3H24A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
267
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 267
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h24A00
1Q7ZA 3H23A 3NOYA 4MWAC 4O1EA 3H2EA 4S38A 1F6YA 4O0QA 4NL1A 4S3BA 3TR9A 2BMBA 2DZAA 4NIRA 1TWZA 4NILA 4NHVA 5JQ9A 1Q8JA 4G9PA 3MCNA 2Y5SA 4D8ZA 1TX0A 2YCJA 4D8AA 3TYZA 1Q7MA 3H2MA 3TZNA 1TX2A 3H24A 2DQWA 4DJDA 3H2NA 3K13A 4O1FA 3TYDA 2VEFA 4D9PA 4MWAE 1AD1A 2YCIX 3H22A 4S3AA 1AJ0A 3V5OA 3TYAA 4DJFA 4HB7A 1TWSA 1Q8AA 3TZFA 2YCKX 4MWAB 4MWAA 4DAFA 3H26A 3H2FA 4CCZA 3BOFA 4S39A 4DB7A 2E7FA 2H9AB 2VEGA 1AJ2A 3H2AA 2H9AA 4DJED 4DJEC 2VP8A 2Y5JA 4DJDD 2Y0FA 4S3CA 1TWWA 1Q7QA 1EYEA 3TYEA 1AD4A 3H2OA 4DJFD 2YCLB 3TYUA 3TYCA 2YCLA 4S3FA 2DZBA 3MCOA 3H21A 4PZVA 3H2CA 4C1NB 4MWAD 4C1NA 3TYBA 1Q85A 2OGYA 4DJDC 1AJZA 3MCMA 4DJFC 4S3EA 4S23A 3BOLA 4DAIA 4S3DA 4DJEA
chains in the Genus database with same CATH superfamily
1US3A 1V79A 4H6RA 1RY0A 1EJRC 1E1FA 3N2CA 2CLHA 4NX0A 3SCSA 4J28A 2QCDB 1PHQA 2WBKA 4HJFA 2EJAA 1PTDA 1K8XA 1UQYA 1MEIA 1AZ2A 1YXYA 1EC7A 3T2OA 3KVLA 4X0VA 3LCIA 1QW9A 4WSKA 2EKCA 1VIZA 4XB3A 3TSBA 4FF5A 5C9WA 3QVQA 3N14A 4XZWA 5D2XA 1G4SA 2J24A 5D02A 3P93A 4HNUA 1I2RA 2D3LA 1I0DA 4LCSA 2HBXA 1YX1A 5CPSA 4J40A 3CZJA 3C2EA 4R85A 1S39A 2OVLA 3B40A 4J3TA 2Z29A 2CLMA 1YDNA 2XSXA 3EOOA 3LSCA 4CCZA 2CLPA 2DT2A 3CL7A 4H6EA 3UGVA 1HJVA 1XIBA 1TJ2A 3CL6A 1MZRA 2AQVA 9RUBA 3VUSA 3B03A 1DHPA 1VHCA 2R8WA 3IV8A 1KM2A 3UF9A 4TTGA 4JX5A 3N6HA 1XYFA 1B57A 2C6QA 2WO5A 1KW1A 2VO5A 3TTEA 3F5JA 4HK7A 2PZ0A 5C2GA 4GYFA 2Y6ZA 3SB0A 4NX5A 3OBKA 4HNLA 2OZTA 4B3LA 2CNCA 3WY1A 2PC4A 3S1VA 3NYZA 2CEQA 1P43A 5SWUA 3FV9A 1M7OA 4QGCA 3U4AA 2XGIA 2FDSA 3B9AA 3SCWA 2CC0A 4H9ZA 4B9ZA 4C7FA 1F9CA 1RVGA 4PMRA 1NWUA 4NZ3A 1XX1A 2CHNA 4PULA 2PCEA 5AECA 3V35A 4NJIA 4B91A 3DC8A 3N13A 4NNBA 3CM4A 3EDJA 3DYPA 1F3EA 5E93A 3H12A 1R38A 4O13A 1TREA 1AH4A 5HULA 2QVHA 3S6TA 1RVKA 2ACQA 5JUVA 3IV3A 3B9EA 1RCOB 4DO5A 1XYZA 1HZYA 4Q7BA 2RH9A 3OA3A 3R5EA 3L5AA 1R7AA 2ZX8A 4EPKA 1J4EA 4JFWA 3WDRA 4UMAA 1FXPA 4ZOBA 2EO7A 1O68A 2B7QA 1VPXA 3CJPA 1R7OA 3V5FA 5F2LA 4S39A 1VJSA 3I6EA 4GC4A 2YXXA 4H7CA 4I3GA 1W1YA 5EPDA 