3H21A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h21A00
4CCZA 4DJDD 4DJFA 1AJZA 4MWAD 4O1EA 4S3DA 4NILA 3H21A 4NIRA 4DJDA 3TYCA 1Q7MA 3K13A 4S3EA 3TZFA 3MCMA 3H2CA 1TX0A 2DZAA 4C1NB 1TWWA 4DJFC 2BMBA 4DJED 1AJ2A 3TYDA 4S3BA 4C1NA 4DJDC 4DAIA 3BOLA 1TWZA 4MWAC 4DJEA 4S38A 4S3FA 2Y0FA 1AD4A 3MCNA 4NHVA 4D8ZA 4DB7A 2VEFA 1TX2A 1EYEA 1F6YA 4G9PA 3MCOA 1Q7ZA 4O0QA 2YCLB 4HB7A 1AJ0A 3H2NA 3H2FA 2OGYA 3H26A 1Q8JA 2Y5SA 4S39A 3TZNA 2DZBA 1Q85A 1Q8AA 2E7FA 1Q7QA 4DJEC 3TR9A 2VP8A 3H22A 4PZVA 4O1FA 3TYZA 4DAFA 4MWAB 3BOFA 2H9AB 5JQ9A 2VEGA 3V5OA 3NOYA 3H23A 3H2EA 3H2OA 4MWAE 1AD1A 3TYUA 2Y5JA 4MWAA 4D8AA 2YCIX 4S23A 4S3CA 4S3AA 3TYAA 2H9AA 4NL1A 2YCKX 4DJFD 2YCJA 3H2MA 3H2AA 4D9PA 2DQWA 2YCLA 3TYBA 3H24A 1TWSA 3TYEA
chains in the Genus database with same CATH superfamily
3ARPA 2XU2A 2I5QA 4DJDD 1JF6A 1ITCA 1WXYA 1JPMA 5TAOA 3TSMA 3POHA 4HNOA 1F76A 3PTMA 2PTYA 2FTWA 4NRSA 3I65A 5CPTA 3W28A 4GY7A 3P7YA 1E51A 4G1KA 1W3IA 1AODA 3BZGA 4XAZA 1H60A 3PF3A 1HT6A 1LWHA 2D3LA 1AJ2A 5A6JA 2ONEA 3B3DA 2ANUA 5AHMA 2H6RA 3VABA 2DZWA 4US6A 4E0CA 1QOXA 1QPRA 2XH4A 2CLMA 3W1LA 4F9DA 3TN3A 4C60A 4JKKA 1T0OA 1QI3A 3K8MA 4QLJA 4CQ9A 5GJPA 2PRLA 1Q6EA 4L7ZA 1JPHA 1HL2A 4KCWA 2OGYA 2WXDM 4XK2A 4HPNA 2GZXA 3RPMA 4LPCA 4OTKA 1SFJA 1GK8A 2RGMA 1V5XA 2H8ZA 2Q71A 3URBA 4CVUA 3BURA 1A5NC 1E6QM 2VEGA 1N82A 3LQGA 1B54A 4WSKA 5H6HA 4C6JA 1UZHA 3KOWA 5I3JA 4EAMA 1VHNA 1YE4A 3N73A 1E6RA 2C19A 4IX2A 3GO2A 3N04A 1JCTA 3A9BA 3M0VA 1UH2A 4NZ5A 3UXKA 1R3WA 3HGOA 1T5AA 1NY1A 1EDTA 1XLKA 2JE8A 2ZUTA 1KCLA 2J7EA 2OMAA 2QPSA 2WMKA 3N2TA 2VR2A 1V02E 3VD7A 5J5DA 3BO9A 4MNLA 1ONRA 3M0XA 1GOMA 3TQVA 2F6UA 1EGVA 2E67A 2V0TA 1LBMA 3LK6A 2OSXA 1J0ZA 4FX6M 4Y96A 1MVYA 4TIMA 5FJTA 3ZJ6A 1CGWA 3JU2A 3NGFA 1ME7A 2QNEA 2ALDA 6TAAA 4KCUA 1ISWA 4Q7NA 3S8HA 3TH6A 4NHVA 2BY1A 4MPKA 3BJFA 3PM6A 4S1FA 3P74A 2YGYA 2VC5A 4UR7A 1K7XA 4YWIA 2VD8A 1VBRA 1ONEA 1MWOA 3VDGA 4R9XA 1ZNNA 4WDXA 1SO5A 4ZQRA 1XW8A 2NSOA 4DRSA 1TR9A 4W9TA 3E0IA 4DZIA 2B0MA 1SUXA 3AYRA 4R9OA 1ZS2A 4WIWA 3H4XA 2VGGA 4QEEA 4OOUA 3UXIA 2QCEA 2X2GA 4H6EA 1A5OC 2UY3A 2VCBA 4Q8TA 1UW9A 5MKGB 4NZCA 5CBBA 1M7OA 4X2PA 1LP6A 3BE7A 1E9IA 3G1XA 3CUZA 1KV5A 3C0LA 4KERA 5C70A 2GPTA 4FOJA 4ZO8A 5G2WA 3J7HA 2AL1A 4UFLA 3NIYA 2HEJA 3BSHA 3NL5A 4IPIA 4JFUA 1YEYA 4MYAA 3DXIA 4XZ9A 4Y9PA 4Q4SA 2Y7GA 3I4EA 2UWFA 4FLRA 3LCIA 3BLFA 1C8XA 3HV9A 4PMDA 4JTEA 3OBAA 1HKMA 4RKAA 4C6LA 2YZ5A 4ZE4A 4G6CA 1RH9A 2CZEA 3GU1A 2G8ZA 3HMCA 3BGAA 2V67A 1TWZA 1WKEA 4CD8A 4RCXA 3CC1A 3CH9A 3UWEA 2INEA 1EYEA 2V8ZA 3ALFA 4B92A 1F3TA 3IUHA 3N2CA 3RPDA 4HOZA 1JRBA 4HYVA 4YHEA 4EPEC 2O56A 2FJKA 4LUJA 1FBAA 2QPUA 4O17A 2ZZ5A 2PD9A 1D3HA 2NQJA 4DJEC 1YIXA 4UC5A 2OGJA 4MTVA 5REQB 4MM1A 2J7DA 3QKEA 3ITTA 2O9TA 3S6TA 1GPFA 3PZGA 9CGTA 3H23A 4UQ9A 1VRXA 5BRBA 2WPGA 2FFCA 5JBFA 5DXXA 2FVMA 4XD6A 4G7EB 3NYDA 1Z44A 4PB3A 3V7PA 1VCVA 2GQ8A 3WF1A 1DWAM 1C9DA 4Q4OA 3T05A 3S1VA 3UPMA 3Q45A 4DUVA 3RYSA 1F2JA 1M5WA 4C6NA 3TTYA 1FDYA 1UUQA 4UXDA 3QN3A 1JI2A 3TQ0A 2QVHA 3F2BA 3R13A 4JS3A 2HS8A 1F8IA 1LT7A 1BHGA 4DYJA 2A1YA 3QFEA 1QK2A 4JTFA 1GVYA 4GK8A 4QNWA 1B90A 4DM1A 1IHIA 1E43A 3SRDA 4U2YA 3WLQA 3UERA 5KEZA 3ZZ1A 1U1JA 4LVDA 3IJ9A 3L23A 4PUMA 1ICSA 3QSRA 3U57A 3FW6A 3TOYA 1EHAA 4IIFA 3UJSA 1UWTA 4XZIA 4CNUA 2DZUA 4NASA 4JTJA 4JTAA 4J3UA 2PP3A 3M0YA 4I8YA 1VLIA 1M7JA 2DPEA 2AL2B 5ENLA 3OZOA 1OZQA 3WQWA 1K3UA 4NI3A 4JGDA 3LTPA 4KFOA 6PTDA 4A3UA 4LSBA 4ECLA 1BFNA 4S3AA 1RLDA 1JIBA 1RY0A 1YLVA 1DJYA 3TJIA 3H2AA 3SCVA 3AZSA 5EMKA 5C9UA 4GO8A 3SUWA 3V0SA 1X1NA 1UHVA 1S2VA 3WLMA 2XIBA 1PTGA 5AHFA 3QFWA 2WSPA 2ZRUA 1FRBA 4MKNA 3MUAA 5ECVA 1M65A 4H7CA 3TW9A 4B3KA 7CGTA 3HJZA 1FWRA 1UC5A 2A3HA 2VCCA 1HTIA 3O3RA 1A0EA 3IARA 4KESA 3SDOA 1KRBC 1J93A 2D20A 1K02A 3PBYA 3PZTA 1W5PA 1B3YA 3ISIX 3S1WA 3NXLA 3GVRA 4UTTC 3NO3A 4JTTA 1UWSA 3AWOA 2VFFA 3ZLHA 1ZALA 1QT1A 5C2CA 1G4TA 4NJGA 4UOZA 2EGZA 3G0UA 4GRSA 1KXQA 3FN9A 1NSJA 1GHRA 2IKHA 3P3BA 5XINA 2BY0A 2V5BA 3V5OA 3G1RA 3P80A 4V27A 1W91A 1ZAIA 3OLDA 4AZIA 4H7VA 1TKKA 4MMWA 3C3UA 4RNIA 3LY0A 2ACUA 1EQPA 4O1AA 2C7FA 2FDMA 3DCPA 2Q8LA 3E6EA 4D6DA 1XLJA 6REQB 3LHUA 2ZYFA 1JG9A 4ZOCA 5HQLA 2Y4SA 3W1PA 5BZAA 4H00A 1CXLA 1OX6A 1BWKA 4JYDA 1N8WA 4ZTXA 4PCTA 4HJWA 1IGWA 4LUSA 5BMWA 1MMFA 3GH4A 4XZHA 3WQGA 5DQPA 1J0JA 4AY7A 1JAEA 4GUIA 3NG3A 3FA3A 4LUIA 2Z7GA 4O10A 3NQCA 2DZAA 3EX3A 4FO4A 1ZJHA 3SW6A 3O1NA 1PBGA 3VKJA 2NUYA 4BCEA 3RGTA 3KBVA 4US5A 1G6CA 2NX1A 2HBXA 4TOQA 1HQTA 1ZFJA 3ANUA 4V2XA 3MQTA 1E9YB 5K7JA 4FXFA 3PZIA 1R0MA 4X61A 4DEFA 2WPBA 2XDFA 2OX1A 3KHDA 1XICA 2NQ9A 3VM5A 4E4PA 1PE1A 3MP5A 1UD8A 4DF0A 3G0XA 3KDOA 3AXMA 4H19A 4KW2A 4ZODA 4O53A 1TPWA 4LJ3A 4REQA 3PUDA 3H22A 4QHRA 4A8RA 3AMDA 3TYZA 2YDAA 5BOOA 4JTQA 3SFWA 4L5ZA 4HP5A 4Y90A 4DXKA 2DIJA 5AC8A 2ZQ0A 4GZIA 3L4XA 1B3VA 2F61A 3WLKX 3O63A 4TR9A 3UXAA 3KWSA 2XZ9A 3CPGA 4BF7A 3LG3A 4M5PA 5B80A 3NL2A 2E28A 3STGA 3P67A 4C5YA 1B4EA 1NQ6A 1VP5A 3WZ0E 2TSYA 1ICQA 8XIMA 5A2BA 4RPPA 4B91A 2EPHA 5I3IA 3TNOA 1XUUA 1IGSA 5E5CA 4RK8A 1UR0A 