3H24A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
267
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 88
structure length 267
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h24A00
4S3CA 3H21A 1Q7QA 3TYDA 2H9AB 4DJDA 1Q8AA 4NHVA 3H2FA 2H9AA 4DB7A 4C1NA 1F6YA 4DJDC 2BMBA 2E7FA 2Y5JA 2DZBA 3MCMA 1AJZA 3V5OA 4C1NB 3TYEA 1EYEA 4DJFD 2Y5SA 4O0QA 1TWWA 2YCKX 4S3EA 3H24A 4HB7A 1AD1A 3H2OA 3H22A 3H2NA 2DZAA 3H2MA 3TZFA 1TX0A 4DAFA 1Q8JA 3TYBA 1AJ2A 1AD4A 4S39A 3TYUA 4S3FA 1AJ0A 4DJDD 2DQWA 3H2EA 3TYZA 4DJEA 2OGYA 4S23A 5JQ9A 4DJFC 4MWAB 1TX2A 3MCOA 3H23A 4MWAA 3H2AA 4DJFA 4MWAE 1Q7MA 4G9PA 4NILA 4S3DA 3BOFA 4D9PA 2YCLB 4S3BA 4CCZA 1Q7ZA 4DAIA 2YCLA 4DJEC 3TZNA 3NOYA 4D8AA 4MWAC 3K13A 4D8ZA 1TWSA 3BOLA 2Y0FA 4NL1A 4O1EA 4S38A 4PZVA 2VP8A 3TYCA 1Q85A 4DJED 4S3AA 1TWZA 2VEFA 2YCJA 3H2CA 3MCNA 4NIRA 3TYAA 4MWAD 2VEGA 3H26A 4O1FA 2YCIX 3TR9A
chains in the Genus database with same CATH superfamily
2A3CA 2VEIA 1W17A 5FL1A 4D2JA 4BF5A 2JGYA 2E1DA 3HFTA 1Q2RA 3LI1A 2ZX6A 4EXAA 2BMBA 3W6LA 1H7XA 3AS0A 3VMPA 3MI6A 4KRZA 3WY1A 4D6CA 2J8TA 1XIMA 4CD8A 4HB7A 1F6KA 4K7VA 1OGBA 5AHLA 3FIGA 4FLRA 3TR2A 3VDHA 5FSDC 3EA3A 4LYKA 7TIMA 1V03A 3R8GA 2PZNA 2YW3A 1AW1A 4C65A 1HT6A 3W00A 4DJEA 4UQCA 1JQVA 4KWUA 2R24A 3MKCA 3C0LA 3HPZA 2PD9A 4P8WA 1PE1A 1A47A 3VTRA 3GNRA 4NAEB 2PS2A 3REQB 4K1GA 3SQSA 3TOPA 3W28A 1KFEA 2GUUA 1DE6A 2DSZA 1W1YA 2PGFA 4JD4A 4GBUA 4O50A 3RCNA 1X7FA 2YA0A 1VYSX 4O1DA 2ABBA 1KGXA 2ZRWA 2VFHA 4BFAA 4AIUA 3HG3A 1X1ZA 3OHMB 2OLAA 3RPDA 2VX4A 4IQJA 2F38A 3MB9A 2PU0A 8RUCA 2VX5A 2BHYA 4RX0A 1FTXA 1OD8A 3Q94A 2UV8G 3GLCA 1DXFA 1OCJA 5KINA 1Q6OA 2A0NA 1ZGDA 3T44A 2PA6A 5DF0A 3CIWA 1UZ1A 3IVSA 4AZHA 1E9LA 1G6CA 1AD1A 4Z2LA 3FNDA 1I2RA 2WCSA 3H8AA 3L0KA 3IK4A 3TTSA 3ZJ8A 1ZY9A 3PTQA 2F2KA 3D3AA 1P0DA 2PDNA 1H61A 4ZO8A 2OSXA 1QPQA 1M7OA 4US5A 1YDVA 4LCSA 1L6YA 1U2YA 2F61A 2Z26A 2G50A 1S5TA 1N8IA 1EP1A 3SN0A 1QI4A 1I45A 3LXAA 1MW3A 2A6LA 2CERA 4AZGA 2ABAA 2WVSA 4MFDA 2TODA 5EFDA 1EJTC 2B7QA 3VD3A 4LNYA 2TSYA 4A2SA 4WUIA 2YA1A 3OOQA 1PL9A 1XH1A 3K8MA 3E2RA 4LW7A 4CEXC 2E9BA 3ZLHA 2PLMA 1ZQ5A 1P5BA 1OB0A 1KFCA 5C2CA 1RUSA 5JBDA 1GT8A 1V0KA 2WNQA 3WD3A 1LUCB 2ZA2A 4XD5A 1OADA 3W71A 3GZ3A 1XIHA 4L61A 3MI2A 3RM9A 3GU2A 4XAPA 2ZE0A 3B9DA 3E3HA 4AYSA 1EQPA 3CBWA 2YYTA 3N3MA 4MUPA 2YJQA 4MLJA 3MYOA 5I3FA 1V3KA 3WJZA 2OMAA 4WD0A 1F6YA 1QWKA 3B0YA 2PFHA 3AALA 3W1LA 4GZJA 3N4FA 1UKQA 3O6CA 1B3OA 2G0WA 4GJIA 1QBAA 4KQNA 4AEFA 1UWIA 2IPJA 2ISWA 4EOUA 1JVNA 3SADA 2V2CA 4MDPA 3FA3A 4UCFA 1F76A 3TA6A 3PG8A 1B1YA 1SPQA 5JU6A 2ZRXA 1QHZA 4B5SA 3E12A 4HHLA 5C6MA 1BF6A 4Y9PA 1IZCA 1VFHA 4HT3A 5IRPA 1QHPA 4PA8A 1WKDA 4WY0A 4QIUA 2ZC8A 5JBEA 2C16A 4QJ5B 4J5NA 4IIFA 3VKKA 4DAIA 3NL3A 4AXKA 3TROA 5I3HA 3DI1A 3MVTA 2I9UA 1R0MA 1NF7A 3R0KA 6TAAA 1K6AA 6PTDA 3EWWA 3H54A 2WMJA 2W0UA 4GIYA 3L67A 4ZVJA 3L0GA 4CQAA 4EP8C 3KBMA 3V7PA 4K1WA 3NSNA 2WOQA 2FVLA 1C8QA 1B4KA 2WC4A 3N6HA 1B30A 4JYFA 2R1NA 5EU9A 4WOQA 2WSQA 1CT5A 2VR2A 1SQ7A 4A2RA 2BHZA 3LHYA 4LAZA 5DBTA 1DWHM 1V79A 2XM2A 5A95A 3BW3A 4O28A 3N6QA 1XLBA 1VBJA 1BKHA 1GG1A 4HPNA 1XYAA 1W1ZA 4MZYA 1E6NA 3WSUA 3GIPA 4X60A 3NQ7A 2VCCA 1A53A 3TYUA 2P8BA 2XM1A 3HG4A 2ZKMX 3EMQA 4PSPA 1QI2A 2GOKA 2CETA 1T41A 3AYTA 1JI1A 3TSBA 2J25A 4R33A 4Z2GA 4WGHA 3UW6A 3N73A 3KLKA 3GU9A 3NPWA 1S2AA 1I8JA 3BH4A 1BSIA 4NILA 4LQ1A 4GY7A 3QY8A 1MEWA 2WCAA 3UY7A 2QDDA 4UQDA 3UXKA 3P8JA 1X8CA 4BHYA 4H00A 4ZSTA 1IXPA 1WA3A 2CZFA 2SFPA 3UY8A 3MUZ1 1O5QA 1IYXA 2XGIA 1N8WA 1FWIC 2DZSA 1FWBC 3GH7A 3NEVA 2V2HA 3EWXA 1IXNA 4XZWA 3SRDA 3VGDA 1XDMA 2TAAA 3KEHA 2YBUA 1UWAA 3LCIA 3BLKA 5HMDA 4NX0A 4DWSB 2GOUA 3IPWA 4V2XA 2P5NA 1ZL1A 4JNZA 4IFKA 4R34A 2Z6IA 1KM4A 3IAQA 3OHIA 3XINA 5K9XA 4A35A 2P8CA 3W38A 2R14A 2WM0A 4L56A 2QIWA 3RNDA 2Y2WA 3THAA 4GMEA 4QDPA 1A5KC 1C91A 1XRSA 2Z28A 3AMGA 3W86A 3E2SA 3GU1A 4OIFA 2PPGA 2V30A 1V8EA 3RX2A 2QJJA 2V5BA 2VC7A 1YE6A 5AZ0A 4ATWA 3XIMA 5G5IA 1GQJA 2ACUA 3R11A 2PDXA 2Z1BA 3T2PA 3LLFA 1R3SA 4DLFA 4TX9A 3FY1A 4P2VA 3QV9A 1FH7A 1Y5WA 4Y9AA 3T78A 1TX2A 4JKLA 4A22A 1JXJA 1H7WA 3CUHA 4L6DA 3DU0A 4MG4A 4H7CA 3RR4A 2C7FA 1E6ZA 4ZQMA 2GGJA 4GX8A 5CZTA 2NT0A 3BCJA 4JXCA 4KW2A 1EX5A 1V7YA 1RQHA 4D8ZA 4E8GA 3BICA 2XN2A 2G3FA 2POTA 4GUFA 5J5DA 5E1QA 2F2HA 3VDAA 4DJED 2H90A 1CECA 3CAWA 1PEZA 1EC7A 3KOWA 1X1NA 2GYIA 1ZZMA 1PHWA 2A4AA 3WJSA 1VFFA 4JTLA 1SZGA 1UKOA 1H0IA 4MJZA 2BXYA 1JAKA 4LAKA 1HVQA 4WZHA 4ZXOA 5IXEA 5GJPA 4CLMA 1TV2A 1KQZA 2QCDA 2FJUB 2TRSA 3K8LA 1BGAA 4YWIA 1FQ0A 4MADA 1IE7C 4AHPA 1G4SA 1SO4A 1UG6A 3CHDA 3WQVA 1ZRQA 4GI8A 1UBSA 3AJ7A 3P5ZA 1W31A 4GZEA 3IIZA 1FWAC 4K8HA 1W5MA 5XIAA 4A4AA 1ZSXA 3QVQA 1K8XA 4R5EA 2NQZA 5A8QA 1ADOA 1GZJA 1D8CA 4GO8A 1Q4NX 1H5YA 1P6WA 3BLIA 1XRFA 1J0YA 3EWYA 2DSVA 1SM9A 2VL4A 4Z17A 4Y90A 2XGZA 2YZ5A 2XISA 3VVGA 1TCDA 2XH2A 2HQAA 1GG0A 1UWUA 3QR3A 5BMXA 3GZAA 4E4FA 1EJUC 3GNPA 3GUGA 4E8DA 3VD7A 1YW1A 2WK2A 4F0RA 1E0TA 2WZMA 1MYRA 4HNCA 2BWGA 3N2TA 3MZNA 1HKWA 3UZYA 3WQ5A 1ISZA 3NGFA 5ABEA 3DCPA 2IMRA 2HXTA 2VP8A 4XIMA 1VP5A 1KBKA 