUGA 2FVKA 3N15A 1O68A 2ASHA 3SCTA 1CYGA 2OKOA 4KESA 1BGAA 2I57A 4WXZA 1PB0A 3HQ1A 4RL3A 1HGYA 3RNDA 2W6RA 3QC0A 1F05A 1W9VA 4RNHA 1WDRA 1NEYA 1V51A 3HV9A 3ARTA 4PL1A 2XINA 2J7FA 3GHTA 2QUTA 3M0JA 2ZZ5A 4WGHA 1OK6A 1ISVA 2VFFA 4B3LA 3VKKA 4JZ5A 1EDTA 3EOOA 4LYRA 2RKXA 1DKWA 4X22A 2DJXA 1JCTA 3LENA 1E3ZA 1DQUA 2Y7GA 2AL1A 2RDXA 4I6KA 4WSHA 4HPNA 2WWCA 2VEFA 3WUFA 1YXCA 1NAL1 4P7LA 3MUY1 3PTDA 1V0KA 1EYWA 3ARQA 2VEMA 2A79A 1TO3A 4I8DA 3BK0A 4DWDA 4ZE4A 2PD5A 3BGJA 3GNDA 3VIFA 1ADSA 4IJCA 3PZGA 3V4BA 4LVFA 2FH8A 2DZAA 3MDWA 2ALDA 2HWGA 3OYZA 1SFLA 1PL9A 1K8XA 4QEHA 5D37A 3N2BA 3PTQA 3SDOA 4CU8A 3VOFA 4NAEA 3GYCA 1M9HA 2W5FA 4EP8C 1BLIA 3NO5A 1MXSA 2BVWA 2MANA 3DG7A 2G95A 4PUMA 3TC7A 3K1GA 1I45A 3A4WA 4H7VA 4US5A 3VNIA 1ELSA 4IT1A 1EP3A 1YBQB 1LOLA 3PB2A 4E3VA 2ZZ1A 4YJ5A 1PEZA 1LRTA 2ZUVA 2XFFA 4LF2A 2NVCA 2F6XA 1Q6RA 3T07A 2V5JA 3FFSA 3NVDA 1EGZA 1S2WA 1PJ9A 1WKDA 1D2KA 1B9ZA 1E5JA 2O56A 4U2ZA 4GY0A 3SY5A 5FAJA 3SQSA 4X2RA 3PAJA 3B9EA 1L2QA 4IIBA 3MY9A 2XN1A 2FZNA 3N14A 4LWWA 1UMLA 3IAPA 1RXOB 4ECLA 1Q13A 3WK1A 4WLCA 4F79A 2YZRA 3ARXA 1NDYA 3QM3A 5HWJA 4XQ6A 4ACYA 1JCJA 1P43A 5D32A 4Y90A 1XBXA 2X41A 3CB3A 3KL3A 4R34A 2ACUA 5A2CA 3A5FA 2EF9A 4A8RA 4IFKA 1FWHC 3CV6A 3FS2A 4MWAE 2BLEA 3KWXA 4JL2A 3WDQA 4DXKA 4RXFA 3BQ6A 2JIWA 1SR0A 2PU0A 3R89A 3LI0A 2J75A 4A3QA 3LU2A 2EG7A 3H54A 3EWCA 4AXNA 3NURA 1AH0A 3S6TA 5HR6A 2PDNA 1QPOA 4D9PA 3WLKX 3S42A 4HPXA 4H3DA 4U31A 2ZXDA 2DUZA 4L1XA 1BXBA 4PCFA 4K36A 5A94A 3ITLA 3BV7A 3EWBX 2BSLA 4LF1A 4O4VA 5I07A 3P8IA 2CNCA 1DJHA 3E2SA 4O13A 3VX0A 3GH4A 3KW3A 4UFIA 2E8YA 1G0CA 1WPCA 1Q2RA 3PJTA 3PAOA 2EO7A 4YLWA 3IV3A 1PSCA 3GIPA 2GPTA 3CJPA 4N9CA 3UJRA 2A1YA 4LEFA 5D9OA 5G1YA 3HOJA 5HMSA 3QKZA 3BUVA 4YXGA 4ERIA 3M0MA 3UG3A 3R0KA 2JGYA 1R7OA 3UU0A 1KR1A 4EACA 1CXFA 2PDYA 1WKYA 3GVWA 3WKZA 5A8QA 4CKQA 4GO9A 4W85A 4I7VA 1EC8A 2W3ZA 3TYAA 3DBNA 4JDBA 1J79A 3QV7A 4YHEA 4BKNA 1JZ3A 1IEQA 2TAAA 3MCMA 5HPCA 1Q6LA 4CU7A 2X1IA 3PG8A 1KWKA 1IEIA 3D6NA 4UOZA 3WD2A 4DWSB 3F2DA 5FACA 1R2TA 2VCBA 1WDWA 1ZHAA 5CJNA 4FIRA 3BW4A 3S0CA 1UQZA 4ZQOA 3TROA 3RFAA 3C2VA 3P80A 1W17A 1IIGA 1AG1O 2WANA 1QCWA 1K8CA 1MVYA 3AU2A 5JU6A 1WUFA 3MZNA 4DI8A 4HMDA 3G8EA 5IXEA 4QISA 1G7VA 4AFYA 1DHKA 2DEPA 3VCNA 1V77A 1H2JA 3DYMA 1IT7A 3QZEA 3G1VA 3WEMA 4RCXA 4JTTA 1OWQA 3TDFA 4XIAA 1J6OA 4UZSA 2XH4A 4C6OA 2CZEA 2CC0A 4RLIA 2QPSA 4HNUA 4JIPA 4QXIA 4DB7A 2TYSA 4AWSA 1IV8A 3GH7A 3GFZA 3TWBA 2JF7A 1R38A 1NJJA 2GVJA 2FKPA 1PZ1A 3W2KA 2X1UA 1C92A 1ME8A 1DQWA 4OBRA 3WNPA 3WN6A 1FP9A 2EPOA 2G4FA 5C55A 4BI7A 3GR4A 1NF0A 2KAUC 3HBLA 3MUCA 4LNCA 5F1UA 4LCQA 1A5OC 4UQCA 2QDHA 4TVDA 1QI2A 1NWTA 4XAGA 2DJLA 4FXSA 3KZSA 4OHQA 3EWZA 1TV3A 3STEA 4OOUA 3LNPA 3GO2A 3UWWA 3WQWA 4NP7A 3S1VA 2W4XA 1PYFA 1EC7A 5BWAA 1TIMA 3C56A 2VX6A 1Y0EA 5T26A 3CL7A 4D6EA 1DHPA 3HV8A 4OVXA 5BXTA 1IZJA 3FJLA 4XV0A 