3H21A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
263
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 263
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h21A00
3TYUA 4DJFC 4G9PA 4NHVA 1Q85A 3H2EA 3H2NA 3TZFA 3MCOA 4DJFD 4S3EA 3H2FA 1AJ2A 4S3DA 1AJ0A 4MWAD 1AD4A 4DAIA 4DJEA 4D8ZA 3TYAA 2BMBA 4PZVA 2DQWA 4DJEC 1Q7QA 4S23A 4O1EA 3H23A 2DZAA 1TX2A 3BOLA 4DAFA 1Q8JA 4MWAC 3TYEA 4DJED 4O1FA 4D9PA 4D8AA 2YCIX 3TYZA 4C1NB 1TX0A 4S3BA 4NILA 3TR9A 3H24A 2YCJA 1Q7MA 3V5OA 3MCNA 1TWWA 2E7FA 3MCMA 4C1NA 4DJDA 2OGYA 2Y0FA 1EYEA 2YCLB 3K13A 4NL1A 4DJDC 3H21A 2YCKX 3NOYA 2YCLA 3H2MA 1AJZA 4DB7A 1TWZA 3TZNA 4DJDD 4CCZA 4MWAE 3TYDA 4DJFA 2Y5SA 1TWSA 3BOFA 4S39A 3H2CA 3H22A 2VEFA 4NIRA 1Q7ZA 5JQ9A 3TYCA 3H2AA 4HB7A 4O0QA 3H2OA 2H9AB 2VEGA 4S3AA 1AD1A 2DZBA 3TYBA 4MWAB 4S3FA 2H9AA 1Q8AA 1F6YA 2VP8A 3H26A 2Y5JA 4S3CA 4S38A 4MWAA
chains in the Genus database with same CATH superfamily
2FTPA 1UUOA 4DWSA 3GNNA 3W1NA 4ACZB 4CNUA 1Y8BA 4JNMA 1U2YA 4AXKA 2O55A 1QXLA 2J75A 1HKIA 3E74A 4EWND 1BPLB 1L8PA 1UJQA 4GYFA 3S8HA 5F4WA 3HPSA 4YCOA 1WZLA 1W3JA 5K3VA 5HXMA 3PK7A 2VVSA 4HPNA 4GUGA 1SYTA 3E9AA 3BJSA 1ITXA 2QDEA 3R5EA 1ODUA 5K4ZA 1OC6A 2HS6A 5G4HC 4ZZ9A 7ODCA 2AGKA 3U4AA 2OU4A 4U3CA 4AZHA 4EXAA 1UOZA 3NQ6A 3T4CA 5JBFA 2ZE3A 2AGTA 3EOOA 2PDJA 2CZ5A 4ZO9A 4YMZA 3A9BA 4M1BA 4R7WA 3VCNA 4C90A 3M9YA 4IX0A 4ZO7A 3SM0A 4ZB0A 3H2MA 1G0CA 2XYLA 5D2XA 1Q2SA 3G22A 1FVPA 2H3DA 4LANA 1SUXA 5F1VA 1OADA 3RPMA 4JN7A 3M0JA 3LUTA 4H00A 1R85A 5DRIA 1IWPA 1CEOA 2DZXA 4F66A 4ZCWA 3AJ7A 1LQAA 2P76A 2Y2WA 4L1WA 3RRAA 1X1OA 1IT8A 1QW8A 1R8LA 1XGEA 1TPUA 1BF6A 1PEZA 2PTDA 3BW4A 3DESA 3DECA 3W6MA 1HVQA 1PZ1A 2OEJA 5CGTA 3ZJ6A 4KMQA 3QV6A 1XYAA 3HJEA 2OVLA 3AYTA 1DHKA 4AD2A 1SFSA 1HKMA 1IXQA 4FOUA 3BAXA 4W4QA 5H8MA 5MF5A 3WQFA 4BJHA 1UKSA 1US3A 3B0PA 5LIKX 2VD9A 4R5EA 3WH5A 3KHDA 4IH3A 3QHOA 4CU6A 4R9OA 2VNCA 1IV8A 3QYQA 4LRTA 1WZKA 4W89A 3URQA 2C71A 4DVOA 4RZ5A 5FACA 4KFOA 1VBRA 4FHAA 2D22A 1ZENA 2CLLA 3DAQA 4UTLA 3BAYA 3GNDA 2EPNA 3U2CA 1VF8A 1S1PA 4JTDA 1UKPA 3FA3A 2PDMA 2GLKA 1GK8A 3TFCA 1X8CA 3W0KA 4XSLA 3WBXA 1JF6A 2XINA 3W2NA 4JTJA 5C71A 2VTFA 2OZ0A 1YNPA 3L4XA 1PKLA 1R2SA 4OWGA 3F4DA 1R47A 4I7VA 3TSDA 1PKYA 1E0VA 1W3HA 4F9JA 1OK4A 1UZDA 1W3IA 1V3KA 3WNKA 3FJNA 3W29A 2DVUA 3PP7A 1ML1A 3QHNA 1VCFA 4ADTA 3JZEA 5A8OA 1DJQA 1BYCA 5LSMA 4DM2A 1FY6A 3VPLA 1VFSA 2VR4A 1GVYA 4LH8A 1EUNA 3W76A 1A3HA 1LWHA 2J77A 3LPFA 1GOXA 2O9OA 5JXQA 3CHDA 2NLIA 3DU0A 2DT0A 5FF2A 1KFKA 2WKJA 1XDLA 1NP2A 3S9IA 2AMGA 4LU0A 4L5ZA 3M0VA 4FXRA 4AF0B 3RLGA 3EPOA 3UJFA 5DLCA 4HJFA 5I02A 4G2DA 2FZDA 2VOTA 1Q6DA 4GABA 3K5XA 3ZFHA 1ELSA 1XLDA 4QS6A 2J78A 3OYZA 3USZA 4MFDA 2XZ9A 4LALA 1E55A 4Z1BA 2DIKA 2YCKX 1E72M 3D3FA 4REQA 3I4KA 2BGQA 1RR2A 4I5RA 2J9YA 4CNSA 4GXWA 3R89A 5AN7A 3AOFA 3BGGA 3CNYA 3TYCA 1KTBA 2F2HA 3IIZA 4ERAA 3CAQA 2ISVA 2PD5A 5BU6A 5D33A 4CD7A 1XISA 4LFYA 4DF2A 3PANA 4GI6A 4AB4A 3WF0A 5TIMA 1IF2A 3C8NA 1MQPA 1WZMA 2FZBA 4KT2A 4I9AA 4IP5A 3I7QA 3NNTA 2A7RA 2FZMA 3RCYA 4KFPA 2HXTA 3CAWA 2W27A 1V77A 3VGDA 3CUGA 1VPXA 1ZHAA 3EDKA 5EBUA 2J62A 4AZIA 4Q33A 1J0JA 3WQ6A 1WDWA 4DBWA 4TVUA 2ANUA 2VCAA 4LJ3A 1BRLA 1TUFA 2WJDA 5AVNA 1YPXA 5FCZA 1FWHC 5C2GA 3WEMA 3EMQA 2JEPA 3KW3A 1PBGA 1T8XA 1ZJIA 1JCNA 3QKEA 3LHZA 1FXPA 1ADSA 1K9DA 1NJJA 3FDGA 1SR9A 4H8UA 3NQVA 1UH3A 1C8VA 3DI0A 2BX7A 2YBTA 5G1TA 2YCLB 3SAZA 3FY1A 1I0DA 1UQYA 3S5SA 2ASHA 4HD5A 4HU4A 2WLZA 1UBPC 3TNOA 4JCLA 1L2QA 1A5OC 3VC6A 1RP9A 2V3DA 2XN1A 3OG3A 1SJCA 4AWTA 5JQ9A 3BAIA 4XD6A 2HRWA 4LUTB 4R9XA 5A6BD 4N02A 3L4WA 3SCPA 3GB6A 4ICMA 4UWMA 3WJXA 2JKAA 2A85A 1UUMA 1UWRA 4E6MA 3HG4A 3KOFA 1GVFA 4K38A 2EAWA 3S2LA 4S2CA 2WANA 4Z1CA 2OSXA 3QR3A 1CPUA 1NOUA 1REQB 3AU6A 1WXZA 5BRBA 1QOQA 1GHRA 1PE1A 3G1RA 3LI0A 3OHIA 3H53A 3KWSA 4BQ5A 1YLVA 3T09A 3URBA 2E3ZA 3R4IA 4YTQA 1OFOA 5CZKA 2G3IA 1DORA 1P48A 3W22A 3HG5A 1E3ZA 1JRCA 4AHQA 4PMNA 4WXYA 4YWIA 4RZ4A 4OUIA 3L23A 2AOSA 2DVXA 3SGUA 5KTLA 4H01A 5CPNA 4JFSA 2D23A 3M4HA 3KTSA 2CZDA 1K3UA 3WJWA 4CVWA 5KITA 1NAL1 2VFFA 3H22A 2HE5A 1QHPA 1UWSA 1BYDA 2PP3A 2QDDA 1ZJAA 1UWQA 2PF0A 4FF5A 3BLPX 3TW7A 2J7FA 1IXOA 1GOOA 5I0DA 4I5XA 4D72A 1L0PA 4N9CA 1Q8AA 1W0MA 1N8FA 2B4GA 4XUGA 1BXNA 3CHCA 3NPXA 1RPKA 4D1JA 4D6HA 1VENA 4FA3A 3N9SA 3XIMA 2H90A 4H41A 4XO7A 3W7NA 3NZQA 1GUVA 4MYAA 2PDNA 4HYRA 1HO4A 2OT0A 2QCEA 3WD0A 4JS3A 4XQ6A 1W5QA 3GXMA 1DWAM 4MWAD 4L56A 1EIBA 4ZL1A 1G7VA 3ZJ8A 2WBKA 1H3GA 4ZB2A 4JX5A 3HJZA 1Q4WA 3WQDA 1E6PA 3W1AA 3H7UA 1DVJA 4CNTA 3OA3A 4FXJA 3TDFA 4MYXA 1F2JA 3AAMA 2VGBA 1G4SA 3MSYA 1Z32X 3ZMRA 1K8ZA 2DPEA 1XG4A 2PWFA 3T2QA 2VR5A 2WHLA 4NL1A 1E6RA 3ARYA 3H54A 4MKVA 4DJDC 2BY3A 2E8ZA 1Z7AA 2WSPA 4H7VA 1XIBA 4DWSB 4CU8A 1M04A 1XYFA 3NVDA 1XX1A 2ACSA 3W25A 1V6UA 1T7LA 5D9OA 2Q71A 4ROQA 3WQOA 4G8TA 4JTRA 4WUIA 1G6CA 2E1DA 2V67A 4J3SA 3MO4A 7REQB 3KTCA 3TYBA 3GY1A 1ENUA 5LA2A 4HP5A 1RBLA 1DXFA 4RE3A 3T05A 4R3UA 4HMNA 1TJ0A 2Z00A 3QOKA 1PYMA 4WOQA 1CXKA 1SU5A 1BAGA 4XISA 1XLLA 3O8AA 3GTFA 1GPWA 1SW3A 3FS2A 3DBPA 3SY1A 1W3LA 3S1WA 