1XS2A 5GPRA 3PNZA 1TWWA 4GH1A 1LOQA 3ARVA 3RILA 3RJXA 3U6WA 2QJIA 3IGHX 3GDTA 1YADA 1XIHA 4BZYA 2CIPA 4ZENA 3UCQA 1VBJA 3WLKX 3WBYA 4ZR8A 5A6KA 1Z69A 3ANVA 4XAPA 1DJNA 3O6CA 5C54A 2JBMA 3SN4A 5CC5A 1YBQB 3EDDA 3CQHA 2PGWA 4L64A 4BWLC 3CV7A 1BF2A 2JQXA 2YL9A 3H2EA 1QHOA 2ZZ3A 3E49A 1K9FA 1XLGA 4ENLA 2ZXBA 4X60A 5CPMA 1R2SA 4JXCA 2CITA 3T4CA 1H4PA 4IGHA 3IVSA 3W23A 4JY8A 3CMGA 1J0IA 2BV9A 2A0NA 1WUFA 5HQLA 4RPQA 1G1YA 3DFTA 4E3TA 1Z42A 4MG4A 1Z32X 1IIHA 3L12A 3O0KA 1W9DM 3ZVIA 4Z17A 2H9AB 2XFYA 3GQYA 1E40A 4A35A 3OQEA 1GVFA 1JYWA 3NM1A 1IT8A 3PUEA 3CEUA 4PUUA 3KL0A 2QCLA 2VZUA 1I2OA 2CKRA 4XWUA 4L7ZA 4E6MA 1ZQ5A 3WK0A 3HPSA 3CB8A 2WSKA 4UFKA 4MKSA 1QO5A 2OLHA 4OWGA 4BK9A 2ZVIA 4JAWA 1TKKA 3M7SA 1T8QA 2OKOA 2UZ9A 2V5DA 2Z2AA 4J7RA 3DG3A 4LTSA 1V51A 5HK4A 1R85A 3M07A 3U2OA 3KL3A 3OHMB 4FPSA 5A6BA 4C6QA 1A5LC 5EB8A 4LAUA 1ELSA 3E96A 3W1PA 4EAMA 1JRBA 1FHVA 1XLDA 2FGZA 3N15A 1N55A 4N9EA 2JEPA 3L68A 3LHVA 3NQ8A 3TIMA 3L9CA 1SVDA 1UROA 3LLDA 4QBXA 1H5VA 3UPWA 1GJPA 4F9JA 1XC6A 4NJHA 5FF0A 4I9MA 4AZ7A 4L1GA 4CU8A 4AIBA 2VVNA 4WUIA 1XSJA 4Q22A 5B80A 4CEUC 4AZ5A 2P1FA 2Y0FA 4ZQMA 3VI2A 4GCAA 1A5OC 1OFAA 1ZHAA 5IBXC 1PJ9A 2Z25A 3LRLA 5CH9A 3GKFA 1UMLA 1E70M 2PS2A 3DH7A 2UY2A 4L9ZA 1RA0A 4JTQA 3BGAA 3S6OA 3QYSA 1QOQA 1T5AA 3VABA 1NY1A 3N34A 4WKFA 3W22A 4GQBA 2YA0A 4XZLX 2INEA 1BHGA 1SW3A 3QHNA 2BLEA 2I16A 1OYBA 2JK2A 5J04A 4J2MA 5K4XA 1IEIA 2RGLA 2VZVA 3ZVHA 1RBOB 1I0BA 4JIIX 3VIFA 3LBOA 1E4IA 3U5YA 4NI8A 4GLEA 4LNCA 2KZHA 2WC7A 3EA3A 2QGYA 4JN8A 3C8FA 4LPCA 1DOSA 3T2PA 1H2JA 4LVGA 2HTMA 3VINA 3WN6A 5FI8A 2B4GA 3O15A 3EKLA 3PR2A 2CHOA 4PMYA 1XFCA 4AWEA 3OBEA 2YZ5A 4LXFA 4AFYA 2O92A 3VGEA 4DNMA 3WUBA 1PWMA 4W8AA 4MNJA 1ISXA 5F4XA 4GMEA 2QCGA 4UB9A 1W9BM 2IPFA 3KTSA 2QCNA 1K6AA 2Z7KA 4Q4RA 1MDRA 2O4QA 5LSMA 1D7FA 4QNEA 4XD4A 3M5XA 4BKNA 1OX4B 3RPMA 2V30A 2EG8A 1HJQA 1KRAC 3OVPA 1NDYA 4YS1A 1R5YA 4O1AA 5GJNA 5T9BG 1U1HA 3ZJ8A 3R11A 2PTXA 1PZ2A 1TPB1 1YXDA 5J5RA 1A5BA 2J79A 2YCLA 3G77A 3S1WA 5AHEA 5BOEA 1L2UA 2G0WA 5C55A 3L2MA 4ZFCA 3ZMRA 3P3BA 3ERPA 4UFIA 1G4TA 3KVJA 4KBXA 1BD0A 1EX5A 4NG3A 1A4LA 4PA8A 2Z26A 4BHYA 3WZ0E 1WXZA 2XIOA 3IJ6A 2A3BA 1KBBA 2E9MA 3IVUA 