4UQBA 1Q85A 3BLIA 4KH2A 3RAOA 1VBRA 3LTSA 3T2QA 3UEQA 3ES7A 4KPLA 3GHRA 1L2UA 1GJUA 3KOWA 5CPTA 3GNXA 1LL7A 3LZ5A 1S5VA 2V2HA 1RUSA 1VEMA 3UWEA 3N34A 1EA0A 1E9ZB 1KKRA 2Y85A 2DSZA 4KCVA 2VNCA 1MNZA 3DHFA 1QI5A 1X38A 1GEHA 4RJEA 4BHYA 1V7AA 3TCEA 2OO6A 3AXXA 1AQFA 4D6GA 4CU6A 4NILA 1VC4A 1V6YA 1XRVA 1XL9A 4Q4KA 1J18A 3QHNA 1O94A 2P10A 2FVLA 2D23A 4Q32A 4MZ8A 3MWCA 2GGEA 1J0JA 1ODUA 4WDUA 2DW7A 2QULA 1UOKA 3MHFA 2GVGA 3B8DA 1WBHA 5A8NA 3EKGA 1KM0A 3SCPA 4IMGA 1FFQA 1KRCC 3VKBA 1HF6A 1S46A 3EMZA 1PCKA 4LU0A 1XGDA 2BG5A 4AHOA 1KFKA 2OELA 1UD3A 1BSLA 4J5NA 3BW3A 2INEA 4LFYA 4I6VA 1XIMA 4M5PA 5CC5A 1JXJA 4AD2A 1F2JA 1M01A 1U33A 3AWOA 3GNNA 3GXDA 5F2IA 2VMFA 6A3HA 4G1NA 2FVMA 1LL4A 1UWIA 4AD0A 1KFEA 2QAPA 2O55A 3V5CA 4QNEA 1E9LA 3R1ZA 4YTRA 1IYXA 3M07A 3LG3A 2HBVA 3KVMA 1EJRC 4IGMA 3AAMA 3UGVA 1YTDA 5D02A 4GXWA 1FXPA 1VBGA 3N1AA 4OFCA 1TKKA 2C16A 3GVRA 2HXUA 3NPXA 3QZAA 3UXLA 4IMCA 1VYRA 2PWEA 4UQDA 2CZDA 3OZPA 3MANA 3UZJA 4WVXA 5DF0A 4Q7NA 2P0OA 3IVUA 3VC6A 3TOYA 1L6YA 1C8YA 3NSXA 2YGYA 4QQUA 4Q4QA 1I2OA 4TTGA 2C0HA 2I17A 1TTPA 2EHHA 3H55A 4KT2A 2X1TA 2ZX6A 2QAFA 2FJKA 1SGJA 4EAMA 3PZOA 3ZLGA 3VZYA 2PDGA 3VX1A 1A5NC 1XRSA 3TONA 1EBGA 4MDOA 1X39A 1H4PA 4D6DA 2OLSA 2BBFA 2VCAA 3AISA 4KGJA 3R5EA 1RVGA 1C29A 3W0KA 4W87A 3CAKA 4FOKA 4RZ4A 4JFSA 3GR8A 3T44A 4GXMA 3B0PA 2Z4GA 5BMWA 1OGGA 2Y1HA 4OV4A 3SRKA 3PPFA 1P0DA 1EQCA 2YFOA 2FMOA 2WSPA 1GVQA 3VIKA 1HVXA 4IPLA 5CSSA 4EWJA 2XIQA 2NLIA 2PLCA 5C0QA 2JALA 5XIAA 3T9PA 5CPOA 4K8GA 3AROA 1JF5A 4O14A 1E15A 1E0VA 4L4PA 3W76A 2VQUA 2QUVA 4QM1A 3S1WA 2J7HA 4J3VA 3GQYA 4HPGA 4O1DA 1FA2A 4YVPA 1QW8A 1IIHA 3B0VC 3MS8A 1Z42A 8TIMA 3E02A 3NWRA 3G6LA 4IL0A 4AD1A 3CH0A 3TZFA 1X6UA 3QQ1A 3TN3A 2VFGA 1GHSA 1EQPA 1NELA 1TJ0A 3WF3A 3BOLA 5AYXA 4JNYA 2Q02A 3MO7A 2FDMA 1RJPA 3BOXA 4F9JA 4K8HA 3BPWA 3QQWA 3RLHA 2J7CA 1RCOB 2OZ3A 4LH8A 3V18A 3FOKA 3T78A 3SR7A 3UNTA 1R3WA 1OZMA 1XLGA 4IGHA 1T96A 2YPIA 4EPDC 1JVNA 3WBWA 2OPJA 1JZ5A 1ESWA 3DOPA 5M1TA 2BASA 2WJEA 3FYYA 2POTA 2NQ9A 4IQEA 1ONRA 3H22A 4GE8A 1VKFA 3B06A 1ZB5A 3S5SA 3NSMA 1S1PA 4YCPA 3WNLA 1FWBC 4Q4MA 4XB3A 2PDPA 2XM2A 3TTQA 2HTMA 2ESCA 3BLKA 1D7KA 1J0HA 1EOMA 2V5BA 3OGRA 2QXWA 4MLRA 3ZJ7A 3U4AA 3GTIA 4DBWA 4O1BA 2CLEA 4C1NA 3FKRA 3G1YA 4I9TA 4O0ZA 4CNOA 1JJKA 1EHAA 4ZTYA 1JFXA 1S2AA 3AJXA 2WXDM 1UC5A 3NVTA 2ZOXA 1KD0A 1ITQA 3HPZA 3LCHA 1FUYA 4NY2A 5C7VA 3VI2A 4NL1A 4WOZA 4JYDA 5AC6A 4AQLA 3RITA 2WVVA 1R3SA 2ZX5A 2A2IA 1MRQA 4MAZA 3G3DA 5DMLA 4ICCX 1YQ2A 2Z1SA 4K68A 4F0SA 1VAHA 1UW9A 3PBGA 4IIFA 2CLIA 4L6HA 2BVYA 3LPFA 1UH3A 2AQVA 3RN6A 3QLDA 2CLHA 1TELA 4MZ1A 1NQ6A 4MUZA 4E0CA 2INFA 1KLZA 1WO2A 3AS1A 1VENA 1DQXA 4DBSA 3FVDA 3VGFA 2W66A 1X96A 1SZFA 1XDJA 5G4EA 4CNNA 1AW2A 4XUYA 5LYRA 5LNUA 1H51A 5HOSA 2OQLA 4AD4A 3GX9A 1SFJA 2WQPA 4XD3A 3CTTA 3QYSA 2INZA 4DPQA 3IEBA 5CBJA 1H7PA 4DXXA 1H1NA 2FZDA 