4P7NA 2ZXQA 1XPGA 2R1KA 4U5KA 2CW6A 1OF6A 4GINA 3DXIA 1FWIC 2IS7A 1XDMA 4JNZA 2FZ8A 1RBOB 1BWKA 3H23A 1Q13A 3L5AA 1LBMA 2WPGA 3T7VA 5A6AA 2PBOA 4JL2A 1SMAA 3SBFA 1XLGA 2YDQA 4ZE5A 7XIMA 1YBQA 4IPNB 4K39A 2R94A 2QUMA 2GQ9A 1O68A 2J47A 3IJ6A 2HV5A 5E0CA 1QO2A 4G1KA 3G6LA 3AHVA 5C2XA 2IKJA 3ES8A 1FH9A 3S6DA 1TE6A 1R2RA 1X96A 2NSOA 4JR5A 3W7KA 2VL4A 4MHBA 3WLNA 3UZXA 2POTA 1SJDA 2PWGA 4A4AA 3PBMA 4IX2A 3W7DA 1Z3NA 3LTSA 1JFXA 1PYFA 3KL5A 4TX9A 3SY5A 2CC0A 3ANVA 2JF6A 3W1LA 1W31A 3LX9A 4MB3A 4HNOA 4FIRA 2VGFA 5A2AA 4CD8A 2JKEA 1E1EA 2OFJA 1OG0A 3WH7A 5D9MA 3I65A 4DM1A 1VP5A 3WBEA 3TYUA 1Z89A 4MZ1A 2TPSA 5LYRA 1PTDA 4GI4A 1M7XA 5DXYA 3UBPC 4IQJA 4JD4A 3N73A 2WM1A 3G1XA 5E0KA 3WH6A 3KBSA 4K8GA 1RQHA 2HS8A 3BC9A 3M6YA 1TWIA 2NV9A 2PDFA 3ABOA 2ZBTA 1AQFA 2ATMA 1TV8A 4LV4A 1EGZA 4EPBC 3GFYA 3U9IA 1OX6A 5BRQA 3RMEA 4CQBA 4YU1A 3K30A 4HIBA 3M5YA 6TAAA 4W7UA 2C14A 4GVHA 5FEWA 3S2JA 4DO7A 5CCZA 4IISA 3S1XA 2F38A 4J4KA 2Z2AA 2GJNA 4RNIA 4U31A 2CWNA 3VTRA 3CH0A 2WNNA 2X05A 1OD8A 3LCWA 4V1XA 3W2LA 3PS7A 4F79A 1VJZA 4MWAE 2GVYA 2QHAA 1IIHA 5HDRA 1FHDA 3AMGA 4O1BA 1VBJA 2E5BA 3CT7A 4HNTA 5IHRA 3IK4A 3P61A 1O94A 2ZRVA 1IIGA 4JY8A 4JXCA 1FWRA 4WY0A 2V5CA 2PDPA 1OCBA 2Y5JA 3WX7A 1Y5WA 1AA1B 1LLOA 4ZQPA 1HL9A 2VENA 5ABTA 2P88A 3H7VA 4B15A 2CBUA 3BK0A 1AJ2A 1FBAA 3TOPA 3TUUA 2DSKA 3BOXA 3ARRA 4I6KA 3W7RA 3MUCA 5A6KA 4M1RA 2FPYA 3CLMA 4REQB 1S2CA 4Q3MA 2VWSA 4P5UA 1LWJA 4TQTA 4DYKA 3W00A 1K03A 1J0YA 3MJMA 4NI3A 2P8CA 1VQTA 3TIMA 1BYBA 3HU7A 4GZEA 4AZCA 5C7VA 4RNFA 2Y4SA 2IMRA 4EPDC 3NDYA 4GQBA 3GSMA 1IT0A 4HNLA 1MMFA 4OV9A 4ZXOA 1VIZA 3EYPA 2OGJA 1DV7A 2ICSA 1QNRA 1JVNA 1ZZMA 2GOUA 3C56A 1KFLA 2GVJA 3L0KA 3ITVA 1RJQA 2PDIA 4PMXA 2J7EA 2Y24A 2PBGA 3CS2A 3PUEA 3QHMA 1UR3M 4E4PA 3O15A 3SQLA 3REQA 1E0TA 1BRLB 1AW1A 2TMDA 1JJKA 3WY1A 3TU9A 4C6IA 3FEQA 9XIAA 3LM7A 1V6XA 1A0EA 2XSAA 1XCFA 1MDRA 3N4FA 5I23A 1VLIA 1G7UA 1ZAIA 5M3WA 1B0IA 3ABQA 4DWSC 1Q5MA 2J25A 1TQXA 1XYBA 2NUXA 1R3YA 1FTXA 5M03A 4LAUA 2ZA1A 3VCRA 3BARA 4FNSA 2CLPA 4PL2A 1H1NA 3PBGA 3ICJA 1UP2A 5AC5A 3L21A 4X63A 5LIYX 3RUBL 1XH1A 1FWCC 5A6MA 3IGXA 1ADDA 3M0XA 5D03A 1XGZA 1B3WA 3HPFA 5HULA 2PP1A 1UB3A 3TCSA 3CJPA 1OBAA 2IKGA 3VGHA 4W7VA 2R1NA 1I45A 1J4EA 3IIVA 1A80A 4GACA 4Z2LA 2E68A 3VFLA 3HZ3A 2B7NA 3SCVA 4DB7A 3BPWA 2V9DA 3AHYA 1I1XA 5D9NA 3U7BA 1Y5VA 2GK1A 4HA4A 1EDTA 2WOQA 1Q7ZA 2PS2A 3S6TA 2YOCA 1LOLA 1FWEC 1DJYA 2Z6JA 1EXPA 1AD1A 2I16A 4JYEA 1U5VA 3SEPA 2QCCA 4KS0A 2C18A 3QZAA 4RLIA 1Y7VA 2DZSA 3CQKA 1R0MA 3UR8A 3JW7A 2I9EA 4DBUA 3W1PA 2ZUNA 3WK3A 1TB3A 3BSGA 3GXNA 3ARZA 2Z24A 3A4JA 4QX4A 2FMNA 4S1FA 4RDZA 3VUSA 2J9XA 4WDWA 5HR6A 4W8AA 3L68A 2BY0A 2WC7A 3LCIA 3F4WA 4I9TA 5EMLA 1E4LA 5G4EA 3EWZA 3IVUA 4JIPA 3QPEA 3GIPA 1R3VA 1GEQA 2QCFA 3EWCA 4JBRA 2GVGA 2DH2A 3TX9A 2Z1SA 3PBWA 2GGGA 5D8ZA 3W4RA 1UD3A 3ONCA 3GZ3A 2QT3A 3WF3A 3WLTA 5CSUA 1UZHA 2ZICA 4UZSA 2NT0A 4KQNA 1GG1A 3EMCA 1ME9A 4K7YA 1DIEA 4GNKB 1KRAC 3ERPA 2XIMA 4HN8A 2RDXA 1C8XA 2YGYA 2QUUA 4KF1A 4DJDD 2OYLA 4V33A 4KH2A 4ZR8A 3O3RA 5EY5A 4HZ8A 3APYA 3LXCA 1H5VA 3LEPA 2GVLA 3SIMA 3VIMA 3QQWA 1XRVA 4DWDA 5J8LA 4CVUA 2X1UA 4O0KA 5B7YA 3GR8A 4N4PA 2WZHA 3HA1A 4H1ZA 1ME7A 3WEZA 5HWMA 2Q3RA 4ZODA 2DORA 2YL8A 3DHFA 4PRWA 1V4YA 3C3UA 4IJRA 4XTDA 4OVXA 1UC5A 3WNPA 3VKKA 2Q6ZA 3OYXA 2WZIA 2J7HA 1JL8A 4ZA0A 3EKLA 1UA7A 3IJ9A 2JQXA 2XH0A 4H19A 3WG6A 4IGHA 1S3HA 1AVAA 5HQMA 2FDMA 3W1QA 3NSMA 1E9ZB 2O9TA 2VJXA 3G0UA 4PBEA 4FNTA 1YX1A 4LBUA 3Q65A 3UPMA 4DPPA 1A4MA 3S4TA 3WZ0E 1CI1A 3DFYA 2VGIA 4AIOA 3S46A 5J5RA 2BOEX 1F8IA 5FESA 1J11A 5FJUA 4DO5A 3T2OA 1OX4A 1JZ5A 5C6MA 3KM8A 5A8MA 3HGOA 3WLOA 1PIFA 2NX3A 3CL6A 3GH7A 1C7SA 1XP3A 4RDVA 1R46A 5E9AA 3ABZA 1NOFA 4M80A 2Z26A 5DELA 4JYDA 1SJAA 2E8YA 4K36A 3AYRA 3LMZA 3WF4A 4OGZA 2CZEA 1HT6A 3BG5A 4QRNA 3O6AA 3WLLA 4IPPA 4Y8FA 1FKXA 1RQBA 4IP4A 5EGRA 3DOPA 4B2DD 1KGUA 5AYZA 4HSOA 1YBQB 1XH0A 4XD3A 1B4EA 1YDNA 1B30A 4RUBA 4WHBA 3AMCA 4LYPA 1Q65A 3OVPA 1W3NA 2XVLA 4AX7A 4IZGA 4MKSA 1TRDA 4F0HA 1PVNA 4R85A 4GYJA 4X0NA 3GDRA 2IPGA 3GD6A 1R87A 2X2YA 5FL1A 3PAJA 2JE8A 3VMOA 4L6DA 1PTGA 4Q4RA 1UR4A 1FUYA 3DFQA 4XD4A 4YN5A 5G1MA 2D2GA 5ABEA 4DBDA 3AQUA 3E0IA 4IG2A 4LC8A 2O4MA 3B9EA 1TX0A 4GK8A 3MU7A 3WJYA 4L4MA 1XL9A 2W67A 3NQDA 3O16A 1OFDA 1WZAA 4L4PA 3EXRA 5A8PA 4EANA 4IJBA 1CGUA 1ECEA 5DF0A 3DEQA 3TQPA 4N4QA 3N4EA 2RDTA 4CNNA 3QSRA 1LUCB 3BV7A 4LY8A 3I10A 1F3XA 4JFUA 3UWUA 4AZ7A 3GLCA 1RH9A 1GYNA 1R3TA 3AIBA 1H60A 2GYIA 2XG9A 4Y6GA 1SVDA 3IUDA 4JTFA 2PTYA 4HT3A 5A8GA 3R8GA 3NFUA 3SRDA 1TELA 4QR6A 3F4NA 3PPGA 3ZT5A 3NAVA 3RAOA 4L6OA 1P4CA 2C6QA 1NU5A 4MSSA 2ZA2A 4HGXA 4PUJA 3AS2A 5LHEA 1CLVA 3SR7A 2FHFA 2OSWA 4BR1A 4HHPA 1BQGA 1Y5XA 2OCZA 4G5DA 4JN6A 2A3EA 1W2PA 3TQKA 4GIRA 3I6RA 2ACRA 2ZX5A 1EPVA 4YIWA 3ZO9A 3STGA 4DAIA 5T26A 4I6VA 3S1VA 1F8MA 4GY1A 4NRSA 4LUSA 1CCWB 5DCBA 1J12A 4LCQA 4WJ8A 1RLDA 1OWQA 1WYIA 2WWCA 3HFTA 3N6HA 3WL0A 1S2AA 2B81A 4B3KA 3F4VA 4LPCA 3BG9A 3GTXA 2X2GA 3WELA 4D8AA 3HGJA 3IV3A 3CQIA 1F5ZA 5CG0A 2VURA 1CIUA 3SUSA 1RA0A 3LXBA 3MSGA 3NQGA 