5IDIA 4EK7A 1ONRA 4CD6A 4U5KA 4I90A 2B81A 4QISA 1MXGA 3TYAA 3MCNA 4I5UA 1ME7A 4FX8A 1IEXA 5KSWA 3RLUA 4DNHA 2YXOA 3B9NA 4NU7A 2XGBA 1V0MA 1Q8AA 3UU0A 3H4GA 2PGRA 2JKAA 3GS6A 4DJDC 2E6AA 2YGYA 5D9OA 2OCZA 3QKZA 3BW2A 4DUVA 1CGWA 4W88A 2X41A 1ESWA 1RK5A 2E28A 3S1GA 3U5YA 1OVDA 2D73A 2WQPA 3EXSA 1ZJIA 2XFFA 3DIPA 4KCUA 2ZADA 3UPWA 1ZALA 1BFNA 3DI0A 4JBRA 3WMLA 3FCPA 3WBEA 4UC5A 2P3EA 1AW5A 4DF1A 1H7PA 3DOPA 2V6AA 3KBJA 3EMZA 3OGVA 1B9BA 3TIMA 4D6HA 1M68A 3JRKA 1S39A 4O1BA 4AWEA 5I77A 5J04A 3CGTA 5AC5A 3KP0A 1FH9A 1Q63A 4HU4A 1GZ1A 4ENLA 1E5NA 5CSUA 3N12A 3QLDA 3VE9A 5C7HA 3UWQA 1K9DA 4REQA 3VZYA 1K8YA 2VR4A 5D32A 2DFAA 1VH7A 2VQUA 1UR8A 1VBGA 2E67A 4DRSA 5EB8A 5HWJA 3ZJKA 4UNKA 2WSKA 2BXZA 2Y70A 4OQVA 2UZ9A 3URAA 2ZX9A 3CO8A 5LIUX 5GNYA 1UD5A 4TOQA 5BNKA 3CIXA 3S47A 5AECA 4LXFA 2VGBA 2YXXA 3MKVA 3QRHA 2QCMA 3A5VA 3AROA 3MS8A 2V8ZA 2X7WA 4Y9MA 5LA2A 1EKOA 4NG3A 1DJIA 4U2YA 3APYA 4YVVA 2PC8A 4RK8A 5J8LA 5C8BB 3H22A 3IACA 3RJYA 5HNRA 1ZCCA 1GPWA 2WZIA 3JU2A 4GACA 5KZ6A 3JS3A 2PWFA 3VX0A 2IKHA 3W81A 2JKPA 3VNZA 1YKWA 1Z6KA 2E25A 4F0HA 3VDBA 2QZRA 3PZNA 4AVNA 4MWAB 1FHLA 1EP3A 3OVPA 2WBGA 4MY9A 2GJXA 4E4UA 3EDDA 2QF7A 1JGMA 1WO2A 1O12A 4GGHA 4GJ1A 4F66A 3K4DA 4O54A 3KTCA 3GVRA 5CEWA 2C13A 3BCDA 1ZJAA 1HGYA 3HO8A 1HIZA 3M41A 4DQWA 3GXDA 1Q85A 4JIRA 1ONEA 4F2TA 3PUOA 4FOJA 4IP7A 1L6FA 3M9YA 1IQ8A 3CYJA 4GCAA 4ZXLA 1YPXA 4GNKB 3LGDA 1XUUA 3VDGA 3O7UA 4YYCA 2JQXA 3SURA 1FHVA 2FQIA 1A5BA 1HFBA 3THDA 3MP5A 4XO7A 2YX0A 1F4HA 2IQ0A 4DJFD 4B15A 3R89A 3MUXA 3LNPA 3WFLA 3IANA 2FMOA 4Z2IA 3UZZA 1KCXA 2VWSA 4N6EA 5HNNA 2NXGA 3PWAA 4XKMA 1F74A 4CCDA 5A8PA 4GJJA 1MW1A 1YRRA 3T7VA 1DWIM 2G4FA 2OWCA 3T81A 4FNUA 3SCPA 3LB0A 4LUJA 4Y8FA 3TWBA 5FL0A 2X8RA 1RP9A 1XIJA 3WUGA 2WNWA 1Q66A 1R2TA 3TAOA 2YZRA 2XHYA 3DFPA 1E1CB 1NWSA 2J62A 3BZGA 3D3FA 1DTUA 1X39A 4C60A 4JTAA 1E9ZB 4UFLA 1EH9A 3L4UA 4AD0A 2X40A 4MKNA 3OBEA 3LZ5A 4UWMA 4WLCA 3MHUA 1DIKA 3UWYA 4FX7A 3CB8A 4JN7A 3M44A 1CXLA 3C5QA 3WF4A 1RVKA 5KZDA 3NL5A 4Q3MA 3I3BA 4HHMA 3UERA 2Z1WA 1GVEA 4LU0A 3GG0A 4US5D 3BZJA 1XISA 4ZGYA 2V63A 4YL2A 2WHMA 4LB4A 1JRBA 3G24A 4QQ3A 1L8PA 4XX6A 4HYVA 3QY6A 4RDZA 3L66A 4XD6A 5HUOA 3QW4B 2INZA 2CLLA 4M24A 3W1UA 4ZOCA 4E2BA 4KRUA 4JTDA 4YU1A 3RX3A 3E96A 4H7VA 1XYMA 4HN8A 1IXQA 1G1YA 3S5SA 4PMZA 4N4QA 4J3TA 1H5VA 1I1XA 3GD6A 3B4UA 2ZC1A 4QG9A 3QC0A 1OX4B 3QFWA 3TX9A 1M1BA 2PF0A 1DWJM 1OK4A 1K6WA 2XFYA 2GVYA 3HTWA 5BRQA 3W7RA 2B0MA 4DY1A 3BLPX 3LXCA 4I9MA 4I5XA 2VO5A 1TB3A 2NW0A 5CCZA 4N02A 3ZM8A 2PTXA 4ZQRA 3CH0A 5AYBA 4QCFA 2XPKA 4P8VA 1PKYA 3KL0A 2E6YA 3VNIA 1M04A 4PGLA 4H9XA 3SGZA 2C71A 2O92A 2W79A 8A3HA 4JEQA 1MQRA 1QI5A 5D8ZA 4IIEA 1F73A 1BAGA 1V51A 3C2YA 3UCQA 4ERIA 2PRHA 3PB2A 4HHHA 2XZ7A 3AHXA 3TONA 3UA3A 4MTVA 3FAWA 1FCUA 3APGA 1QBBA 3LBCA 4ACZB 4W93A 3F7JA 3H2NA 3B3DA 1QNOA 2IUZA 3W02A 2ZZ1A 3M4HA 1E15A 1KNWA 4QG6A 3WD4A 4KGJA 5EMMA 1EIBA 1SO5A 5E9XA 4CD7A 2O9OA 4Q4KA 2Y5EA 1A50A 1W1IE 4LAUA 1JDCA 3RITA 1BTMA 4UTMA 2WZEA 1US2A 2QPSA 1XGEA 2HBVA 2GVEA 4NXSA 3BQ6A 4QJ3B 4DN1A 2F9RA 4ZE5A 4EPBC 3VUSA 3WFAA 3RK8A 2GWGA 5DMYA 4AD1A 1PIIA 4DJEC 3NOYA 4AZCB 3GR8A 3LV6A 4FIQA 3GXMA 5KZEA 2V0TA 3VIHA 5D2VA 3C56A 1K4GA 3II1A 3IWPA 3VD9A 4LF1A 1FWTA 4CEUC 4WSKA 1TPWA 3CPUA 3FXYA 4C6OA 3L68A 1J0KA 3B06A 5EBUA 1A4MA 4IICA 1KLYA 4F2UA 4PEKA 3ALFA 3EA2A 3P67A 4TU1A 4CD5A 1EPVA 1YXCA 1DL3A 4O0KA 4IFRA 1H62A 2WMGA 1W9DM 1EJ7L 1FDYA 1EF2A 3BMXA 1KFBA 1TPEA 2Y63A 4FA3A 2E40A 4JQ2A 4DNMA 2ZUVA 1X38A 3O06A 3TSMA 5FJRA 3FYPA 1QUMA 1C8XA 4MAZA 5CKSA 5D30A 1ML1A 2VQTA 1TQXA 2FDMA 2QPUA 4DPPA 3W27A 2C0AA 5GQBA 1K02A 3B4YA 4PODA 2W6RA 1UR2A 3M16A 3WMCA 3N2CA 1H63A 1KTNA 3H2AA 1CGVA 1GEQA 3W74A 3K1GA 1J0HA 1YNYA 3LU2A 1JD7A 1XBXA 1JCNA 4IFKB 2H3BA 4UQAA 4N4PA 1KXQA 3MJMA 3U6WA 3TXZA 1VFUA 2QCEA 2GJRA 2X0SA 5LNRA 1FWNA 3UP8A 3B8DA 1RY0A 3DFOA 4QLJA 3O6DA 2D3LA 4UFJA 4MOZA 3CIVA 4E2OA 3AZRA 4LUTB 3HQOA 2DVTA 4XUYA 3VGEA 4QHRA 1OX6A 1V93A 1XX1A 3WLPA 1WDQA 3UR8A 2PTDA 3R1ZA 1T6MA 2QJIA 1VAHA 2REQB 5DMNA 3CZLA 3P93A 4L65A 3O1NA 3W2UA 8XIAA 1RD5A 4FHAA 3VC5A 1GZGA 5HINA 2E5DA 1IIGA 4IHCA 2C0HA 4RUBA 3L4ZA 1FH8A 1MNSA 4QX4A 3S83A 4CNNA 1DVJA 1QOQA 3WNKA 4H1ZA 2J77A 1UPMB 4FF5A 4A8IA 4W5ZA 4H9VA 4GD0A 3UG3A 3VM5A 2D69A 1VR6A 1XR2A 4WCJA 3IVTA 4C5YA 2CITA 3FHAA 4MJMA 3O6YX 4AD4A 1UWTA 1NP2A 3SRHA 4DWSC 1B31A 3VZZA 2HE8A 2XINA 1NELA 4DJFA 4FNPA 4X2PA 2A1YA 3ABQA 3H4XA 2V69A 1I6NA 1U5JA 4P8XA 2G8ZA 5FESA 1SO3A 4GH1A 4OU1A 1IGWA 4MNKA 1FVPA 2GVGA 4R9XA 3SW6A 3TZNA 1PX3A 1US3A 5SWUA 3DGBA 1L6GA 5DCEA 4GO9A 4AMCA 4H9TA 3LPPA 3NFUA 4XTIA 1EWDA 3RPTA 1E40A 1CNVA 4J3WA 4XKYA 1R9YA 1VQTA 3CWHA 3QSRA 2AKZA 9RUBA 3DFHA 4B90A 3PZQA 1TPH1 3VOFA 2CLEA 1T8QA 4GABA 4GXMA 2GZXA 1M5WA 4HIBA 5TF0A 4ML4A 2IQTA 3JZUA 2Z1KA 4LS2A 3AHVA 2Y6ZA 4ADUA 4LVFA 2J7BA 3GHSA 3QTGA 4AIEA 1QNVA 2YCKX 1U1HA 4CU8A 2W63A 1VBHA 3LN3A 2R82A 3O8AA 2BG5A 3AUOA 1UD4A 4RZ4A 1LROA 4Q8UA 2XSBA 1JCYA 3W7GA 3BAKA 4JNMA 2R1MA 4RNHA 3BLFA 3GVVA 2OR2A 1AL7A 2QUVA 2C1IA 2BY1A 3QMTA 3CUZA 4P61A 1EXPA 