3SGGA 3EEGA 4HHMA 4CQAA 5CG0A 5BU6A 1W3NA 3URNA 3JUGA 4XK2A 2E28A 3ID7A 3GBEA 4LPCA 2OX1A 2HZGA 4L5ZA 1PZ3A 4C91A 3SI9A 3LRLA 1SYTA 1UA7A 2ISFA 3PBVA 5JH2A 4FNQA 4GPNA 3LXCA 5CPLA 2ZE0A 2VD9A 2V8ZA 2DVXA 1M7XA 3V7PA 3A13A 2NX3A 2CITA 4W89A 4DYEA 4O0KA 3M46A 3HGJA 4TTUA 2XVLA 2FHFA 2P8CA 5G1TA 4IIHA 4N4PA 2YKKA 3SM0A 3R0DA 4B91A 3OP2A 3HB9A 2WPGA 6REQB 1DJYA 4Z17A 3KRUA 3G1FA 3WQFA 4UFMA 5F4SA 2DZPA 3DX5A 4BF5A 4KIEA 1XDMA 4N4QA 1PS9A 4FK9A 4AYSA 2A3CA 4HGXA 1UKQA 3E6EA 5A8OA 1WKEA 5F2GA 2QCMA 2YL8A 3EOLA 3ZS4A 3P62A 3H2OA 1D8WA 5E5CA 3HPAA 1GPWA 3OYXA 1PUDA 1IWAA 3W1MA 3QFEA 4PMOA 1XM3A 3WUEA 4MWAD 3DG6A 3Q58A 1T7LA 1HP4A 3H2NA 3SRFA 2YLLA 2PTYA 3O2LA 1Q5MA 4UBPC 2A7NA 4FXJA 3PB0A 3ZM8A 3A3XA 5E6YA 1EZ2A 2FGZA 1TUXA 5F4WA 3WMBA 3UWZA 5LGXA 3KE0A 2H3BA 2F38A 1SMDA 2EGZA 3BCFA 3CPGA 2VXNA 1HO1A 1IF2A 4IIGA 2BXYA 2OEKA 3RPMA 3TNOA 3GM8A 4GX8A 4X9YA 2C71A 2AL2B 1Y7VA 1F76A 1DOSA 3SCUA 4H2CA 3DEQA 5D05A 3Q37A 3G77A 1BYCA 1GT8A 3LQGA 4K39A 2QCDA 4AVFA 4D6JA 4MKNA 1LTDA 4H8HA 1DJIA 3ZJ8A 4HSOA 3HFTA 3IAQA 5C6MA 2NT0A 3QGAC 3S2LA 1UD2A 4GIEA 5I5RA 5HJYA 3TQPA 4GACA 1JYVA 1IR2A 4PTNA 4PTMA 4OJYA 2A3LA 1EHNA 3MB9A 1KGXA 1TIWA 3UG4A 3AXHA 4JDYA 1YW1A 1VIZA 2J27A 1E4IA 2WZMA 5AOUA 2JIEA 5LXEA 4MF4A 1XYFA 3S9YA 3U7VA 3WQ6A 3CTLA 1DBTA 1OFEA 3U9IA 3QY7A 5HR7A 4Z2LA 1H0GA 1M7OA 2Y7FA 4AEEA 4DJFD 1I2RA 5CH9A 2OMAA 3PZMA 4Z2KA 3W87A 1RJQA 2VP8A 1P7TA 3DCPA 1AFSA 2E68A 2VX5A 4HU4A 2X0SA 3S46A 4ICNA 3E1F1 1H41A 2VR2A 2TRSA 3EXSA 3ZXWA 1XGZA 4O1EA 3OG3A 4WDWA 1EIXA 4D6FA 1DTUA 3G5EA 4C1LA 3NA8A 1R3YA 1T40A 3H6OA 4GD0A 4OUEA 2YBUA 4HD5A 3I68A 1QRQA 3WJXA 2W9MA 3QHMA 3P93A 2AMGA 4JIEA 5CPNA 2E77A 1MSSA 1O4UA 1X1OA 2ON3A 2E1WA 2WMHA 3FCPA 1DPMA 1NWRA 1F9CA 1ISWA 2NVDA 1R2SA 4BI6A 1MDRA 1J2BA 2A4AA 2XH0A 4LVGA 3WCZA 2GDUA 4CN4A 1UASA 3BAJA 1VP5A 4E4UA 1GG1A 3L0GA 1K6AA 4I5UA 4MUPA 4JIHA 3HQNA 3GD6A 3G0UA 3MKVA 4XISA 3C3NA 4GUGA 1V4YA 1KRAC 3L4VA 3VCCA 2XH2A 4AD5A 3L4ZA 1JG9A 4Q8QA 3L2IA 3OA3A 4CD5A 3MUXA 5AYZA 4EVZA 3TN6A 5ECVA 3SJNA 2ICSA 4ZO7A 4LRTA 4IG2B 3UY8A 1A5AA 5CAKA 4I5XA 2HVOA 3VNJA 5I24A 2YJQA 4MOZA 4RDZA 4Y9NA 1JUKA 3NCOA 4GINA 2PTZA 3W37A 4DN1A 4F0MA 4EOUA 5FJUA 3RG6A 4Q4SA 2PP1A 4MWAB 3LCFA 1QHPA 1KM6A 5D2TA 1ZSXA 4PTWA 1LOQA 3B97A 1GK8A 1FCBA 3LCLA 3N12A 3DFYA 3FIGA 4NXSA 1WKFA 4QS6A 1Z32X 1EX5A 4JQ3A 2BY3A 4KWUA 1J5TA 4UTIA 2W63A 3GYEA 4B9YA 5DCEA 1R85A 1KXQA 3LEPA 4F9DA 3NL2A 3MSRA 4AXKA 3DECA 4TU1A 4WUIA 3MKCA 1A0EA 1PTGA 1KCKA 2PDQA 4Q4PA 1Q8AA 3VNLA 4IL2A 4UQ9A 1UR4A 5FCZA 4MY9A 4GIRA 4BK9A 2FJUB 1XP3A 2R6OA 5EMMA 2OXNA 4GZJA 3CL8A 2BWGA 1ICSA 3C2YA 3ARWA 5I23A 1A0DA 2NQHA 1B31A 3CGTA 4UFJA 2GQ3A 2VCCA 4BQ5A 3NGJA 1V79A 1IR1A 2V68A 2G0WA 5CLTA 2VO5A 1J2WA 5MF5A 2R1NA 2WBGA 1SW3A 2YB4A 3APYA 1CGTA 3TYEA 4JTSA 3I3EA 4ALDA 4FXFA 4MG4A 1P6CA 2X42A 2CLFA 1JEZA 3HJEA 4X0VA 1V3HA 