1GPFA 4M5PA 4WY0B 5ABGA 1BLIA 1V03A 1PDZA 3S9YA 2O7SA 3ECQA 1O12A 3N19B 4LB4A 4YWSA 3OO2A 4NUWA 5BRPA 3VZXA 3VOHA 3NPUA 3KVKA 2WVVA 3AHXA 2V5LA 2P3EA 4Z42C 1TZ7A 2HDJA 3A4XA 1RV8A 1IQ8A 5B7ZA 5I3GA 1TPEA 3LOTA 3NQAA 3OLIA 4NRRA 3U8GA 4PCTA 5TD4A 1LRNA 1B3ZA 4O15A 4LBRA 4F0MA 4XTIA 3LHYA 3DFPA 3LLFA 1EJSC 3VM7A 3GU9A 3TC3A 3MTWA 3UXAA 1X6LA 1POKA 5AC6A 1UH4A 4NZJA 3ELFA 4LV9A 3WQPA 4IMFA 5KETA 1BKSA 1MUWA 4DI9A 1ALDA 3U4FA 3VDAA 3I3EA 5BMWA 3CIXA 4DWSD 3RJXA 4PB5A 3NZ1A 3E5BA 2REQB 1JZ6A 2BSLA 3WMSA 4R33A 2NUYA 2F6UA 4AXNA 3T0CA 1BG4A 3UVAA 5G4WA 4AD4A 4L1GA 1HVXA 3BURA 2WNQA 3WD3A 3GVGA 4PULA 4XZBA 3WSUA 4QFUA 1JUBA 5BXSA 4MUPA 2QPUA 2XSBA 1GJUA 4JEQA 3W2UA 1VFFA 3MCMA 1B1YA 1MXSA 3W1TA 4HTYA 2WVSA 4GFIA 4XX6A 1AJZA 3WLQA 4IPJA 3CHVA 5HNRA 1M7OA 3CZGA 4HU8A 3QC0A 4ASTA 3RGTA 4RPPA 1EZ2A 3MYOA 1QOPA 1UD6A 3RG6A 4W93A 4YPJA 3ARWA 2G5WA 2GJPA 8RUCA 1W9DM 3W7EA 2VXNA 2XGBA 5HNUA 1YQ2A 2XVNA 3ENLA 3KP0A 4ZOEA 1MSSA 1WDDA 3UZWA 1E4MM 3EWBX 2BODX 4P8VA 1HO1A 2DIJA 2V2CA 3AZTA 1VCGA 1XW8A 5AHFA 1UWTA 4Y8EA 4V28A 3VM5A 3CUFA 3AALA 2PF8A 2PZNA 1KFJA 3JZUA 3LG3A 3AICA 1K4HA 3DX5A 4ENLA 5FSEC 1MZHA 3AXMA 4GO9A 4O16A 1DHPA 1JZ7A 2PDLA 5BU9A 1FHVA 4LS1A 2EPMX 2QJGA 3EKGA 4RL3A 1K1DA 5HBFA 2ZXBA 2VCCA 2ZTJA 3ZWSA 1W9PA 3GYEA 2GK1B 5I24A 2BG5A 2C79A 3ZJKA 3W6YA 1UZ4A 2TAAA 1K6WA 4H3DA 4WLCA 1EIXA 1NM9A 3GIYA 4IL0A 3NOEA 1ISWA 3TTEA 1TMHA 2VT0A 1VJIA 4DNHA 2QJMA 4C6DA 5CEWA 1W9XA 1MFUA 3G1HA 1NFGA 3DZ1A 2PWVA 3MP5A 4XAZA 3BZGA 1RY8A 3G2GA 5PTDA 2HBVA 1XQKA 2DH3A 5B80A 3EDFA 3AMKA 1MEWA 4IFRA 2PB1A 1DJWA 1SSDA 3PJXA 1L2UA 4QE4A 2NUWA 2CU0A 3WLMA 5IOBA 2Q01A 1EOMA 2H9AA 1XD0A 4M24A 4H9XA 3PPCA 4OJYA 4CNOA 1FDZA 4IMEA 3HMJG 3GAKA 4C7GA 3GUGA 3KS5A 1JDCA 4HMCA 2VFDA 1W3KA 1ZJBA 3R58A 3UGRA 2CKSA 2ZZ2A 1R30A 4KGLA 1SW0A 4FXFA 1SFTA 4Q8VA 1KM6A 3KRBA 2J24A 5CSYA 6ENLA 3G1YA 1F73A 1WBHA 2E28A 5D4YA 4M81A 3BZJA 3VNYA 3URNA 3KOXA 1E51A 1GVSA 2WCAA 3EKZA 1ME8A 3MA8A 3DG3A 3KBMA 2P50A 3GVWA 2BS9A 1RBAA 2XVKA 3GHTA 5JH1A 4RPQA 5JBDA 3LB0A 2YCJA 4ZOBA 4DHGA 3VX1A 1TJ2A 3V5OA 2CPUA 3NO3A 1JDFA 3KRSA 4HVXA 3CH9A 4LUIA 4P7LA 4KIRA 2ZWZA 3MBDA 1H50A 1GEHA 1JF5A 2ATSA 4FR1A 1PX3A 3PWAA 1CX9A 4AZGA 2X7WA 1BWVA 4IXXA 1R3WA 1GKRA 4HU0A 2XGIA 4HKPA 4LXFA 1RHCA 3TN6A 5FJRA 1XGDA 4KIEA 3R79A 4LAMA 3RYSA 2D0GA 5FIPA 3CO8A 1ZP4A 5AC8A 4EP8C 3C2OA 1Q2RA 5C9ZA 2VP8A 2W5FA 4GYKA 3UWZA 2QJHA 3T07A 1D8WA 1KD0A 1UD5A 3MUY1 3FXYA 4BHYA 3FYYA 4XZLX 3B9DA 3ABRA 2NQJA 3SADA 1I2NA 3GW0A 2CXGA 4F2TA 3NQEA 4EF8A 1W1B1 3JRKA 5I07A 5FJIA 1RK6A 1V0NA 1VBGA 2BMBA 3VCCA 3UWEA 3B4YA 2A0NA 3E12A 4GGBA 4Z08A 5EU9A 1B31A 3SUVA 4GBDA 3VIPA 2VFGA 1UR1A 3W84A 2RGMA 1TYGA 3GBDA 5XIMA 2TSYA 3C6CA 3IIPA 4JDYA 1EJVC 3U57A 1JZ8A 4FR6A 1NQKA 3MCNA 2E7FA 3TEVA 3CWNA 1M9HA 3LHTA 3LLDA 3MKCA 4G7EA 3I6TA 2VEIA 5C9WA 5J04A 2WMIA 2WO5A 3NR0A 4J9JA 1G5AA 1XSIA 5LIWX 2A6NA 1F9CA 3W7LA 2W4XA 3H2AA 4JAWA 1X6UA 2RDUA 1DBTA 1XIEA 1NTHA 3NQ8A 4O17A 4ZVJA 2D2HA 1XF0A 1BSLA 5CPQA 3BAWA 3K8KA 1YKWA 4ORMA 3WQ8A 5HWNA 4MJZA 1VLWA 4IG2B 4GNJA 1QI5A 3VDBA 3VYLA 3LBOA 1OD0A 3SCNA 4HOZA 1WDSA 1KBKA 1M3UA 2PA6A 3GTNA 4HTBA 2G95A 4A8NA 4KFNA 4X61A 4ZBCA 4D6FA 4UNIA 4QJ4B 3WLKX 3BLLA 2XFFA 1HKVA 4D6IA 1JUKA 3HQPA 3CIVA 2A21A 4JL1A 4MZYA 1JCMP 3ARVA 2R6OA 1C7TA 2QYGA 3NPVA 3OVRA 3AS0A 1BVZA 2O9RA 3T0TA 1K70A 5E1QA 1G69A 2PZ0A 1TO3A 1IR1A 4IT1A 3C3NA 2EXOA 1MZRA 2EJAA 2O92A 3WLJA 3UZYA 1DIKA 3K13A 1LBLA 2CLOA 4JTEA 1F61A 3O05A 3L0GA 1LWIA 3MHGA 5FEZA 2HVOA 4HK7A 2F2KA 2YFNA 1LCOA 3CMFA 2DFAA 1E56A 5LHFA 3ZLGA 2PWEA 4CD5A 4XBSA 3TV8A 1JNEA 3ABXA 1QPNA 4LT9A 3VD4A 3NIYA 4Z1AA 1E40A 3H4WA 4XAGA 4HNVA 3TNBA 3BMWA 2A6LA 2V3FA 3E6EA 1UROA 5DY2A 2CLFA 1LG1A 4WR3A 1A47A 4BI7A 3ZSSA 1BWLA 1TV4A 3RK8A 3C0SA 5BXTA 1QWKA 3QTGA 1IEXA 4YTTA 3E2SA 5ABFA 1A5LC 2VZVA 2Y61A 4JN8A 5LNUA 4EPEC 5H2ZA 1QHZA 3U5YA 4A2RA 1LBFA 3N17A 4FNRA 3R10A 2WVUA 1M01A 6REQA 3E49A 1HJUA 3N2OA 4GXMA 1IR2A 3SCWA 3N12A 3FW6A 1B90A 1E1CA 2WSYA 4MDPA 4N42A 1GVRA 3MHUA 2Z6IA 4PRRA 4MIMA 4NX5A 3THUA 4F0RA 2QJIA 4GI8A 4G56A 2CLKA 4QP0A 3HOJA 2NVAA 4UQDA 4DXKA 3AIUA 5AECA 1GVIA 4AHPA 3EB4A 2WC4A 3DUGA 1FCUA 4PH6A 3BE7A 3VOIA 1EDQA 4FALA 3LPGA 1OG6A 5CLWA 3O6YX 4EVZA 3RX4A 4QCEA 4QE5A 1GZ1A 4C5YA 1WE5A 2WB5A 1A0CA 3IUIA 1XJBA 1EA9C 1EC8A 2BHZA 1XIDA 2CHNA 1DWJM 3TK7A 3ZVIA 4GKLA 1LDCA 1ITQA 3ARSA 2C0AA 3VD5A 1RVGA 3W1XA 5CPOA 3V18A 4KRUA 1K77A 1XR2A 5BWAA 4ZOCA 4GUIA 1TA3B 1AW2A 1UKQA 3UYCA 1LORA 3M41A 4NZ4A 4ZXLA 3UY7A 4O1FA 3RHGA 2E5DA 3WUFA 1CGXA 3NXLA 1LM1A 2W92A 3WLHA 3S2MA 2G37A 3NWRA 1UOKA 3NGFA 2YL6A 4UFMA 1NWTA 4GX8A 3VOCA 3GM8A 4WDTA 4H7ZA 4C7FA 4UFLA 1I60A 1EWEA 4I90A 2ZFAA 1N8WA 3NL5A 2PLKA 2LLEA 1KBBA 3O7UA 5K2ZA 4LS0A 2EGZA 4C6BA 1WPCA 4PGLA 1AW5A 5IFTA 1GT8A 3LNMA 3IACA 1XKYA 3SQMA 1XLJA 3WQEA 1HKJA 3WUGA 4XUYA 1DL3A 2IXVA 4YTRA 3LA4A 3KE0A 3LYEA 1W5PA 4NNBA 4TUFA 1C8YA 3TJIA 3OIHA 1YW1A 3I3DA 4JTIA 2XH4A 2I7GA 1OEPA 3CZKA 2Y62A 2BGNE 1LRQA 2GDVA 2DQXA 4OBTA 4WSJA 1OIMA 4DNMA 3GG7A 4V15A 1OX5A 1THFD 2NV2A 4I9MA 