5AHIA 4YMZA 4ZB5A 4ZQOA 2FPVA 3UXAA 1JDCA 5LNUA 4V33A 2OCZA 2R94A 4L61A 3SQLA 1O12A 3BJTA 4IP5A 2VELA 1RSCA 1K4GA 3HO8A 4R7JA 2EJ1A 4MB4A 3VD9A 1UIOA 1TQXA 2VR5A 3T42A 1F76A 3QJAA 1JG9A 4GUJA 1K02A 1GQLA 5CQ1A 1U5HA 3GXPA 3RU6A 3WELA 3GXTA 1R30A 1NARA 3W87A 3JS3A 1K1DA 4JTUA 2WVVB 4HMCA 4QP0A 3SN1A 4Y9MA 1FHLA 3BH4A 4WDWA 4GY1A 2Q71A 3NJ3A 3L4UA 4Z1AA 3RJYA 1C7SA 2CBVA 3C61A 4S3CA 1D8CA 3B8SA 3G24A 3C52A 4RV3A 4RZBA 1S2VA 1SR0A 3I6RA 4PUNA 3PZMA 3IACA 2BVWA 3P5YA 1VYSX 4LWWA 3MKVA 3VU2A 4ZODA 3CQ0A 5A8OA 4YTUA 4DJDC 2VM8A 3I7QA 1K6WA 4DUWA 2QDGA 2VGGA 1I1XA 3CUZA 5IM51 4GY0A 1XIIA 3RLUA 5IDIA 2P10A 2XFFA 2PGRA 5HAOA 2ZZ7A 3CASA 5FJIA 4FALA 2Y7GA 1YLVA 5IOBA 3KOXA 5FJTA 4H9MA 3TNOA 3ZSSA 2EBNA 3FOKA 1GUVA 1LLZA 5H8UA 4N4PA 1HXJA 2DSWA 4DF2A 2FHFA 3LPFA 2ZBTA 4LOCA 1M04A 4YCPA 1O4UA 3WLQA 4MSSA 1QW7A 5D2TA 3W2JA 3WX7A 2XTKA 3WQPA 3PWGA 3MMTA 3ENLA 2AOSA 2G97A 1VPYA 1ZBWA 2QIWA 2IPGA 4IQLA 4AHQA 3LCLA 1ZENA 3GNPA 4NAFB 4CQBA 3RRXA 6TAAA 5HQEA 2J74A 3M0IA 4LT9A 3BC9A 4DBDA 5E9XA 1OFPA 3A6OA 4HU0A 3W85A 1BYAA 1XG4A 3U2CA 3L2IA 5FD0A 1XF0A 3VA8A 3QF0A 4GISA 3E02A 2QKFA 1UPMB 3M5YA 3O05A 4MWAD 2F38A 2YL6A 4NASA 5CSRA 3L4WA 2O9OA 3BQ5A 1GOIA 1XCWA 3ZT6A 4D6CA 2P3ZA 4LY8A 1B9ZA 1UASA 4CD6A 2QDDA 1EEXA 2G4JA 4JTLA 1NVMA 5AHNA 3W6MA 5I00A 2BHZA 2Q3OA 1GZGA 2OODA 2FGLA 3WLLA 3M0HA 1UH3A 1KM3A 4P8XA 4LUTA 3UNDA 4H01A 3ARQA 3T44A 5EU9A 3XIMA 3M0VA 5C9UA 4C7DA 4HSNA 3DESA 4WKHA 3FCPA 3ID7A 4M5PA 1R3VA 3FDKA 1PB0A 4DM1A 3N17A 4WXYA 1TR1A 4IZGA 2VRJA 3WUEA 1UP3A 4DYKA 1KWGA 4ZMGA 3S9YA 4M3PA 4PCPA 3BW3A 4FHAA 3S1XA 1J2BA 3TQVA 3A24A 4GYPA 1TPUA 3C3UA 1IT0A 7PTDA 3AXIA 3VPLA 1POJA 1J01A 4IGNA 4YVPA 3WG6A 4CU7A 2VEGA 3TK7A 1S2WA 4JTKA 3DEQA 2I14A 3FA5A 1XG3A 1ZP3A 3I68A 1A5CA 5TAOA 2PU0A 3AJ7A 2AQWA 4I6KA 4M24A 1SFJA 2HK1A 5CZ0A 4IG2B 1TPVA 1XRVA 1T0OA 3A4JA 2EPKX 1XYMA 1E1CA 3KCLA 3T78A 4ATLA 4TVCA 5LGZA 1BKSA 3ANYA 1UZDA 4OQVA 4B4FA 3L5LA 1L6YA 1JXJA 1VH7A 1TRIA 1OFQA 2EXOA 5T26A 4C1KA 1V3KA 1OCBA 3FHAA 2FPTA 4K8GA 3GTXA 4DPPA 1CECA 3YPIA 1F3TA 2PDLA 3CHDA 4FXSA 4QX4A 4K36A 1POKA 1LM1A 5K7JA 1KQZA 1JRCA 3VOGA 2BODX 3E3HA 3QMSA 3ITVA 2VRQA 4O1EA 1B3ZA 3NQCA 