4JFSA 1CZ1A 3V4BA 4L9XA 4FNTA 2QYGA 1U30A 3T55A 1I1WA 4H2HA 1R9YA 1YDNA 2QUMA 1MNSA 3ARVA 4ZB2A 1P6BA 2JKAA 1RSCA 4N6FA 1FWIC 2PDFA 1UUMA 1GVFA 2D0FA 1R85A 1TPB1 2OLSA 3E0LA 1XS2A 4RR4A 3VA8A 2FDSA 2PDUA 1TMHA 4C6QA 1TMQA 1PTAA 3WLRA 4KF1A 2DZXA 3RMJA 4RDYA 3S83A 4HA0A 1KRMA 1ME8A 1AQFA 2Z2BA 4F79A 2H3DA 3G6LA 3M64A 4WF7A 4DIAA 5M3WA 1D7KA 2J79A 5G4EA 1PVNA 1FP9A 3P0WA 1NOUA 1TJRA 3P60A 3VOIA 4GZEA 3I3DA 4BI7A 3OVQA 1HFBA 1KM3A 2Q6ZA 3UYCA 3N6QA 1MXSA 1R6WA 5HNTA 3AHZA 3F4DA 5FJPA 4D6HA 1RQBA 5I07A 3TYUA 3UJFA 4JNZA 1DKWA 5K9CA 1MRQA 1YXYA 2Y5EA 2XWEA 3SJNA 1X38A 4H01A 2QGHA 4F0MA 1KBIA 1D8CA 3WIJA 1EJTC 4I5UA 5C9ZA 3R8RA 2YW3A 3AJXA 2GUYA 1EUNA 1XBYA 2QDGA 3U4AA 4MUPA 3HIJA 4W93A 5CC7A 1NAL1 3NZQA 3S1XA 5E0KA 1EA0A 1DXEA 3VUPA 4AZBA 1GVRA 2YDRA 3GNXA 2ZRYA 3T42A 4X63A 1EDQA 3ZIZA 1I1XA 5KZMA 2PB1A 4UZSA 2XGIA 3SJ3A 2OCZA 2FPTA 2F38A 4LWWA 4ZQOA 4TU1A 1ZBKA 5DRCA 3VIFA 1RXOB 2OOFA 4UOQA 1W6TA 2MUCA 3NZ1A 1GKPA 2J77A 1FWCC 2XFFA 1HZYA 4OBTA 4O0QA 4HB7A 2CERA 4FA3A 1AFSA 3B9OA 4ML4A 1XV8A 4XVEA 2PF0A 3BV4A 4MLRA 6XIMA 1N7KA 4UTJA 1CI1A 3M5YA 3W2UA 1JCXA 3GXPA 4HNNA 1IR1A 4IOTA 1SR0A 3IRSA 3QR1A 2NV9A 2Y5JA 3WK2A 1HJQA 3WELA 3TIMA 4QQUA 3TN5A 1R3TA 2V3DA 3WDPP 2A21A 3OPSA 2J6VA 4DO6A 1S2TA 3NZGA 1L0PA 3FHAA 2Z1SA 4FK9A 1DTNA 3KBNA 2NWRA 4H9YA 2R1PA 4AIOA 3DFOA 1W9VA 1V51A 1FX6A 1RJRA 2VEKA 2GQAA 3A24A 4AWSA 3MWCA 2P1FA 4JIIX 1UOZA 1GW1A 3FJ4A 1WKFA 3FCPA 3S42A 4PMZA 4W88A 3V18A 3W1TA 5GQBA 3R0KA 2Q02A 2IQ0A 2FH6A 3MHGA 2WC4A 5BXPA 1C8YA 1QATA 1UBSA 4AY1A 1BYCA 2ATSA 4H2CA 2WC3A 1JZ4A 1TE1A 1EXBA 3MCNA 3PJUA 2YBTA 3E2VA 3TU9A 1UH4A 2PDMA 3P2VA 1UD2A 1IZKA 1EX5A 2HVOA 1X8FA 4IPLA 2W0UA 2J13A 4WJXA 4RXGA 3RILA 1EBHA 1KGWA 3WFZA 2PWDA 1K8CA 3D47A 1XSJA 3U9IA 1GVQA 4HJFA 1UD4A 2A3BA 1WBJA 1XR2A 3HQOA 1H0IA 4AZGA 1EX1A 3VNYA 4HBKA 4KWOA 4CN4A 4ZA0A 4F66A 5E0FA 1T6MA 4P2VA 2F2HA 3I4KA 3H70A 4O12A 2WJDA 1A0DA 4PA8A 4P7RA 3RFAA 4RNHA 3QQWA 1MI3A 4GQBA 4G56A 4YWSA 3VM7A 1F4AA 3UGVA 4MWAD 3C2YA 3ZR5A 1SVDA 2ACRA 3R1ZA 2ZUSA 2HISA 3TYCA 5DMMA 2WSQA 4ROPA 4O50A 2X0SA 1B2YA 4A8LA 3LSBA 5L9FA 2VFHA 1EOKA 2WMIA 5FAJA 3DH7A 3MP4A 3PPHA 4XO6A 3LCGA 1JYNA 4MNMA 2WNWA 1A5BA 2Y62A 5MKGA 4WOQA 1K4GA 3S4TA 1WZMA 1ADSA 5DCDA 3GHTA 3T40A 2ZTJA 3WQVA 2YA2A 1ISZA 5EMYA 2V5KA 3PSVA 4CNNA 2BG5A 1O5QA 4U10A 1XC6A 3CTLA 3U5YA 1HJUA 1KLYA 2H3BA 3TLQA 1KBLA 5CSSA 1S38A 4LUTA 3HFTA 3S5YA 3G6MA 3O07A 2HK0A 3N2XA 1J5TA 1KFCA 4HZMA 4UR8A 3VNMA 1TR1A 3B0XA 4F48A 3GTIA 3IUIA 5J04A 2YR1A 1DJNA 3DHDA 1KTCA 1L6FA 5EB8A 1FWFC 4C6FA 3U8GA 4KKXA 5BRQA 2WVVB 2XYLA 1ISXA 1FFRA 1EJ7L 5JH2A 4JX4A 2E6YA 5G4HC 4MFDA 3EX6A 4E2VA 4CUCA 2ZA3A 5C2GA 4Z42C 3WL1A 3AISA 1EYWA 2PCEA 4N4QA 1E55A 3NPUA 3UVIA 3NZPA 2WLYA 1G0CA 1JDCA 1FDZA 1V0KA 4UTTA 2RJGA 2Z7KA 1E4NA 1PZ2A 3HG4A 5F2IA 2XVGA 1CGXA 3E2RA 4HCDA 1DPMA 5DT7A 3OZPA 5REQA 2WOQA 2G97A 2BOFX 3MCMA 1E3ZA 2Y88A 3W75A 1TSIA 3LCWA 2VGFA 4WZHA 4GOAA 3APYA 4AD3A 2C1HA 1XIEA 4DVOA 1QJWA 1PKMA 5BCAA 3ARUA 1TB3A 2E77A 3KLLA 1XFCA 4GIAA 2ZZ1A 1XIHA 1SJDA 2GJRA 3T0AA 1XIGA 2Y7FA 3WY1A 2XIIA 2ZRVA 2C79A 4HA3A 1X96A 1YDOA 1F73A 5HJYA 4HMDA 3V1PA 1PZ1A 3DI0A 3WF4A 3FFSA 3W87A 2Z28A 4XZLX 2YW4A 1AW1A 3ZYZA 2ZRZA 2CBVA 2YB1A 2CCRA 1EP2A 3ARSA 2RUSA 3B9NA 2PDGA 4I6KA 3TXZA 4GACA 4WHBA 4PFMA 1R2SA 4QITA 1YPXA 1BYBA 2KZHA 3M6DA 1DV7A 4WCJA 6TIMA 4AIEA 5F4WA 2JGQA 1UKOA 1KR0A 4K38A 2PLCA 1MYRA 2OEJA 4IISA 4JN8A 1JRCA 4MY8A 1KR1A 3QC0A 1Z3NA 4XUYA 1O94A 1YRRA 4DM2A 2P50A 3HPZA 3ATYA 3DUGA 3M0LA 4JKMA 2Q8ZA 3A22A 2VRKA 1Z89A 3KRSA 1UKTA 1A3HA 2AL2A 4K7YA 1NELA 3EBVA 1O5RA 1QO5A 3CK5A 1VD6A 5D04C 2OX4A 3WYZA 3DC8A 1N2VA 2HPMA 3A47A 2PUZA 3AC0A 5EFDA 1I75A 2DW6A 4CNTA 7PTDA 3EWXA 2X7VA 4W5UA 1TZ7A 5LHFA 3TTQA 3NNTA 1ZGDA 1AW5A 1XRTA 1XH0A 3IEBA 4BEUA 5AC5A 3QZ6A 4X9YA 2PDCA 4G8TA 2A3EA 3WBWA 5F4XA 4GKLA 4JFTA 3APTA 3LPGA 4M51A 4JTLA 5BROA 2QCDB 4BJHA 5GNYA 2R24A 5ABTA 3ZOAA 2CNCA 4J3WA 2Z26A 4M6UA 3RNDA 1ISYA 5LIYX 2ZZ2A 3EDKA 4GYPC 3A3HA 4Z1BA 2VT0A 3EOEA 4F3HA 3EPOA 3BW2A 3OZYA 3WEMA 3C6CA 3W1MA 3RXZA 3Q37A 2H90A 3H7UA 1W1A1 4D9PA 5DF0A 3ITYA 1B0IA 3TQPA 1M53A 1KBJA 1NIUA 3EZ4A 3U6WA 2GGGA 3QMRA 4JIQA 4ILSA 3D46A 5JVLA 4I7UA 3SCWA 4BK9A 3Q2DA 3P5ZA 4HTYA 4WGXA 1JUBA 2PWEA 1F7BA 1SU5A 3KVKA 3OZMA 4A4AA 1J4EA 2CIPA 2CU0A 4V33A 7REQA 2QUUA 4GH1A 4LF1A 2DIKA 5EA9A 1KM5A 3E02A 4UMAA 3GS6A 4MADA 3THUA 1CECA 3GWQA 3C2OA 4EWJA 2OYMA 3UZXA 4I9MA 2PP0A 5DBTA 3ZXWA 5I78A 3P81A 4IT1A 1AJ0A 5IOBA 4RDVA 4ZFMA 2I56A 1OX4A 5CG7A 2Y89A 2IPJA 4R3UA 1RR2A 2NUWA 5K2ZA 1DQUA 1XCFA 1K4HA 4JHOA 3EOSA 3RU8X 2VRQA 3R6IA 2BVTA 1VYSX 1Q6GA 4PMQA 4R5EA 2PLMA 4LY4A 4PMNA 5JBEA 3I10A 4GHRA 1OIFA 3NJ3A 3THDA 3AZRA 3VZZA 1FXQA 3CAKA 3EA1A 3WLHA 2W4XA 1EPXA 1XIIA 4FI4A 1JFXA 4X0VA 2CZDA 3KRUA 2F6KA 4I9JA 2ZUWA 3OEXA 4QLKA 1QRQA 3KVLA 2QKFA 3INPA 1QPKA 1CCWB 4PMJA 2JKPA 1E40A 4F0RA 5CGQA 4RXFA 1QNVA 5FKYA 2P3EA 2ISFA 4UTKA 1CPUA 3CZLA 4QROA 3CV6A 1XWYA 4E4UA 3M5ZA 2TPSA 3AXIA 1HO1A 3VAVA 4H6RA 4Q4PA 3TLLA 1HXJA 3UG3A 3S1UA 