3F03K 4RK8A 4ACZA 1J9YA 3GFZA 3T08A 4HCLA 3O2LA 1O5XA 1TREA 3DYOA 3SY8A 4AH7A 4H9MA 3QYSA 1P0KA 5DRCA 3LTPA 1AMYA 3BMXA 3SRKA 3SJ3A 2XU2A 1H2JA 1I2PA 2VMFA 2QCNA 4K1WA 3IJIA 3LN3A 3KOZA 2XWEA 3E2RA 3WQGA 2JKPA 1MUCA 4WD0A 3W2MA 4LYKA 4UFIA 3TXZA 3STFA 4M19A 4NJHA 5JIWA 4C6LA 1V7YA 1H11A 4WQ6A 1QI0A 2FB3A 3UXKA 3RR1A 2C8NA 2XH2A 1S2VA 2PGWA 1QDSA 3T4WA 1W9BM 3E0VA 3QY8A 2AQOA 3POCA 4XWUA 4NZ1A 1CXIA 5K7JA 2GWGA 1YMYA 5K9CA 1OGBA 1RLCL 3VNZA 2EPLX 4S38A 1N82A 1JULA 1KWGA 2H8XA 2E9LA 3CUZA 4MM1A 2J27A 2Y85A 3W73A 4DUWA 3SCQA 4LRSA 3OGRA 3WIJA 3WK2A 1T6MA 1ZTVA 4WRHA 3E38A 3H2FA 2PU1A 4LUJA 1HKWA 4QHRA 4E2VA 4FNQA 4L7ZA 4NZ3A 5LZLA 4LGXA 1OCQA 4ZOAA 4OHQA 5BMXA 4RE4A 1T96A 3SI9A 3AIRA 3EWDA 1C93A 3F1QA 2B7OA 1MUMA 3H4GA 4YCPA 1GW1A 1G4TA 5LNRA 4D9PA 2B0MA 1F7BA 2Z7GA 1O66A 1EHAA 3VDHA 2VX5A 3LM3A 5C7HA 1BXCA 1GORA 1ZQ5A 1G1YA 1XINA 2BBFA 2YA0A 4JQ4A 3GWQA 3PNZA 3LSBA 4GZ7A 3W27A 2ONEA 1JD9A 2ZZ6A 3PZVA 1H7OA 1YXCA 1LOQA 2VR2A 4ZFMA 1YXYA 1T5AA 5FF3A 1S46A 4O13A 3F7JA 1TR1A 1FWSA 1XSKA 4HSNA 1NWSA 2VFIA 3OOQA 3ZT6A 4HYWA 1WUEA 3ZWTA 1X1NA 4GNVA 4LYQA 3ZVHA 3ARTA 2VEKA 3WMLA 1TZ9A 1NDWA 4QNEA 4S3KA 3CLWA 1BVWA 4GC4A 2YW4A 3OBAA 3NCOA 4GCXA 2WZEA 4ILSA 2ZXAA 4G9PA 4WGHA 3SIZA 3SFKA 2ZRZA 1DJHA 5A94A 1M7PA 4WK9A 5EMMA 5JMUA 2AL2B 4MPQA 1CLXA 3SB0A 4G7EB 1JCTA 1HTIA 1ZRQA 3GXFA 2FFIA 1CGWA 3B8VA 2BVDA 2CZFA 3SUWA 3NM1A 2O7QA 4KWUA 4O50A 5CZTA 4DF0A 1JPDX 3H7RA 4GQRA 4K2SA 2E40A 1FP9A 3LRKA 3EMZA 4E8CA 4UIOA 1XLMA 3AUOA 4NJJA 1VEOA 1N2VA 3QN3A 1OVDA 3AXKA 3ZOAA 3FOKA 4M6UA 3C0LA 1SJBA 6PTDA 5BW6A 4GOAA 3WLRA 4HMEA 5RUBA 2VCBA 4UBPC 3I6EA 3R13A 1J96A 4LW7A 2QGHA 1G4PA 3NYDA 1HJVA 3AZSA 2NQLA 1ZBCA 1UCWA 1JI1A 4WX2A 2VEGA 1JAKA 2DZBA 2H6RA 2OMAA 3UQNA 4DIAA 2PD9A 3W28A 3AJXA 5C54A 3BLFA 2E6YA 7CGTA 3N25A 3K4WA 2WYSA 5D2VA 4B16A 4O54A 3T42A 2ZYFA 3A3WA 4JIIX 1SM9A 4GCAA 3RF9A 1QJWA 3S42A 4XZWA 3ALGA 1JNDA 3QV9A 4QLLA 1QWGA 4FF7A 3CXOA 4O18A 1TV3A 3IJQA 1UQZA 3OZPA 5E70A 2OYKA 2BWGA 1DJZA 1R9YA 5DCDA 1Q8JA 3D6NA 1TJ1A 1CLKA 3VIOA 3IGHX 1WO2A 3N04A 2W62A 1O95A 3N15A 2B31A 4NU7A 4Q8QA 1W5OA 4IICA 1Z42A 4MNLA 1H7XA 3WDHA 1TCMA 3QTPA 4NF7A 4QDPA 3VIHA 3M44A 4NG3A 1E4NA 3R11A 2PC8A 4AY8A 1XBZA 2WMGA 4B2DA 3W01A 1VFUA 3W7MA 2HEJA 4CD6A 2YXOA 2CHRA 5EB8A 1LRTA 1DWFM 2YCLA 3I7SA 3L67A 3G8EA 3F2BA 1KM5A 4Z2KA 1S5MA 1VRXA 4KESA 2FDSA 4Q8OA 2GFTA 3E0LA 3GVVA 1D7FA 1BQCA 4IPIA 4JFVA 3UG5A 3B0YA 2YPIA 1E9IA 1TQJA 3DCPA 5A6LA 3KLKA 3NQCA 3POHA 3ANUA 1GQJA 1B3OA 1ISYA 3MV01 4DO4A 4WDUA 4AAJA 3M0HA 3ZS4A 1Q6OA 3DG6A 4X22A 1MYRA 2HZGA 2PCEA 3RXZA 2J8FA 1V6YA 5FAJA 4AY7A 3ITXA 4S2BA 1GW9A 5D37A 4N9EA 3TSMA 4PUWA 1TPC1 4FNUA 1GNXA 4GYPC 3CQ0A 4AX6A 5F2MA 3GE7A 2PU0A 3FX4A 3OGVA 3EAUA 3MDWA 4LF1A 1VFHA 4AMCA 4IQLA 1ISVA 1MXGA 1N7KA 1DIDA 2PWUA 3O06A 1JPHA 2I9UA 3LCHA 2R91A 2ZQ0A 1DWHM 1UKTA 1XM3A 2DUAA 1UMYA 4ZO8A 1OFPA 3UWYA 3UCCA 1VKFA 1WDQA 1VIWA 3UA4A 4Q4QA 3GC4A 4H83A 3W83A 1W1TA 3CT2A 3NO1A 3V16A 3T0BA 5HMFA 2GPTA 2D2JA 4KPLA 3W2JA 3VIKA 5AVHA 4RE0A 1LZOA 3T0AA 1KRMA 4C6QA 4JTHA 3EX3A 5ENLA 3CV2A 5H6HA 4E0CA 4F9DA 2OPJA 2P1FA 2QZRA 4WOZA 2QW5A 4HOXA 1YTDA 3KHJA 5EMYA 1XSJA 1KR0A 2X0HA 4J35A 3W7GA 2ZDRA 1E5JA 3H2NA 4WEVX 1EEXA 5C9XA 4HSHA 5BXRA 1VFMA 3EEZA 2ZUVA 2VX4A 4QM1A 1DQWA 1KBJA 2YDSA 2D0FA 4FB7A 4AZ6A 1PZ0A 2IPWA 4P2VA 3Q67A 1O1HA 2NX1A 8XIMA 3BSMA 1A50A 1PDYA 1KCZA 5DCEA 1W1PA 1XCXA 5G1YA 3KRZA 1W5NA 7TIMA 1ZS2A 2HVMA 4JDBA 4QQ3A 2Q09A 2YB1A 2CXEA 1JPIA 3VX0A 4MF4A 1JPKA 1BG9A 3EXSA 1BKHA 2D73A 9CGTA 4Y9NA 1GG0A 1PPIA 3VNLA 2QF7A 4M0XA 1MO0A 3B9AA 4Z2HA 3WQWA 3BW3A 1EUAA 5FJOA 2VOMA 3P0WA 1W17A 1PCWA 3QZ6A 2Y6ZA 3N4AA 7REQA 3C61A 3HQNA 3B8TA 2FYMA 3P80A 3S1UA 2VX6A 1KQYA 2EKGA 1CB7B 1DXEA 3AFBA 5T9BG 1GYLA 1GTHA 3KVJA 3SCSA 2R82A 1GOWA 3ATYA 2J7GA 2A7PA 3RLUA 4S23A 3QSTA 3W1RA 1A5AA 2XIBA 5AHMA 2C19A 1I4NA 3EOEA 3HF3A 4GG9A 2NWRA 3UPWA 5HPOA 4DY1A 1WOAA 2HWGA 3PFRA 3S2CA 4EX4A 5FJJA 4FX7A 4HJWA 1LLWA 2PDQA 4POCA 1P6BA 3K8LA 3LPPA 4PCPA 2R9RA 4MLJA 1PKNA 1XPYA 3THQA 3VKBA 1YADA 3ZM8A 4C6KA 3SQSA 2EKCA 1FQ0A 4IF2A 4XZMX 3EX1A 1IEIA 1QI4A 4JTQA 1ZCCA 1S5WA 3TC6A 4DXXA 4WKFA 3EPNA 2PDGA 2DEPA 3UXLA 2GGIA 2J66A 4A35A 3CBWA 4PTXA 2NV1A 1D8CA 4C6EA 1W1ZA 3N1AA 1EJ7L 3R94A 1IHIA 4GQGA 1Q66A 1NWRA 1BGGA 4I8YA 3TROA 3CV6A 1RALA 4GE8A 2QJJA 1WAWA 3FJ4A 4KEMA 3G18A 3R0UA 4RKAA 3O0KA 3IPWA 4D8ZA 1T8QA 4DPQA 3PB2A 4PZVA 4IMGA 3H70A 2QGYA 2KZHA 2P5NA 6TIMA 5FL0A 3C86A 3TYEA 1MW1A 1NF7A 1SO6A 3LHUA 4PSPA 5LA0A 3NSXA 4FP1A 4JIHA 2FH6A 3E2VA 3AHZA 1A5SA 4LEQA 5I5RA 3EB3A 3MMUA 3DYMA 4OIFA 3TR9A 4UQAA 2BVTA 1UR2A 3TVAA 2CBJA 4WSKA 3KBJA 2W66A 2HE8A 4JIQA 3TP4A 3ZVHB 2PDUA 1QTWA 4J3ZA 3RR4A 3NQMA 4J3UA 4AEFA 1KRBC 1JQXA 1H51A 2WV8A 2PP0A 4D6JA 4HHHA 1A5CA 4LNCA 3PUOA 3TQVA 5CJ5A 2KAUC 2OOFA 2VHLA 4QSHA 4K7VA 2QJNA 3LY0A 1BTMA 1ONWA 4KERA 4CQCA 4JKLA 4YL2A 2QR6A 3W23A 4GIEA 3PSWA 4A8LA 2HPMA 5CC3A 3APTA 4TU1A 3GX9A 1I2OA 3WLPA 4GPNA 1PL9A 3G5EA 1TPWA 1ZLPA 4GUFA 3OB8A 1R3QA 3LTYA 4IMCA 5KZMA 1EOKA 4EXBA 1Q63A 4O52A 3BGJA 