4JFTA 5FCZA 2X0YA 3ABSA 1JFXA 5CAKA 1B9BA 4O0QA 4AY1A 3UD6A 4Y96A 3GAKA 3RNDA 5M5DA 3AICA 4GJIA 4CQDA 1PPIA 1PYMA 4HYWA 5IDZA 2HVNA 4XQ6A 3CHEA 2CLIA 1M6JA 1P6CA 4PMJA 3SR7A 3W02A 3VFCA 4UTIA 3QPZA 4RUBA 1FQ0A 4K8HA 3WD4A 3CB3A 4PMXA 3O16A 1KRCC 3HJZA 1C8XA 4HHLA 3GKAA 3W7IA 5BU6A 3QY6A 1E6SM 4QFUA 1XGEA 3WMSA 5D2WA 3USBA 3MUAA 2WM1A 1XDJA 3P60A 3B4YA 2BG5A 5TD4A 1SZRA 3WQOA 4N02A 3SRFA 1P1MA 3CT2A 2YFNA 4ECLA 4DJFD 1YRRA 3IJDA 3VIJA 2YJQA 4FLQA 1U33A 4D6HA 2DZBA 3EOUA 1B4EA 3E12A 4RLIA 3DYMA 3W2UA 1U30A 3NQVA 2DIEA 3IUDA 1X1OA 3E1F1 2R6OA 1P1XA 1T7LA 1CX9A 1AJZA 1UWIA 3QOKA 4W87A 2ICSA 1MW3A 2E28A 4QITA 2YA1A 5TNVA 3R2GA 3HPAA 2PFHA 1OCQA 5DMMA 1ZBCA 2XWDA 3K1DA 1IZKA 4CLMA 3ABXA 1UKSA 1PCWA 3HF3A 2DIKA 2ZUNA 1OG6A 3EKGA 3NQMA 4PCSA 4MPKA 1ADOA 2DZAA 2P3EA 1YTKA 3B97A 3DFOA 4NNCA 4PN2A 3TAKA 4M56A 5D04C 3V36A 3TJXA 3GTFA 2WV8A 1N8FA 5CBBA 4AD1A 3UZ5A 3LA4A 5D2YA 3WQCA 2DORA 1ZJBA 7CGTA 2E5CA 3MANA 3WQ6A 4E2DA 3W1TA 4JTCA 4HK6A 3IIVA 4LV9A 1AQFA 2J4GA 3I6TA 4JKMA 4IT1A 4DB7A 5BNKA 3AMDA 5A8PA 4FNTA 3O9NA 4LRSA 1QI5A 3ES7A 4XZHA 3CLWA 1E55A 4H83A 4EAYA 1VHNA 1AD4A 4D72A 3UPMA 4ZFMA 4M82A 7ENLA 2DVXA 1EJXC 1VCGA 3AZRA 5AC7A 1YXCA 1H7WA 2X0HA 4XBJA 3HGSA 1W56A 4GWEA 3KP0A 4AWUA 2WCAA 1R2TA 5CZTA 2ZRZA 2FZDA 1NWSA 2GUUA 3BCDA 5F2MA 2IQTA 4FNSA 3WDQA 4ATDA 3DN5A 3E5PA 2XFWA 3GVQA 1VEPA 3Q45A 2YA2A 4UFHA 3C0SA 5BZAA 4S3DA 3IJ7A 2Q3RA 1L6SA 1JDFA 5FF7A 1FH9A 4NXKA 7REQB 1S38A 3MI2A 3GG7A 2ZWYA 1UB3A 4QSHA 7TIMA 3FYYA 1Q6OA 3R13A 4NAEB 5F2IA 1WOAA 4X9YA 4KRTA 2ATSA 3C2FA 1RHCA 3PZIA 4MADA 3VTRA 1RCQA 3ORWA 4GY7A 3PZ9A 4EVZA 4RNHA 3WUGA 1AQHA 3SUUA 4JOMA 1C9DA 1L2QA 1M03A 1NSJA 3GSMA 1EKOA 1XISA 4MZ8A 1E9IA 1XIJA 4J1OA 2AGTA 3R4IA 4Q8VA 1E4LA 4FXFA 2WMGA 2C1IA 4UOJA 4D6IA 1V02A 3VDAA 3C2OA 5I2UA 2CLLA 1JQVA 1OQFA 3VX1A 3VIIA 3C2YA 2YYUA 5T9CE 3S5OA 4OKDA 2PP0A 3TYCA 1UR4A 3I4EA 1JDDA 3NSNA 4R33A 3V0SA 4PCFA 4AVFA 3VD7A 4FIRA 2O56A 2EPNA 4LEFA 3FEMA 5TBOA 1IXNA 1U2YA 4GGHA 1ML1A 4J3VA 1VLIA 1WXYA 3SSZA 1HJSA 1L8NA 3GH5A 3USZA 2YGYA 3THUA 3OVQA 4I5UA 3PPGA 4YTTA 1MXDA 3GNOA 3DHUA 1E3ZA 3PFMA 1SJCA 5AVHA 3GIYA 4YCOA 3EBVA 8RUCA 4DIAA 2PI6A 2R1LA 4MB5A 1FBAA 