3BLPX 4O4WA 2FLIA 2VEFA 3KBWA 2C1IA 3AHTA 5DRIA 3UZ5A 2BBFA 1JDEA 2QIWA 3V75A 1OFAA 2ZX6A 5CAKA 3LGEA 1L8PA 3KM8A 1Q85A 1XYZA 3FA4A 4JX5A 5H8UA 1RCOB 3MO4A 4F4RA 1XLCA 5AYIA 3L4WA 1DQXA 1V3IA 5HMFA 1EZ2A 3B9DA 1JZ8A 4C65A 2BHZA 4UMBA 1QXLA 2FTYA 3CXOA 4HTBA 3ARYA 1KTBA 1ITXA 4GABA 4EOUA 4JICA 1EDGA 5HMDA 5FCZA 4OBSA 3PBUA 2P88A 3N14A 2GDUA 1DJHA 2D69A 4H6QA 5GJNA 1PIFA 3E5BA 5BW6A 3NSNA 4ZL1A 3A23A 2XVKA 3TZFA 1VEPA 4AZCA 2PDHA 2PGWA 1IEIA 3HGSA 1DE6A 1MQQA 4AU0A 2PLKA 2ZKMX 4JAWA 3LCHA 4O57A 5MF5A 4GYKA 1FWDC 3TC7A 1MDRA 2GJNA 3MKCA 1DJGA 1ODUA 4HK6A 4YN5A 4IGMA 4K1GA 2J24A 4DAIA 1KCZA 2WZIA 5CLWA 3VDCA 1C8QA 2WYSA 2YLLA 3STEA 2R1LA 3SSZA 4OOZA 3VXGA 3WNLA 2P76A 1KKOA 3LBCA 3CZEA 3NQBA 2VZTA 4J3VA 1EEXA 2YCLB 4PUDA 2GDVA 2FZ8A 1W1ZA 2DW7A 3SCSA 1K9FA 1XGEA 2FHCA 3N34A 4XX6A 1TWIA 2EXOA 1DQWA 1MXGA 3VNZA 4O14A 3UWQA 1LUCA 3LV6A 4B5XA 2ZZ7A 3MDUA 1KRAC 4ACYA 4AEFA 4TTGA 4PCSA 4AFYA 3NYZA 4IMCA 3OG3A 4PSRA 4LCSA 1KXHA 3N3MA 4YPJA 4S23A 3DKJA 4ZVJA 3AHXA 2HRWA 5HNUA 5CSRA 1BG9A 4O18A 3GVWA 4KGJA 3GAYA 1JNEA 3USZA 3WH7A 4PBFA 3UG8A 4YLWA 4QSHA 4I9TA 4NAFB 2B81A 3WMBA 3VMPA 1J0KA 4L4PA 1W1YA 4M7TA 4ZTYA 3HG2A 4KRTA 4N42A 5K4XA 4UQDA 3LHYA 3WF2A 1KXTA 4ALDA 4QG9A 1ITUA 1TPEA 3EB2A 4ZZ9A 1JXKA 1YXDA 1LG1A 4WY0B 3GDBA 1H7RA 1TJ0A 3NEVA 1I0BA 3GZAA 3UY8A 4P7NA 2FKPA 1V3HA 3DGRA 2CBIA 1ZCCA 2J6XA 1U1HA 2INFA 1LBLA 3BOLA 1JAKA 5DN1A 3LRMA 1OC6A 3MBDA 5I3KA 2E5CA 4YNGA 1MO0A 4C7FA 1A0CA 1REQB 2PWHA 2PWUA 1TUFA 3LQLA 4XV0A 1A53A 2OO6A 1S2AA 3DBNA 3ITXA 2FZ9A 2HQAA 2X16A 1W9DM 4Q8UA 3UT0A 1P6CA 1E5JA 3GDMA 2PDWA 4DXXA 4XTIA 3S6OA 2D0HA 4BKNA 3TR9A 4RNJA 3GXTA 3V0TA 4PMRA 1TPDA 1E72M 3MMWA 3BG5A 2C13A 3C2FA 1NM9A 4FR6A 1BG4A 2F84A 3L2IA 4J3TA 1DIKA 1AMKA 1IIGA 3EDFA 3YPIA 4CLMA 4Q8VA 3EXRA 2YOCA 3O9NA 1B4KA 4OIFA 3C86A 1VHCA 1DIEA 1W1PA 4LVGA 3CUJA 5HNRA 3QF0A 3P93A 5HUPA 2OWCA 1PDZA 4NIRA 3CIVA 2WKLA 3MI6A 1XYAA 3K13A 1W9UA 3PBVA 3OVRA 4HPGA 1XM3A 5GVJA 2GOKA 2YFOA 3DFNA 4ASTA 1DJIA 1SJBA 4XISA 1E0WA 5CZTA 3NA8A 1QAPA 3VE7A 5HOSA 3M7WA 2J8FA 3CAWA 5U4NA 3QTPA 3FAXA 3U5UA 5LSMA 1UR4A 3QRHA 1CT5A 3E1F1 4XD3A 2FZMA 3M9YA 1V3KA 4CQBA 3TTEA 3EOUA 3U2OA 3CV2A 1XCXA 4F8XA 8TIMA 1OFQA 5D8ZA 5AYBA 1FHLA 1DWGM 1NF7A 5FJUA 2FMNA 1I8JA 1GJUA 5AY7A 1XIMA 4IFKB 3BAJA 3G1FA 3EDEA 4L56A 3NVTA 4B4FA 5K9XA 2P5NA 4GFIA 3Q65A 4PFHA 4EP8C 2CFFA 1TVLA 3T7VA 1HP5A 1YPIA 1C90A 1TTIA 1PWLA 5I3DA 1G7VA 2PBGA 3F5LA 3LNPA 1Y65A 4Y9AA 3ZJKA 4UTUA 4DELA 1DL3A 2PDKA 5E6YA 5TBOA 3ITOA 3K46A 3B8WA 1CEOA 4CEXC 1Q7MA 3L7RA 4EIVA 2GLKA 4DZAA 2EKCA 1S5TA 1TCMA 1GHSA 2C3ZA 4L1XA 4JHZA 4JCLA 5DXYA 1XYBA 2WVVA 4XG1A 1VIZA 5IBXC 4GYPA 3SECA 4DJFC 1TV7A 2FHBA 5IHRA 2PMQA 4XZBA 1MZHA 3KLKA 4E6MA 4KEUA 2YCEA 1EO7A 2PS2A 3GY1A 1ZHAA 2QUNA 2XIJA 3B97A 3EWDA 1GTHA 3OJGA 4DYKA 4OQVA 4J2MA 4PN2A 3OO2A 4H8VA 3N9RA 3AXXA 3UESA 1A47A 4BS0A 3CHVA 4JIEA 5CZJA 3TFXA 1FCVA 1A5KC 5C55A 5EYWA 4PUUA 3V16A 2O9OA 4CNOA 4F0KA 4MFEA 3VDAA 3WNKA 1S5WA 2CKRA 1US2A 3FJNA 1VZWA 4JNYA 3TAOA 3DZ1A 4AZ5A 4PSPA 1KA9F 2JFEX 2J27A 4S3CA 3PVFA 2H9AA 5M2FX 3C3NA 1XKYA 3UWUA 4LS2A 2J7BA 3RLVA 2UY2A 4NNBA 4EXQA 1KQYA 1F07A 1K77A 5C0QA 4ZQPA 1X6LA 1R86A 1H4PA 4CCDA 1RCQA 2CYGA 2VFEA 4GJJA 2GUBA 1IT8A 3CHDA 4ZSUA 3G0SA 1P0KA 4D71A 3QM3A 3LERA 4FSAA 4R7OA 4TX8A 4LAUA 1Q63A 3LLDA 3EXSA 5H91A 1LWJA 3EA3A 4LAMA 1LL7A 3THAA 4J5NA 1HJWA 4ZR8A 4DJDC 2DZVA 3R4IA 1BKHA 4KWSA 4HYWA 1Q6CA 4XD4A 1XLEA 2OZ0A 1VPXA 3EWUA 4HHHA 2WZMA 3MUZ1 4QJ1A 4DWSB 3BW3A 2IQDA 1FWEC 2V3EA 1AZ2A 3CQJA 2VWTA 2WANA 2GGEA 2RDTA 3TJ4A 3WD3A 5CBIA 4MF4A 3AU6A 3GC4A 5C9RA 3H7VA 4W86A 3DAQA 5JBDA 4JD4A 4XKYB 3VZXA 1R3SA 1Q6LA 4GGHA 4D6JA 3EEZA 4KIEA 4IIEA 3BJSA 2ZOXA 1IT7A 4UFKA 3QQ0A 1EP1A 3SSJA 3TC6A 3EX1A 3GLCA 3FHQA 1U1UA 3TN6A 1B30A 1P0DA 2NQ5A 3FYYA 3W70A 3KAOA 3KFTA 1ZB5A 4S3GA 4RE0A 4C6KA 2G50A 3FY1A 2PP1A 3PZNA 1G01A 3W7PA 1L6WA 4L1WA 2WB5A 3C52A 1V3MA 3HQ1A 5M5DA 4I6VA 3WDHA 4ATLA 5CSYA 2QCDA 2I14A 2EEXA 4HZ8A 1NOFA 1DJXA 5A5WA 1MEHA 2ACSA 2OSWA 4WKAA 3PJXA 3LUTA 5JUVA 5A6SA 1PHQA 1XG3A 2VCAA 4WJEA 1KCXA 1KQZA 1WYIA 3II1A 3VO0A 1ZZMA 3R2GA 1BTCA 1E4IA 4EPBC 5FACA 4EX4A 4ENLA 2DT3A 4W85A 2AQVA 2QCHA 3URQA 1P1MA 4GMEA 1Q6RA 3QVQA 4PB4A 1K1DA 1X6NA 3T2OA 4CCCA 1JVNA 3WN6A 1ECQA 1U2YA 4BWLA 1TTQA 4HNTA 2G96A 4LAKA 2AGTA 3I7RA 3M46A 1SMAA 4TXEA 1E15A 3L65A 1BXBA 4YTRA 2UY5A 3B0PA 5I3HA 2QCGA 2WM1A 2DVXA 3M44A 2AAMA 3T0TA 2YBUA 5LIUX 3IIOA 5J5RA 5BOEA 3ANYA 4XSMA 1P0NA 3PZMA 2ZADA 4PTVA 5EMMA 1T40A 5DT5A 3HA1A 1G9HA 4QRNA 1VYPX 2DP3A 3PG8A 4J27A 3PAOA 1XJBA 2QLYA 1M7PA 3B9AA 2PU1A 1S2WA 4LY8A 1VJZA 2XM1A 2UBPC 1OK6A 4B3ZA 5B7ZA 4UBPC 2Y8UA 2VXNA 4N9DA 3TEVA 4NAEA 3TK7A 2IKJA 3LTYA 3GFYA 2OZTA 1RALA 1VS1A 2AMXA 3O8AA 2ZUUA 3UYIA 3SCOA 1EC9A 2FZDA 3CQIA 4MHBA 4AD2A 2BMBA 1PWMA 4PYSA 1XQLA 4LBSA 4YVXA 2V68A 3O7UA 1PS9A 1WOBA 2AAAA 3ONCA 4KWUA 3LXCA 1DP0A 3NO1A 5H8PA 2WWDA 3KCLA 2E0PA 3MVTA 3EB3A 4PMVA 3W0KA 3GTNA 4EACA 3TVAA 1OF6A 4P8UA 5E09A 2OYLA 4LQ1A 3NDOA 1LT8A 3L2MA 2CWNA 4KMQA 1UPPA 3CMGA 