4NNBA 4PL2A 3V0SA 4AEEA 4K2SA 2NX9A 1HO4A 2ISFA 4JL2A 3DESA 4BA0A 4WKAA 4PRRA 4W8BA 1L8NA 3WEZA 4WOZA 3WLSA 2VZOA 2CFFA 4D6EA 3L5LA 2J9YA 1UHVA 3QF0A 1TJPA 5DXYA 1FY6A 5HOSA 3VZXA 2VZVA 1IEVA 4P8UA 1MWOA 3W24A 2ZICA 3GO2A 1VJZA 1FWEC 3G1AA 4FLSA 4BQ3A 3PSVA 3OG2A 4AIOA 3GXPA 2JGQA 1GUVA 2YXGA 4I9JA 3MQTA 3MJYA 2P0OA 3NQ6A 3P8IA 3H21A 2EPLX 3IRDA 1TZ7A 1E9IA 4DXVA 5CLTA 3LUTA 4B5TA 1J0ZA 2XG9A 2E7FA 2VZSA 5A8OA 1YDYA 3OEXA 1DJGA 3R0UA 4EANA 1GW1A 5A8MA 2E0PA 1M01A 4B4FA 1DIOA 3IIVA 4ASTA 2CBIA 4C6DA 2VC6A 3GAYA 4K38A 5CGTA 4ROPA 3CZJA 2J7FA 3M0MA 4TIMA 5A6AA 5ECVA 3NQEA 3ERPA 1D3GA 1LRNA 4XKYB 3SUVA 1KA9F 3VK5A 4M80A 1PS9A 3ITTA 3WF2A 2NUXA 3E5BA 3RPMA 3SY8A 2PDIA 1W5PA 1UIOA 3CEPA 5DEZA 5I09A 2VEPA 4HCDA 1EUAA 2RDXA 1O5RA 1HJUA 4EAMA 4RE2A 3JW7A 2QULA 3TNBA 3Q45A 3AAMA 1IF2A 4H3DA 1XYLA 3R4IA 3WNPA 4DVOA 4E0CA 5DXXA 2Z2BA 1LQ0A 3ZMRA 3N9SA 3EWZA 1UKTA 5LNVA 2J75A 1JF5A 4YMZA 3O63A 1D7KA 3EDEA 4GE8A 3UGRA 1JDFA 3R8RA 4AWTA 1HF6A 1EB3A 2HBXA 1B54A 4I6KA 3MU7A 3PFRA 1E55A 3CUXA 2BOGX 4LV9A 1W3TA 3OIXA 2KZHA 3OB8A 1SYTA 3CB3A 1U33A 1BQCA 1M7PA 3N29A 4H8HA 1Q3NA 1A0CA 1MW0A 3V5OA 1J2BA 5D9PA 1EBGA 2PAJA 4YJ5A 1OIMA 1A3HA 3SJNA 3OPSA 3MSYA 1K3UA 1C93A 1SU5A 4GXWA 1GJUA 4JS3A 1SJCA 2VYOA 4Q8NA 3WBYA 1V6TA 3SY5A 2HNHA 1BYCA 2CYGA 4HGXA 1PKNA 2Q6ZA 4X9YA 1PWLA 1XLFA 2JE8A 3N2OA 1RAKA 4KESA 5LIXX 3BGAA 4XBSA 1WBJA 3MCOA 5A6MA 3M7WA 3ARUA 1O68A 7TAAA 3GDBA 4LAMA 2XFWA 5K4XA 4IPNB 4TQTA 5CPLA 4MB5A 2J9ZA 1OY0A 1TWSA 4IX0A 3RCMA 4R53A 1KR0A 1QVBA 3ZSTA 3VXGA 1LLWA 3O9NA 3VIFA 1M41A 3KVLA 2EF9A 4ONVA 4YTRA 3GHTA 4PYSA 5JIPA 3EDJA 1LUCA 3UA4A 1PSCA 1A5CA 1MQQA 4UMAA 2E1WA 1VPQA 1ADSA 1MZHA 3W85A 4UXDA 2XWEA 5TNVA 1FXPA 3HQPA 4U10A 3T0BA 1TVLA 3GC2A 3OA3A 4EWJA 1E56A 2WCGA 3W07A 5D09A 1DJZA 2XWDA 3CPGA 3CXOA 3SAZA 3IVUA 2VMFA 3M5ZA 4GLEA 1V6WA 4O0QA 3FGCA 5HR7A 4HK7A 3DHPA 4GY1A 2CZ5A 3VKCA 2HVNA 3B97A 4NI3A 1GVSA 3POCA 1YDOA 2XDFA 4QLKA 3N2XA 5AFDA 2QT3A 3ELFA 4J40A 4MJ4A 1F3WA 1OGSA 3H7RA 3WF1A 4MYXA 1FX6A 3PZOA 1W1A1 1JNEA 3LGEA 3O07A 1L6WA 3A5FA 3PBWA 4DJFC 4INFA 5I3KA 5EFFA 4LFYA 4KCWA 4JTGA 4HJFA 2UY4A 4YN5A 4PUEA 1KTCA 5TAOA 1OC7A 2GPTA 3EGJA 2AGKA 3W2NA 1Q7ZA 1BWKA 2OYMA 3CAVA 3KBSA 1LZOA 3GDTA 4Q32A 4O15A 3RGTA 1GPFA 4HSNA 3BAWA 1FHUA 1EEPA 4XZMX 1BD0A 1X8FA 2OQYA 1V3IA 4LNCA 4DLMA 5JIWA 3D47A 4K36A 1YPFA 2FHBA 2Z2UA 2ZUSA 3BG5A 3VNMA 2V5JA 2BXVA 2J9XA 4OT7A 1US0A 2YDRA 1WDSA 3C2OA 3MMTA 1PYMA 4Q6XA 3RLGA 4NHVA 5CPTA 4BJHA 5IM51 1FWGC 3T9PA 4JHZA 4C90A 4JY8A 2J74A 2V68A 1HP4A 2EG8A 4M6QA 3QH2A 4GUIA 1TYGA 4MMWA 2CW6A 1Z41A 2ALRA 1H1NA 2NT1A 3LERA 3PUEA 4QSHA 3NZPA 3G1HA 4YPJA 1ZLPA 2YLLA 2V3GA 4BKNA 1J10A 2QLYA 3K46A 1ISVA 4XZIA 3DFYA 4JFSA 3DGRA 3GKFA 4U5IA 1LM1A 3H4WA 4JCLA 3LRMA 2NLYA 3QXBA 3CTLA 4XD3A 2CLKA 2DZUA 3SFKA 2QDHA 1K9EA 1UW9A 3N13A 1V0NA 1GOQA 4D9PA 2VZTA 4P5UA 1Q6QA 4JYEA 2R6OA 2CHNA 1I0DA 2BS9A 5LIKX 1GJWA 1PXGA 4AAJA 2CHRA 4C6CA 2PWDA 1R3YA 3PNUA 2GGIA 5CC7A 1IR1A 2ESCA 5HBFA 3UYIA 3RDKA 3NQBA 3O15A 3MUAA 2FH8A 2WMKA 2XH7A 2E5BA 4W8AA 4BI6A 1MXDA 2E8ZA 1ZBVA 3AXMA 1PTAA 1JIBA 5AYYA 5E6ZA 3GTIA 1A0EA 5FF4A 3G5EA 1J96A 2OZ0A 2H9AA 5AHMA 4PH6A 3S2LA 1UJPA 1IHIA 2F6XA 1ONWA 2HTMA 2ODOA 4ZOAA 1TWWA 3CT2A 4QE5A 5EGRA 4MB4A 2PDCA 1PTGA 1WUFA 3OBKA 4PC8A 3VIMA 1XPGA 2Y61A 4WIWA 3RMEA 3BV4A 1MUCA 2XIIA 4O0ZA 5C9RA 4UMCA 2DZWA 1E0UA 3IGUA 1YIXA 5D04C 1TCMA 4KETA 2J7EA 1A3WA 3CQ0A 4LBRA 1E71M 1H3GA 3OVGA 4C7FA 4DXKA 1EO5A 1YQ2A 4ML9A 3P74A 1MQPA 2W27A 5D9NA 2UY5A 3WLJA 3EEGA 3M0VA 4NAEA 4FZIA 4Z2JA 4NAFB 4LANA 1Z89A 5D05A 1CTNA 3M0IA 2PTZA 5AKQA 4X9SA 4JFUA 4IP5A 1KKOA 2I57A 2A21A 3AZTA 1HZYA 1JEZA 4ICNA 3M5XA 3M0JA 1H7OA 3U48A 3W83A 4AWSA 3ABSA 1BF2A 4AZBA 3VOHA 1UMLA 1P0NA 1SVDA 4O10A 1NWRA 2AQWA 4OHQA 1KRCC 1XBVA 1OQFA 1DWAM 5LA0A 1X6NA 4GYPA 7XIMA 2VM8A 4BQ5A 3T4WA 3UT0A 1HL2A 1G67A 1TPB1 4NI8A 1QPOA 1E73M 4MUZA 4PUDA 4U2ZA 5BWFA 4GUHA 1G4EA 5LGZA 3E0VA 1UUMA 3W7OA 3W7LA 4I7UA 1F3XA 2WXDM 2EKCA 1Q2SA 1NP0A 3WNOA 4MM1A 2ZWZA 3DHDA 3HGRA 3F5KA 1XC6A 4UNLA 4XZ9A 2FTWA 3WK0A 1S5NA 2YYUA 5T9BG 2V82A 4F40A 3SCWA 4M7TA 2X16A 3ATZA 3XISA 2G37A 3SSJA 4YCOA 2QMKA 3S1XA 2QVHA 1UR1A 1GQKA 3F4NA 4AC1X 5LIWX 3LI0A 3GKAA 5E93A 5I3IA 4A3HA 5ABFB 3E0LA 4ORMA 4OV4A 2MANA 1WNOA 4IMEA 4MWAD 4XBKA 4CGTA 2ANUA 2PGEA 3H26A 3R43A 3W53A 3ICJA 3KHDA 3OZOA 3KTXA 4RPQA 5C71A 2OEKA 1SR0A 1TELA 1E0XA 2TMDA 1Z44A 2PP3A 1AODA 3EYPA 3G6MA 2DIEA 5FKYA 3B8UA 2DZXA 4HNUA 4UTLA 3CL6A 3B8TA 1P0KA 3B0VC 4LVDA 2O7QA 1MMFA 1P1MA 3D46A 2HWGA 1PTDA 4IM4A 2XN0A 2E77A 1NOUA 1M7JA 1X6LA 4GFSA 3UJ2A 1S5WA 1MO0A 5CLWA 2GUBA 3VM7A 3G0XA 3GYEA 1EC9A 1HVXA 5EBAA 3TH6A 3U7VA 1GVFA 2JKEA 3RRXA 3VABA 4FLQA 4PUKA 1OFEA 4UIOA 2WVVB 1Q45A 3CJPA 3L4WA 1SFSA 2I16A 4GC3A 3WEMA 3NM1A 4QROA 2Y4SA 1XFCA 1W1PA 2YPIA 4HK5A 3P60A 3BJSA 1PV8A 2JFEX 4IX2A 1R30A 1E1CA 4E3VA 3DG7A 1J0JA 2YL9A 5CPSA 5DMLA 2YL5A 2FGBA 3IUIA 1UOKA 1VHNA 3A23A 2A79A 1GONA 2FVKA 3A9IA 4WK9A 3UZ5A 4B3KA 1QNRA 5I5RA 3QMSA 4W8LA 1WXZA 2V9DA 3WLHA 3GXIA 3QPZA 4WGXA 4F2BA 5C0QA 