1MRQA 2J8TA 3QGKC 3T0AA 5A2AA 5D37A 1Q2RA 2OZ3A 1LQ2A 1FDJA 3PTKA 1XIEA 2QUUA 3ZIZA 3UT0A 3VNLA 1AD1A 4JHMA 1F8MA 1RXOB 2RDTA 3TJ4A 1QT1A 1V6VA 4P8WA 3TW7A 3GU9A 3PK7A 9XIMA 4JHZA 3LDVA 1EB3A 3GR7A 3RN6A 3XINA 1HL8A 2A3EA 2ZRWA 4XV0A 4YTSA 3U8GA 3W07A 3WK3A 3VC6A 2PDKA 3R0DA 4V1XA 3PANA 3M64A 4A8RA 1MWOA 1SZEA 1RY8A 4Q8TA 1A5NC 2FH6A 3VM5A 3SFKA 1Z7AA 3GHSA 1EA9C 4UNIA 5DO8A 3EB2A 1W91A 1XDLA 2V3GA 4LS0A 4YWSA 6TIMA 1TE1A 3SCTA 4IFKB 4FNQA 1OF6A 2AL2A 2FDMA 3F03K 4RE2A 1KTNA 2QJNA 3R8RA 4RV8A 2QS8A 1SUXA 3TW6A 4CNNA 2GGEA 1NFPA 4HK5A 1GORA 3SY5A 1LYXA 1OZMA 4LY4A 2FMOA 3EB3A 2ZTKA 1K7FA 4OGZA 1TELA 3M9YA 3BXWA 1B0IA 4JNMA 3A4XA 2ZICA 1MW1A 3VFLA 1F2JA 3RF9A 3SEPA 4LUIA 4RZ4A 3INPA 2ZX5A 3DU0A 8XIAA 3F2BA 3U2EA 1W17A 3ZM8A 4MZYA 1GOQA 3DBPA 4P8VA 3LBMA 5E9AA 3VC5A 1EJWC 5I5RA 2Y5JA 3WL0A 3PWIA 4PUEA 4A3UA 1GOKA 3AYSA 2VFGA 1DXIA 4C6DA 2X7WA 1XPYA 3K8MA 3DFPA 3AALA 1LLWA 1EHNA 2CWNA 1F8IA 3H21A 2W3ZA 4ACYA 2C0AA 4LUJA 1LJYA 1UZ1A 5GJMA 3H7VA 3VDGA 1DXEA 3N73A 5PTDA 4S2CA 4GQ0A 1IHIA 3N3TA 2PDGA 2FB2A 2W5FA 3WLMA 3GXIA 1MUMA 2Z1VA 1Q6GA 4W7VA 1DV7A 5HUPA 2OQLA 2V67A 3W7LA 2FKPA 5D9OA 2Y8KA 1X38A 3HIJA 1UCWA 4JTAA 1JGMA 1ITCA 2XG9A 4ZO7A 4HMEA 3BLIA 2PLMA 1M7XA 1SFTA 4ILSA 1UIPA 5AZ1A 3LHWA 2CPUA 3NEHA 4A29A 4AD5A 4HOXA 1G67A 3UCDA 2IQ0A 5FAJA 2NT0A 2ZUTA 5BWAA 4V15A 4M0XA 4UQCA 3N04A 4KS0A 3HGOA 2RJHA 4HA1A 4K38A 3VIGA 5HXMA 2VP8A 2FZ8A 4ACZA 4AYSA 1N8WA 1XLMA 3LNPA 3L0KA 1W9XA 4IF2A 1M9HA 5FL0A 2NWRA 3COTA 1M53A 4DO7A 3MBFA 4Q4OA 2YR1A 4YTQA 2BXVA 4ZTYA 6CGTA 3QMTA 5K2ZA 1YNYA 3EPOA 4OU1A 3GW3A 3KCJA 4E2VA 1Y65A 3C0LA 4LW7A 4KWUA 5DLCA 4L6DA 3OLIA 3B0YA 3GTIA 4PSPA 1ZSXA 2HS6A 1UD5A 4YXGA 1XBXA 3VIOA 2NQJA 3S2NA 2Z1XA 2J25A 4GYJA 3FVMA 4I9AA 3ITTA 3DZ1A 3LRMA 3W3OA 4M1BA 3DFNA 3A3WA 3EXRA 3IIZA 1VYRA 4Y9NA 1FWJC 3CHVA 3UJ2A 5ECVA 1CI1A 1KB3A 4HOWA 3I3BA 2G96A 3KOFA 1E0TA 3BMWA 4O12A 4DRSA 3F4WA 2VWSA 2BHYA 2GJPA 1JCNA 1ZS2A 1BVNP 1WDSA 4L4PA 1KM1A 3ABQA 4KRZA 4AW7A 1XLFA 1W3TA 3EDEA 4AWTA 4B2DD 2C71A 4XIAA 2VEFA 4HBKA 1ZFJA 4S3AA 2GSJA 3E38A 1H7XA 3W2KA 1M3UA 1JNDA 4XSMA 3WF1A 5DMLA 1H51A 2FVMA 1XRSA 3W28A 3HV8A 4HPXA 2DSUA 5HDRA 1V8EA 2NQZA 3BJFA 