1YTEA 2YZ5A 1XYCA 4FS9A 1V3JA 1CXHA 1OYBA 5DXXA 3WDJA 2GL5A 4K68A 3I7RA 4DZIA 3CWOX 4H9YA 5DBTA 4QBXA 3M0KA 5I3DA 4JX4A 2OX4A 4WJEA 2NQZA 3K2GA 4ZGYA 3FHAA 1V79A 4NP7A 5GNXA 2OZ8A 3M7WA 4Q22A 3W87A 3WKZA 4UOZA 3U5UA 1A3WA 1QBBA 5KSWA 3OW1A 5CJMA 3FHQA 2F6KA 4ZQCA 4IJCA 4ES4A 3E1F1 3BLIA 3GG1A 1HW6A 4L9ZA 4JFWA 3CZ8A 4CNPA 3WQVA 4PCFA 1CDGA 2OOGA 4UTWC 4L65A 3BGAA 1M7JA 1C8QA 1FWBC 1F76A 1F3WA 4Q6XA 3MDUA 2DVTA 4S3FA 4QIUA 4F8XA 3GTHA 2V8ZA 5GVJA 4UUIA 3RO8A 3EOLA 4S3CA 1W8GA 2QAPA 4MY1A 3N34A 1MQQA 3QMRA 2E6FA 4HOWA 5F2GA 4MMWA 1KV5A 4MADA 4L6HA 4XIAA 4DUVA 1KV8A 2OXNA 3GZAA 4DN1A 2NZLA 4FZIA 1K7FA 3L2LA 2A2IA 4CN6A 1PKMA 1J8VA 3WH9A 1LJYA 3CGTA 1M5WA 1JCJA 3CHEA 4Q4KA 1K4GA 1AL7A 5L9FA 4K37A 2OEMA 3PWGA 2J74A 1RZMA 2VDIA 5C9RA 1BFNA 2PCQA 4B9ZA 2CESA 3CYVA 3NQBA 1EC9A 1UZ1A 1OGGA 4HZ6A 1UUQA 4JHOA 3HIJA 4A3QA 1UH2A 3L2MA 2Z7KA 3M47A 3QMSA 4CCZA 1EJXC 3NVTA 1ZSXA 3L4ZA 4ERIA 1GVOA 1J6OA 1V02A 1LQ2A 4TMCA 3GKFA 1YRRA 1E6XM 5IHSA 1J0KA 4NI8A 1DTUA 2EG6A 5BOOA 5I7GA 2GUBA 3FKRA 3MI6A 3KRUA 5F1UA 3MUZ1 1JYXA 2IKIA 3PHAA 2VEMA 3W70A 3UCDA 1W9VA 4JTTA 1FCBA 4TO8A 1EP1A 3V4BA 4A8RA 2I1OA 3S5OA 5LGXA 3OP2A 4BFAA 3PBVA 3TR2A 1Q85A 1IZKA 4IWWA 1OB0A 1ONRA 1P6WA 4C6FA 3RU6A 4PMUA 5IBXC 2WKLA 3D46A 3CMGA 5D2WA 3F5JA 3IVSA 1MEIA 3WENA 1H1YA 4IFKB 3SCUA 4ZE4A 1GOMA 3OLEA 5EYWA 1H7RA 2WVTA 4PB3A 4ZEPA 3W6LA 4XAYA 1IYXA 4LX4A 4EK7A 1FFRA 4AU0A 1QCWA 4HZMA 4QTGA 3NZRA 4JCMA 3PG8A 2X7VA 1B54A 4YHEA 2INEA 1GOIA 2E4TA 4XZNX 4IPLA 4Z2JA 3AYSA 1E0UA 3DH7A 4W84A 3OBEA 4LNYA 4RJEA 4BI6A 2C15A 5LNVA 5T8GA 2QS8A 2WSKA 4D6GA 1U1UA 1O1ZA 1Q6FA 5HMDA 1AZ1A 3PTDA 3URAA 4KWVA 2DY3A 3KXQA 4O0QA 4LS2A 4M6VA 1SZRA 3BH4A 3GXDA 2D3LA 3N14A 3R12A 1OC7A 2IKHA 4QXIA 4PUKA 4OT7A 2GQAA 4GVGA 4UMAA 1H0GA 1ONXA 4GZIA 2J88A 2WW5A 4YLWA 2J6XA 2W61A 1A5MC 5AYIA 3WQ4A 1GYMA 4HCDA 3TZFA 3UVIA 3LHWA 4JX6A 2YA2A 3GKAA 3QFEA 1YIXA 1RK5A 2OX1A 1EX5A 1N55A 1IZCA 4PTVA 1QASA 3MS8A 3GH5A 3W3OA 3E0WA 1XLKA 4XAFA 2EPHA 2DZAA 1GVQA 4IGNA 4MOZA 2YL9A 1I75A 1SR0A 4KETA 2OO0A 3EX6A 4LAKA 4W5UA 4JEJA 3THDA 3RMJA 3T81A 3E3HA 1EQPA 4IGMA 4IUOA 3GDBA 5A69A 4NKCA 4CEXC 2PGFA 1LL7A 1ITUA 1ICQA 4AIUA 2EPOA 1H1ZA 2WZTA 3RNDA 5E6ZA 3VDGA 4PFMA 3LNPA 2HCVA 1VFTA 1QAPA 3B97A 4JY9A 3UEQA 4CN4A 3E2QA 3CUIA 2V68A 5JIPA 4ATDA 4DBEA 2HNHA 3TTYA 4F40A 3N2CA 4JIEA 3LV5A 1E5NA 1I1WA 1PWLA 2VYOA 1P0EA 3GH4A 3WNNA 4WCJA 1GTEA 3BSHA 4Z0SA 5G2WA 1AZ2A 2ACUA 4ZO6A 3AMDA 4RR4A 4BF7A 4A21A 3HO8A 1WUFA 5CZSA 2PDCA 3UY8A 4ORIA 2E9BA 2OT1A 3PB0A 1BHGA 2J79A 4W88A 4LWWA 1TVPA 1B57A 4IIGA 1O7AA 1W2VA 2QVNA 3MC5A 2VI0A 3TW6A 1OT2A 1VEMA 1BYAA 3UXIA 1YNYA 1KM0A 1R7OA 5A8NA 2X1RA 3IJLA 4Q8NA 4CCEA 5K4XA 4A3YA 3B3DA 4J28A 4CN1A 3SUUA 5AKQA 1EFZA 2PI6A 4FK9A 2QEZA 3COTA 2CHOA 4RDYA 1NARA 4LVBA 3KCLA 1CT5A 1LTDA 1TTIA 3I68A 5F2IA 2VD8A 5ABHA 2FVLA 5A6JA 3GVRA 2D69A 2X09A 3B8UA 2OG9A 2POZA 3OQ8A 3WYZA 3V3WA 2FPTA 1R3RA 1V5XA 1FWTA 4H6KA 4E4UA 4CGTA 3DFNA 1QO5A 3TZNA 2X41A 1LUCA 3H55A 1XICA 5DT7A 3S5ZA 4IM4A 2X40A 4TV5A 3N2XA 3N9KA 4B5NA 3VIGA 4DBSA 5CSRA 4HCHA 3MUIA 3K4AA 4FIQA 2WC3A 3SGGA 4MWAB 4PB4A 2Y5EA 1IEQA 4DX3A 5DMNA 2WQDA 1FKWA 4PMDA 4MZ8A 4R7OA 4QAWA 4UFHA 3H6OA 3NXFA 5DX7A 4B4FA 3JS3A 4TR9A 2Z1XA 1Q6RA 1UKOA 4DJEA 3N29A 3FKKA 3N13A 2WMHA 1D2KA 2RAGA 2YJQA 2GSHA 4URIA 2UY2A 4PTNA 1R2TA 3KVLA 2Z1KA 3OG2A 1TZZA 4J27A 3ZJ7A 1V6VA 3RITA 3W53A 4EKJA 2OB3A 4XK2A 3ES7A 4ZQMA 2EG8A 3KCOA 4TTGA 1EPXA 4CKQA 3EDJA 4AWSA 3NYZA 4NJGA 4O8AA 3C2YA 1RA5A 3P5YA 4CQ9A 1J18A 4AIBA 1WKFA 4M82A 5A95A 1OFEA 3L4YA 1FA2A 4PYSA 3UESA 3ITLA 3FGCB 3WLIA 4ZSTA 1HKKA 3ZR6A 6XIAA 5D02A 1QRQA 4TTUA 3HG2A 4KEVA 3HM7A 1J5SA 3GG0A 5D09A 1V3MA 3CV7A 1DQUA 3VI2A 4Y96A 1H5YA 2HMCA 4M56A 3VKAA 3LXAA 2DT3A 1UPPA 5I03A 3HV8A 3R0DA 3JR2A 5BROA 3P62A 1GKQA 3ALFA 2ZUWA 3RILA 4QJ1A 5HJLA 3MSDA 4F0KA 2IQDA 1DE5A 3RU8X 3G77A 3TW9A 2QPXA 4PSRA 2P0OA 5M2FX 1QPOA 4PTMA 4I3GA 3OEXA 4V2XA 3NG3A 3F5LA 2OQLA 3BCJA 5EPDA 1QNSA 1K9FA 1S2UA 1KBIA 1BGAA 4LVGA 4BEQA 5FF4A 4X0VA 3AHTA 2ZC8A 4TVCA 5HPCA 3IJ7A 3DFSA 1I2RA 1XBXA 2REQA 3OZMA 3SJNA 1B2YA 3KL3A 2Z27A 2WBGA 5FKYA 1OFAA 2CLEA 1FXQA 2Z1WA 3LZ3A 4AC7C 1EJRC 1O6IA 5E09A 3KBNA 1M03A 4H8VA 4LOCA 4H7CA 2AAMA 5J5DA 2V81A 3VGEA 1TPFA 2RHGA 2GUUA 4C1KA 1ISXA 2ZUUA 3T8LA 2Y89A 3S5YA 1FP8A 4GY7A 3BANA 3T6CA 4PMOA 4ACYA 5HUPA 3GR4A 2Y5SA 2Z0IA 3QR1A 1XIIA 3F2CA 1GOQA 4JOMA 3WO8A 3PNUA 2AL1A 4C65A 1KXTA 4JNYA 4UTHA 4O28A 2W6RA 2OWXA 2DP3A 5FJPA 3UWQA 4GO8A 2EG7A 4OFCA 3V0TA 4JTGA 1G9HA 4FLRA 2Y63A 4J1OA 2MNRA 4TXEA 3ITTA 5FEXA 3ME3A 1SO3A 3RCNA 3RO6A 4I7WA 3NL2A 2FHCA 3V7PA 1OQFA 2F84A 1S5VA 2CCRA 3RFAA 2I56A 1L6YA 2J7CA 2WAGA 4B5VA 1AD4A 5KMYA 2QIWA 3U2ZA 4Q32A 3CB3A 1YDYA 3STEA 1T0OA 3TH6A 2QUTA 1TG7A 3GDLA 3FFSA 1KXVA 4N2YA 3HG3A 4HBKA 3L7RA 3P93A 1PXGA 3Q37A 3BO9A 3FNDA 1FFQA 3LCFA 3CTTA 5A2BA 1QI3A 3PZIA 2DT1A 4ML4A 4J2MA 3U6WA 1K6AA 4E4FA 4Q8MA 3QR0A 1NY1A 3FDKA 1S38A 1AL8A 5I3HA 2V5KA 3AWNA 6CGTA 4DUOA 1KLYA 1WP6A 4ML9A 1WXYA 1EBHA 4GIAA 1TVLA 1KFWA 2Y8KA 1P0DA 5U7SA 5C70A 