1SW0A 2FZNA 4MPQA 1UCWA 4DZIA 5EMUA 6REQA 1LCOA 4GYFA 4B92A 3HU7A 3GRIA 3O2LA 5A6KA 1ZHAA 2HSAA 2PTWA 3T09A 1UR4A 3W7QA 5F2IA 2E9MA 4DB7A 3SEPA 1G4PA 3SECA 5FEXA 3FKKA 3KVMA 1LL6A 1IT7A 6TIMA 2DSKA 3TE9A 3NOEA 3PJUA 3DH7A 4B4HA 5LKYA 4JQ4A 2QIIA 3N6JA 2XSXA 4H41A 4MJ2A 5GNZA 4F0SA 1BYBA 4AFYA 2OO0A 3S8HA 3ES7A 1QI3A 4IQLA 3STEA 3P2VA 4KF1A 1QAPA 3NVTA 4HU3A 1TREA 3NYDA 3KOXA 2D0HA 4PRWA 3W1PA 3F4WA 3PWIA 1PZ2A 2GSEA 3OYZA 2YBTA 1J2WA 3ES8A 4RDWA 1HJQA 3GDLA 3WIJA 4DF2A 1GK8A 1A3XA 4HPHA 1C7TA 3AS2A 3HPSA 3MI3A 4GYJA 3CTTA 1XD0A 1J11A 3WNLA 1WX0A 5G2WA 4YXGA 1S2UA 3DKLA 3H53A 2BVYA 2J6XA 1H50A 2DV0A 1EOKA 1AA1B 3AU6A 2GUYA 1WE5A 1AG1O 4GKLA 1LYXA 1DJWA 2YCEA 4GQRA 1OZQA 3MDUA 2A3HA 2WVUA 3VA8A 1JJKA 4JTRA 4XQ6A 2B31A 2C1GA 3R58A 1AJZA 4IPJA 4XVDA 2Z1XA 3LK6A 4LBUA 1QW8A 2WC3A 3UETA 5BXSA 3LBMA 3PBMA 3P81A 5D4YA 3T0DA 3CPRA 5A3HA 5DQPA 1OSEA 4KKXA 3IGHX 4KERA 2QUUA 4CQDA 5BXPA 4IP4A 1PWMA 3GE7A 1BWVA 1OM0A 3A4JA 2OYKA 2QHAA 2ZFAA 4GUJA 2GQAA 3W7CA 3U2OA 2B7NA 3TC7A 1OX5A 2WNZA 3TYZA 2D24A 5M17A 4Z1YA 4HA4A 1QTWA 1X1OA 3W7EA 1YTDA 5DN1A 2ZUNA 3KBWA 3OYXA 4HMDA 5HR6A 2NSXA 3GG1A 1ICQA 2PDPA 2VELA 4ZB5A 1R86A 4MFEA 4M5PA 2VX7A 2GSHA 1WDWA 4UTKA 3VNKA 1YHTA 2YCLA 3KP1A 2G4JA 3UJFA 1Z32X 1JD9A 5G4WA 2OO6A 3W73A 1OIFA 1EEXA 2CKRA 1XGDA 4Q8PA 1E0VA 2ON3A 1LOQA 3WQ4A 2X0HA 2J24A 3MHFA 2QV4A 5BROA 1R85A 1H51A 3LHWA 1GYLA 3BG9A 1CB2A 4K8GA 4FF7A 3WK2A 4GYPC 4TVCA 5F1VA 1TVPA 4JY9A 1WBHA 4EIVA 1PUDA 1AVAA 3ZR5A 3KL5A 1O6IA 1TV3A 8CGTA 3LLDA 1VJIA 3DERA 5FD0A 1ZUAX 3DFTA 2WKGA 1J4EA 3FVMA 2EHHA 2AMGA 1K8CA 3PHAA 3QMRA 2G95A 4Q8WA 2AKMA 5REQB 4C7GA 3TYBA 3QQ1A 2Y7FA 3CHEA 3GK0A 3P0XA 2PP1A 5EA9A 3V0UA 4UQBA 4E8CA 2CZEA 1RJRA 2OB3A 1B9ZA 3DEQA 1AMYA 4L1GA 1H7NA 2VJXA 4HNOA 3S5NA 2PP0A 1RALA 1B3VA 3CAQA 1HX0A 2OT1A 4JHMA 3F4VA 3EPMA 2YOCA 4O12A 1F61A 1TJ1A 1EJVC 5IHSA 4YVXA 3BLEA 1LG1A 5FEZA 2BOFX 5DBUA 4WJEA 2YFOA 2VX6A 1RQEA 1LTDA 1DJQA 4MWAC 3PVFA 4HPJA 3EX3A 3LPFA 1CI1A 5MKGA 2WV8A 1K77A 3NO1A 2Z24A 5LXEA 4WEVX 2VEFA 5E5CA 3PSWA 1GVYA 4HJWA 4CNUA 1TRDA 2B7OA 2CEQA 6XIAA 4ZB0A 3AWNA 4EF8A 1W1VA 3RMJA 1M65A 2BFGA 1SUXA 3T1GA 3HQ1A 3LLXA 2D23A 3E0WA 4OWGA 1HKKA 3S1UA 3CNYA 1VBRA 4ACZA 1H0GA 4NRRA 1VEOA 4UR7A 4CNOA 4WHBA 3PR2A 2QW5A 1YLVA 5EY5A 1YMYA 1DXIA 1R3QA 2HK0A 3C52A 1MEIA 2OWWA 4ICMA 2XJ7A 3DFNA 2W67A 4JQ3A 1WZKA 4MNJA 1WAUA 2QGHA 3PPHA 2J4GA 1HO1A 2PD5A 3A21A 5CC6A 1KCKA 2OOGA 1TV7A 1QW7A 5KZMA 2OPJA 1Y5VA 3FLUA 3LHVA 4PFMA 3QLLA 1HTIA 4FR6A 3RO6A 1EQCA 3I65A 4I7VA 2FH6A 5FF3A 2ZUUA 1O4UA 3PJTA 3ANUA 1ZTVA 3CWOX 4IIHA 1A4LA 4ZBCA 3L2LA 3WF3A 3HA1A 4QQUA 3ARZA 3DECA 1UZHA 3W7KA 5A6TC 3TDFA 4PTMA 4WQ6A 1QDSA 4FLOA 3WDHA 3E2QA 2WSRA 4K68A 5REQA 4S3KA 4Y8EA 3N1AA 3TQ0A 4HPXA 2YDQA 2ZDRA 5C2XA 4IGMA 3AS1A 4AW7A 1FWDC 4YS1A 2IXVA 3OO2A 3RF9A 2QCDB 2D2GA 1TUFA 2EGZA 5ABGA 3VILA 1ENUA 4W9TA 4TVUA 2ZYFA 2R1PA 2Z1VA 2D0GA 3ARXA 1MFUA 1WKFA 3HJEA 3W23A 4U3AA 4D1JA 3VDCA 1KCLA 2V81A 3THCA 4B2DA 1P43A 2AGTA 4X0NA 1JZ6A 3OODA 5IBXC 2GVLA 5I24A 2OXNA 2VCBA 3CZKA 2X42A 1T96A 5JH1A 4GVFA 3BSGA 3V35A 5CBIA 5G4EA 2R8WA 3AO0A 3EX1A 1RJQA 3C0QA 1D9EA 3P5YA 1ZU8A 4BCEA 3RLVA 4A6GA 1GQNA 1TV5A 2GSJA 2OEJA 4UTFA 4RE4A 3VMOA 1P1XA 3I68A 1NDZA 3I6RA 5BXRA 3MW7A 4FX6M 3ZVIA 4FS9A 4L1WA 1CLKA 3EOSA 2Y89A 3VU2A 2ADAA 2HNEA 3DHFA 1BVWA 3P3BA 5CXPA 1ZFJA 4JEJA 2YLAA 5FF7A 4JIIX 1ITCA 4L9ZA 1GOKA 1K7XA 1HKMA 3CV2A 7ENLA 2FPYA 1G7VA 5E6YA 4AXNA 2BB0A 4YNGA 1CGTA 4JIHA 3MHGA 1GOWA 4H9ZA 1KO0A 5T9CE 1PO9A 4BI5A 3CL8A 2AOSA 1NWTA 3L4YA 1SGJA 1I9CB 1RBLA 5CZKA 3ATYA 1MXSA 1CLXA 1KBJA 3DN5A 4HQVA 2X1RA 3WQPA 3NXFA 4TO8A 1AD4A 2ZZ4A 3KS6A 1BLIA 3IJQA 2YDAA 1WDPA 3ID7A 3Q58A 5H8PA 3CU2A 4IUOA 5DY2A 1TZ9A 4I8DA 2VNCA 5DT5A 4C6KA 3I7QA 1L0PA 3AXHA 4G7EB 3MBDA 4I3GA 1EA0A 3HQNA 2XVLA 1O5KA 2DGAA 3MZ2A 4LUIA 3C86A 1XLAA 1LJYA 3SZ8A 2QCGA 4TMBA 4C6IA 2WHLA 4D8LA 4H6RA 5M3WA 4AD3A 2IKIA 3I10A 3RAOA 5D8WA 1ZBKA 4N0RA 1XLIA 1QHOA 4JDYA 4OBSA 1QU4A 3WLQA 1QNSA 7CGTA 3E74A 2G5WA 2V5KA 1NOWA 1S2VA 3W1RA 3TYDA 3ZXWA 2WLZA 3HF3A 3DYOA 3USZA 4BS0A 1O94A 3AIQA 4R9OA 4GZ7A 4JTFA 3SJ3A 3NL6A 2V5DA 4KGLA 3LHUA 1ZCOA 1Z69A 3IIXA 1YADA 5DANA 2CLOA 4LOCA 3W87A 1E9YB 5DT7A 4O14A 1F9CA 2XSAA 4XG1A 3RRAA 1TR9A 3IJ6A 1JZ2A 1EIXA 3FAXA 5F4XA 3WQ8A 1HW6A 4F48A 1G9HA 5FSEC 5BXTA 2L5HA 4AH7A 1J18A 4V33A 1IWBA 4MWAA 3F03K 3INPA 5AHNA 4D6DA 3N17A 1RLDA 3G2GA 1UOZA 1BSLA 1Q5MA 4DI8A 3UESA 4ZOBA 5EL1A 1D3CA 4BWLC 4XUGA 4M56A 3NL2A 5D38A 4BF9A 3UJRA 3QV7A 1C9DA 1UD8A 3G3MA 3E49A 2WJFA 3V36A 1S3HA 2ZIDA 4ZFMA 2ZUTA 2PRLA 4XVEA 1R46A 3UG5A 2ASHA 5FJIA 5KETA 2X05A 2XFRA 1MDRA 1VKFA 1EDGA 4PMYA 4FO4A 1WDDA 3KS5A 1J6OA 3M6YA 1UKPA 3MYPA 3U8GA 4M0XA 2POZA 3ARYA 1TR1A 2Z00A 2NX1A 1UB3A 3WD2A 1DWGM 5I2UA 1EUNA 3F4DA 4HTBA 3IIPA 3WLRA 5ENLA 4I9TA 1CCWB 4XZHA 4NJGA 3AIWA 4LGXA 4FAMA 2VRQA 1GTHA 1OFBA 4JTIA 4QCEA 3L4TA 4BEQA 4A3YA 1TE1A 3GY1A 3EDFA 3VOGA 4W89A 5BU6A 2QCLA 3EKGA 3L4XA 4W5UA 1JG9A 4HMCA 1BRLB 2FMNA 3K5XA 3HZ3A 4GOAA 4HU8A 2OELA 3G8RA 4Q8OA 3ZJ7A 3PPFA 4TUFA 