4O0KA 2ZVRA 4XTDA 4QM1A 1W31A 2Z4GA 1QNQA 1CXKA 4RNFA 2D0GA 3PZNA 4V28A 2VTFA 3W7CA 3H2OA 5BXRA 3T9PA 4OFCA 3TN6A 5D9PA 1MNSA 5EMJA 4B92A 1HNYA 4L1WA 2G37A 1HVXA 3WFZA 2XH7A 3EOEA 2WMFA 5A6JA 1Y5XA 3MV01 4JY9A 1B4KA 2NXIA 3GRIA 1CGYA 3VGGA 1S1RA 1GG1A 3ZO9A 3IAQA 2DPEA 4OUEA 4OOUA 1W3NA 3CUHA 4KIRA 1HKVA 5CGTA 2ZXDA 3LX9A 2C18A 3OIHA 3ICJA 4JFUA 1JGIA 5CG7A 1WXJA 5BRBA 3ZZ1A 2YLLA 4KT2A 3PSVA 4ZO8A 3WLHA 1DJIA 4AZ6A 5B7YA 4NJKA 3KLLA 4I5XA 4AUBA 3QY7A 3CIWA 4UOZA 2X8RA 1ZB5A 2JALA 5DBTA 1KFJA 3LXBA 3KP1A 3S2MA 3T8LA 1F74A 3R58A 2VFIA 1XBYA 5KZEA 5BYWA 2XIIA 4AZIA 2ALDA 3FKKA 2YDAA 4MWAA 3B8TA 2VFDA 1PXGA 2A85A 1EQCA 4A3RA 3BLLA 1ISYA 4KH2A 3CIVA 1JPKA 1VFHA 3CC1A 2XPKA 1PZ3A 1E56A 2ATMA 3LCGA 4DO4A 1JCXA 2QF8A 1GT8A 4UR9A 2PP1A 2PRLA 3ITGA 5H8MA 1W0MA 2PB1A 4L4LA 5G4EA 4O10A 1X6UA 5DCEA 4D8LA 2C1GA 1RPKA 1F7BA 3N4FA 2WVTA 1W1TA 4OE7A 2FFCA 1E5JA 3OZOA 4EX4A 1MYRA 2DVTA 1KFBA 3NURA 1KM0A 1QNVA 3A22A 4UBPC 1V0KA 4E8DA 1DWHM 1E51A 3LTPA 2VFFA 3V0UA 4K1WA 3AYVA 1M65A 2R82A 1W2PA 1OFBA 3TTSA 2PLCA 1JZ5A 3GZAA 3ITCA 4PMZA 3GYEA 1W32A 5EL1A 3EX4A 3K8LA 3VIPA 4PODA 3W83A 3UYIA 3UJRA 3RFAA 3PM6A 4DN1A 4JZ5A 2V2CA 1NM9A 3MI3A 4D71A 5G1MA 2XIJA 1XDMA 4RCXA 2EHHA 4JCMA 1VJIA 3PULA 4LGXA 5CPNA 2Q02A 2PC8A 3M0YA 3VD4A 1W37A 4EANA 2DW7A 1V5XA 1VBGA 1HGWA 4G7FA 3H26A 3Q2DA 3O07A 3NPXA 1ZJHA 5C6MA 3E5BA 4RW5A 5K3VA 3LQGA 1F3WA 4XVDA 3NWRA 2BFGA 5AKQA 4EWND 3UG3A 4H1ZA 5HUOA 3KHDA 4U33A 4BQ3A 5HJYA 1L8PA 1LUCA 2A7PA 2J27A 4R7WA 3VGBA 3WF0A 1JR1A 3HBLA 3VIMA 2AQOA 2CLKA 5JIPA 2CZEA 3QC3A 2DJXA 1XLEA 4GZJA 4RZ5A 1WBHA 3U57A 3ARPA 2E6FA 2G41A 5JXQA 5D2VA 4IUOA 3ALGA 3CQKA 3M0JA 3SURA 4QJ3B 3UZWA 1WP6A 1RCXB 3ARYA 1KKRA 2A1YA 4HA3A 1WKYA 1CTNA 3MZNA 3AS3A 2DZXA 1TV5A 4BA0A 4Q6XA 1B1YA 1P48A 2VDGA 2A3HA 4C7GA 1TO3A 4G9PA 3Q58A 4EKJA 5G1YA 3KLKA 4DBUA 2OWCA 1TX0A 4MFDA 2BXZA 1MZHA 3BLDA 3GH4A 5BOOA 1OGGA 1LL4A 1NH6A 4DJFA 4HB7A 1UJPA 4F2UA 2DIJA 2YDQA 4QG8A 4UR8A 1BTCA 2OT0A 4WY0F 4HMDA 3H8AA 3VK5A 4L9XA 1OT1A 3DBNA 4KFPA 3CAWA 2EPOA 2VEMA 4RDYA 3G1VA 1VPQA 3F2DA 3MHGA 5HNNA 4AXNA 2GLKA 1B54A 3TEVA 3WF2A 4CD4A 5XINA 4A22A 1NTHA 1R3YA 2NV1A 1C8QA 2ACRA 3V3WA 2QIIA 