3W7EA 1Z41A 2OU4A 2QDEA 3BLLA 2EQDA 4IQJA 1RQHA 1ZENA 3AOFA 4WXYA 1OYAA 3VO0A 2NX1A 3GRIA 4HTBA 1GVOA 2ZRZA 3DN5A 2OCZA 4IZGA 4FR6A 5M17A 4QQ3A 1BFNA 1VFOA 1QHZA 1I2QA 5BRBA 1FDJA 2YSWA 4N9EA 3WLNA 2CWNA 4AIEA 4LVDA 1HJVA 4GUIA 4H9MA 2E4TA 3ARVA 2BVDA 3SRDA 3PTKA 3SFKA 1XINA 1EXBA 2EPHA 4F0RA 2OOGA 5CKSA 1DTNA 1OFDA 4AY7A 2WK2A 3QC3A 4REQB 3YPIA 3ENLA 3VNYA 4ADTA 4QR6A 4O15A 2DVTA 3P67A 2BGQA 2QCFA 3D3AA 3IVSA 2PC8A 2HXTA 4NU7A 2ZKMX 4KWWA 2FZMA 1QNOA 1REQB 1TB3A 2QJGA 2DY3A 5A8GA 3KVKA 2D2OA 1MQRA 4GJIA 4XZLX 4DJDD 5E0CA 3MP5A 2JQXA 1QASA 1F3WA 3MZ2A 2NX9A 2C6QA 3ABZA 3C4UA 4UCFA 3D5HA 5E9XA 2DT0A 1IXPA 2VOTA 4LC8A 5C9XA 5DELA 2Q8LA 3IUHA 1UR9A 4H1ZA 4J40A 2P0IA 2ZWYA 3BO9A 4O18A 4XTDA 2Y6ZA 3RJXA 4BEUA 2PURA 3PZIA 4EPBC 3POCA 3UZZA 1ITCA 1TREA 1US0A 3Q94A 1EO7A 1PDZA 4YYCA 3TTEA 3CT2A 3QJAA 1CPUA 3RX3A 5CG7A 4MFEA 3MT1A 2BS9A 3PPCA 3LBCA 3PZQA 3AFBA 1H5VA 1QPKA 1M04A 1SZNA 2UZ9A 2XGBA 3SCOA 3V16A 1BF6A 1IZCA 2E25A 3EDKA 1XDLA 1AJZA 4B16A 4CGTA 4DX3A 2C79A 3W7RA 3EKZA 4TV5A 3CS2A 3F1QA 4LC6A 1RPKA 1R9ZA 3VD4A 4PMYA 3A4JA 3V75A 3F03K 4GBUA 1HKKA 2GZXA 1S3HA 1FWGC 3V5FA 1AZ2A 2VL4A 1YADA 1U5JA 3WNOA 1GOWA 1NDWA 3LGGA 2CIPA 1I60A 3IRDA 3DBPA 3TR9A 2GSJA 3TFXA 4I90A 3U0HA 2H8XA 3VD7A 4CN1A 1G5AA 1XLJA 1UQYA 1MUCA 4RDWA 1X1NA 3THAA 3UFYA 4EWND 4KBXA 3JU2A 4Y9PA 1UWUA 1OCQA 4L1WA 4PBGA 3WQ5A 4DO4A 2ZUMA 3LHYA 3VDCA 1GJPA 1XRTA 3VD3A 1SO3A 2YR1A 4H9XA 3IIPA 3W1NA 1AD4A 3MJMA 1R3VA 1TX0A 4OE7A 4IGNA 1LL6A 4FSAA 2YCKX 3NZPA 5I77A 3NG3A 3WFZA 5C9UA 4IGSA 4NZ3A 4PBFA 1ZBVA 1SZGA 2VKZG 4H9TA 3TW7A 3H2CA 4FNSA 4GH1A 2WW5A 1I4NA 3THQA 3TX9A 1OX4B 1EL3A 2PRLA 1CT5A 3DFNA 4IX0A 1W5PA 1GZ1A 4YNGA 3CWNA 4MAVA 2ZX7A 1SJDA 4EPKA 1Q6EA 4H00A 1W1TA 2YW3A 2O9PA 3N6QA 2Z2AA 2H9AB 1W1A1 2YBTA 1TZZA 4E2BA 5ABHA 3UGRA 3E49A 2DSUA 4V1XA 3TN4A 2DT1A 3KL0A 3WMLA 1UD5A 3ZLFA 3UESA 5HQEA 4E2OA 2CXGA 4PCNA 4DXVA 4FF7A 1K02A 2Z00A 5MKGA 1MW2A 1LT7A 4DF0A 1BYBA 3PZUA 3MTWA 4D2JA 1R5YA 4JTKA 1VLWA 4LANA 3GDLA 3CQJA 1GZJA 5F2LA 3N4FA 4GQRA 1PX8A 2V3GA 3H12A 2J66A 3N04A 3KP1A 3BWWA 1KCXA 5DCBA 3DU0A 1NSJA 1A4LA 5D8WA 2NXGA 2Y62A 3F7JA 3P8JA 5FIPA 3FDGA 1I0DA 4YN5A 1CLVA 3VGGA 6REQA 4AX7A 3SUWA 3DIPA 5CJMA 3ZFHA 3M47A 5EU9A 1GQIA 3I6EA 1CXEA 1W5NA 4D72A 4PFHA 4MLJA 3K8KA 1XV8A 4AAJA 5I3IA 5AHEA 3L2LA 4AY1A 5BRPA 1WA3A 3A6OA 2WBKA 4XZ9A 2J24A 4ZFCA 1PTAA 4LS1A 3MC5A 2J79A 3GBDA 4JFWA 1PIIA 3ZO9A 1XSKA 4WJ8A 3SN4A 2XVPA 3B4YA 2X8RA 3G8RA 4JIRA 2PS2A 3HTWA 3TXVA 5BXPA 4WOQA 2FMNA 3LPOA 3T8LA 3FYOA 3SCNA 1NOWA 3I7QA 2QV4A 1PE1A 4J3ZA 1FH9A 4JFVA 4KIRA 3AIEA 2QCEA 4TQTA 1V3KA 1LG1A 4KWSA 5L6UA 5E6ZA 3VKCA 1OHLA 3USZA 1HL2A 1NF7A 3IIVA 4UTTC 5K9DA 2PF8A 4O8AA 1TJ1A 3QOMA 2VC5A 2VX7A 4K7YA 2E0PA 1L8PA 2GQ9A 4F0KA 5A2AA 3UR5A 2QJMA 1NOFA 4GLEA 4LUTB 3QHOA 1T99A 4ZQCA 2EG8A 1FDYA 2E5CA 2ZRXA 4W86A 2DT2A 2GK1A 2V5CA 