5HINA 4X9YA 5HJXA 3N18A 2GDQA 3TAKA 1FWWA 4QITA 3P84A 3R0KA 1YE6A 3SRFA 2ISSA 4JQ2A 5A5WA 1LYXA 1VD6A 1EDGA 3CL7A 1M65A 4XKYA 4D71A 1Q3NA 4W8LA 3EGJA 1ZB5A 4XG1A 3GHRA 4YYFA 1OSEA 4L80A 3UWVA 5EFDA 3V1PA 3NM3A 1XIFA 4IL2A 2YBUA 3PZUA 4D2JA 2NXGA 2Y1HA 1JYWA 1GKPA 3LDVA 5HK4A 5CSSA 4Q8TA 3ZXWA 1JGIA 2WMJA 5EA9A 3QGKC 7TAAA 2QDGA 4B92A 2BY2A 4MB1A 3LS9A 4FI4A 1Z48A 4MWAC 1UWAA 8TIMA 2V69A 3G1SA 3M0IA 1E70M 1HNYA 1L6WA 1V3IA 1KM1A 2HTMA 2Q8LA 1U1HA 5E6YA 2QCLA 5CPSA 3L0NA 3KCJA 1H09A 5D8WA 4TOQA 4JTLA 3CUJA 3IK2A 3W9ZA 2XN0A 2YDRA 3QQ0A 1TWZA 4P8WA 2Y7FA 1C92A 4MAVA 2D0HA 2ABAA 2XVGA 3DN5A 4U2ZA 2XIJA 3CWHA 2EEXA 3CASA 3L5LA 4S3JA 1D7KA 2Y70A 1UR8A 1XCWA 1WDPA 2C3ZA 1OT1A 3KOWA 1PHWA 1KCLA 2YLLA 1PWMA 2Q8ZA 3R1ZA 4HPJA 3LLXA 2C13A 3RIKA 3WDPP 1M1BA 2D3NA 1T40A 1W5MA 4W85A 1BD0A 4H2HA 3TKFA 1EBGA 4N0RA 4GH3A 4BF5A 3LMYA 4KWWA 3VAVA 4CLMA 1KKRA 5DMLA 4D1IA 3QY6A 1R6WA 1KCXA 3Q45A 2PRHA 3WNLA 1EYWA 2ALRA 4XV0A 3LRMA 1P7TB 5IXEA 4AG0A 1VBUA 3C2RA 3NURA 3GDMA 1X1ZA 3LK6A 4IIHA 4PEEA 1KLZA 3GNOA 2L5HA 1C29A 1NDZA 2FH8A 1UIPA 3S9ZA 4G1NA 4JTAA 4C1LA 4NILA 1VAHA 4MAZA 3N6JA 1H7PA 3KWXA 3T55A 2PPGA 4B91A 2OGYA 4GQ0A 1K8CA 1NSJA 3B04A 3LCGA 3LENA 2DW7A 4AC1X 5AC4A 2QCDB 4MNJA 3KFTA 4M8UA 3LGEA 8CGTA 1UG6A 5G5IA 3W26A 4BKNA 2A3BA 4OTKA 4QG9A 1XLHA 1XLFA 1UHVA 3MI3A 4B5UA 1E1FA 2DU2A 3ZZ1A 1D9EA 5A3HA 2J6VA 3CC1A 1GJWA 3NGJA 3H26A 3ABSA 1CGYA 4NNAA 5M5DA 1FWDC 3KZSA 1VCVA 4LVDA 5HA7A 3WBAA 3EWXA 1NEYA 3GYCA 1MXDA 3ARXA 4NHVA 1W6TA 1J6PA 3AIEA 4H8NA 2Q3OA 3MPGA 5AFDA 3Q58A 2NLYA 3SSJA 3TJ4A 3L4TA 1VS1A 5H91A 3WL1A 5U4NA 3R8RA 2PFHA 2YCEA 4Y7EA 1VR6A 4GISA 1CENA 5HMSA 4ERGA 2FMOA 2MANA 4XBJA 3MVIA 3O0FA 4PE8A 1MDLA 4US5A 5KINA 1DP0A 4Q4MA 4RDWA 2HK1A 5DO8A 1A53A 3TJLA 1WB0A 2BOFX 2YB4A 2QQ6A 4MY9A 1TIMA 1EB3A 1UC4A 5EMJA 5I06A 1RCQA 1TSIA 4DZAA 5JUVA 3SDOA 3M43A 5CZ0A 4ZMGA 4PMJA 2H3BA 3DGRA 4WSHA 4IIDA 2G50A 3ONBA 1Z41A 4I8DA 3VUPA 3C52A 3O6CA 3EA1A 3OBKA 1CXLA 5CGQA 1JPMA 4O8RA 4R27A 1UASA 3PJTA 1R38A 5AOUA 1OABA 1MNSA 1JEZA 2A4AA 1TTQA 3EOSA 1F6YA 1AODA 1F4AA 1FWJC 4UTFA 3H8AA 3ZQ9A 1LG2A 3VZZA 3LBCA 1OGSA 1VJSA 3NA8A 2WSRA 2CLHA 1G67A 3GIQA 3RM9A 3DKJA 1Q6GA 3MCOA 3TAOA 4QLJA 3FIGA 4AD1A 1R86A 4QSFA 1KXQA 3BLEA 4C6OA 1R7AA 4MVAA 3KBWA 3BXWA 3QKZA 5DT5A 1AG1O 4PBFA 2ADAA 3M07A 2GUYA 3M46A 2GJLA 3DFTA 5L6UA 2AQVA 1KGXA 3GDKA 4KCTA 1AK5A 3S47A 3PZQA 1W91A 3G8RA 2WHKA 1P1XA 5EMUA 3FJLA 4UNKA 4NAFA 2P8BA 4WVXA 3GFXA 3WNOA 4DXVA 2WHJA 1SZEA 3GU2A 3EA2A 2FKPA 1S5TA 3CUHA 3FVDA 5BNKA 3MP4A 2UY3A 2FGZA 2XUCA 3ARPA 1KNWA 4HU3A 4LEFA 4Y9AA 1HX0A 2O0TA 2E25A 5HQEA 4NIRA 1B9BA 2XM1A 4DLFA 4XIMA 3VO0A 3BQ5A 2XSXA 4NJKA 4FMVA 1IT7A 1ISZA 4RV8A 4Y9MA 4AVFA 3A5VA 3MSRA 2E77A 1RAKA 4OQVA 2C7FA 4X2RA 1P1MA 5CPLA 3AMLA 3VZYA 2UWFA 1TV5A 3CQHA 2HJPA 1YPFA 1JYNA 3LV6A 4WKAA 2GWNA 5CG7A 1O60A 4TVDA 2PE4A 3ID7A 1TA3A 2Z29A 5A8QA 3XISA 4PUMA 3PN8A 4LCRA 3PJWA 1HJQA 2PLCA 3IJ8A 3UR5A 4J3VA 2HROA 3EX4A 3GTIA 4MJMA 4NZCA 2V30A 1JZ2A 1E71M 4W87A 1QW9A 1J10A 1GJPA 4JQAA 1W1IE 1IXPA 3VGBA 2G8ZA 1AH3A 1W54A 2XIQA 3PZGA 5A6SA 4JKMA 1JD7A 1OFRA 1SFLA 1XH2A 1JCXA 5CGMA 3L12A 4JTUA 3P74A 4S39A 4NSBA 1XDJA 1TMLA 4Y9PA 2RDWA 1RVKA 5C2CA 3OPSA 3STCA 2DZTA 2PGEA 3ATZA 3GHSA 3IIXA 1EA0A 1H63A 4HHLA 3LPOA 1F4HA 4N6EA 2HXUA 3A47A 3PF3A 4KWSA 3OIXA 3FVMA 4B5TA 2ZVIA 1OZMA 5D2TA 2FQIA 1EWDA 3VKCA 4IQEA 3AZRA 4KEUA 1Z69A 3WEOA 3EA3A 3W37A 5AY7A 2QPSA 2CWXA 3QV8A 4ZQRA 2GGHA 5HNTA 3UD6A 2NVDA 4F0LA 3STPA 4GJ1A 2X1SA 2D20A 4WY0F 5JH2A 5F4SA 1ADOA 4IOTA 1FHUA 1J01A 3UU0A 1JUEA 2R8WA 4AQLA 3CL8A 1IEWA 4RW3A 3LSCA 1VYSX 4C1NB 3CPUA 2CLMA 2VVNA 2YXGA 3G6MA 1HXJA 5A6TC 1B5TA 1NVMA 3VD7A 2CFFA 5HANA 4XVEA 2NW0A 1T41A 4JTKA 2DUZA 4PTDA 3A21A 2XFRA 2XVPA 5AHNA 5AZ1A 4NZFA 4XKYB 3W7QA 3UYIA 3VGGA 2JIWA 4N6FA 3DFOA 3I3BA 3NDZA 4XO6A 3KEHA 1U33A 3IGUA 1W37A 1MW3A 3AS3A 3DI1A 3VIJA 4LAZA 1KKOA 1VHNA 4X60A 1H49A 3WNMA 4UZUA 2I17A 1E6SM 5IM51 4PL1A 6XIMA 3FA5A 5DY3A 3UJSA 2Z1VA 4D6CA 2NXIA 1WX0A 2FGBA 2KX9A 5CC7A 4U2YA 1DXIA 2FIQA 4BCEA 2VUNA 4V1YA 2ZRYA 2CIPA 4GYPA 2ZUTA 1XC4A 4HA3A 1H7NA 1RP8A 4DF1A 3H2EA 2RKXA 3MUAA 1XUZA 8A3HA 5FJTA 3LHVA 2DUXA 3VNJA 5GNYA 2I14A 3EPMA 2OWWA 2W91A 3W1MA 4DJEC 4E2BA 1SFJA 3BW2A 3TE9A 4KCVA 2PRMA 4QLKA 4GUHA 1UW9A 4CUCA 3UNDA 2GQ8A 4EE9A 2DIEA 3S3GA 2YCIX 3JUGA 1V6WA 4UC5A 2W0UA 4MFEA 1ICPA 1PX4A 4J3XA 3WH8A 3Q2DA 3B03A 1ZCOA 4L9YA 3V5FA 1K02A 1KO0A 1VHCA 1IXNA 3PBYA 3LERA 4EACA 1VGAA 2QLYA 5LXXA 3NZGA 4Z0JA 3VOJA 3H2CA 1NELA 2OQHA 2VEFA 4P7OA 2G3JA 1L6FA 2WM0A 2V2HA 3LD5A 1W8SA 5EFFA 2JIEA 1U83A 4UTUA 4UR9A 4B5XA 4YTSA 3IRDA 1KGWA 2F6XA 3EX2A 4C6PA 2XTKA 1VYPX 3MYPA 1MQRA 5I2UA 1F3TA 2GJXA 3KLLA 2XJ7A 2V38A 1ITCA 4RNHA 3H12A 4KCUA 2X8RA 3PZ9A 1FDYA 4O1AA 3A22A 4JZ5A 1PV8A 1E43A 4FO4A 1DKWA 2ZCGA 5EL1A 1X98A 2W79A 4FX6M 4PMZA 3V36A 1PCKA 3BDKA 2CBVA 3NQ2A 3HBLA 3OHMB 4GZJA 2ZX7A 1RJPA 1IGWA 1I9CB 2AL2A 3VA8A 4AISA 4O0ZA 1HL8A 4IXHA 5GNZA 5I3JA 3SCTA 4Y9OA 2IW0A 1UMLA 3Q94A 4QDMA 2B7QA 2Q02A 3B9NA 2CBIA 2V5BA 3N11A 1OYAA 