4X2PA 2XZ9A 1YDVA 2VX4A 3CWNA 2PF8A 4I8DA 1E6QM 1SYTA 1OB0A 3SY1A 1UBSA 5HBFA 2DZTA 3MQTA 3NZGA 2XHYA 5CLTA 3MS8A 5BRQA 4HPJA 2ZRVA 1GJWA 2V5JA 2QULA 3P82A 3RLGA 3SCOA 4TR9A 3L7RA 3DDMA 2FFIA 3CS2A 4C1LA 3TQKA 1MUWA 2Z1SA 2D3NA 2WK2A 2J78A 1OEPA 3RHGA 3SDOA 4LC8A 2PDBA 2FZNA 2HRWA 4JTGA 4M8UA 1JZ3A 4Q4SA 1DWIM 4RNIA 3MA8A 4H8UA 2DT0A 2YBTA 3N2MA 4WGHA 1ITXA 2INFA 4S3GA 4AX6A 1P0KA 2VEKA 1Q8AA 3RK8A 2YYTA 5ABFB 4UNKA 2H3DA 2G3JA 4DAFA 2BGQA 2B7NA 1WDQA 5CGQA 1W9VA 3Q37A 4MIMA 1QWKA 1UPPA 3P2VA 2WOQA 4WJ8A 1A5MC 5CZKA 1UWAA 1RALA 2VGFA 4YIWA 3ATYA 2C14A 3NQAA 2FLIA 2OSWA 1Z48A 1L0PA 5CPQA 3DENA 4YLWA 1CGUA 2E8ZA 4XKMA 5MKGA 2NVDA 3AHVA 8XIMA 4WXZA 3DX5A 2HROA 1TPC1 3WH8A 2WMIA 4U5KA 1OWQA 2C19A 4NQ1A 4QHRA 1QFEA 5HA7A 3S6DA 1YE6A 2HWGA 3AHZA 3LUTA 3XISA 2CXGA 4WQ6A 3B04A 2E5DA 4KWOA 1XD0A 4P8UA 2R9RA 3L4YA 3DERA 3CV2A 3M47A 4DZAA 3EX3A 3VNDA 1PO9A 1UKTA 1MRAA 2KX9A 3UZZA 1Q66A 1EXPA 1FDYA 2GJRA 3DHPA 1AJ0A 1KTBA 5H2ZA 3AU6A 2WHJA 1XWYA 1CGVA 2PDMA 3BL3A 3RPDA 1KFKA 4U10A 2HXTA 3U9IA 3NVDA 3OBAA 3CAQA 3DI0A 1JNEA 3R0UA 3ISIX 3TDFA 1MI3A 2X0SA 4PH6A 1F61A 3OTRA 4GYKA 4UQAA 4IIBA 1BYCA 2V5KA 3GZ3A 3GYCA 3HG3A 2CLOA 2J9XA 1THFD 3P5ZA 3N2XA 2O9RA 4C6KA 1DKWA 3MBDA 5EBUA 3UZYA 3VGHA 1DXFA 4UCFA 2WLYA 2EQDA 4B5WA 1SSGA 1TPFA 1JYVA 4B16A 3FJLA 1MVYA 4QS6A 3MU7A 4I90A 3BCFA 3WLOA 4WY0A 2YW3A 1OJXA 1JYXA 4HZ8A 4FO4A 2PF0A 2WQDA 2VR4A 1DJXA 1FH7A 4HTYA 5HPCA 4CQ9A 4K37A 1B3WA 1XLCA 2IXVA 2Q8LA 4D8ZA 2YL8A 5IXEA 3CQIA 1QW8A 3MC5A 2WC4A 3TFCA 2PA6A 4ONVA 5EFDA 1ZGDA 4GC3A 2V82A 2XWEA 3CLMA 4C6NA 3FXGA 3W1UA 1ZAIA 1RBLA 1BEUA 3A3HA 4LU0A 2OWXA 4NU7A 4NRRA 2ZZ2A 3W2NA 3G3MA 1A53A 1EOKA 2BS9A 2I7GA 3C8NA 2HVMA 1O5QA 2NQLA 2QJJA 2FH8A 1KTCA 4R7OA 3R10A 2ZADA 3SIZA 1LRTA 3SJ3A 3UQNA 4BF9A 4IIDA 3IK4A 2PU1A 4Y90A 1PE1A 2ESCA 3LCFA 1XHGA 2VNCA 1JF5A 2VR2A 5EGRA 4ZQRA 1JD9A 3WH9A 3N9KA 4PUJA 1VEMA 5CG0A 1MEHA 1OCJA 1GKQA 2NX1A 3IIPA 1SO5A 1DQUA 3JW7A 4C91A 4ZZ9A 4LBSA 1QRQA 3AS0A 2W9MA 3M0ZA 4UTKA 1Q6EA 3FYOA 1CLVA 1UG6A 4B3KA 1MQRA 3WEMA 4HN4A 2FTYA 1CCWB 3POHA 4DUOA 1UR3M 1UWRA 4UIOA 1UMYA 4LH8A 5H91A 2P76A 2QYGA 1SO4A 4IWWA 4BR1A 4X22A 2WPGA 1X97A 3HURA 3N9RA 4XZBA 