1PKLA 4GIAA 2QV5A 2H6RA 3MKKA 5C2XA 2C13A 4MB4A 4JYEA 1XUUA 3DGRA 4UTJA 5EMLA 3B05A 1VS1A 1QNPA 5HNRA 2WHLA 3HZ3A 4KWOA 4C7GA 2J74A 3LLDA 4RV8A 4P8WA 4HZ7A 4I7WA 4J28A 4JOMA 4A3YA 3WLRA 3E5PA 3TTOA 3WNMA 1XWYA 2DSWA 1P1MA 1W3JA 1L6WA 1UOZA 4MY1A 1QPQA 4PB3A 2NT1A 3W24A 3SY1A 1GUVA 3VOGA 7TAAA 4WDTA 5FJOA 2NSOA 2X1RA 3BLDA 1IXOA 2FH6A 1RV8A 1I1XA 1U5VA 4RW3A 3B9OA 4N9DA 5HQLA 3W07A 3DFQA 3UPWA 3L4XA 4PUWA 3UPMA 3GZ3A 3IV8A 2ZCGA 2ISSA 2BHUA 3GC5A 3WD0A 3GHUA 3EBVA 2HMCA 2XJ7A 3RO8A 2DZBA 1OFPA 1FXQA 4PH6A 5FJRA 1I6NA 2IS7A 2VGIA 1TRIA 1UJPA 2X0HA 5KZEA 2VUNA 3CUFA 3L0KA 4F0HA 1TSIA 1UJQA 4AWTA 3OOQA 3OEXA 3STFA 2NQ5A 3P7YA 2ZRWA 3KOYA 1H09A 5BCAA 3WLOA 2FTPA 5LGZA 1QO5A 2VGFA 4UTTA 2R1LA 4L4LA 4AD3A 5LNWA 3LYEA 3BGAA 4E38A 3MVIA 3C0LA 3K46A 4D6IA 4B15A 2GSHA 4WQ6A 3AIUA 4HQVA 5K7JA 1OFAA 3A4XA 2FTYA 3W7HA 3BMXA 4UTMA 2VURA 1H62A 3N3TA 2VZTA 4Y96A 1ZRQA 3A4AA 3WBEA 4H9YA 3UG5A 3DC0A 4CUCA 2J8GA 2F84A 3UR8A 3B9NA 1E70M 1ZP4A 1VBJA 1DE6A 1Q65A 3O9NA 4AZGA 5D04C 1GG0A 1UKTA 4JX4A 2GWNA 1XYZA 2YA2A 3KCLA 1HO4A 1KCZA 4MWAA 3NSNA 2GOKA 3KRSA 1QDSA 1UH4A 2HEJA 3AHYA 3BCDA 5G4HC 3P2VA 3LBOA 4QSFA 1F5ZA 4LEQA 2XFYA 3QQ0A 4WR3A 2Z29A 4KFPA 4HZ8A 4XD5A 1RA0A 2YXOA 2RGMA 4EXBA 3I4EA 2W91A 3FY1A 4C6MA 3GHSA 2A6LA 4JXCA 4P7QA 4Y7EA 3VOJA 4Y9AA 2B7PA 4WKFA 3UJSA 4E2DA 1FKWA 1VB9A 3VNMA 2DV0A 4NRRA 1E6QM 4FX6M 2ATMA 1BTMA 1EEPA 4DWSC 2W0UA 3FLUA 4RK8A 2E8ZA 1WUEA 3GFYA 1GOXA 7CGTA 1SSDA 4GZ7A 3W28A 1WZAA 2OKTA 3C0JA 4JN8A 1ZP3A 4NX5A 1O5KA 1UPMB 3W1TA 4JIIX 1HG3A 1C7SA 5C70A 4LOCA 2GOUA 1E6PA 3HU7A 4HN4A 3RPDA 3G1AA 3LERA 3W02A 3PBWA 4DJFA 1UD4A 4DZHA 1YE6A 4S23A 2FQIA 1TCDA 4R5EA 2QCHA 2CU0A 1U1HA 4FZIA 3N4EA 1RBAA 2C14A 3URQA 2O9TA 5A1AA 2JKEA 3TVAA 5I0DA 2O7QA 3NJ3A 1VH7A 3CIWA 1A5UA 3CH9A 1J4EA 3VCRA 3PPGA 4G8TA 4XAZA 2OJPA 1HW6A 2O92A 4XUGA 1VHCA 1JAEA 3HG5A 4Q6JA 2WHJA 1UWSA 2JK2A 1ECEA 4O0QA 2ADAA 2ZX8A 1R9XA 4ZZ9A 4DJEC 4N9BA 4G7FA 4HHHA 4B2DD 3EB3A 2GJNA 2WLYA 4N02A 1HT6A 1XG4A 2ODOA 1SO5A 1BVZA 5HPOA 4QX4A 4ZVJA 4N6FA 3KOZA 3LCWA 4V15A 1GNXA 1F6KA 1XHGA 2QIIA 4ATDA 2B7OA 1CB7B 1YE4A 4O1AA 3WZ0E 1REQA 3TJLA 1TE6A 4NZ1A 3NQVA 5GJPA 1D3HA 3H26A 1GVRA 4G5DA 3B8UA 1T8QA 3B4UA 3W6YA 3VC5A 3WLQA 2EPMX 3B8VA 5A6BD 2E1DA 2R9RA 2C15A 1M7JA 4A22A 5FL1A 2J7BA 2GJPA 2PRMA 3GK0A 4UTHA 1TPEA 2J8TA 3E5BA 3W7DA 2H8ZA 5T8GA 2FFIA 2G97A 4HHPA 1VYPX 3FJ6A 3JS3A 1CXIA 3A3WA 3NL3A 3RDKA 4M24A 3TTYA 1C93A 3NGFA 5J04A 1CECA 1BG9A 1Z69A 2FFCA 1TV2A 5D9PA 1KKOA 3M4HA 1EF2A 1PWLA 4AYGA 3L5MA 2PLMA 6ALDA 4ZTXA 4UQEA 1YLVA 1IZKA 2R91A 3GDTA 2V81A 3RR1A 1MXGA 4HZMA 4AW7A 2PDCA 2GUYA 2QDGA 4DI9A 3GXIA 3UR2A 3PJXA 1VD6A 1E1FA 1PAMA 2QMKA 4MPKA 3ZT6A 3T09A 3LCGA 4GYPC 4KRTA 3KP0A 1SJBA 2C1HA 1H63A 3IJ8A 3GIQA 4H7CA 4PCTA 2ATSA 1TG7A 3VGEA 2OWWA 5I2UA 4IP7A 4LS2A 3C3UA 2V6AA 1LLOA 2QKFA 3PTMA 1VBHA 4NAEB 2PRHA 