4UCGA 3A12A 4MKSA 3LA4A 4UZUA 4IL2A 4R53A 4YTSA 1BXNA 2E40A 4LNYA 3SO7A 3ABZA 1M04A 1XSIA 1KM0A 3VMNA 3MPGA 5A1AA 3ZT6A 2W79A 3AO0A 1XUZA 4RZ4A 3LDVA 3ZSTA 4RE2A 3NR0A 2PRHA 2DH2A 3VOJA 4XO7A 1JD7A 3H21A 1FWWA 3R5EA 1QI0A 1KRCC 1LWIA 5FL0A 5IDIA 2AOSA 2ZBTA 1B1YA 1V6VA 1JUKA 1XKJA 1D8WA 1Z32X 3KRBA 3IS4A 3GUGA 2X30A 2Z1WA 4B16A 6ALDA 3N2OA 1M9HA 1ZBVA 3GIPA 3TYDA 4B4HA 4C1NA 2ACQA 3U3HA 4I5XA 4W8BA 1B9BA 1T41A 4U31A 5LA2A 2R8WA 5D4YA 1WDDA 1JYVA 5A2AA 2IXUA 1A5UA 4K8EA 3F4NA 1F05A 1V0NA 2C16A 3EXTA 3N9SA 5DLCA 4IP7A 2C1GA 2GSEA 3VD9A 2EPKX 1POJA 1H5VA 2D73A 3DI1A 1BYAA 3DFHA 4GI4A 2QV5A 3BOFA 4P8XA 2WJEA 3BZJA 1YTEA 1GT8A 3UNTA 4AWEA 1VJIA 2Z4GA 4W8AA 1GOIA 2NV1A 4HNCA 1JUEA 3CHEA 1Q66A 2ZX7A 3KBSA 1Z8AA 2YCLA 3WEOA 3VC5A 4JEQA 1LROA 2EPLX 4NZ4A 3QH2A 1QW7A 1GPWA 5C8BB 4YCPA 1I2PA 4OECA 2VR4A 2VC9A 2PDNA 3ORWA 3UG5A 4K6AA 4CU6A 4FB7A 1J8VA 4KQNA 3S47A 4YYCA 2W3ZA 4IICA 5HATA 3IGSA 1TREA 2ZA1A 1ZBWA 2ISSA 4P5UA 5A6BA 4X2RA 3CPUA 1TCDA 3FK4A 3F4WA 3N4FA 2QDHA 1GYNA 3ALGA 1OCBA 2WW5A 4NAFA 4O16A 1WDQA 3E38A 3OU8A 1XDMA 5T26A 1S39A 2X0HA 1MW0A 4LUYA 5CEWA 4QJ3B 5D2YA 2BY3A 1XX1A 3W00A 1YX1A 4WY0A 1ML1A 4K7VA 4AXNA 4OV4A 3N25A 2ZZ6A 4HCLA 2BLEA 3KCOA 4PTXA 5A8NA 3SCRA 2QEZA 2BTMA 5IBXA 3AIEA 3QQ1A 1LJYA 3D6NA 5CBJA 3FYPA 4TQTA 5TIMA 2PDLA 2CLOA 2YCIX 1REQA 1UG6A 2G3MA 4BQ5A 3ZJ7A 2WSYA 3TYAA 1NWRA 5AC7A 1F3WA 4HD5A 3ZS4A 4I9AA 2YL9A 3PUGA 3C0SA 3WG6A 4WLCA 3LMZA 3HQNA 4LANA 4PRRA 3OODA 3GZ3A 3VUSA 3TTOA 3GXMA 1EZWA 4TO8A 4QQ3A 4I7WA 3GIQA 5CGTA 1ZBCA 4S3EA 2VQTA 4GQQA 3SQLA 1YKWA 1CLKA 2PWVA 2X40A 2VFGA 1DJQA 3CS2A 2ZWZA 3NL3A 4NVTA 3TA6A 4B9YA 1TJ1A 2XH2A 4H9TA 3E12A 4PUJA 3WNMA 4KCTA 1G4SA 1EF2A 3BAKA 2A4AA 2GOUA 4EKJA 3KEHA 1NH6A 3KZPA 1V3JA 7A3HA 4AEEA 4TVDA 3L66A 2HE8A 2DSUA 3EPMA 3UY7A 3W02A 5CPQA 4XZNX 3A3WA 4PTWA 3BLKA 4H9XA 3UF9A 3G8EA 3IIPA 4AC1X 4N9BA 2NV2A 2YPIA 4QSFA 1DJZA 1XRVA 3WKZA 3ZFHA 2G5WA 4JIHA 3WUEA 1US3A 4E8DA 1XHGA 3VIGA 3TW6A 4V1YA 1FWBC 2EHHA 3WL0A 3E5PA 2VEPA 4O28A 4M1RA 3MZNA 1QNOA 5DY2A 4F40A 3HPFA 1OGSA 2GWNA 1QPNA 1GYLA 4WD0A 4D2JA 5EBUA 3ZMRA 1JDFA 1TIWA 4PL1A 3IJLA 1E6ZA 3ERPA 3H4WA 2PF8A 3CU2A 1VF8A 4DZHA 5I3GA 4ZO9A 2G3JA 1EH9A 3CQKA 1TV2A 2WBKA 2VVSA 1NFGA 1PYFA 1GNXA 3KE0A 4EE9A 4B15A 1OFOA 4X3ZA 3QXBA 5T91A 2REQB 1ICPA 2OYKA 2XM2A 3GR4A 1S2CA 2J75A 2E3ZA 4GD0A 2FGBA 3QZAA 1WZKA 3RJXA 3FXGA 3GYEA 2W62A 1ME9A 1P1XA 2W67A 2J9XA 3IJ8A 3LU2A 4PCFA 4UNLA 4LYPA 1JDAA 3FSTA 4OE7A 3UR7A 5C9XA 1Q2SA 1SQ7A 3HO8A 4PTNA 5CZ0A 4ZQNA 1LCOA 3Q58A 3QR3A 1H1NA 3CUIA 1C92A 4AZHA 2DH3A 1Q6DA 2BXYA 4YCOA 3R0DA 1QNRA 1W31A 4Q4RA 2ODOA 3TOPA 4UB9A 1UWUA 1HJVA 3VI2A 5HWMA 4ZOBA 4DBWA 3R58A 4AYGA 1UR2A 1MDLA 3CEUA 5M17A 3GQYA 3BDKA 1YW1A 4WSHA 3N19B 5HUOA 3I3EA 4UNKA 1OD8A 3NSXA 3GC2A 3NPWA 1QK0A 2D22A 3GNNA 1OIMA 3ZWTA 4W84A 2G37A 4H41A 5JIPA 1CYGA 1XI3A 3AWNA 3RCMA 1DBTA 1CBGA 1HIZA 5D8WA 2ZX9A 3MC5A 3WMCA 1KC7A 2WZEA 4C7GA 2B7OA 2V5CA 1TO3A 2EPMX 4NUWA 5T8GA 3ZQ9A 3W7OA 3JZUA 4MB1A 2SFPA 3UR5A 2OO0A 2PDIA 1E4LA 1TTPA 4QNEA 1QI4A 2FB2A 4WUIA 3ZR6A 3V36A 3UA3A 5DMNA 1L9WA 5FEZA 3DFSA 1QBBA 1DVJA 1XYMA 1QI5A 3VKBA 2GDQA 4Z0SA 3GSMA 4ZBCA 3T1GA 2OT0A 3VD3A 3RF9A 5BOFA 1KNWA 3AMCA 3S5SA 3BLLA 1IQ8A 3GR7A 1ONXA 1FUYA 4E2BA 5LXXA 3VYLA 3N6HA 4GKTA 5ABEA 4GCXA 3IAQA 4L4OA 3B8DA 4JL1A 3L4YA 2WMJA 3LRKA 5FEWA 3PNZA 4MB3A 3VD4A 3A4XA 2X1SA 3WJWA 4IIGA 4XKYA 4Q7BA 3RN6A 2J78A 1W8SA 2I5IA 4ZXLA 4CVWA 2R14A 1PKLA 2AQOA 1QVBA 3TC3A 3WENA 3AHYA 1SJAA 1VAHA 2A3AA 3OOQA 1PX4A 4Y9NA 1F6KA 4E2DA 1N55A 4GBDA 3VIIA 1WA3A 1CX9A 3GR8A 5PTDA 6XIAA 1CGUA 3MI2A 4ATWA 2IQTA 2CHRA 4XIAA 3M41A 3O0KA 4GXPA 3N3TA 4FX7A 3EOLA 1SW3A 2CLKA 3G1YA 4PC8A 5LNUA 1EQCA 3BLIA 3MCOA 4IMFA 4O0KA 2OXNA 1UD5A 2IKIA 1UA7A 2Y61A 1BWVA 3W24A 1WZLA 1IE7C 2ABBA 5JIWA 5HNNA 3A6OA 2V5JA 4IMAA 2WNQA 1TE6A 3EWWA 5KINA 2WNZA 1YNYA 4B2DD 2GJXA 3JW7A 5JQ9A 1OCJA 1E6XM 4GI9A 5I02A 3A3XA 4GC3A 3O16A 3ITLA 4PTMA 1FTXA 3SQMA 4Z2JA 3W73A 3RCYA 3SM0A 1Y7VA 3JR2A 1A5LC 1FH9A 4GUFA 5AHEA 1WKYA 1I2QA 1VLWA 5H8MA 4QG6A 3V5FA 1R3RA 1SFSA 4GQ0A 2GQ9A 4Y8EA 1ZENA 4C6IA 3VGDA 3UFYA 2DZSA 1R2RA 4O52A 1E0XA 2VFDA 2ZZ3A 2JGYA 1JPIA 4H6KA 4HSNA 4Y2WA 3GUWA 1T8XA 2OOGA 4A05A 4N0RA 3WQFA 4PCNA 1J9YA 4DYEA 2G3NA 4U4MA 2PE4A 1S1PA 2JIWA 1S5MA 1W3LA 4HNUA 3GH5A 2PDPA 3V1HA 4E3TA 3NVDA 4GVHA 3W29A 1PL9A 1ZPTA 4L61A 4MWAC 3RLHA 1RA5A 2WV8A 5AHIA 3I7SA 3LLXA 2ISWA 4MNKA 2D1ZA 4G9PA 3TONA 1XD0A 4KETA 3MA8A 1EUAA 3QLDA 4A2RA 1YTKA 4BA0A 7TIMA 4H8NA 3MSGA 4KEMA 3PZVA 4U5IA 4GUHA 4F2UA 5AYZA 3FGCB 2WJFA 4NZFA 1A5SA 1FCQA 4L6HA 3E0WA 5D2XA 4K37A 5M1TA 1EP3A 1CIUA 1JQVA 1PX8A 3GD6A 5CPMA 1IXPA 3DFYA 4NXKA 4S2BA 4BHYA 2VUYA 4I90A 4HKPA 4J3ZA 2ABAA 4ZO7A 4E3VA 1TVPA 4O8AA 3K5XA 3RLGA 3WQEA 1XF0A 4HSHA 3E0FA 4GVFA 5A8MA 3TUUA 5BRPA 2OU4A 1RD6A 2GK1A 4LB3A 4CQDA 7XIMA 5FJJA 3OBKA 1FWAC 1Q13A 1LBFA 2EG7A 4M0XA 1SO4A 3NTYA 4BI5A 1SO6A 2E9BA 3IV3A 1CXIA 2C0HA 2XH0A 1F8MA 1QHZA 4HIBA 1WXJA 3MWAA 3VOFA 4S3BA 3WFAA 3ID7A 4BI6A 4GI6A 4PUWA 4B5VA 5KITA 3B4YA 