4NZ1A 3PM6A 3SY1A 4QS5A 5E09A 1DWFM 3R6IA 4PMRA 5CQ1A 3KVJA 4AMAA 2R1KA 4ACYA 3STGA 4CU7A 1R9ZA 3BVJA 4WR3A 4U3CA 3R10A 1D8WA 3S0CA 3UXDA 1RCQA 1XDJA 1ALDA 1N82A 3W6MA 1RJPA 3BL3A 1F7BA 3AYSA 4GCXA 2G97A 2P0IA 4MY1A 3DUGA 1OEPA 2VEGA 3WQOA 1W32A 4OJYA 3VIPA 4IJCA 5AVHA 4E3TA 5I3GA 5FA5A 2PBGA 3DKJA 2E9LA 1XBYA 4XAFA 5I3JA 3AI0A 3TV8A 2X2YA 4GC4A 4NX5A 2ZXBA 1VCGA 3BE7A 1XCFA 3NAVA 4Y7EA 5HWNA 2X09A 3T0CA 3S9ZA 1KM3A 3SCRA 1MDLA 5K9CA 1KM1A 1AUSL 3TTYA 3PANA 4PMXA 4IPPA 2CLHA 5EMKA 2QR6A 4Q4QA 3T6CA 3S3GA 1QI0A 3WO8A 2Y62A 4I8YA 3PJXA 3P0WA 1V3HA 4K39A 1TJ2A 1W3NA 1XKJA 4R3UA 2WWCA 3ECQA 4F0LA 4DWSA 4GKTA 4CQ8A 5M5DA 2QCHA 3ZJ6A 3M0KA 3G6LA 1DP0A 3KDNA 4QAWA 4A3RA 4F3HA 2ZZ7A 2ZVIA 3TJLA 2ACRA 2VGGA 1W56A 4PBEA 3IEBA 1XIBA 1T8XA 3OQEA 2EG7A 3ABXA 3P62A 4FNRA 4HYWA 2TYSA 4DO4A 4LC8A 1WXJA 4UFHA 4HZ6A 4S3AA 5CJ5A 4XTDA 1O1ZA 1A5SA 4AIBA 1E6SM 1MEHA 1GKQA 3CLMA 4HZ7A 1LWJA 4GXPA 3H2CA 3B0PA 1YTEA 2QUNA 1EX1A 3ONBA 6A3HA 3AIUA 4XZNX 2F6UA 2VFGA 2FIQA 3N9RA 2QAPA 2H9AB 1XYFA 3U2CA 2Q8ZA 4HZMA 2ZA1A 1VD6A 3TMQA 1TA3B 3VO0A 2BVDA 4J27A 5BU9A 3ZIZA 2XIOA 1JPKA 3V75A 1E5JA 5A2CA 3N04A 4MKSA 3A3WA 5IHRA 4S3EA 4TTGA 1JF6A 3EMCA 1HKIA 4IXXA 4GISA 2X2GA 3EB3A 4NUWA 4J3UA 3UFYA 4UBPC 2FFCA 4DM2A 3E6EA 1QPRA 4GY0A 2J8GA 3BAYA 2IKGA 2YB1A 4A8LA 1Q65A 2DP3A 5B7ZA 4QG8A 5G1YA 2Q3OA 3IUHA 3NQ2A 2ZA3A 4S23A 3RCYA 4AVOA 2PWHA 3WH8A 1EBHA 4J35A 5E0FA 3W3OA 3W7PA 4FXJA 2YBVA 1DHKA 5DFAA 4QE4A 4NAFA 3QZ6A 1WQ5A 1ECQA 3S5YA 1W9PA 3VCNA 3NQGA 1NAL1 4HU0A 4L9YA 5HJYA 4OTKA 1AH4A 4P7QA 3GR7A 2HJPA 1F3EA 3SCNA 3KLLA 1VENA 4OVXA 5C54A 1GKPA 1DYSA 4LCRA 4NJKA 2OFJA 2CLMA 3C8NA 1UP2A 3WMBA 5JVLA 4W86A 1FWWA 5HMFA 3HGJA 5M03A 3H70A 4G8TA 3BG3A 3HFYA 4O1FA 3POHA 1WZLA 3AXIA 2CWNA 2Z29A 1HG3A 3OP2A 3TWAA 3AIEA 5HAOA 1A49A 1E3XA 3HMJG 3F1QA 2OOFA 3V1HA 4XZLX 4GI6A 4RPPA 1R7OA 2EPNA 3W1XA 4O1CA 1TMLA 1C9WA 1E3ZA 2C3ZA 2BZNA 5FF0A 4Q4PA 4DZ5A 1TVNA 1YXYA 4AG0A 3S46A 4PL1A 4G1NA 4JGDA 1MVYA 1A0DA 1UJQA 1W0MA 3W29A 4W85A 2R94A 1CXIA 1DXEA 4KBXA 3ITCA 1C90A 5MKGB 1FDZA 4EPEC 1KBLA 4H2CA 1OC5A 3GDKA 4IIGA 4Z2KA 1IT0A 5LNSA 3QKEA 2NV2A 1ICPA 4U28A 3N2BA 1U5VA 3C4UA 1TFVA 1W1B1 1TQJA 1G4TA 3TP4A 5CH9A 4RR4A 5H91A 1FWJC 2FZ8A 4FXRA 1PKLA 5BOOA 1ECEA 1UPPA 5CPNA 1SSGA 5LHFA 3FJ4A 4Z1BA 3PN8A 1F07A 1OT2A 1SR9A 7REQA 3DDMA 3WL0A 1MNZA 1BYDA 3MPGA 1SZRA 2J7CA 4FMVA 4CVWA 1LOLA 5AOUA 2Q02A 4QLLA 1P0EA 1CXEA 1EA9C 4I9AA 4IPIA 3EZ4A 3OVRA 1JFHA 4N9DA 3PZMA 5C2GA 3WUBA 3SCUA 4P7OA 1V3MA 4CN4A 5PTDA 1E51A 2AL1A 1X7IA 2XVPA 1WCGA 4V1XA 4NJIA 3F4CA 2VDHA 1RP8A 3RG6A 2PTYA 5I02A 4IMDA 3DYPA 3C2VA 3BXWA 2NUYA 3ZR6A 5C55A 1XS2A 3H12A 3U4FA 4IMFA 3Q67A 1PBGA 1TJ0A 1EYWA 3TJXA 3AFBA 1DIEA 4ZCWA 4MHBA 3CUFA 3WBXA 1M6JA 2RKXA 1VGAA 2GWNA 3CAKA 3VOJA 1TG7A 5JUVA 3I3DA 3VE7A 2D2OA 2DQWA 2XVKA 3O05A 4NF7A 3TCEA 3E1F1 3W9ZA 3F5LA 1IEWA 4DYJA 1SW3A 1A5MC 3ITGA 2G41A 4HYRA 4MNLA 2J13A 3MANA 2OGJA 3KRSA 1XPYA 1GQLA 1BTCA 3GIQA 3GW0A 1K8ZA 3HGOA 4KFPA 3TVAA 1ADDA 1W8GA 4QR6A 5FIPA 4C1LA 2RGLA 4REQB 1OT1A 3HBLA 1H11A 1VFMA 4LB3A 3U3HA 6REQB 4B2DD 4IWWA 2ZXDA 1AFSA 1O60A 2C14A 3F5JA 3HMCA 2GFTA 4AF0B 1ITUA 2FTYA 2V5LA 1RH9A 5LIYX 3W7DA 4OKDA 3OJGA 5A2BA 1CX9A 3NSMA 4KCVA 3RO8A 1BXCA 3U2EA 1W3LA 3UNTA 2GJXB 3FSTA 5E9AA 3EWBX 1NIUA 3AMKA 4HNTA 2CHOA 4XIAA 4Q6JA 4BF7A 1E72M 1PDYA 3OGRA 4H2HA 5DRCA 3I4EA 1VFSA 4J2MA 3VKAA 4KMQA 3GM8A 4IOTA 2WMFA 3P82A 3PULA 2H3DA 2ZUWA 4AY7A 3SN1A 3DHUA 3WD0A 3L0NA 4PMDA 3T8QA 1EXBA 4H4IA 2NLIA 4RDYA 3A9BA 1FFQA 5JQ9A 4M6PA 4XB3A 4HCLA 1GHRA 2JIWA 3VGHA 2PLJA 3EBVA 5GVJA 3HB9A 2HXUA 2JF6A 3C3UA 3CHCA 4GINA 3URBA 4OOUA 1VPYA 4JZ5A 3ZYZA 3VOIA 3ZVHB 2OSYA 1VCVA 4UNIA 3NGJA 3R13A 5D2WA 1FCBA 2IKJA 5HANA 4IFOA 1TWZA 3PAJA 5LXXA 3V0TA 3MY9A 3UR2A 3GHRA 5H1WA 3SQMA 3LV5A 1YXDA 3PWGA 2Y8KA 4G1KA 1OG6A 1ZNNA 1W5OA 3V5CA 3WEOA 4J3SA 1A5NC 4HMNA 3ITXA 1KXTA 4QP0A 3A24A 5BCAA 2HZGA 4YTSA 1FBAA 1TE6A 2CBJA 3DAQA 1PIFA 4HA1A 1S2WA 2A3EA 3GFZA 1JCJA 3LQGA 4F0MA 1W3HA 3UWUA 2OZ3A 1KBIA 4IIDA 3QY7A 1I75A 3LX9A 3VKJA 3IJIA 1KD0A 1ZAHA 3V3WA 1B4EA 1NY1A 3VI2A 1VC4A 2VR5A 1KC7A 4U31A 4UR9A 4IGHA 2W3ZA 1AJ0A 1AZ1A 3CT7A 3L5AA 4AY1A 4IPLA 3GIYA 1LQAA 4WF7A 4IIBA 4NZ5A 3BGGA 3DENA 2O0TA 4D72A 4GI9A 3L5MA 3ZFHA 2DQXA 4KWWA 3PTKA 2V2DA 1XG4A 3SM0A 5CPMA 5DELA 4D6JA 3GG8A 1NDWA 3LCGA 3GXNA 2Y7DA 2FTPA 2OQHA 3BMWA 4QNEA 5AC6A 5FF2A 5BRPA 2QGYA 3CHFA 1QWGA 4PZVA 5DCDA 1ZAJA 3PUGA 2FYMA 1OG0A 1NDVA 2OTDA 4PTVA 3TQKA 4ZFCA 3B40A 1QO2A 1JRCA 3D0CA 1ONXA 1ODUA 1QK0A 2EJAA 2QV5A 1S1PA 3FDKA 3T2OA 5LGXA 1JPIA 3KRUA 2VEKA 2Y1HA 4NYUA 4C1NA 3W0KA 1GVRA 2WHKA 3MCMA 3FXGA 4XAYA 4K7YA 5E70A 2CLFA 2ZRVA 3SR7A 3M07A 4C6QA 2VFIA 4HNVA 4B5UA 4KT2A 3BJFA 2PBOA 3QSTA 2Y7EA 4MYAA 1HGWA 3VYLA 5HPCA 2GDUA 1JPDX 1JZ8A 1NSJA 2VXNA 4Y9NA 3UG4A 2BGSA 3A13A 3H2EA 3IGSA 3MUCA 4M19A 3WLLA 1TWDA 1MRAA 3DFSA 2QCNA 4EAYA 1CXHA 4JR5A 1LLZA 2GGEA 2V3FA 4MWAE 2DZVA 2XZ9A 1QT1A 4LTSA 1E4NA 2P50A 2QJGA 3CV6A 1R3RA 2C1HA 4TV6A 1TMHA 1WDRA 2HK1A 2PDJA 2X1SA 4UFIA 3ZS4A 2V38A 4O1EA 1KB3A 3U57A 