5JUVA 2VR4A 2QVNA 5EBUA 1E51A 3IUDA 1ALDA 2GVLA 1G4PA 1GVFA 3ERPA 2A3AA 3AZSA 5FEPA 3WQOA 3H2MA 4X61A 1I75A 2EJ1A 2GLKA 4AZ6A 4LBRA 3GU9A 1RLDA 5ABTA 4U3AA 4RDYA 4LAMA 4A8NA 4GJ1A 3N13A 3ABQA 4GVIA 1Q3NA 4JICA 2X05A 3N18A 2P50A 5A69A 4M29A 1VR6A 1Q6QA 1ZFJA 1RZMA 1RPXA 4DVOA 4DEFA 3GUWA 1ONXA 1Q7MA 2P3EA 4W9TA 2WCGA 3WQGA 4PTDA 4XD4A 3UBPC 4PEKA 2ZRVA 2HPMA 1JCXA 3G18A 5I03A 4CQDA 3NZQA 4P61A 4QTGA 4PTVA 4IFKB 3W84A 4BZYA 1RK6A 3AC0A 3LNMA 2PMQA 1XRFA 1LROA 7ENLA 4PUDA 5CEWA 2XZ9A 5IM51 5KSWA 1LCOA 3RLGA 1YDOA 4BQ2A 1AL8A 1L6GA 1YDYA 4C6KA 3CHFA 3CUJA 3O7UA 4HNNA 3BAKA 3VM5A 1EYEA 3SB0A 2A5HA 2E9BA 3PSVA 2PDMA 2V5LA 1PTDA 4JTAA 3T0BA 2ZUWA 5D2XA 4HNTA 4DJDA 6TAAA 2AQOA 1O95A 3ZSSA 4CCCA 4XWUA 1TVPA 2VTFA 2ABBA 1LQ0A 5DT5A 1LORA 3D47A 4HPJA 4FALA 4ZL1A 2IPWA 5I3KA 1KQYA 1R0MA 2V0TA 4JQ2A 1V0LA 4AISA 4NZCA 1VGAA 1NFPA 3A24A 2DPEA 1B1YA 3MMTA 3T2OA 3LSBA 3WY1A 2Z6JA 1GYMA 3U3HA 1BSIA 1TZ7A 3WSUA 4HA0A 4QLKA 2QGHA 4JN6A 2QCGA 4GOAA 1XPGA 4QHRA 2ZDSA 1WXZA 2UY4A 2F6KA 3PUDA 5CZTA 3N2CA 4JHZA 4GBDA 4LBUA 1V03A 2YIHA 5I3HA 1JQVA 1EDQA 4H01A 5BROA 1WZKA 2D2GA 4IH3A 1DWIM 1M7PA 4GC3A 5CLWA 5DRCA 1OX6A 2Q01A 3ARRA 3SQLA 2B7QA 4UFLA 1GEQA 4B5WA 3U2ZA 1UMYA 1PVNA 5U7SA 4C6JA 1EP2A 1HN1A 4Q33A 2ZUTA 2CKSA 2Y8KA 1FWWA 4PMRA 3EMCA 5BWFA 4U10A 4DAFA 4XSLA 1M65A 4V33A 3AQUA 1P0NA 4HHLA 1W91A 1PIGA 2O9RA 4IQDA 1Y5VA 2YA0A 3ABSA 2D0HA 3DFPA 4RNIA 3EX4A 3TOPA 4CCZA 3GAYA 2Z1BA 1UR0A 1UROA 1QUMA 3FA3A 2ZADA 4HA4A 1NFBA 2A21A 1W9BM 4JTFA 1CLKA 4EXQA 4MNMA 4GY7A 4W5UA 4GQBA 2YA1A 2Z1XA 1BHGA 1EKOA 4GZEA 4HYVA 1V6TA 4LUTA 5CXPA 2J9YA 3LV5A 3PSWA 1PZ2A 3RX4A 3MI3A 3HG2A 3V1PA 2DZWA 3NFUA 4O4WA 4E6MA 3VUPA 3WBYA 1YNYA 3WK0A 4D71A 2Z26A 1UA3A 1POJA 4KMQA 4FI4A 3NQ7A 5BNKA 2XISA 3PNUA 3W1XA 4GVHA 2VFEA 2YLAA 5LIUX 5CAHA 3K2GA 2CXEA 3LV6A 2WMJA 1MUWA 3GW3A 3BARA 5E9AA 4H8VA 1KGWA 1XGEA 4F4RA 4NNAA 4H9ZA 5SWUA 2WKJA 1S39A 3MV01 3B8IA 1UKPA 3F4NA 3TCSA 1BKHA 4H9VA 4MJ2A 3LMYA 3GC2A 3EB2A 3ARUA 4PGLA 4IP4A 4J9JA 1NQKA 2VC9A 1W8SA 2EKCA 3CQKA 2NLYA 3CIXA 5KEZA 4M6VA 3VUSA 5JIWA 1VJZA 3HURA 3WLMA 1DJWA 1Q2SA 4R9OA 4LAKA 1JULA 1TR1A 1AJ0A 1MQPA 2GJRA 2WCSA 1ZCCA 1GJWA 1KGUA 3ZWTA 3FGCA 3DKJA 2QYGA 5DN1A 4Q22A 1TPB1 4S1FA 4WJEA 3P74A 2V69A 2XIOA 3CV2A 1CGVA 4NZFA 4YU1A 2HJPA 2J13A 5JBEA 1GTEA 3BTNA 2V2CA 2J4GA 2P3ZA 4JFTA 4JTDA 4L9YA 4GQGA 3SEPA 3BOFA 3P6LA 1HVQA 4UTWC 1MZRA 3VOHA 3RU8X 5F2MA 2V3FA 3GY1A 3BANA 1F3EA 2R1MA 1KQZA 1TJPA 3ME3A 1AMKA 2NUWA 1FHDA 4JBRA 3TSBA 1NOUA 5TF0A 1ZTVA 1A47A 2C3ZA 1VFTA 2HISA 5D9MA 1KM4A 1Q7ZA 2R94A 3NO1A 1QWGA 3G1XA 3ZLHA 3O0FA 2C1GA 2D1ZA 1WOBA 3ARPA 1F74A 4DLFA 1K9DA 5DBUA 3S9ZA 3NYZA 3VVGA 4B5TA 1DXIA 1JGIA 2D2JA 3MCNA 1SO6A 4PYSA 1A5LC 3UCCA 1A80A 1XH2A 3QW4B 1A50A 1GW9A 2G50A 3B0YA 2DUAA 1A0CA 2XGIA 1BPLB 4UUIA 2YDQA 3E0FA 2WZIA 3GUGA 3A21A 3IACA 8XIAA 1OB0A 4L56A 