1NWUA 2J47A 1CXEA 4LALA 3FSUA 3MW7A 4IGHA 5FJOA 3UZJA 4CQAA 4FXRA 3SUUA 3FEQA 3VILA 2P53A 2ESCA 4P7LA 3E0VA 3B0VC 3N18A 4IFOA 2D0GA 2DT1A 3C0QA 3FVDA 4H8UA 1HG3A 1FWGC 4FHAA 4WRHA 4FR1A 2XFRA 4JEJA 4LBUA 2GWGA 3K4DA 3DECA 1N8IA 2O9RA 1V4YA 2IXVA 4DWSD 4JIPA 5DFAA 4MWAE 4DPQA 1H1YA 1KBBA 4AZ7A 4UTWC 2WJZA 5HXMA 1LZOA 2YL6A 3REQB 2GQ3A 3C0JA 2OWXA 4OU1A 3LS9A 3E74A 1W1IE 3CUGA 3FYOA 3AS2A 3M43A 3C8NA 1J6PA 4UTHA 1YPFA 5I09A 3MSDA 4CD4A 3QV9A 4S2CA 1TA3B 3QV7A 3TW7A 3AS0A 3W1AA 1O66A 3PB2A 3NQ6A 3BWWA 2E6DA 1T8QA 1JCLA 2H8XA 3QY6A 1I2NA 1LM1A 1ENUA 1HUVA 1SZNA 3F4VA 3ES8A 4FEZA 1WV2A 2QGYA 4URIA 4ORIA 2FJUB 2OQYA 4Q4QA 3IK2A 3T44A 4QX4A 5DANA 4P61A 1F3EA 1FY6A 4F0SA 3M7SA 5EGRA 1W56A 3CO8A 1M03A 4XBKA 3GTXA 3KTXA 3VZYA 1NP0A 4YTTA 1XISA 3WK3A 5A2CA 3LCFA 4ZSTA 1S5NA 3CIWA 1YMYA 3M0JA 3UGRA 1TPFA 3WNNA 1OT1A 4Q7IA 4OUIA 3S1GA 3ARQA 4WJ8A 4IUOA 3AS3A 2CESA 1SW7A 4IJCA 2V38A 3NPVA 3ECQA 1HL9A 3BAYA 3W6YA 2XSXA 3FEMA 1HKIA 4GUGA 3IJ6A 2PRMA 2VDGA 2NWSA 3N9KA 3RO8A 3E3HA 3N13A 4KGLA 1WBHA 1S3TC 4M6PA 2QCCA 4MKVA 4AQLA 2HNEA 5I23A 1BVWA 2L5HA 4U3CA 4U2ZA 3OB8A 1GONA 1MFVA 3B9EA 4J9JA 3GRIA 2FZNA 1WP6A 2VDIA 5AYXA 4UQCA 2CHNA 3XINA 4KCVA 4HU8A 1VB9A 4HN4A 2EG6A 4L6OA 3LXBA 2VELA 4QE1A 4PCPA 3DERA 4PRWA 5IDZA 3VNJA 1UP3A 2BWGA 4IHCA 1VPYA 3W1NA 2Z6IA 1B3OA 3S5NA 2EQDA 4IP5A 4MZYA 3O6AA 4A6GA 1HKVA 4UTLA 3LM3A 3AUOA 4HVXA 2I57A 4D8ZA 3AYTA 1AH0A 3MYPA 1DHKA 1V77A 3PANA 3OLGA 2WMHA 3NQFA 3PBWA 2IS7A 3MU7A 5HR6A 3LBMA 3CZJA 2TYSA 2XINA 2BODX 2CBJA 3L0GA 5HPOA 1EJRC 4ZOEA 1GOXA 3QYQA 5HDRA 4RZ5A 5MHBA 3GVGA 2A85A 5A95A 4IG2B 3VD5A 1LF1A 4LV4A 1ZRQA 4NT0A 3M0KA 2Z29A 3ICJA 1E73M 3N15A 4K8HA 2DQWA 5EU9A 3P5YA 4YS1A 1W54A 3WCZA 5E70A 4B5TA 5FD0A 5D37A 5FF4A 3GNPA 2VZSA 4L4MA 3G2GA 4B3LA 1J5SA 1CW2A 3NGJA 1TMLA 1A3WA 5DO8A 1S3HA 1RJQA 2YJQA 2Y24A 3IIXA 3IV8A 4ZO6A 2YXXA 2J74A 3SUSA 2QJJA 2NSXA 2NVDA 4FAMA 2CPUA 2C18A 5EY5A 4RE3A 4A3YA 3IRDA 3WLIA 5AVNA 3IWPA 5A6MA 1O68A 3HGRA 3WLJA 4GINA 1NARA 1H11A 1IWPA 4RPQA 2EBNA 3VE9A 5C6MA 1TYGA 2JKEA 3GFZA 4DO4A 2TMDA 1GOKA 4NY2A 2WBGA 1J2WA 5LIWX 4LC6A 1Q65A 3I6EA 4M56A 2Y8VA 1NEYA 4ZENA 4DF2A 3WH9A 4LU0A 5A69A 1ADOA 5GPRA 3VIKA 1BLIA 1AG1O 2Y85A 1AD1A 3NM3A 6ENLA 3MB9A 1BWLA 3HB9A 4AF0B 1G4PA 4GXWA 3H54A 2GUUA 2WQDA 2YCKX 4QEHA 3CJPA 3PJTA 3LHWA 5E1QA 4JBRA 1OYAA 3B0YA 3T08A 3CL8A 3STFA 3MSYA 2YDSA 3R94A 3E96A 3VDHA 2WCGA 2D2JA 3LYEA 4DUWA 1F61A 1B3WA 1DORA 2O4QA 4S3KA 4MDOA 2Y1HA 1ZP4A 2ISDA 3CIXA 2BASA 3L4TA 3OA5A 3MUCA 2EJAA 2ZFAA 4CD7A 5CAHA 5ABHA 4CCEA 3MKVA 2PTWA 1H1ZA 1Q6OA 2EAWA 1KFWA 2PTXA 1XC4A 3DYPA 5DMYA 2E6AA 3IJ7A 4L9YA 1H50A 4CEUC 3ZT5A 1K6AA 1XH1A 3PBMA 1H49A 4E2OA 1XRFA 2RAGA 4YTUA 5B7YA 4LEQA 1H7OA 5CPSA 1X1ZA 3CMJA 1E3XA 1P5BA 4PB5A 1XPGA 1X1OA 1GEQA 3RM9A 5D2TA 3V3WA 5D05A 4MUZA 3V35A 1BEUA 1TVNA 4W5ZA 1CDGA 3RG6A 2E7FA 3LI0A 3FVMA 4NYYA 4PGLA 5LYRA 1U22A 3OHMB 1JI1A 1FWJC 1HKJA 1QNSA 1P7TB 4FPSA 4G2DA 1P6WA 3RM8A 2PTZA 2W92A 4PODA 3W9ZA 5I0DA 2PI6A 3WLOA 3GXNA 4MWAA 4LCRA 3LX9A 1OX5A 4HN8A 2ATMA 3MMUA 3IPWA 1QO2A 4UFIA 4FS9A 1NDVA 1BD0A 1A5MC 2A6LA 4ORMA 4HSOA 3PTKA 1ZCOA 2XVNA 3MZ2A 4U28A 3F2CA 4JTIA 1VR6A 1GZJA 2ICSA 3QPEA 4EXAA 1HGWA 3ZVHB 4Z2KA 1NDWA 4Q22A 4QE4A 3PULA 2CC0A 1QWGA 2W91A 3VVGA 1HNYA 2GFTA 2VJXA 1F9CA 4RW5A 2VDHA 5D30A 4JN6A 1H51A 3PWGA 5H1WA 4XUGA 4S3FA 4WEVX 1WUEA 2BGSA 4OWGA 1Y8BA 3UVAA 1MZRA 3OA3A 3O2LA 2IPWA 2GVGA 1A49A 3WQPA 1VEOA 1OF8A 1W3JA 2RGLA 3MYOA 4KEZA 1XCWA 1BPLB 2QQ6A 3HURA 4I7VA 4JR5A 4A8NA 4HMEA 2DSZA 3KOZA 3NQGA 4NNAA 1BRLB 3NQVA 3OP2A 2QAFA 4NX0A 3I7QA 4PBEA 6A3HA 2JF7A 5G2IA 3U7BA 2RJHA 1SJCA 1Z7AA 3QGKC 2OODA 1RD5A 1M41A 3UCCA 1PSCA 4ES4A 5CC5A 2HVNA 2OSYA 3BGGA 1FKWA 4HA1A 4GX8A 1LOLA 2QAPA 4LT9A 1RBLA 1C7TA 4JTKA 4YXGA 3H53A 1XPYA 1HF6A 3LV5A 2AQWA 1PPIA 1A3XA 3AJ7A 4UTFA 4Z2LA 3LZ5A 1JJKA 3LOTA 3SADA 4DX3A 1R2TA 4IMGA 1OFPA 3VCNA 5E93A 1JZ5A 4G5DA 4W7WA 2P0IA 3GG0A 4UTWA 2DSVA 2C14A 4DI8A 3IJQA 2QF8A 5AYYA 1OEPA 3ZM8A 3K1GA 3LGGA 1VCGA 3W71A 1V79A 1JGMA 3D3AA 2QHAA 3PZ9A 1J96A 4AIUA 4H9ZA 2P8BA 1JQXA 3MUIA 4D8LA 1YBQB 2Y5SA 5BNKA 1JZ7A 2NQHA 2EF9A 1TWDA 4GLEA 1UWRA 3QGVA 1FCBA 3AAMA 3IUDA 3UQNA 4O54A 5AHLA 2YDQA 1K6WA 1E9ZB 3WLNA 3FOKA 2A7PA 4JTUA 4JTSA 4FMVA 3CWHA 2YCJA 3MS8A 3TYBA 3CUXA 4XAPA 3NAVA 1TTJA 3L9CA 4H9UA 2E8YA 3GNRA 2HCVA 2WVTA 4FZIA 4QCFA 1IWAA 1W17A 2BVWA 4IH3A 4MIMA 3M0ZA 1K8YA 3UXDA 2WWCA 2VFIA 1R9ZA 4FF7A 2O0TA 5HJXA 5TF0A 1QW9A 1E70M 2DV0A 4Z2IA 3SY5A 3JVAA 4GVGA 3KOFA 4WK9A 1TPC1 3C4UA 5RUBA 3HOJA 4N9EA 3A4AA 4XZMX 4CQCA 2HJPA 1O1HA 1EGMA 3SCUA 3CM4A 1TX2A 3UPWA 2DZTA 3CL7A 4QBXA 3V0UA 1KLZA 4R85A 1A4LA 5CJMA 2GGHA 5KMYA 1IT0A 3GG8A 4C1KA 4Q32A 3XISA 2A2IA 3I6RA 3GDLA 1UKPA 3SEPA 1XLHA 3IACA 1YE6A 4N02A 3LPFA 3OIHA 2VGIA 5AHNA 2QULA 1XXXA 2FZBA 2F8QA 1XYFA 4DLMA 3PP7A 3TV8A 4UFMA 2X41A 2WHJA 3BAXA 1EJUC 2Z24A 2YB4A 3S3GA 4Q6JA 4Q8NA 4ROQA 1FWSA 2ZXQA 4KBXA 1GG0A 3MDWA 2E8ZA 4LVAA 5T9CE 3ABRA 4HHPA 4JHMA 1U5VA 1H62A 1UP2A 1CB7B 4FIRA 3R7MA 1AJZA 4GG9A 3M0IA 4K8GA 