4UB9A 2A3HA 2ZZ7A 2ZOXA 4BWLA 3WJSA 3QJAA 1UWUA 1V93A 2YDAA 3S83A 4KRTA 3WK0A 2A3CA 2OQYA 2BNJA 2Z25A 3H21A 1NP0A 3OQEA 5D04C 4BF9A 4Z1DA 2OODA 5FEPA 3MKKA 4R7JA 3L65A 1VPYA 3HGRA 2GGEA 3WDRA 4GHRA 1WCGA 4HB7A 4D8LA 1VPQA 1H61A 3CO4A 5I3FA 3CPGA 3KOYA 3R6IA 5F4XA 2ON3A 1KTCA 4IP7A 2FZNA 4W8BA 5AHIA 4UQBA 2VQUA 4WDXA 2ZVRA 3WK1A 1HIZA 5AB3A 3TN3A 3GG8A 3QM3A 4HK6A 4QG6A 4ZQNA 1JAEA 2GZXA 2YR1A 2Z28A 3VFCA 5TF0A 1UD8A 1KFBA 4D6DA 4U3AA 3T9PA 1V8EA 1SSGA 2E6DA 3P60A 4GVIA 2F9RA 2QXWA 2YYUA 1KW1A 3TLQA 2PLJA 3DC0A 3AIQA 2OKTA 4WIWA 2RJGA 3VIIA 5E5CA 2A5HA 3W75A 4IMDA 5M17A 1HJSA 3C5QA 1VBHA 2ALDA 3P5ZA 1FWFC 3KVMA 1E9LA 3B4UA 5CC6A 2INFA 4HHMA 4DLMA 3YPIA 4N9BA 4MDOA 3RPDA 2BXVA 3W7JA 1VEPA 3PAOA 4IMAA 4JHZA 3UXDA 3E0FA 2V5DA 4NXKA 2HQAA 1AMKA 3UT0A 1YE4A 3VD3A 1LT7A 4BY3A 4XB3A 3VD9A 4PN2A 5IDZA 1GVEA 4Z2GA 1XKJA 4QEEA 2FTWA 3MZ2A 3TN4A 4GXPA 3UJEA 1QATA 1QR7A 3RRXA 2BP1A 2VFEA 1XC6A 3ANYA 1WOBA 3OLGA 3KDNA 4BS0A 3P2VA 4ATLA 1SGJA 3DGBA 3AXXA 3WJZA 4Q4PA 3SGZA 2GSJA 5C55A 4Q8PA 2VKZG 3B8SA 3NUKA 5FF7A 3VXGA 3LGDA 1CWYA 1ZGDA 1GWJA 4AYSA 4ROPA 2QMJA 5CLTA 2PURA 1IE7C 1FDJA 2ZKMX 4KKXA 4DJFC 2C16A 1JZ3A 4JQ1A 3B0XA 2DZVA 4W7WA 4UXDA 7ENLA 4NAFB 3RCMA 3BLOA 3OVQA 4J40A 3G3MA 3O63A 3VABA 2A3LA 1ZBWA 1C9WA 1EEPA 1XLIA 4UCGA 3W1UA 2RJHA 3GO2A 3QZEA 4BQ4A 3AC0A 2XN2A 3M16A 4O1EA 3KUMA 3WUEA 4BZYA 1K9TA 3R8HA 4X3ZA 1GZGA 3UNTA 4M7TA 4Q6JA 3G0XA 4QEHA 3ARQA 2C1IA 3UJRA 4A2SA 4L4OA 2WJZA 1X38A 1LP6A 4A8IA 3G1DA 3GC5A 1W1VA 1YDOA 2WNWA 4BK9A 1EYEA 4H6RA 5LNWA 1AFSA 1HGYA 4GJIA 2V3GA 3RX3A 3WD1A 2JF7A 3PBUA 4A3HA 3GQYA 1J0IA 3KP1A 2DZUA 4UNLA 1OK6A 2V5JA 3HFYA 4A29A 3QXBA 5XINA 5CQ1A 2BFGA 2G4JA 1JR1A 4H9ZA 2XIOA 1WAUA 3QPZA 2FJUB 1FWNA 3VK5A 4E3TA 2NT1A 4C5ZA 3WCZA 1PUDA 5DBUA 3V75A 5CPTA 5BCAA 4GC3A 1U22A 4NVTA 4E8GA 2XISA 2HK0A 3T1GA 2C91A 4NAEA 2WJFA 4QE1A 2BHUA 1YEYA 3DHUA 2DSZA 3IS4A 3ZSTA 3WD2A 4FXSA 1OHLA 1HUVA 4GY0A 3OTRA 1GCYA 2F8QA 2VELA 3NL3A 3E02A 4LVFA 2QV5A 2QDHA 5DMMA 3U0HA 2E09A 1TIWA 3KBVA 1L9WA 2PAJA 4FOKA 4IQDA 3WFZA 3OJGA 4L4LA 2AQWA 2C1GA 4NT0A 1VFLA 3MZNA 4UTWA 3L2IA 1QPRA 4O12A 2ZZ3A 1EF3A 1V02E 1U5JA 3ORWA 5I09A 4AMAA 2GGJA 5C9UA 4KBXA 1W1YA 4LF2A 5H1WA 2RFGA 3MUXA 4XZHA 3RM8A 4RX0A 3W81A 1XXXA 2DSWA 5TQLA 3QF0A 2ZRUA 4WGXA 1S2WA 5F2LA 1RSCA 1AQ0A 2G3MA 2EQDA 3LZ5A 4PR4A 3S1GA 2FB2A 3LBMA 1MRAA 1R9XA 5I6SA 1YHTA 4MGGA 1DJNA 1VFOA 3FCPA 3IRSA 3UWWA 3PM6A 1JGMA 4E3VA 2VRKA 3TFXA 2XWDA 2F61A 2BGSA 1NFPA 4FSAA 1U30A 5AYYA 1TR9A 5G2HA 4MNMA 3C0JA 2ZWYA 4H9TA 1KB3A 3VKJA 4FPSA 3FYOA 1PS9A 2XM2A 3OA5A 4LVAA 3NEHA 3MVTA 3L5MA 3TYAA 1UYQA 3MBFA 3MHFA 4UTTA 1SQ7A 3OZYA 4DJED 3M64A 4RXGA 4P7QA 5D30A 4E2OA 4YNGA 1ZFJA 5DANA 3V0UA 1P0BA 1A5BA 3ZLHA 3MKVA 1V0LA 3UP8A 1WKYA 2C0HA 2ZZ4A 4JKKA 4EAMA 4F2BA 4Q7NA 1QUMA 5BYWA 4BI5A 1O5KA 3FSTA 1B3YA 3EB2A 4QJ5B 1XUUA 2Z4GA 3CQJA 3V5CA 5E0FA 3HQ1A 2GOKA 1X6NA 4JYFA 1MI3A 3BAJA 4LUYA 2XFWA 3T40A 3RJYA 1E6QM 3A5FA 3J7HA 4U5IA 1EGVA 1DE6A 5IBXA 4AY1A 5BOEA 3G24A 4O53A 1XQLA 2XZ7A 3EZ4A 4W86A 1MRQA 4ATWA 3VMNA 5FOOA 1PAMA 1Z8AA 4IGSA 1VH7A 4HPHA 1GGOA 1XHGA 2EHHA 3KL0A 1FHLA 3HPXA 4TX8A 3WFAA 2PDWA 3T8QA 1RJRA 3F2DA 2ZX8A 5C0QA 1UR9A 1QU4A 3MMWA 3CTLA 3FV9A 4Q4SA 1SO5A 1DJXA 1DQXA 1PIGA 4ZENA 4US6A 1MFVA 3VDCA 3N3MA 4AUBA 1H62A 1YTKA 2RGLA 4LAOA 2X0SA 4JQ3A 1QNPA 1U5HA 4MJ4A 2PWDA 1ODZA 3LRLA 3PWIA 4AVNA 3CB8A 2VC6A 2G3FA 2PGRA 1DJIA 3QEZA 1NH6A 1W1A1 2OJPA 5I00A 4MG4A 3P0XA 5CH9A 1C9DA 1Y0EA 3VVGA 3INPA 8XIAA 4LBSA 1XWYA 1G4EA 2FGLA 2ODOA 1RUSA 2GJRA 1SZGA 4EWJA 3MJYA 3ZR4A 2GJXB 1VYRA 3M5VA 2J7BA 5AHEA 1J2BA 4AFYA 1LL4A 2ACQA 2OZ3A 3W74A 4XSMA 3B8IA 1N8IA 4GGHA 1NDVA 1Q4NX 4UQ9A 2IPJA 4A6GA 3GAYA 1E3XA 1KRCC 2Z1BA 3TLLA 1DJGA 3KZPA 5AYBA 4AW7A 1XBVA 1QFEA 1WQ5A 1FWAC 4YXGA 1JZ4A 4F48A 4DYJA 4PMVA 1IWAA 2OR2A 5DQPA 5A2CA 4O10A 3QLDA 3KAOA 4D6EA 5F7UA 1AUSL 3GR7A 3N2BA 1CTNA 4EAYA 4O4VA 4EIVA 3IAQA 3VILA 3SURA 3TMLA 4BA0A 4RXFA 2WWDA 5SWUA 2V0TA 4UQEA 1FH8A 1CZ1A 2UZ9A 2F7FA 3MW7A 5E93A 1POJA 1RXOB 1Q7QA 1ZBKA 4FEZA 1D3CA 1SZFA 5CAHA 5GJPA 1CW2A 4OZOA 2JALA 2YA1A 2V82A 1ZPTA 4JHMA 1VZWA 4M6PA 2PDXA 4J3TA 2QCMA 2WCGA 4K3ZA 2J7DA 2P3ZA 3WF2A 3K4DA 3FSUA 4I7UA 4R53A 2EBNA 2Y0FA 2OLAA 4Y90A 4AD0A 4O1CA 4IFOA 4KCWA 2Y7EA 4DZ5A 4GUJA 2ZC1A 5D32A 3TOYA 2CLIA 1ZU8A 1Q45A 1I2QA 3AU2A 1TWSA 4LTSA 3BOFA 3EBVA 4PC8A 3TQ0A 3LCLA 1QT1A 2VQTA 2JGQA 4UOQA 4C6JA 3H2OA 1PIIA 3TXVA 3HQOA 4S3AA 2W3ZA 4O14A 3VU2A 2YFOA 4NYYA 1S3TC 2ZA3A 5E9XA 4PCNA 2PMQA 4UTMA 2AKMA 3A9IA 1FCVA 3N3TA 3SO7A 2E5CA 3RPTA 1HJXA 5C5YA 9RUBA 4AEOA 5MKGA 4KWOA 4DJFD 3AISA 4CCCA 2PLMA 1V08A 5GJNA 2OWCA 1XD1A 3R25A 3W86A 1TKKA 2ZZ5A 2ZDSA 1TTPA 1AQMA 2D2OA 2QUVA 1H4PA 1A5UA 4K8HA 3MB9A 5HMEA 3ZYZA 3GXTA 1TVNA 1NDYA 5JBEA 1XV8A 3G0SA 1GONA 4AZCB 3ZLFA 3K1DA 2PC4A 1Z9AA 1T99A 2CETA 4YVVA 2NWSA 3BICA 5GQBA 2RH9A 3PPFA 1E9YB 4W5ZA 4W9TA 2FVKA 5FAGA 3WBWA 1SW7A 1TPB1 2TRSA 2E67A 1C90A 1XRSA 5DN1A 1U1JA 1SMDA 1CGTA 1LQ0A 1XIMA 3W7HA 5GPRA 2DV0A 2G0WA 3HB9A 1SPQA 1BEUA 4K1GA 4CCDA 3REQB 5GJMA 4JPGA 1J0ZA 