2H8ZA 4DF0A 4EWND 1P7TA 2VENA 1T0OA 2WPBA 2ZX8A 4MVAA 3H7UA 2DW6A 3TA9A 4AZ6A 1NFBA 3VINA 4UFKA 1R38A 3VIJA 2OZTA 2O55A 4NZ3A 2O56A 4DO5A 4J28A 1BRLA 4LF2A 3LM7A 4AB4A 3UGVA 3N9KA 3W7NA 4PMQA 2VC5A 5A6JA 1KM6A 1W54A 3SBFA 3TW6A 3WLIA 1WZAA 3CQKA 1FP9A 2W61A 2ZRZA 3B9OA 1HJSA 5AHEA 1JI2A 3QYQA 2WJZA 3WLKX 2C8NA 4DUOA 3W2KA 4C6EA 3W7JA 3W2LA 5L9FA 3BSMA 5LZLA 4R88A 4UCGA 1EJRC 2P1FA 1ODZA 1CW2A 3HG2A 5U7SA 3E0IA 5DCBA 5EMYA 3UR5A 3LOTA 2P3ZA 5BRBA 2VDGA 4JX5A 3TJIA 1GW9A 1EHAA 1O5XA 2PWEA 2BOEX 3FVDA 1EC8A 3JZEA 3E38A 3KE0A 3RILA 3W26A 2ISVA 3LMZA 4FR1A 4MLRA 2BSLA 4LC6A 3H23A 1G94A 3AUJA 1UWQA 3LA4A 4ZEPA 3MWAA 4C6PA 5D2XA 2UWFA 3FYYA 1JPHA 1HKVA 1YPIA 4UTJA 2QNEA 3VGFA 3WJXA 4EE9A 4GHRA 4PTWA 3SUTA 1XQKA 4RNIA 4QJ4B 4L4MA 3EWUA 3KUMA 3GTNA 1E4LA 5M2FX 4JYDA 3WDJA 5HA7A 3NM3A 4RDVA 1VFTA 2V5CA 1YNPA 3UPBA 4OE7A 1ZJHA 3S42A 4X61A 4PCPA 2QMJA 4MZ1A 3FFSA 3P80A 4L64A 1TKKA 3G1XA 4PUWA 1R2SA 3W1NA 1B90A 3UF9A 4AQLA 4WSHA 4XAGA 2EQDA 3BANA 4AC7C 3EDKA 1Q4WA 1TX0A 4J3XA 4AZ7A 3EOUA 5FEPA 3F2CA 3R25A 4XK2A 4DZAA 1UD2A 3LSBA 4FOKA 4ORIA 3RM8A 2NQLA 3F2BA 3GH4A 2C18A 2VI0A 3FV9A 4ZSUA 1G7UA 5AYXA 4L4PA 3RU6A 1G5AA 3EB2A 1R7AA 3W7HA 4FIRA 3CZ8A 4OFCA 2HVMA 2EG6A 3OTRA 1XLGA 4AHQA 2HS6A 4XAZA 3S5ZA 2Q8LA 5I6SA 3QHOA 4JIEA 4QDMA 2WKJA 5CZSA 3LCWA 1P0BA 2WJEA 2Z4GA 4IL2A 2J66A 1NFGA 1RBOB 3GUWA 2VRJA 4QRNA 3C2EA 3PF3A 5FJOA 3PZIA 3G1RA 5D9MA 5ABFA 3FDGA 4LUTA 4R7WA 1TWIA 1RCOB 3NJ3A 3CC1A 3VCRA 4AHOA 1KM0A 3HV9A 4O17A 4KWSA 4ZO9A 1LP6A 3L7RA 3TU9A 3NYZA 3WH6A 3ZWTA 4WSJA 3ANVA 1EDTA 1U83A 1PKMA 1MFVA 1ZBCA 3AQUA 4XSLA 3MSRA 4Y2WA 1ZB5A 4H83A 2NXIA 1GGOA 4BWLA 2WLYA 5B80A 3TZFA 1VJSA 3BARA 3C2FA 4GVIA 3NPVA 3L2MA 2HRWA 2I7GA 2J78A 3T4CA 2NXHA 1XLHA 2W4XA 1TV4A 3N4EA 2DUAA 3MUY1 3TC6A 1PZ0A 2YL8A 1XCXA 4M6UA 1QFEA 4IMGA 4UTWC 2ZZ3A 3NURA 3EX6A 4G7EA 1NQKA 4DX3A 1EO7A 4O8AA 1KRBC 2PLKA 3UD6A 1DPMA 3DBPA 4M3PA 2PB1A 3QQ0A 1GTEA 1RZMA 4BEUA 5HK4A 3KWXA 4ROQA 4WKHA 3PB0A 4JTKA 3G3DA 1W2VA 1FDJA 3GXFA 5FCZA 4M81A 1XI3A 4Y6GA 1JCTA 1OFOA 4EKJA 3NQFA 2VD8A 1XLLA 1TIWA 1IZJA 3R2GA 3WQFA 2FHFA 3TFXA 3TQPA 3WD1A 3G0UA 2C79A 1BG4A 3BURA 1HKJA 3VFLA 2OLHA 3LM3A 4JIPA 2D2JA 4KCTA 3W7MA 5H2ZA 4BQ4A 2DUXA 5AHFA 3BK0A 1W3KA 3ZLFA 4QBXA 3J7HA 4Z1CA 1KFWA 9XIAA 1XYBA 5BOEA 1BGGA 3BUVA 3QFEA 3D5HA 3OZMA 4O4VA 1GYNA 2OODA 4WVXA 3P61A 1VFLA 2I5IA 4FSAA 3VMNA 4OZOA 5ECUA 2WKLA 1HJVA 3K2GA 2Z7GA 1J5SA 7REQB 4GX9A 3THQA 3G22A 3P6LA 3ITVA 4N42A 3W75A 3BWWA 3TQVA 4KEUA 3RJXA 1PCWA 6ALDA 1V6VA 4JDBA 3TN3A 1J79A 1LORA 1LG2A 4UFMA 1LBMA 4FNTA 5CG0A 1R3VA 3SSZA 3N3TA 3UG8A 4PB5A 4WDXA 2O4MA 4X0VA 2CESA 4Q4MA 3SIMA 4PMNA 2QUMA 3K1DA 2BODX 2PURA 2WZHA 1OK6A 1KV5A 5HQEA 3PZUA 1QJWA 3VOCA 4GVGA 2FZMA 3R94A 1EGVA 2HEJA 1SJBA 1KM5A 4LUYA 1QMLA 1CWYA 3VD4A 3W1TA 1XYCA 2GL5A 3AIBA 3HGSA 3P84A 1BXBA 1OABA 2O7SA 4H9UA 1JGIA 2W62A 5T8GA 1N8FA 3A47A 2GQ9A 2GGGA 3TSDA 1XJBA 2OVLA 3P14A 1RA0A 1E6XM 3TN6A 1DQXA 3EX2A 2HCVA 4J3ZA 3MVIA 5CGMA 3KHJA 2RDTA 1S1RA 3SGGA 4IGSA 4O53A 5AHIA 3AC0A 4CQ9A 2EJ1A 4OBRA 3TK7A 2QDGA 1XLJA 3APTA 3LQLA 2I5GA 2P88A 3SI9A 4ILSA 4KPLA 2VC9A 2R9RA 4GGBA 1AH3A 1H1YA 1LOSA 4LSBA 3USBA 4PUMA 3L9CA 1F4AA 4P7LA 3LD5A 4NP7A 2ATSA 3KOYA 3W1AA 1KWKA 3RHGA 1XLDA 3VNYA 4EF9A 3R5EA 3ZLGA 4DUXA 1YYAA 1GOXA 3IARA 1XXXA 3Q4DA 3G18A 1MZRA 1Q6GA 5CPOA 1PIGA 4IJBA 2DH3A 1V02A 2DUZA 3S2JA 3DFQA 4URIA 3HM7A 4I6VA 2UY3A 1FWCC 4Q7BA 1I60A 2AAAA 3DZ1A 3A3XA 1GVOA 1ZAIA 3T07A 1ISXA 1FXQA 1S2CA 5HDRA 4ERGA 5KEZA 3VGGA 2AQOA 4PCNA 3GH5A 3T8LA 3RX4A 1JUEA 3W82A 2FZ9A 1J0IA 4GFIA 4IGNA 3SGUA 4WY0B 1FCQA 3LXBA 2DDXA 2EPHA 2XN1A 3HOJA 4R27A 4R7JA 1ZBWA 2G3NA 3QOKA 1REQB 4I5RA 1IXOA 4LVGA 3WBWA 3LG3A 3AXXA 3BO9A 1HXJA 1NARA 2E68A 1X97A 3CV1A 4Q8VA 4NXKA 4PE8A 4ZZ9A 2BV9A 5GJMA 5RUBA 2DT3A 5EMJA 2OKTA 3NZRA 4CCCA 1EDQA 1LLOA 2FB3A 3M47A 4C6BA 4EACA 2VFDA 2PI6A 3MA8A 1HL9A 4AUBA 3QQWA 4FK9A 2OJPA 3KBNA 1ZP3A 1AQMA 1Z8AA 4O18A 2TPSA 3EAUA 2CZVA 1T99A 4V28A 4QEHA 2BGNE 1XYZA 1RPKA 1NFPA 3PPGA 1KFKA 1EZWA 1BHGA 4C5ZA 1OZMA 3ARWA 3DG3A 5E0CA 4E4PA 4J4KA 3OW1A 2ZX7A 1YEYA 1WPCA 5KMYA 2WZTA 3FGCB 4MY8A 1S38A 4W87A 3PAOA 3W2MA 1JXKA 2OX1A 2Z27A 3S2NA 3A6OA 3BJTA 4XWUA 2CBUA 3VFCA 1CZ1A 1UR0A 5IBXA 3W6YA 4JTQA 3LBOA 3CEUA 4NT0A 3AMLA 3O0FA 4KWVA 3Q2DA 3WH7A 3T0AA 4OUEA 4A3QA 1WKEA 3UJEA 1JUKA 1SMDA 4ICCX 3B05A 3S1WA 1TMQA 1U22A 1TPDA 2QXWA 1W9XA 2VVNA 2FPTA 2NV1A 3B04A 3WLTA 4MZ8A 3MSDA 2CLPA 1RV8A 3MKKA 3ITOA 4LPCA 1SZEA 2EAWA 4JTHA 4LV4A 1XSIA 1WV2A 3WLMA 1WB0A 3MC5A 3URQA 1E70M 3HPAA 1AJ2A 1M9HA 2UY2A 1SO6A 3THUA 2NVCA 1I4NA 1V0LA 3ZWSA 3E9AA 4GK8A 5F4WA 3SFWA 4AD5A 4POCA 3I3EA 1DBTA 2ZCGA 2D1ZA 1BYAA 3OBAA 2NWSA 4JN8A 5FJJA 1LL4A 4I7WA 3S5OA 3F2DA 1UQZA 1O95A 3NQAA 3VIGA 4C6MA 1W5NA 3W88A 4UQ9A 4CCEA 1B3YA 4OUIA 4P7NA 2RH9A 5EMLA 3TXVA 4CNTA 1W91A 2BTMA 5G1TA 4M8UA 5LNUA 1VPXA 3TW7A 1L9WA 1QNQA 4KRTA 1OCBA 3FW6A 4A8NA 3ZT6A 3MP3A 1SJDA 3GHUA 4JOMA 4LYQA 1CGXA 3FJ6A 3H7VA 3ITYA 3LCLA 2ZE3A 4V1YA 1GORA 1XW8A 3ANYA 3FX4A 4GIAA 4A3UA 4L1XA 2QEZA 1Q7QA 4BK9A 