2PGFA 4J7RA 2DUZA 2FTPA 3W01A 1QI2A 3TWBA 1VBGA 4ERIA 3WJSA 3G8RA 4AIBA 4IJBA 4C90A 2XVPA 1TX0A 2J88A 4Q8OA 3SAZA 4FLQA 2OG9A 3GTFA 2POTA 1DXFA 2JEQA 3RK8A 4M6QA 1GGOA 3G1AA 3LENA 5CJ5A 4NJIA 3REQA 1Z48A 4AB4A 4LC8A 3U7VA 2CZFA 2VL4A 2XIMA 3CYVA 2CW6A 2YYTA 2GVEA 1E6NA 4DF1A 4HNLA 4DUOA 1C7SA 3UWWA 1TA3A 4GA8A 1XIBA 3U0HA 4N4PA 4H4IA 3WLLA 1UOKA 3C56A 1K9DA 1EHNA 2BXVA 3H26A 1H0GA 3POCA 2V30A 2G4JA 1FXPA 1RP9A 1LQ0A 1SMDA 2RDUA 2ZVRA 5D09A 2J62A 2A3CA 4Z08A 3RLUA 3GM8A 4NYUA 2OEKA 5G2HA 1RAKA 3GBEA 3W7JA 2WHLA 3VKKA 1MUMA 3DDMA 1U33A 1C93A 4M7SA 3N2BA 1MUWA 3D0CA 2DVUA 3KL3A 3TWAA 2G0WA 4G7EA 3OQEA 4ZQMA 3IJDA 2O7SA 1HKWA 1OFRA 2BFGA 4R7JA 4IQJA 1W37A 3W3OA 4Z1CA 3Q67A 5A8PA 1OBAA 2F6XA 3KW3A 4M3PA 2CBUA 3GTHA 4LOCA 1H5YA 3PFRA 3UCDA 3UJRA 2UZ9A 4LW7A 3QMTA 1R3YA 4FOUA 5CZKA 3HGJA 4OJYA 3SY1A 4D1IA 4FXJA 2BNJA 4IGNA 5JH1A 1RJPA 4NZJA 3OVPA 3B8TA 4RNFA 4OUEA 4QLLA 2DFAA 4FNPA 4AVFA 4POCA 3IIVA 1RBAA 2C6QA 4MDPA 1L6YA 1E4MM 3AXKA 3LTSA 5IXEA 3DKLA 3LPOA 1SYTA 2VP8A 5U7SA 3GXDA 1DJWA 2VUNA 5HWJA 1HN1A 2F9RA 2OFJA 2YX0A 4M1BA 1WX0A 1T96A 2X0YA 3GH7A 3W23A 1Q6QA 3R12A 3BLDA 3QMSA 2PA6A 2PTDA 5F2MA 5FI8A 3HTWA 2PWFA 3ARXA 5D9PA 3MMDA 2QS8A 2ZUMA 2YL8A 1TWSA 5HBFA 1WNOA 1FOBA 4BEQA 5LGXA 2QMKA 3WBXA 3WBYA 1KM2A 3L4UA 1QW8A 1JCNA 1WCGA 2WK2A 3ONBA 4LB4A 1AUSL 3SN0A 2QDEA 1Q45A 1VYRA 1OB0A 3BQ5A 2QJMA 2VM8A 3IIZA 1R38A 3VIOA 1FHUA 1YHTA 4F0HA 6CGTA 3L5AA 4L64A 4INFA 1EC8A 3DEQA 3DOPA 4IG2A 5D33A 4OT7A 2WZTA 1EGZA 4AD1A 1WAUA 4BFAA 3RX2A 3QJAA 4QCEA 1G94A 3VFCA 2VURA 1EFZA 5HJLA 2D2GA 4PMOA 5ABFB 2ZIDA 4ZGYA 2WZHA 1AD4A 3CUFA 3HG5A 2HTMA 4LXFA 1Q7ZA 2QJHA 3MANA 2NVCA 2VX4A 4OV9A 5AVHA 3VPLA 3NOEA 3I3BA 4V15A 1RY8A 1GG1A 4ICNA 1NFBA 2Q09A 2V69A 3WMSA 5A94A 4GPNA 3AALA 4ICMA 2Y70A 1RUSA 1UR8A 2NUXA 4AG0A 2J7FA 4EANA 3NSMA 4HNVA 1O12A 3QY7A 4UMCA 1OFEA 5ECUA 3WK1A 1R5YA 1W32A 3KP0A 4MAVA 3DBPA 3VCCA 2FGZA 2NZLA 3W7EA 5BMXA 3RU6A 4MYXA 2VEIA 2EKGA 3C2VA 3W82A 1EL3A 1SSGA 2EO7A 4MAZA 2I1OA 2WHMA 2YZRA 3WDRA 1RP8A 1IEXA 1NDZA 3FJLA 2WMIB 3SCTA 6REQA 2CETA 3F5JA 1ZQ5A 1TIMA 2ZRXA 4E8GA 3T0DA 4PEKA 2FPVA 4KRUA 1G7UA 3W7KA 1UD6A 1H3GA 4Y9MA 2XN1A 3K30A 3W2NA 3W81A 4AF0A 5LNVA 1EB3A 2IUZA 2B7PA 3PHAA 2E09A 4L9ZA 4MNJA 4LUTB 4A21A 4PEEA 5I3FA 2GJLA 3P84A 5FEPA 4DBDA 3CWNA 2Z1XA 2CLIA 3R79A 3M47A 4RZ6A 3CL6A 3CV1A 2IPFA 4AZ6A 1OG6A 3VINA 4DUXA 1ZUAX 3NQ2A 1ZL1A 3MJYA 4JQAA 2DUXA 1PUDA 3BH4A 4PUKA 1AH3A 3EMQA 2A0NA 3QOMA 2QMJA 5C5YA 2CEQA 4GISA 2ZZ4A 3SY8A 4JQ3A 5FIPA 2P0OA 2DZPA 4LFYA 2Z6JA 2CXGA 2ON3A 3KTCA 1FCUA 1BQGA 1W3KA 4BF9A 4GC4A 5EMJA 4CN1A 2DGAA 3A21A 4O0ZA 2GGIA 4JXCA 3T9PA 4W7VA 4QJ4B 7TAAA 4WQ6A 5BXSA 1YADA 3U48A 3VNIA 2W66A 1VFUA 2AKMA 4Q8PA 4NNCA 4FX8A 1VBUA 4JYFA 1GORA 3K4WA 4GGBA 1P7TA 1W9XA 1P4CA 5CPLA 2BHYA 3WF0A 4EAYA 3QPZA 4IX0A 2QF7A 3T07A 1S1RA 4RX0A 3MUXA 3B06A 2NXHA 2QUVA 3N17A 4LAOA 1V03A 4TTUA 1KGXA 3BTNA 1DXIA 4QG8A 1TQXA 1J0HA 4MB4A 2G41A 1XD1A 1A5AA 4XWUA 3UWVA 4DNHA 3LCXA 4X9SA 1KWGA 1K7EA 2OR2A 4YIWA 2OLHA 3NURA 3AIWA 4XAFA 1OHLA 1NFPA 4UOJA 3ZVHA 1Z41A 1UD3A 3GYCA 3OLIA 2HSAA 1UR1A 4ZFCA 4MJZA 2HMCA 1EBGA 3CZGA 3GBDA 5LIXX 4UUIA 2BHUA 3H12A 4IPJA 3GVVA 2Z1BA 2OPJA 3QHOA 4G1NA 1X98A 3STPA 3WDQA 2XISA 3UETA 3U2CA 3KP1A 1HJXA 2CLHA 3CV7A 3TFCA 5AZ0A 1JCMP 3F03K 3N1AA 3G1DA 2Y6ZA 4NZ3A 4BWLC 3TE9A 3C5QA 2RH9A 4LYQA 1KWKA 1GJPA 1WXZA 1HKKA 3FDKA 3G1HA 1NU5A 2X7WA 2RKXA 4Q4KA 2X2YA 2G4FA 4UR9A 1G67A 2Y7EA 1B9ZA 1IXQA 3UP8A 1Q5MA 5CC6A 2O7QA 3SGUA 1ZJBA 5AC6A 2ZVIA 3NM1A 3QV6A 3W7CA 4LS1A 3CHFA 4EF9A 1FWHC 3QZEA 4Y7EA 3C2RA 1BRLA 4LBRA 4YL2A 1FA2A 2BV9A 3TX9A 1UBPC 1PCKA 7ENLA 1KFJA 2QCNA 3WQOA 3PWIA 1W3HA 1DEDA 2XIOA 1YYAA 1IZCA 2VX5A 1EWEA 3MBFA 3BANA 2VC6A 4JKLA 1F5ZA 3BLEA 1AQMA 1F6PA 2CLLA 2PGEA 2QCFA 3F5KA 4MJ2A 3VGEA 3WJZA 1E6SM 1GQJA 5I03A 1DHPA 4W8LA 1U83A 4UQAA 4F2TA 2BVDA 4RDZA 5HINA 5HPCA 2QV4A 3EX4A 5HR7A 3KS6A 4HU3A 3W4RA 2HXTA 1QCWA 3W85A 1PCWA 4J40A 2VI0A 3F1QA 3VC6A 2XGZA 2X09A 2Z1KA 4LYKA 3PZQA 2CZ5A 4RZBA 3W7DA 4R34A 4HZ6A 1KGUA 5HMSA 1KM6A 3GAKA 1L6SA 3A5FA 1YBQA 3BAIA 2X1RA 1SZEA 1PAMA 3S2NA 1B57A 4Q3MA 1VKFA 5IFPA 1EKOA 2BXZA 3T2QA 3JRKA 4AISA 1I2OA 2DUAA 3RMEA 3T0BA 7REQB 2I16A 3S2JA 1V08A 3B8IA 3RX4A 1C29A 3MHFA 3M1ZA 4GIYA 1R9XA 3L2LA 3UEQA 4JQ1A 4ERAA 3OLEA 5EBAA 2KX9A 5LZLA 1ZJAA 4GZJA 5C7HA 3TROA 2V3GA 3G5EA 2XGBA 1EJVC 5KTLA 1ODZA 1UYQA 1V02A 2XSBA 4A22A 4D6FA 1OX4B 1OCQA 4AD0A 4DI9A 3AU2A 2YXOA 3LN3A 3BPWA 3GC5A 4IZGA 1ZP3A 2QDDA 3N4AA 3KDNA 3T2PA 1F4HA 4EPDC 2XFYA 1TV3A 4ADSA 4Z2HA 3W7MA 4GQRA 1GQKA 2DIEA 3G18A 5I77A 1JZ6A 1K9TA 1OC5A 3VMOA 2QZRA 2QW5A 5I79A 1R87A 1MW2A 3UWZA 1OT2A 3EYPA 4MJ4A 2QCLA 3MVIA 1TV4A 2NLIA 3PFMA 1UQZA 1M01A 3WLTA 3O0FA 2C91A 4FNQA 3ZO9A 1V7AA 2JBMA 5TD4A 1J6OA 1H7WA 2Z2UA 2DJXA 3WD4A 1QU4A 3W7GA 4L1GA 1Y5VA 4XBSA 2ZA2A 2O9PA 2I9UA 4AW7A 3UU0A 5CPOA 2V5LA 4NX5A 3QEZA 2NT1A 4DO7A 1I45A 1U5JA 4KIRA 3LHTA 2BB0A 3RO6A 3QR0A 2PD5A 1E0VA 3R0UA 3EOOA 3A64A 3O6DA 4M6VA 3B8SA 3NDYA 3R8GA 2ZX8A 3A4WA 1W1B1 2AGKA 