1LT8A 5CKSA 3TN5A 1B3VA 2E1WA 3IUHA 3N2TA 3PUGA 1XFBA 4UFJA 3HURA 5TBOA 4PUEA 3PFMA 1ZY9A 1PTAA 1XI3A 1OJXA 1XYZA 3PC0A 2VZSA 1ZJHA 3GK0A 1GQNA 3S2NA 1E73M 5LNSA 3ITOA 1GQIA 1K8XA 1EL3A 3VE9A 3ZIZA 3NTYA 1FX6A 3MQTA 1XBYA 1V0KA 1A5NC 1BF2A 1I8JA 2EPKX 4HNCA 4S3DA 1AH4A 2HBXA 3T2PA 2BV9A 2YZRA 1K7EA 4M29A 2DQWA 2ZXDA 1XYLA 2BDQA 3UG8A 5BOFA 4IFKA 4C6CA 4M7SA 1F6KA 1E0WA 4MB4A 3P7YA 4M3PA 3W02A 4UQCA 2GSEA 3EWWA 1D3HA 1MWOA 3TC7A 3UF9A 3THCA 1W56A 1EJWC 3E96A 1F74A 4XVDA 4R34A 2WPBA 1UA3A 4H8HA 2ZX6A 2YL5A 3GNXA 3WF1A 4DO6A 4NAEB 2BXYA 3SN4A 1Z6KA 1KR1A 5CC5A 3P82A 2WCSA 4H9UA 4XKMA 1IGSA 4CQDA 4K8EA 4MJ2A 3QW3A 4OUEA 4LCSA 1CXEA 4GKTA 1RCXB 4A05A 1V51A 4YVPA 2I5GA 4JTCA 3W38A 4B9YA 3PY2A 1SO4A 1XLEA 3U2EA 3IVTA 3HTWA 1L8NA 3CV1A 1CB2A 2X42A 3F5KA 5IFPA 5H8UA 3EDEA 3RDKA 4HQVA 5HR7A 1KFEA 2DZWA 3PUDA 3AROA 4ZTXA 3AWOA 4C6NA 1NF0A 3PTMA 4OOZA 2OYMA 1AJ0A 1MNZA 4F2UA 4PMQA 2O9PA 2QCGA 4S3GA 3CM4A 1QMLA 3V1HA 1JRBA 3GU1A 1TX2A 3QGVA 3BCFA 3BOLA 2VRJA 4O19A 5KZ6A 2WKGA 2J9ZA 1G01A 2SFPA 2OSYA 1DYSA 1XLBA 4S3BA 4KEZA 1GHSA 3C0QA 2YW3A 4JICA 2CEQA 2DJLA 3DDMA 2V3EA 1TWWA 5CZJA 2D1ZA 2DZPA 4BWLC 3FLUA 4US5D 4AD3A 5FF0A 1HGWA 5XIAA 2WSQA 4GA8A 4LC6A 4NXSA 3PULA 1HN1A 4XD5A 1MVYA 1OY0A 5A6BA 3APGA 3TYDA 3G1VA 2EJ1A 5EMKA 3MWAA 4UMCA 4UTKA 2R1LA 1TCDA 3DYPA 1BVNP 4TMBA 1Q6QA 4N7QA 4PBGA 3A4AA 1TTJA 2PTZA 3VC5A 1ONEA 4LQ1A 2FFCA 1P5BA 1HQTA 1MW2A 2ZE0A 4U33A 1Z44A 4UOJA 2QUNA 3USBA 1ZNNA 5AZ0A 4Y2WA 1UP3A 3GXIA 1KBLA 1A4LA 3AI0A 3DERA 3UA3A 4DYEA 3QGAC 1JI2A 3HMCA 4H6EA 1FWGC 2YSWA 1NQ6A 2WLYA 2V63A 1HJWA 1ZUAX 2CKRA 1LF1A 5REQA 2VC7A 1V0MA 3HPAA 3II1A 3GBEA 4IHCA 1P6CA 1X39A 3RLHA 3QC3A 3BQ6A 1X97A 1EZWA 3VMPA 2FLIA 4DAFA 3UW6A 5CPMA 3DFHA 5TAOA 5HWJA 2JEQA 1S5NA 4QROA 2J13A 2I5IA 5LIXX 4GLEA 3HPZA 2FVMA 2V2DA 4FNPA 2NX9A 1E4IA 3QRHA 1XRTA 1QHOA 5ECUA 1OFBA 2IQTA 4GH1A 1OX4B 4OOUA 2O4QA 1MEHA 6A3HA 1CECA 1TV2A 4YS1A 4HPXA 3V35A 3VOFA 4UTIA 1H41A 1H0IA 1JCLA 5JU6A 3SZ8A 3S5NA 1PZ2A 3P8JA 4QISA 3NOYA 3H4XA 3NEVA 2PTXA 3RN6A 4AHOA 3K46A 5DMYA 2BLEA 5I79A 1PJ9A 2XFYA 2XIIA 4H4IA 4B5WA 2D24A 4GFSA 3U3HA 4N9DA 1KFCA 2XPKA 2ABBA 2FTYA 4JTSA 1V3LA 2PWHA 3XINA 1QBAA 3M5ZA 3QV7A 2OTDA 3MWCA 3AS1A 4G7FA 3DHPA 1JXJA 2BZNA 4MWAA 3A64A 1RD6A 4GX9A 4RW5A 2B7PA 4ICCX 3THAA 1O4UA 3VE7A 3UR7A 3LQGA 3UPBA 3VNIA 3VIFA 1E15A 4KGJA 2QAFA 5IDIA 4IUGA 3T44A 3RM4A 1ECQA 3NZPA 4IIEA 5KZEA 4J2PA 1J0HA 1WXJA 1DIOA 4DUXA 3PZNA 4PUUA 3O9NA 4YYCA 2WK2A 1WA3A 4GMEA 3PZOA 3GNPA 1UWIA 1OFQA 3EEGA 4E38A 2J8TA 3QW4B 4FAMA 3H24A 2CERA 1IEVA 2NSXA 4M6QA 3IGSA 1RY0A 1UD4A 2G3NA 4L9XA 1OINA 1AQHA 4P61A 4ZB5A 3U7VA 4OE7A 3P6LA 1GZJA 4A3UA 3W71A 3OU8A 2WJEA 5G2IA 4DI8A 4HZ7A 3A12A 3HN3A 3C4UA 1GQLA 1R9ZA 2QCHA 3FGCA 5T91A 3K8MA 2DJXA 2VZOA 4M51A 4BEUA 3PG9A 2VZTA 4IIBA 4MB5A 2J8GA 4ALDA 2VC9A 1DOSA 3MV11 1KC7A 1JDAA 2HPIA 3K1GA 3OZOA 3GRIA 4P7RA 2OEKA 3GW3A 3B8WA 2WMKA 3W2KA 3TJXA 4WZHA 5CAKA 4NQ1A 1PHQA 2GDUA 5LXEA 2QF8A 2HVNA 3UR2A 3D0CA 1HFBA 4Q7IA 1Q6CA 2DSUA 4INFA 1M6JA 4GD0A 3P81A 2ISDA 3DKLA 1JYVA 1OIFA 2RUSA 2VRQA 3PSVA 1YXDA 4UFKA 2HISA 1M68A 4LUSB 5I77A 1KWKA 3BAKA 3CEUA 3LI1A 2X30A 1MW0A 1NWUA 2WHMA 2DSVA 1FOBA 3F4CA 3TWAA 1CXFA 1JCYA 3CMJA 2NQHA 2VDHA 5D05A 1K9EA 1JIBA 1YDVA 1J93A 4AD5A 1W3TA 3EDDA 3NSNA 1I0BA 5M1TA 3SUTA 2G4FA 3BG3A 1Q7MA 1NIUA 2P53A 1VB9A 1US0A 4E2DA 1TWDA 3P14A 4EOUA 1M41A 2XH7A 3EWYA 3SSZA 1E6ZA 2OO6A 2WVVB 3WN6A 2X1IA 2YBVA 1L6SA 4JFTA 3C2VA 1Q6LA 3VNDA 5AC7A 3CZJA 4ADUA 4GI9A 3BWWA 1R5YA 1PSCA 4RCXA 2QMKA 5MKGB 4B3LA 3VOGA 1X7IA 3B06A 2BTMA 4PCSA 4E8DA 1TFVA 1EH9A 1V6TA 3IV8A 3CK5A 2FHBA 4LB3A 3WMBA 3FXGA 4BQ3A 4FOJA 1TJPA 2Z2UA 3SN0A 2OLSA 3VKDA 4WKHA 1UBSA 2VC5A 2NVCA 3PJUA 4DELA 4NYUA 4AVOA 4B4HA 3E5PA 3KDOA 3IWPA 4OV4A 4B3ZA 1ICSA 3SCRA 4JIRA 3QH2A 2QIIA 3I4EA 2BHYA 2ZRXA 3MP3A 3PZTA 1S39A 2WNZA 4Z17A 1QPKA 2JFEX 1E0XA 3MMTA 4C91A 2BVYA 1DWIM 4LY4A 4J5NA 5EKYA 5HNNA 1OM0A 4AZBA 1KM2A 3CHFA 4PODA 2J4GA 4UTTC 1YPIA 4EPKA 1NFBA 4H9VA 1HL2A 3UCQA 4JGDA 4OU1A 3TYZA 3P8IA 4CD4A 2QULA 5IRPA 4OBRA 1KTNA 4PEKA 1E6NA 3G1FA 1V3HA 3MMDA 3TA6A 3NQFA 5C8BB 3WMCA 3FAWA 3DHDA 6ALDA 3FN9A 4LYRA 1BTCA 1OF8A 1JDDA 3O6DA 2VWTA 4L64A 4UCFA 1GQKA 2PDBA 5CXPA 4H04A 3G1AA 4C60A 1TUXA 5FA5A 3VNMA 3WD4A 3O07A 3B9OA 4NASA 3G3DA 2X16A 4HYVA 2Y7GA 4CEUC 3GC2A 1S1RA 3WQCA 1TE1A 3N9RA 3T78A 2VX7A 4J7RA 2PEVA 3UG4A 3V0SA 1HG3A 4L61A 3MI2A 3L4VA 1KXHA 2H8ZA 1L6GA 4QNWA 3NPWA 4QAIA 1G94A 5HUOA 1OCJA 2XHYA 1ZAHA 3BV4A 2PDYA 3ITGA 1A0DA 1EP3A 3NL6A 2INZA 1PB0A 1DTNA 1JXKA 1TMQA 2A79A 4L1XA 2ZX9A 3WQ5A 3W7OA 3UZ5A 4B90A 2VFHA 1GOKA 2E0PA 1OC5A 1XLAA 3S6OA 4FX8A 1W32A 2C1HA 3BL3A 3W88A 5AHLA 2OZTA 1WDRA 1DWGM 2TODA 4ICNA 4U4MA 3BTNA 3N6QA 2E6AA 2VEPA 1JQVA 4HPGA 1EKOA 4BQ2A 3WLSA 3SRHA 2YKKA 4DZHA 1J79A 2OLHA 4NZ5A 4Q4OA 1EX1A 3CZEA 4PUNA 2R1PA 3A13A 3GXPA 1DPMA 1ZAJA 1VC4A 3IAPA 4PUDA 3M0YA 3ITCA 1F05A 1QK0A 3LGGA 5HQLA 1EJTC 4O57A 1A3XA 2BY1A 2H9AB 4MTVA 5D38A 4FLSA 3BMVA 3MT1A 4B5SA 2Y8UA 1QOXA 3W82A 4F0SA 3AIWA 1UPMB 3FA4A 1XFCA