3QR0A 4C7DA 4FALA 1R87A 5U4NA 1ITQA 2CKSA 3M6DA 4DWSD 3CWNA 4RKAA 3OIHA 1XIIA 1I2PA 3GNXA 2PMQA 5T26A 2A7NA 1SFLA 2ONEA 3SCVA 3H2MA 2J7GA 5F4SA 4LEFA 1N55A 2BNJA 2DSWA 4L4OA 3W37A 3SCSA 4XO6A 3NR0A 1OFDA 2PEVA 4HZ8A 4QNWA 4C1KA 5HATA 4QE1A 1PHQA 3NZGA 3UZJA 1HUVA 1W5QA 3AICA 1Q6LA 1OYAA 3FOKA 4WX2A 3BAIA 1Y8BA 1NEYA 4QGCA 4ZO6A 4Q8MA 2XIQA 3L23A 4S3DA 3W4RA 1U1UA 3M46A 3SN4A 4GQQA 1JPMA 3PG9A 1ZPTA 1EL3A 1BVZA 1Y65A 4QEEA 1UASA 5HULA 1QASA 5HJLA 1DE5A 1DEDA 5LA1A 3E2VA 3VIIA 3L65A 4GVHA 1ME8A 2Y8VA 4RLIA 3T40A 1JZ3A 1XUZA 5EYWA 3SRFA 1YBQA 3SRKA 4HA0A 3KCOA 2XIBA 3EWDA 4AWUA 4AX7A 3NO5A 2FLIA 5LSMA 4HVXA 3ITLA 1V7AA 4RXFA 2D3NA 1UC5A 4NJHA 1S2TA 4PCSA 5I7GA 5TBOA 4JTCA 3V18A 5MHBA 5A6SA 3B0UX 2WSYA 4JIQA 4MNMA 2X0YA 3NTYA 3ORWA 3EPOA 1KLZA 1UC4A 3NDYA 4UZSA 3UBPC 4F79A 3EKZA 4XV0A 3NZ1A 4GZIA 4DXXA 1MRQA 4ZA0A 5TQLA 2FFIA 1KCZA 4ADSA 3EXRA 5HUPA 1PDZA 1H60A 1KGUA 3L2IA 3W01A 4MKVA 5F2MA 1LT7A 2VDIA 5B7YA 1XV8A 5FJTA 3VNLA 3MV11 1O1HA 2J8FA 5M1TA 4CN6A 2NSOA 3M0LA 4IJRA 2DH2A 4PB4A 4H8UA 1W8SA 4XZBA 1TPUA 2HROA 4RZ5A 3TN4A 2NUWA 2WNNA 2RJGA 5HWMA 1KXVA 1QPNA 2ALDA 1E43A 1CGUA 3BAJA 3GYCA 2YCJA 4KIRA 3WK1A 1NTHA 4R7OA 3GDMA 5FOOA 4H8VA 3WJWA 3GVQA 3P7YA 3M0HA 1KTBA 4IMAA 4FNSA 4YCPA 1QNPA 4B3LA 1QOXA 3UEQA 2OWXA 4NY2A 4J7RA 4G7FA 3GVGA 4DEFA 4IUGA 3C2RA 3QGVA 4HMEA 1K1DA 2ACSA 1VCFA 5BOFA 1XIDA 1FP8A 1XLKA 1JULA 7PTDA 4G5DA 4AZIA 4FXFA 3U5UA 4LCQA 3UR7A 1PX8A 3BW4A 1E4MM 4LALA 1BWLA 2O9TA 1FWHC 2VURA 3UVIA 4S39A 4RW5A 1EJSC 4MDOA 3SIZA 7A3HA 2NQJA 1LRQA 5L6UA 4QS6A 2WO5A 4MF4A 5I00A 2GDQA 1FUYA 4RNFA 2O9PA 3CM4A 3M0ZA 3CLWA 5C7VA 3UWWA 1GOOA 4F8XA 4MAVA 2W92A 3GTFA 3ZVHA 1EPXA 1QW9A 4S3BA 3FA5A 1TPFA 2G96A 9XIMA 3R7MA 1I2OA 4D8AA 3WLOA 1Y5XA 1RBAA 3UQNA 3RIKA 5CSYA 3ONCA 1FKXA 3QPEA 3TYCA 1V3LA 1X6UA 6XIMA 2X7VA 4CKQA 4KFOA 2YA2A 1EGZA 2DEPA 3WZ0E 4OV9A 2ZRYA 1OBAA 4B9ZA 2ZTJA 4PMVA 3S9IA 4ATLA 1C8YA 4DELA 4H6EA 3M0YA 4PRTA 4PR4A 1FRBA 3QV8A 4ATDA 1LBLA 3NG3A 4H7ZA 5FAJA 4ZOEA 1XGZA 3H24A 3LTPA 3C6CA 3NDOA 1WOBA 5CBBA 4TX6A 2ZDSA 4UOQA 2X30A 4YHEA 3IV3A 2ZUMA 1H4PA 1Z7AA 3O6AA 1ISYA 3BMVA 4IT1A 4TVDA 1QRQA 2OGYA 2HPMA 5DY3A 4L6OA 2QPXA 4KIEA 1ELSA 3T42A 1WUEA 3UCDA 2YR1A 4JTEA 2QYGA 4ES4A 1AQ0A 3K8KA 3W7IA 2CZDA 3AHYA 4JPGA 1ICSA 3CZEA 3WYZA 3U2ZA 3QPYA 5FEWA 3AJXA 2E4TA 1Y7VA 1PJ9A 2A85A 4AF0A 1UR9A 4Q33A 2J6VA 3QZEA 1DJNA 1OHLA 3STCA 1HP5A 4S3CA 3WNMA 4O16A 5HXMA 1KFJA 3L12A 1DORA 3TC3A 2ZWYA 2E5CA 3URNA 3ME3A 1GNXA 2DT0A 2FJKA 3AHTA 1A5UA 3WKZA 3IS4A 4QM1A 3B03A 3GBEA 4JX4A 2BLEA 2J7HA 1OCNA 4OECA 2J88A 1B0IA 4E6MA 2FB2A 3LNMA 2YB4A 2A7PA 2EPKX 3C0JA 4DUWA 3I7RA 1THFD 2PWGA 4YTTA 3UYCA 2BP1A 3GW3A 1O7AA 3B8VA 4FOUA 1B2YA 4E2DA 2PDKA 4H9YA 4C6JA 1RR2A 2RUSA 4WDTA 4F4RA 1SFJA 2J79A 1JFXA 4CN1A 4RXGA 4S3JA 4S3GA 4WDWA 4EPKA 3CYVA 1KWGA 4Z08A 3VNDA 3FK4A 2WSPA 2PODA 4CUCA 2DW7A 2NV9A 3UXLA 1VLWA 1R3WA 1XM3A 3ZOAA 5AB3A 5GPRA 3EB4A 2EKGA 5CAHA 5C9WA 3FA4A 3PUDA 1LBFA 3BCFA 2RDUA 3V16A 3LTSA 2NVAA 2ISDA 3WQ6A 2A2IA 1C7SA 2ZQ0A 4V27A 4D6FA 1D7FA 3KTSA 2E8YA 2A7RA 1UP3A 3MMDA 1IEQA 4C6FA 4D6IA 3EPNA 3EOLA 4EPDC 5GNXA 1TRIA 1UD3A 3AYVA 2WHJA 1W6TA 4LX4A 2QJMA 1EHNA 1KXHA 1PVNA 2CCRA 4HKPA 3UZWA 3QGKC 4GUGA 3ZZ1A 5HPOA 1P48A 3YPIA 2VEMA 2WVTA 4Q4SA 3NZQA 4JTJA 3HPXA 5CJMA 2CNCA 3TTEA 2EBNA 3IJ9A 5AVNA 4TTUA 4DHGA 1MSSA 2VVSA 3VX1A 3VPLA 3BTNA 1FWSA 5JMUA 1EZ2A 4HOZA 3FHQA 4QFUA 1HL8A 2JEQA 3KOFA 5AN7A 1C3FA 4M51A 1IEIA 1TTJA 2INFA 3SCTA 2WPGA 3MMWA 3FJLA 2QF8A 2DSUA 1K9TA 1XFBA 1ZS2A 3RUBL 4C6NA 1CEOA 4F9JA 4Y96A 2PDMA 2NVDA 1IV8A 4B5VA 3A4AA 3FN9A 3I4KA 4C6LA 2R91A 2OZ8A 1HNYA 3JR2A 3WQDA 3N4AA 8XIMA 5A94A 1NJJA 3AIVA 4O57A 1QOPA 1F5ZA 4J3VA 4KEMA 1QO5A 2QDEA 2YCIX 4N6FA 3SQLA 3ARTA 3HPFA 3TAKA 2VT0A 2INEA 5I79A 1Z9AA 3L21A 1UZDA 1KGWA 3AMCA 4M29A 1V3JA 1MW2A 1RPXA 2J47A 4RCXA 4YLWA 3WN6A 2OSWA 4GPNA 1EP2A 3Q65A 3O0KA 2PDFA 4H01A 3RFAA 1UIPA 4A05A 3SB0A 1EJWC 3EWCA 2BY0A 4JNYA 1UH2A 4AY8A 1SMAA 1T7LA 1VLIA 3C8FA 2QJHA 3N2MA 1G69A 1DIDA 2XVNA 3RM4A 3M64A 3MSGA 5HNUA 1DJXA 2CIPA 3R0DA 2RAGA 3WDIA 1NDYA 4HSOA 2VOTA 3IJ8A 4GNVA 4H19A 2OQLA 1XSJA 3NCOA 1W9VA 3UWVA 5CAKA 4LYPA 2O9RA 5JBFA 3WQGA 3KAOA 1XIEA 3SCOA 4RE0A 3PY2A 1XINA 4FNQA 4X63A 1A5AA 4B16A 2RDWA 4HA3A 3KZSA 4NZJA 3MT1A 3DX5A 1WAWA 4UR8A 5BZAA 4PTDA 1KV8A 5I23A 2AAMA 2OKOA 3EEZA 6ENLA 4O4WA 4PB3A 3S2MA 3ZSSA 5LNWA 3QZAA 3PJWA 1V6XA 4L9XA 2YDSA 1R3TA 2W91A 5K3VA 1TSIA 2PGWA 3IUDA 4XD4A 4DYEA 1E0WA 5CGQA 1JCLA 4JN6A 2GGHA 1W9BM 1KKRA 1EYEA 3LEPA 4TR9A 2PDHA 3OQ8A 3PZTA 1XLMA 3WL1A 3EX4A 4HNLA 3QJAA 3T55A 1AH0A 1CB7B 5MF5A 4UOZA 5T91A 4CNPA 1J5TA 4AZCA 2XUCA 3K4WA 4DAFA 2JBMA 1S3TC 3PS7A 3PTMA 2WMIA 3MUIA 4B91A 3QW3A 2WANA 3G1DA 2VTFA 4B9YA 5HMEA 4MSSA 2Y24A 1KRMA 4K3ZA 4US6A 3RN6A 3KOZA 3AZSA 1UUOA 2PDBA 1GJPA 2NZLA 1UQYA 3CQIA 1GOMA 1S5VA 2PWUA 4DWDA 1VFOA 4RJEA 3GTHA 1R2RA 3C61A 3NEHA 1BPLB 3TEVA 2VFFA 4GWEA 4K37A 5I3DA 3CUJA 1VYRA 4M82A 5F1UA 1D2KA 2WQDA 2D0FA 4DBDA 3KW3A 4CNSA 3NQCA 2A3LA 4G2DA 4LT9A 4UMBA 2P53A 3DYMA 1EWEA 3CK5A 