3QC3A 1JNDA 4PUEA 3KVJA 4O19A 4CQ8A 1OYCA 2D24A 1EEPA 2OWWA 2XN2A 3H7RA 2QVNA 1R30A 3OIXA 5FEXA 3U2ZA 3F7JA 1QBAA 5F1UA 1P0EA 2DDXA 5HULA 1SFLA 3RR1A 3S9ZA 3NPXA 1KFEA 1Y0EA 2W27A 4DNMA 5DX7A 3DHFA 3WD2A 3QHNA 3UR8A 2YYUA 2NX3A 1THFD 4CGTA 3OGVA 2FGLA 5DCBA 1HVXA 1X39A 4AZCB 4MG4A 1WDSA 3KTSA 3CNYA 4HHLA 4JTCA 3W1RA 3K1DA 1Z69A 4QE5A 3ES7A 3SURA 4AEOA 2J4GA 3W83A 5E6ZA 2PC4A 2VENA 3W7IA 2QIIA 2QR6A 2VQUA 1OJXA 1TJPA 4LS0A 4MSSA 1ZJIA 3BAWA 3KOXA 4QXIA 4AD4A 1Y5WA 1RK6A 2W61A 1E6PA 2VR5A 4NI8A 3JUGA 1V3LA 2VMFA 4LTSA 2I7GA 1V6WA 4AD5A 1RK5A 5D32A 2IMRA 3CLMA 1VFLA 5F2GA 4XD5A 1S5VA 3USBA 3AFBA 2DORA 4NZ1A 1QPOA 1A5CA 1V6YA 1LUCB 1KFKA 2XG9A 1G69A 5EMLA 3DENA 4UTIA 4WXZA 4AY8A 2XH7A 1W1VA 5KZ6A 1IWBA 3TNBA 2GSHA 3DESA 1NQKA 1O1ZA 2HBVA 4BQ2A 1HX0A 3W2JA 5G1MA 2XTKA 1XIFA 3S9YA 4GE8A 3VIMA 3QY8A 4HQVA 3ATZA 1VBJA 5F1VA 5I06A 1V6UA 2VWSA 4ZMGA 4NRRA 2ZDSA 1EPVA 3QHMA 3NQ7A 1BTMA 5EFFA 4QJ5B 4DN1A 3CO4A 4CCZA 4J1OA 5FAGA 4D72A 1MEWA 1VPQA 1OADA 2R6OA 3R8HA 3BXWA 3UBPC 5C71A 2PFHA 5G1TA 3COTA 3FV9A 3TMLA 2ASHA 3P6LA 4Q4MA 2Z27A 1JPDX 5A3HA 4EXBA 1M68A 2DT2A 4MY1A 3CAVA 2Z00A 2CITA 3OBEA 2PODA 3PB0A 4HPXA 1UPMB 4B9ZA 1QASA 5D2VA 3ARTA 1AMYA 1QNPA 1J12A 3WBAA 1O5KA 1W5QA 4C5ZA 4DJEA 3G24A 4GJ1A 4QP0A 2Y0FA 3ITGA 1AW2A 4IQLA 4JL2A 1JPKA 4WGHA 1C8VA 3S6DA 3W84A 2NW0A 4KH2A 4PL2A 2WSKA 4E38A 4FF5A 1NDYA 4LRSA 3MI3A 1FH8A 4US5D 3L4ZA 3WQ5A 4ICCX 1E0UA 1W1TA 4GFSA 1TZZA 1W9PA 1Q7QA 4DXVA 2VTFA 1XLDA 2ZDRA 3E2SA 2ZRWA 2XUCA 3VTRA 4HK5A 5I2UA 2CZVA 1KKRA 3M07A 1NOWA 4E5TA 3P8JA 4ACZB 3LNMA 3NQEA 5ABFA 2FHFA 4FALA 3VGBA 3THQA 3CQ0A 1MSSA 5HWNA 4XKMA 1C91A 3W22A 4TMBA 3BMWA 1LQAA 3PR2A 1HO4A 4L6DA 1PB0A 2DSKA 3SIMA 1XLGA 4IIHA 2ZUVA 3KHJA 2DVTA 3LB0A 1XFBA 4S3DA 4WKHA 4J2PA 4YMZA 2TAAA 1FKXA 4Z1YA 3IGHX 3T09A 4IXXA 2HE5A 4RV8A 1F3XA 3EAUA 1DIOA 1G1YA 2VKZG 4PMUA 1ZTVA 1TWWA 2FIQA 2OQLA 5F4SA 3VX0A 3R89A 3WD0A 1XQKA 2UY4A 4R27A 4EF8A 4DBSA 1LL4A 1SZRA 4UQEA 1A80A 1O95A 4P7OA 3W53A 3WLSA 3GW0A 3QYSA 4N2YA 5BXTA 1GVEA 2WCAA 1BAGA 4IFRA 3ZSSA 3VK5A 1GJWA 3NWRA 1OWQA 1W5NA 2GGJA 3URNA 1NWSA 1XIJA 2WCSA 1EJWC 3H2FA 3O05A 1JGIA 2DQXA 3OTRA 2TRSA 3T8LA 2JF6A 2R9RA 2HROA 1AQHA 1JZ2A 1TV8A 4MJMA 3ITVA 4UIOA 2GYIA 4XZWA 3GKFA 4AWUA 1IEQA 4JOMA 4PUNA 2X1UA 3T8QA 5I6SA 4B5SA 4BR1A 5KZEA 1NTHA 3FLUA 4PH6A 3BCFA 4KWVA 5AKQA 4JFVA 1CB2A 1Z6KA 3W72A 1NWTA 3OVGA 3H24A 1PEZA 3OW1A 3VOCA 4AYSA 4TV5A 1OK4A 3ELFA 2X1IA 2NX9A 2X1TA 1UASA 3ABSA 1XLAA 1JF5A 2O55A 4X22A 4XAYA 3RUBL 1FWNA 3GU2A 1EA9C 1Y5XA 3S46A 3VNLA 2RHGA 3CB3A 1W5OA 4DWSC 4C6DA 1JDDA 3DG7A 4HK7A 1YXCA 2BGQA 1D2KA 4BY3A 4JTDA 3R10A 3LBOA 3W2MA 4QDWA 3DFQA 1A50A 3HPXA 3TQKA 4GX9A 4UFHA 4AX7A 5BU6A 3TXVA 5M03A 3WEZA 3TCEA 2EPNA 3DG3A 4D6GA 1CXKA 1LDCA 1XLLA 1PJ9A 1AH4A 1QHPA 1IXOA 4XVDA 1YNPA 1M3UA 3GDTA 1HP4A 4GYJA 2Z0IA 5LNRA 4JN7A 3DYMA 1DWHM 2VD9A 1V8EA 3D3FA 3GXIA 4W87A 4NG3A 4V1XA 1TZ9A 3W25A 4K3ZA 5K9DA 1E56A 2X42A 2E9LA 1KFLA 1LYXA 4IXHA 3AIRA 3GDRA 1PTDA 3AIVA 1KCKA 2H9AB 4AMCA 1V7YA 4JFWA 3W76A 1VFTA 1POKA 4H83A 1UROA 1S2UA 5AB3A 1XYCA 4GBUA 2BX7A 3W6MA 1QMLA 4Y8FA 4HU0A 3SCNA 3LRLA 3TAKA 5FSEC 1KBKA 3CAQA 1UWIA 4M80A 1OG0A 2R94A 5J8LA 3W1UA 3UW6A 3B8UA 1MFUA 1EF3A 4GY1A 3O6CA 1V0LA 1FHDA 5D38A 2OKOA 3QV8A 1GQLA 1ZLPA 4O1CA 1K7FA 2ZUNA 2X05A 2PC8A 5A8GA 1QR7A 2PBOA 3P0XA 3VDBA 2PU0A 1LLWA 3BL3A 3C2EA 5A8QA 1ZAHA 1FP8A 2J8TA 4DJED 1PXGA 2KAUC 3SCPA 5CGMA 2F2KA 3WMLA 5IFTA 1BF6A 2OTDA 1XGZA 1VCFA 2XVLA 1WDPA 3N11A 3FXYA 3CHCA 1XLIA 4Q8WA 1BF2A 2BZNA 1JCJA 4AH7A 5E0CA 3SN4A 4XB3A 2XZ7A 4AMAA 1Q8AA 2OJPA 1O6IA 5FF3A 2WO5A 5A6TC 1M1BA 4LVFA 2D2OA 1BVNP 2V9DA 1JZ3A 2ZXAA 1I0DA 3WUBA 4Z2GA 1LRTA 3DX5A 4R7WA 2XPKA 2WNNA 3WX7A 2IW0A 1W2VA 1JD9A 3B40A 2R91A 5C7VA 1O7AA 4FNRA 2BP1A 3L12A 3ME3A 2PDXA 3PS7A 3HJEA 2JALA 4A35A 1BXCA 3VKCA 3WSUA 3L4VA 2E1DA 2WAGA 1AK5A 4IUGA 1EJXC 1PIIA 2ZICA 1QOQA 3PZOA 4B5NA 5GNXA 4H04A 1R47A 4IMDA 1V93A 2Q8XA 4GNJA 3IVTA 4CD5A 1TPVA 4LH8A 2HV5A 3HV8A 4JTGA 5XIMA 5LA0A 3LEPA 1E71M 1WOAA 5FF2A 3NO5A 1TJ2A 3QTGA 1EWDA 2DT0A 3LI1A 3PY2A 3RRAA 3E9AA 2YFNA 2RFGA 3W7QA 1KO0A 3ZLFA 4JPGA 1UKQA 3VGFA 4BQ4A 1VH7A 5I7GA 2ZC8A 3AUJA 1WO2A 4QFUA 3WBEA 4HYRA 3DIPA 3H2NA 5CSUA 5CG0A 7ODCA 1XIDA 3UPBA 3NQ8A 2V2DA 1VRDA 3TDFA 4MVAA 2C0AA 4HHMA 3CZ8A 3NEHA 1UJQA 3GB6A 3SRKA 4P8VA 3PN8A 4AVOA 3G22A 4OHQA 3BUVA 1S46A 2YL5A 3VU2A 2QT3A 4D6IA 1SSDA 1ISVA 4NAEB 2YBVA 3EWYA 1JYXA 2OVLA 1KW1A 1CXFA 3PPFA 2YA1A 5HAOA 2FQIA 3SFKA 4IWWA 2GL5A 3QOKA 4WDTA 3ZR4A 4A2SA 4DBEA 1EOMA 3PBGA 3W86A 1LLOA 3EDDA 3UR2A 3FX4A 3RIKA 1H2JA 3ITCA 2HZGA 4I5RA 3W07A 4JX6A 1T99A 3S2CA 4ZXOA 1PHWA 3R25A 4C6OA 3CGTA 5IRPA 4M24A 3AQUA 3BMXA 3APGA 3CQHA 2W63A 2EPOA 1PV8A 3HPAA 4M19A 1XSKA 1BGAA 1AZ1A 3S5OA 1PX3A 3PK7A 1TRDA 2DY3A 2E4TA 1UWAA 4B2DA 1JCYA 4Z1AA 2YXGA 5BU9A 4CU7A 1FHVA 1Q8JA 5LGZA 5EL1A 3WD1A 5JU6A 3SRHA 3H4GA 2O92A 4E4FA 4C6MA 3R11A 2Q01A 4TUFA 5C54A 4D6EA 1TG7A 4E8CA 2C8NA 3DU0A 2XHYA 2R1NA 3H2EA 1UR3M 1PKYA 3URAA 3PZUA 4BQ3A 3MMTA 3AI0A 4IFKA 2PWGA 