4K2SA 1XBYA 3TAOA 3VDAA 2PC4A 3QMSA 4QFUA 2NQJA 4A05A 4QE5A 5D4YA 3WLSA 2RAGA 2NWRA 3WH5A 1AODA 4RZ5A 1MFUA 1WXJA 3WFAA 1IWPA 2NQZA 4PZVA 1RD6A 1JI2A 1J12A 3OQEA 2VRQA 4MADA 3E12A 2Z25A 4L6OA 4WZHA 1Z44A 2QHAA 5AHLA 3CV7A 2WMKA 1YX1A 2XHYA 4CN6A 2UY3A 4UWMA 3R58A 3UNDA 4P5UA 1MW1A 3MI6A 3LRMA 4X3ZA 3QR1A 1E6SM 1WZLA 1Y65A 3CC1A 4S3FA 3NXLA 2WM0A 4Y9MA 4AF0A 1X97A 3C2EA 4GI6A 4RXGA 1CTNA 2EJAA 2F6UA 2GGGA 3RLVA 1CENA 2QJJA 4WGXA 1TPWA 4BS0A 2BY1A 5CQ1A 3GE7A 4ZOAA 3GS6A 3SUSA 2VT0A 4IISA 2XIIA 4QJ4B 4TVCA 3B3DA 1V7YA 4A21A 4MKSA 4EXAA 5I79A 3U2EA 2QQ6A 4CQ8A 4A2RA 2IPJA 1OY0A 4NHVA 1ONEA 4GI9A 1BAGA 3GSMA 5HNUA 4CVUA 2V38A 1KM5A 1G4EA 4HZ6A 3UVIA 1CX9A 1K4HA 3CU2A 1RJRA 3GDMA 1GHRA 3KDNA 3AHTA 3WLLA 1LUCA 3K30A 4WD0A 2UY2A 4LCRA 7REQA 3GKAA 3HQOA 2OFJA 4UC5A 5L9FA 1C7TA 1RBLA 3UG8A 3JZUA 1LYXA 4LYQA 4CEUC 1PKYA 4TIMA 3EDDA 3K4WA 1VJIA 6ENLA 3B03A 3H4GA 4P8VA 4Z0JA 2OT1A 1G4TA 1JAKA 4Q8WA 2ZZ2A 1UIOA 2CZ5A 3ZMRA 3D0CA 4HCLA 3GG7A 3MV11 3INPA 2OEJA 3S5YA 3GKFA 1FWAC 2CLMA 3L7RA 4XG1A 1K1DA 4Q8VA 4LUSA 4Q8TA 1V6XA 2QS8A 5BW6A 1BYDA 3LCIA 2UWFA 4M6UA 4XZWA 3LX9A 3TW6A 5KETA 4F0LA 1MZHA 3PBUA 2XZ7A 2I16A 3CQIA 1E72M 1XQKA 1ZJAA 2FPYA 3UERA 2DSVA 4EK7A 1GW1A 4OOZA 2ZRUA 1W2VA 4G9PA 4FOUA 3TLQA 1TV5A 1SPQA 5K9XA 4UTKA 4S3CA 1M6JA 4W8AA 4AMAA 2BHZA 3MP3A 8XIMA 4D6HA 5H8PA 5KMYA 2BFGA 3NZ1A 3OBKA 3MSDA 2J78A 1FP8A 2WHMA 2IXUA 2D0FA 1I0BA 3WELA 3WMCA 3WQEA 3QXBA 1H7WA 1YTEA 4JHOA 3BLOA 4RW5A 3EOEA 1FTXA 4O50A 2FHBA 1F4AA 4G1KA 3SY8A 1ZBWA 2R24A 2BNJA 4KRUA 2ZVRA 1ZAIA 4C1NB 1JCMP 2GYIA 4DHGA 3TXZA 1UP3A 3H7UA 1DV7A 2QT3A 5HINA 3MU7A 2HVNA 1FWTA 4TX6A 5CZKA 1Z6KA 1HKMA 4HA3A 4IPPA 3W81A 1RQEA 4L1GA 3T8QA 4PB4A 4QE1A 5BOFA 2WSQA 2V3DA 3ZR5A 4PB5A 5CZSA 3GTFA 4AVNA 2WVVB 3PZNA 1CI1A 1DE5A 4Q8OA 4Q4OA 1JZ4A 1MW0A 2GL5A 9XIAA 3KL5A 3TN5A 3VMOA 1BKSA 1W9DM 4IXHA 3SUUA 1GTHA 3AS3A 1Z48A 5FD0A 1X98A 1ZPTA 4HN8A 3SCSA 3W7LA 3F4DA 5BU9A 1ISXA 3M7WA 4B2DA 4ONVA 3I6TA 1E4MM 3K5XA 2Z1WA 5EFFA 3BE7A 5REQA 4JTLA 4NXKA 1M41A 3EOSA 1BWKA 1XLDA 3F2CA 1BTCA 1FWCC 1K03A 3I4KA 4KETA 6XIMA 4Q8PA 1B3OA 1UWRA 1NP2A 3KBMA 4I9JA 4Y8EA 3ITCA 3PR2A 1CGUA 3SW6A 3NQBA 3CMJA 4BY3A 4G56A 1ONWA 2HS8A 5JIPA 3E2VA 1FHVA 3LCXA 2OR2A 1M5WA 1ZL1A 1FFRA 3W1AA 4F2UA 4H6RA 3QLLA 3WYZA 1NP0A 3EDFA 1ENUA 4ES4A 3BSHA 1VYSX 4RKAA 4DM2A 5A6BA 1PDYA 4Y9OA 4GX9A 1NWUA 4HMCA 2DSKA 1AD1A 3VIPA 5TBOA 4H83A 1MNSA 4UMBA 3RU6A 4J4KA 4EIVA 2I9EA 3S47A 1QMLA 4LAOA 3RILA 1VIWA 4ZB0A 5LA0A 3MW7A 3QOKA 3EKLA 2X1SA 3MYPA 2BODX 3B9AA 3BLFA 3OBAA 3EAUA 4ATLA 3STPA 1KFCA 3EX6A 3BMVA 4V27A 3RHGA 4JGDA 3CHVA 1KO0A 2J7EA 3B0UX 5AY7A 3NQAA 4E2VA 5HAOA 2ZA3A 4FMVA 3TQ0A 2Q3RA 1EPVA 1OT1A 1PKMA 1Y8BA 4LALA 4QE4A 4WSKA 3WF4A 1KBLA 4C5YA 3N2XA 3EX2A 3KLLA 3LHZA 1EXPA 2DUXA 1OCJA 2W61A 3WH7A 1UZHA 4WKAA 4IM4A 4AZ7A 2OZ8A 3FHAA 4MNLA 2NSXA 3R12A 3FSUA 