1OWQA 4IG2A 5I07A 2GK1B 1CLVA 4IH3A 4Q8QA 3KM8A 3AXKA 3KZPA 2NQ5A 3B0XA 4IQEA 3SUSA 4BQ2A 1VEMA 3VD5A 2YIHA 4LS0A 4NZFA 5IFPA 3GVWA 2XH0A 3T05A 4O19A 2A5HA 2QJNA 4EXQA 5IOBA 3GSMA 3CASA 3T2QA 3DBNA 1D3HA 2A6NA 1OF8A 1QATA 1X96A 3GAKA 5FAGA 1XKYA 3OU8A 4Q7NA 2ISSA 3ARQA 3BV7A 5F2LA 4KEZA 4PTXA 4QSFA 3GTXA 4Q7IA 3QV6A 3AHZA 1UKSA 3B9EA 2GK1A 4IZGA 1J01A 3LPOA 1JCMP 1U5HA 1OGGA 5A6LA 1N2VA 1YBQB 7ODCA 3OG3A 1NU5A 3GB6A 1YE4A 1BG9A 1ZJBA 4YVPA 4XBJA 3FYOA 4JKMA 5AYIA 2Z0IA 2P76A 3BOLA 3HG5A 3A4WA 1JDDA 2GJPA 3MDWA 4DYKA 1EFZA 4HOXA 4DIAA 1VS1A 2PWVA 3BPWA 3PTDA 5BYWA 3PZVA 4Z0SA 3LGGA 4FI4A 3OLEA 1NWUA 2AMXA 3NVDA 1A80A 3QHNA 2AL2A 4K8EA 4AX6A 4JHOA 1OFPA 3RU8X 3NPUA 3FEMA 5D37A 1YTKA 2DZBA 4KS0A 3A3HA 3TYEA 5A5WA 1ZENA 4PUUA 4NZ4A 3NQ8A 4AISA 1U30A 3VIKA 1K03A 2V3DA 2VOMA 2C6QA 2OYLA 1LRTA 2FPVA 1IWPA 2VGFA 4WY0F 3OLIA 3WX7A 2VRKA 1EOMA 1GQIA 3KFTA 2JEPA 2FZBA 3V5FA 3WQWA 1IT8A 2ZZ5A 3G8EA 4YIWA 2LLEA 3BLLA 3KDOA 3AWOA 4K6AA 5F7UA 4GA8A 2BVWA 4UQEA 5K7JA 2PLCA 1W3IA 4TMCA 1CBGA 1CYGA 4KWOA 1XP3A 4TX8A 3TTQA 2HV5A 2PDQA 4F9DA 1Z3NA 5A2AA 3T0TA 3LCFA 1CGYA 2BHUA 1PZ3A 4DBSA 1XH0A 4P7RA 4QXIA 2QAFA 3KRBA 2F7FA 4ERAA 5KITA 2PDYA 1XIFA 2VKZG 3G1SA 3OLGA 1XRVA 3CH9A 5AC4A 1JL8A 4S38A 4ZB2A 1I1WA 2NQHA 5A69A 2QCCA 4JX6A 1G0CA 4JQ1A 3WK3A 1OYCA 4XISA 4HSHA 2A3BA 5DRIA 1V02E 1K7FA 1XF0A 1UD6A 4L6HA 1S5MA 4LWWA 4DJDA 4W4QA 3N25A 5LHEA 2DT1A 2V67A 4HTYA 2E6FA 5FJPA 5H6HA 1UH3A 2WC7A 1VRXA 3QGAC 3PC0A 2Q3RA 4LUSB 3OGSA 5CC3A 1BVNP 4N9CA 1XLCA 3QTPA 4GNJA 1PYFA 3V1PA 2KX9A 1NF0A 4UTTA 3EOEA 2PC4A 4A29A 4JTUA 3PZGA 1AW2A 5A8GA 1B3XA 2EO7A 2JK2A 3CO4A 3KVKA 5D03A 3WUFA 4BR1A 2FVMA 5F2GA 3RLHA 1WP6A 3H6OA 1XG3A 3SDOA 1XHGA 4G9PA 4LVAA 4RNJA 4QDWA 4RV3A 3R79A 2VZUA 3WMSA 1Q6DA 1DKWA 5ABHA 5TIMA 1WKYA 4J1OA 3STPA 3EOOA 3K4AA 1KRAC 1W1TA 2W9MA 1J93A 4KFNA 1CXKA 1XH2A 4PSRA 4L7ZA 3ABRA 1V08A 2RHGA 4AU0A 1RSCA 1H41A 2FKPA 1V6UA 1OJXA 3VKBA 3ABZA 1J12A 4WKFA 3S1VA 3E0FA 4Q8TA 1GOIA 5E0KA 2OEMA 2IPWA 2CXEA 1A5LC 4NIRA 1P6BA 4ZMGA 2XVGA 1O66A 3QBUA 1CPUA 2ZOXA 1OFQA 1AQHA 4HN4A 2VUYA 1G01A 1GKRA 3A12A 5BWAA 3I7SA 5BMWA 4LVBA 1B5TA 3MO4A 3N19B 3SUWA 3GNOA 3R12A 2JF7A 4GIEA 3C3NA 1XD1A 5BW6A 2YW4A 3UWEA 5DLCA 1C29A 4Z1DA 3NQDA 4O8RA 2I17A 5I78A 5JH2A 3OZYA 3MWCA 4F0KA 4PUNA 4X22A 3NDZA 4RZBA 2FDSA 3B9AA 4JICA 2CC0A 1H2JA 1W3JA 4RV8A 1E6RA 4XSMA 2IS7A 3WH9A 2RGMA 3IGXA 4CD4A 3WQCA 5C70A 1UH4A 2PDLA 3KCLA 4KH2A 2PCQA 4PTNA 4YWSA 4WJ8A 3WLNA 8TIMA 2EEXA 1V5XA 4BY3A 3GG7A 5DX7A 1SJAA 4NJJA 2Y88A 2H8XA 4E5TA 3LPGA 3KX6A 4ZQPA 2I5QA 3Q37A 3BOFA 2PSNA 2Z7KA 2G3MA 3WQEA 1J9YA 2XYLA 4OGZA 4AD2A 4HNNA 3MO7A 3UCCA 3IJLA 3R8HA 3OLDA 1LF1A 2Y0FA 5K2ZA 3WBAA 4PEEA 3W22A 4LUSA 1JYXA 4ADTA 1DJHA 1VF8A 1PX4A 1VZWA 4HOWA 1FKWA 2JALA 3RYSA 3LMYA 1UYQA 2CBVA 2DT2A 4MIMA 3PBVA 1UR3M 4LRTA 4GQBA 4OOZA 5G1MA 2DORA 1E6PA 3GBDA 3ISIX 1K7EA 3CL7A 2Z6JA 4B5WA 3TMLA 3WJYA 4GH3A 4N2YA 1Q6FA 3N14A 3DC0A 3N18A 1EGMA 4FEZA 4ZR8A 1Z42A 1W2PA 3W2JA 4ZTXA 1DHPA 4S1FA 1IIHA 1RD6A 2PRMA 4ZQOA 3KL3A 2RFGA 1YDNA 1XL9A 3NPXA 3I6EA 5JXQA 1R47A 4Z1AA 1XCWA 4EVZA 3SCQA 1RCXB 4NASA 2QVNA 1J8VA 4NNCA 4PFHA 3IV8A 4O52A 5K9DA 5AZ1A 1C8VA 2GVJA 5J5RA 3WDRA 3VNJA 3G1VA 2ACQA 3ALGA 3BLDA 3FJNA 5XIMA 1SZNA 1WZMA 5AC8A 3M0XA 4NVTA 3VIOA 2WWDA 4ZE4A 4M1BA 1F6PA 2ZVRA 4NKCA 4GYKA 3VKDA 2G3JA 2Y7GA 4MB1A 1YNQA 2HS8A 1QK2A 2I14A 1DTNA 6CGTA 1POJA 3WENA 3CMJA 3UWZA 1TA3A 2DZTA 4ZENA 1TJRA 4WXYA 3IJ7A 3HJZA 2E09A 2HISA 1R9XA 3B8WA 3W70A 4ZL1A 1WXYA 5CSRA 4G56A 1KFLA 1UMYA 1DOSA 5AC7A 3AMDA 3G77A 1ISWA 3WCZA 1KQYA 1UZ4A 4NSBA 2REQA 2VD9A 9CGTA 2CPUA 4MB3A 4L80A 3AYRA 3UVAA 4S2CA 5H8MA 2F6KA 2OT0A 5G4HC 5CSSA 3BAXA 3NIYA 4PMOA 1OFRA 3DXIA 3W72A 3LTYA 1MUWA 1KM2A 4J9JA 1IZKA 1I2QA 5D33A 1Q8JA 1RLCL 3UXIA 2W5FA 4ZTYA 1XDLA 3A4XA 1HN1A 2HMCA 4DM1A 1TZZA 1SFTA 3IK2A 4UTWA 2E3ZA 1SZFA 2EXOA 3NQVA 1QCWA 2Q09A 2ZXAA 3JUGA 3RXZA 4Q4OA 2A3AA 1BKSA 1VEPA 2PCEA 3W84A 3KRZA 3G1YA 4NZCA 2F8QA 5A8NA 4CCZA 3TJ4A 1LWIA 3BGJA 2QQ6A 1T40A 2QKFA 2OU4A 2YSWA 4O1AA 5EPDA 1PZ1A 3DG6A 2WMIB 4C91A 2ZBTA 4LS1A 3M5VA 3QM3A 3CZGA 3UNDA 3WFZA 4LH8A 1DQUA 3LDVA 2EPMX 3U9IA 1M3UA 1VRDA 1VIZA 1NVMA 1JAEA 4B3ZA 5C9UA 4IG2B 3LSCA 4YHGA 3UJSA 3W76A 3AISA 3HV8A 3E02A 4AVFA 2VUNA 1XSKA 4HD5A 3PBYA 5CG7A 5C9ZA 1P4CA 1I0BA 1LQ2A 3VAVA 2DU2A 4FXSA 2IPFA 4DO6A 4YTQA 3TFCA 2AQVA 3HURA 2CU0A 4U33A 4PULA 3S6OA 3CQJA 1JCXA 1PAMA 4DPQA 3O16A 2PZ0A 4IL0A 1VHCA 1E1FA 4A8RA 1XBZA 3W1QA 1F3TA 4S3FA 2DJLA 1CENA 1OC6A 3UPMA 1Q6CA 3UZXA 5H8UA 4DJDD 3CV7A 1TPVA 3GDRA 1RVGA 2XU2A 3G0SA 1C92A 4R85A 2EPOA 1KR1A 1PPIA 3LCXA 4M6VA 3U0HA 1Q7MA 5HJXA 3W25A 4DZHA 1F2JA 1L2UA 1TUXA 3B8IA 3S2CA 3QOMA 3MMUA 5FJUA 4WJXA 2Z2AA 4YYFA 4M1RA 1GEHA 3BC9A 1F8MA 4MGGA 3M43A 4JFWA 1V77A 2P10A 2BY3A 2MUCA 1JDEA 4HHPA 2Y8UA 3NO3A 2VGIA 1ME9A 3MBFA 2W66A 2AL2B 3ZQ9A 1W37A 2PDWA 4BI7A 2BDQA 1L2QA 5GJNA 3H2FA 4Q4RA 3IRSA 5AY7A 4NYYA 3VCCA 2VCAA 1T5AA 2YKKA 4DBUA 2Y5SA 5IDZA 4ZQCA 3M5YA 1WOAA 1XRTA 4ZO7A 1Y0EA 2PDGA 1V6YA 3S4TA 2X1TA 4UTHA 2HE5A 1VB9A