4D1JA 3FA5A 1RBOB 4LAZA 4DZ5A 3C61A 5AFDA 3QPYA 5KSWA 3BCDA 3WH6A 5K4ZA 1GVOA 4ERGA 3NQMA 3WNPA 1UMYA 3TYEA 1GOOA 3EA2A 1Z42A 1E1CB 4OKDA 3CB8A 5E9AA 5FESA 2V5DA 5I00A 2YA0A 2RDXA 4J28A 3RDKA 2OLAA 4MZ1A 3QLLA 3KL0A 3ARRA 3LGDA 4ADTA 1US0A 4PRTA 4QR6A 3EB4A 2QCMA 2Y7DA 3EEGA 3HMJG 4C1NB 5CH9A 3W2LA 1RV8A 1UZ4A 4I8DA 4F0LA 3M4HA 3SR7A 2E25A 4KRZA 4XIMA 3B03A 1RPKA 3ZVIA 2VVNA 3TJXA 2B7QA 3LHZA 1LORA 3WUGA 3XIMA 1XLFA 1GEHA 1ADDA 1MQRA 5DY3A 2PSNA 4DQWA 2P8CA 4LRTA 1MRAA 1CTNA 4KFNA 1UA3A 1F6YA 2Y2WA 2WQPA 5T9BG 3PPCA 1ECEA 2VZVA 1W9BM 3GDKA 3ZWSA 2VX7A 3TA9A 3MHUA 4MB5A 3TMQA 3GXFA 1R46A 4O11A 1WE5A 4O1FA 4U3AA 3MUY1 1VFSA 3HFYA 3L5MA 3T6CA 1V6XA 2WVSA 3H2OA 3IGXA 1NP2A 1VENA 1XBXA 4NP7A 3AZTA 2C71A 3MTWA 1XH2A 3I6TA 2X8RA 2QUTA 4FLSA 1KXVA 3KBJA 4XSLA 3Q4DA 4XAGA 1D9EA 3B0UX 4L65A 1IR2A 4C1LA 3WDJA 2ADAA 3EKGA 3HQPA 2GSJA 1RCXB 5D03A 1FWTA 4Y6GA 2XFWA 1QHOA 3LHVA 4DLFA 1QFEA 1PZ3A 4WR3A 4M29A 2W5FA 2IPGA 2OEMA 5EMUA 4I3GA 3PTDA 3UA4A 1TUXA 1ELSA 4NKCA 1UCWA 5IHSA 3WQ6A 2I5GA 4YU1A 3IJIA 4AHPA 2V63A 3T4CA 3KRZA 1GUVA 1PDYA 1OFBA 3B8VA 3B04A 1MNZA 1UP0A 2NLYA 4N7QA 2NXIA 1OGBA 4DWSA 4M82A 1VBHA 3JZEA 4AHQA 2WLZA 4PZVA 2VX6A 3VNDA 5D2WA 3NCOA 3EWCA 3EPNA 4NXSA 4ATDA 4ONVA 4DWDA 4B5WA 2O4MA 1LQ2A 5A6LA 3AOFA 2J7HA 5FF7A 3STCA 1AL8A 4B90A 3OYXA 4GO9A 4GVIA 1P43A 3LMYA 3DC0A 9XIMA 4EK7A 3AIUA 2WKJA 4CNPA 4CNSA 3VGGA 2J9ZA 1W5MA 2ZTKA 1UKSA 1WB0A 2FVKA 2HNHA 4R33A 3RJYA 4K39A 1CLVA 3PJWA 3EX2A 5G5IA 5CPNA 1PZ0A 4XTDA 4A3RA 4H9VA 5HK4A 4DBUA 1BQCA 2E1WA 1DWFM 5JXQA 4ACZA 4QDPA 3SGZA 1UC4A 3LZ3A 1XL9A 2FMOA 2PURA 3MV11 4NU7A 1I2RA 1TV5A 1VFHA 4GIRA 4HPJA 3CMFA 3AMKA 1KD0A 4RL3A 1BVZA 3AYVA 1R3QA 2ZC1A 3WFLA 3O06A 3C8FA 3PWAA 5HQMA 4LF2A 3CYJA 1IF2A 3BVJA 3W7HA 1B3XA 3W1QA 1AA1B 1B31A 2QJGA 2G95A 4G7FA 3B05A 3N12A 2CLPA 2Q3RA 2B31A 4F2BA 2G3FA 3UG4A 4DPPA 3AS1A 4DAFA 4NJKA 4ZE5A 5I5RA 5D9OA 1G5AA 3BSMA 1I9CB 4WKFA 1O5XA 4Z17A 4KPLA 4ZB5A 3PPGA 1Q2RA 4UNIA 1Q3NA 2A7RA 3UNDA 2D3NA 1JULA 3HG3A 1E5NA 3BICA 3TTSA 5FL1A 2E68A 1VC4A 2TODA 3L68A 4JDYA 2WM0A 1J01A 2BS9A 3VIPA 3RX3A 4PE8A 2FFIA 2Y63A 3TN4A 3BSGA 2G3IA 2P10A 4F9JA 4KT2A 3I68A 2GVYA 4LEFA 1VJSA 3WQCA 4TX6A 1WUFA 1FVPA 1ZAJA 4IIBA 2PCQA 4YJ5A 3GX9A 4WOZA 5D9NA 3F2DA 1XP3A 5HQEA 3WUFA 3K8LA 1HW6A 1GYMA 4QGCA 5BWAA 4JY8A 1UUOA 4NSBA 2ZE3A 4IMEA 3P8IA 1DE5A 1VFOA 4LNCA 4J3XA 3N2MA 1UMLA 3THCA 3WH8A 1AL7A 3WK0A 3WO8A 3A13A 1KB3A 2LLEA 8CGTA 3DFTA 3M16A 1EO5A 1QDSA 4AX6A 4J3SA 3AIQA 4IPPA 4KS0A 2OB3A 4N9CA 3M5XA 3PTQA 4HCHA 4LVBA 5LA1A 4GY0A 3NL6A 3IGUA 4W7UA 3SIZA 1TELA 1WQ5A 3UJEA 1HVQA 1RVGA 8A3HA 1IIHA 1I60A 4ML9A 3LCLA 2EG8A 1SFTA 2XWDA 4OVXA 1Q6FA 3RCNA 3BQ6A 4A29A 4JIRA 1OD0A 2PAJA 3DN5A 3FDGA 1GKQA 2A3LA 2HK1A 3CPRA 1OINA 3DHUA 2QJIA 3CH0A 4GCAA 4CD6A 4EPKA 3HPSA 4Y9OA 3T81A 4V28A 3ZJ8A 4GI8A 2E5DA 4HPHA 5C2XA 4JQ4A 4U33A 3FNDA 1GTEA 1OY0A 1H41A 1RQEA 2VZOA 1VFMA 4A3HA 2ZXBA 5H2ZA 2V82A 3SI9A 1NVMA 3K2GA 5KETA 4TV6A 4AAJA 1LOSA 3KBMA 3ANVA 2VOTA 3UXLA 4AHOA 2NT0A 5I24A 3BG9A 3KX6A 3EMCA 2OQHA 4HU4A 3GKAA 4MGGA 3AXHA 1UQYA 3R43A 1SW0A 1W2PA 4UFJA 3GG1A 4X60A 1LTDA 3NOYA 1J18A 4BF5A 1G4EA 1OABA 4TVUA 3GFXA 2OELA 1PIGA 2HWGA 4FP1A 1KTNA 1DTUA 2VO5A 3PC0A 1HL8A 1Q4NX 3GE7A 5JMUA 1LOQA 4L80A 1RHCA 4DHGA 3IVUA 2V81A 2A7NA 2CLEA 2VOMA 1EC7A 5C9WA 1H09A 4TX9A 3KOYA 2ALRA 2PPGA 1E1EA 4RE4A 1D3CA 3H2CA 3NZRA 5SWUA 3VOGA 4M8UA 3L0KA 3GVQA 4IP4A 2HS6A 4B5UA 1H7NA 3TSDA 1JYWA 5E9XA 2P3ZA 3BW4A 3QGAC 1VEMA 4JZ5A 5CZSA 3ARWA 1J0IA 3GW3A 1MW1A 4AWTA 3CEPA 1YDYA 3AIBA 1CGTA 4OGZA 4RDWA 4Q33A 4DB7A 3CT2A 4EWND 4PR4A 3BC9A 1L2UA 1OGGA 2V6AA 3AHVA 3MV01 3RM4A 3MKKA 4QS5A 2AKZA 1DWIM 2GJXB 2JQXA 1QUMA 2Z1VA 1XDJA 1XLBA 2VHLA 1GWJA 1WAWA 3A9IA 3IK4A 3LLFA 1CNVA 3KCJA 4U5KA 4HOXA 4TVCA 3QSTA 1FQ0A 3BMVA 5HA7A 1KV8A 4H9MA 5A6KA 3G1VA 4Q8QA 3JS3A 2WVUA 4JDBA 5DELA 3L0NA 2CLFA 3IAPA 2BDQA 1PYMA 4MY9A 3FJ6A 1SO3A 5L6UA 5BXRA 4HT3A 5AC4A 5A8OA 1QNQA 1IYXA 1OQFA 3W26A 1X6UA 4N6EA 2PZNA 5HMEA 2VC7A 4HA4A 4JTHA 5LXEA 5IM51 3WJXA 3GK0A 3KXQA 3DFPA 4EVZA 3PUOA 3LD5A 4Q6XA 5GNZA 5CLTA 4YTQA 1WPCA 3NFUA 4GQGA 3LPPA 1ZY9A 1JL8A 3SUVA 3N4EA 2IKGA 4GXMA 1OVDA 5BWFA 1YDVA 5DCEA 4S38A 1AQ0A 2FVLA 5TNVA 5F7UA 3SRFA 1TFVA 2V3FA 4MLJA 3NQDA 1E0TA 3V5CA 1VGAA 3BGJA 3GHRA 1EIXA 3G1SA 3G3MA 3LXAA 2OZ3A 3VKDA 5ABGA 4UTMA 3AICA 4HMCA 1UH3A 2CHOA 3T4WA 1U5HA 1I4NA 4O15A 4Z1DA 1GVIA 4WX2A 2VEMA 2E9MA 1O60A 2VNCA 5HANA 5LKYA 3W6LA 4H7ZA 3T78A 1UZDA 4L4LA 3L21A 3MO7A 2Z2AA 3W2KA 3U4FA 2JIEA 3LM7A 3WLPA 3VOHA 1AVAA 4RLIA 4D8AA 2WMFA 5GJMA 1J11A 2QJNA 2Z25A 3RRXA 3RITA 4KFPA 4RW3A 1W8GA 5FSDC 4IIDA 1LLZA 3W38A 1SZFA 1VIWA 1ONWA 2GK1B 2PZ0A 2XJ7A 4YVVA 4IQDA 4O1EA 1V6TA 2HDJA 3UWYA 1XG4A 2DJLA 4ZCWA 4K1WA 3FKRA 3BLOA 1CENA 2B4GA 1K03A 1X7FA 4IGSA 1ITQA 1J79A 4XQ6A 1QTWA 3B4UA 4IPNB 2J66A 3CLWA 1QWKA 1H63A 5FJRA 4W89A 2J25A 4ZB0A 4K68A 3TR2A 9XIAA 3G3DA 2A5HA 2BSLA 3EMZA 1IV8A 3W74A 5BYWA 5EPDA 3E49A 3BOXA 1XBZA 1D7FA 4QAWA 2INZA 4DY1A 1E1CA 4A3QA 1J0YA 4D6CA 2V2HA 4QISA 1XINA