4J3UA 3T1GA 3PJWA 5CPMA 4I5RA 3W83A 5FEZA 2D2HA 2ONEA 1TRDA 1T41A 3W7QA 4C60A 3IJDA 4KWVA 4KCWA 3AUJA 3LD5A 2WC3A 2POZA 3UXAA 4KFOA 3BZGA 4ZA0A 1TFVA 2W62A 1E9IA 2PBOA 1OG0A 1G4SA 1KXHA 3LXAA 4F8XA 1KTNA 1H60A 3KVLA 3QY6A 2IW0A 5FF4A 1B30A 2QCDB 2VGGA 4KEZA 4GKLA 3BMWA 3CAWA 4W7UA 5T9BG 4NYYA 4G2DA 3T55A 2QVHA 3LY0A 2ZYFA 1WX0A 3B0XA 4RNFA 1GZGA 2NV1A 3APGA 3ZZ1A 1GORA 1Z7AA 4NVTA 2OSXA 2HBXA 1VRXA 4JNMA 5IBXC 3MCOA 4JTHA 4OTKA 5I3GA 1J0ZA 1Z3NA 1FBAA 2A6NA 3PK7A 1WOAA 4WDXA 5J5DA 3UQNA 1FX6A 1XFBA 2Z24A 1AZ1A 4C6LA 2B31A 4M82A 3P0XA 3N2MA 2Q6ZA 4Z2GA 4JX5A 3GB6A 1ADDA 1CNVA 2MUCA 2GVEA 3S6DA 3NEHA 5DO8A 5GNXA 1P7TB 1HKJA 1HX0A 3FEQA 1A5MC 2HRWA 2XG9A 3VOIA 4CCDA 1L9WA 3Q45A 2VEIA 1J5SA 3W38A 3AMCA 3HM7A 1JDCA 4GXPA 3F4CA 2JE8A 4F2BA 4IPJA 3VIIA 3TJ4A 3RCMA 2BGNE 1LLZA 4B5XA 2G4JA 4DBEA 1EJUC 1ME7A 1MW3A 2WJDA 1DVJA 3PBMA 1BF2A 1G6CA 3AALA 5D03A 2PE4A 4F2TA 4GGBA 1OSEA 3T40A 4WSJA 4TMBA 4M56A 2QCLA 4XO6A 5I78A 3M5VA 3MBDA 4MFDA 3ZVIA 2QUUA 3SCVA 3O07A 2GGHA 3IIZA 1JI1A 3S1UA 1P5BA 1BWLA 1PZ0A 5TD4A 2DQXA 1VCFA 3H2EA 1TE1A 3EA2A 4GCXA 5JQ9A 4ACZB 3WLIA 2GWGA 3W1UA 4N0RA 5IBXA 2JFEX 1JCNA 2F61A 1R46A 1V6VA 4AU0A 1DXEA 1UZ4A 2YCJA 3AICA 4TMCA 5A6LA 1R3TA 1O66A 1UUMA 1Q6OA 5TQLA 1DP0A 3GNOA 1RCXB 5DMYA 3CNYA 5EMUA 3AO0A 3T81A 3HMJG 1ADOA 2RGLA 4D1IA 4OUIA 1MMFA 1VLIA 1F8IA 3QZ6A 2V63A 4PCPA 5I3FA 2Y5JA 3DHUA 2VENA 2PLKA 1EPXA 1J8VA 1VEOA 4DZAA 2VZVA 3AMLA 3C8NA 3CB8A 5FL0A 2CW6A 5LA2A 2YYTA 4XBSA 1TPC1 4ZOBA 2DVUA 2VD8A 1U1JA 3OZOA 1F61A 4L7ZA 3ANVA 4L9ZA 4LNYA 2PTXA 1JF6A 1EEXA 1W1VA 4QJ3B 1QO2A 4QSHA 3OIXA 3M5XA 1XIBA 2QF8A 1MRAA 4QCFA 2XU2A 2SFPA 4NZJA 4JAWA 2VOMA 1RR2A 1IXNA 4U5KA 1HIZA 1JYNA 3PANA 1TUFA 5C9WA 1EH9A 1WDSA 4NX0A 5HJXA 3ABXA 5AHMA 1OG6A 1QI0A 1E55A 3NO3A 4BI5A 1TVNA 1WQ5A 5EMJA 2Y88A 3LLXA 2F7FA 2VX4A 3QRHA 3ALGA 4GO8A 2ISDA 2P8BA 1TR9A 2PCQA 1V5XA 4RX0A 1BXCA 3NIYA 3KBJA 2Z0IA 3OBEA 4CCEA 3HF3A 1KBJA 2PWFA 1E0XA 5C9ZA 3HJZA 4JCMA 3CAQA 4BR1A 4ZQMA 5E1QA 3VFLA 3W7MA 4OV9A 5CPSA 1T6MA 2DFAA 1EUNA 3ITTA 4CNUA 3FKKA 4ZGYA 1IEXA 3THCA 3AWNA 4XAYA 2EPLX 4LYKA 5K9CA 2G3MA 2OO0A 4WKHA 3F5KA 1WE5A 3ECQA 3UXKA 1V02A 3T6CA 3PVFA 4XAFA 1MO0A 5HJLA 2YX0A 1E6RA 4GH3A 1MEHA 1OINA 4XZNX 3MQTA 4MKVA 1XLKA 1GOMA 1ZUAX 2NWSA 2JF6A 2J88A 2WSRA 3BAXA 2AOSA 1TWZA 3S3GA 3NQCA 1WB0A 3WDRA 3BVJA 3BDKA 3AIQA 1PXGA 3N4AA 4JTUA 2DH2A 3BG9A 2PDXA 3UD6A 1JZ8A 1U22A 4NQ1A 2W92A 3W82A 1E73M 2BOEX 3DYPA 3M0ZA 1XQLA 5H1WA 1J0YA 2VGBA 3CIVA 1XX1A 2RH9A 1GVSA 3SBFA 1W1ZA 1H7NA 1C91A 1QI3A 4NJIA 1T8XA 1C8XA 3G0XA 3WG6A 3T0AA 3LRKA 4C6NA 4RE2A 5AZ1A 1W9XA 4P8XA 3EWYA 2E6YA 3AHZA 3VM7A 4U33A 4QG8A 1AQHA 2Z7KA 3USBA 2TSYA 4KFNA 2WQDA 8A3HA 4CQ9A 5LHFA 3CQ0A 2Y5EA 1ZGDA 4J3XA 4NJGA 3CUZA 2ISVA 3WD4A 4FEZA 1HFBA 1GQLA 3FX4A 1TJRA 1FCVA 3H7VA 3L4TA 3QTPA 3TIMA 4QDMA 5A8PA 3I3BA 3WDHA 3MSYA 1OM0A