5FKYA 3LI0A 1EDQA 4PBEA 1UWUA 4TQTA 4KQNA 3GDMA 1OIMA 3IGSA 3GXFA 4J3UA 2OLSA 4C5YA 3ARRA 1G6CA 3W86A 1WYIA 3ARWA 1W3LA 3BJSA 3SO7A 1ICSA 3BLFA 3M4HA 5ABGA 3L66A 3W38A 4TX6A 2XH0A 3PBVA 4XAFA 4HD5A 2V68A 3K46A 1R3WA 3TLQA 1ME7A 3ZQ9A 3O0FA 3RLHA 4FNUA 1RBAA 3LQLA 2WKGA 3GU2A 1K03A 3O3RA 1EYEA 2PD9A 2GWNA 4KWVA 3KOYA 3W27A 5CPTA 1W1PA 3MZ2A 4LCQA 2AAAA 3MMUA 4UTWA 4PEKA 1YMYA 1TMQA 4DZHA 4C6CA 2X30A 5EMUA 3K30A 2CWXA 3QRHA 3D46A 3KBVA 1FHDA 4G6CA 4FX6M 3BZJA 6ENLA 3UCCA 1IR1A 1VBRA 1WDPA 4O4WA 1A3XA 5CBIA 6PTDA 4UTHA 5H8PA 4PUKA 1X1ZA 1FWCC 5IHRA 4G7EA 1DQWA 2YDRA 1UUQA 3LGGA 2EG7A 2WHLA 4REQA 3ATZA 4US5D 2GK1A 3PBMA 1NQ6A 3PZVA 1EWEA 1CB2A 1OZQA 4MTVA 1TPH1 3EZ4A 4CNOA 1E15A 2ZDSA 1MW0A 2R1MA 1T96A 1JQXA 4HYRA 2QR6A 2EPMX 4ADSA 3CBWA 4B5NA 2UBPC 3V5CA 3GK0A 1VB9A 2QGHA 3MUXA 3UG5A 4AZGA 3GUWA 3EX2A 2OXNA 4J3XA 2INZA 2WB5A 4I7UA 5IRPA 3UY8A 4GOAA 1KXTA 2D0HA 4QJ1A 2PWFA 1I2PA 1NDZA 2P5NA 1Q4NX 4ERIA 3NQFA 4LQ1A 2YKKA 1PX8A 2YCEA 3EAUA 3TC6A 3T0TA 1UQZA 1EDGA 4Q4KA 3U3HA 2GWGA 3A12A 2MNRA 1E73M 5EA9A 3OJGA 2J7EA 3M0MA 3PJUA 4AVNA 3DUGA 1QASA 1YDOA 1LDCA 1Q85A 5HNUA 1XJBA 3N9SA 5A2CA 1S5VA 4YN5A 4GIRA 1H63A 1GTEA 1GOXA 1H1ZA 1PV8A 3KAOA 3WFLA 3K8KA 4GE8A 2GJXA 2QUNA 1KWKA 4AD0A 1ITUA 2X7VA 4RE3A 2YPIA 5EY5A 4JQAA 3U48A 3EWYA 4DQWA 2NX9A 5AHFA 2A4AA 2BMBA 4UXDA 5AYYA 1PEZA 4FF7A 3EDFA 2ZUSA 3HJEA 4HNNA 3CZEA 5CEWA 3DKLA 2V81A 3PNUA 3JZEA 3CZLA 2HBVA 4PMOA 3WBEA 5DBUA 2YX0A 4PMNA 1F07A 5AYIA 4GUIA 3G22A 5HMDA 1P5BA 3O2LA 3P0WA 1KCLA 3BV4A 1JCMP 3SGZA 1NAL1 4X3ZA 8CGTA 2E7FA 3TTOA 2A7NA 3CWHA 4A3HA 3B8UA 2JGYA 1LOLA 1YEYA 1A5SA 4N6FA 4MLRA 4QJ5B 2B0MA 3W6YA 2FGBA 3QSTA 4NXSA 4DUXA 2WWCA 3GB6A 2ZUMA 2VZOA 2J77A 4QLLA 1GHSA 5ECUA 2VYOA 4N7QA 1IYXA 4JDYA 3WIJA 1BRLA 1V6TA 2PWUA 4D6JA 4A8IA 3VNZA 3WNLA 2D2GA 3VCCA 1E0XA 4ZA0A 4U28A 1YE4A 2FZMA 3BOLA 4MNMA 4FXJA 3M0LA 1S1PA 1A4MA 4M6VA 3QV8A 3WDPP 1G4EA 4ZXOA 4KKXA 2BVYA 1GYLA 4NL1A 1F3XA 4O4VA 3UG8A 5DT7A 4H7VA 1UH4A 1MXGA 1RZMA 3WMBA 2Y24A 4I5RA 4U2YA 1KXVA 1TTIA 2XVPA 1J5TA 5I3IA 4JTFA 3H7RA 3HU7A 2Q09A 4R9XA 4KRUA 1KD0A 3CL8A 1SMDA 4G8TA 4E3VA 5D05A 4NZCA 4XD3A 4UTJA 3W24A 2ALRA 3M43A 1TWIA 4MB3A 2FZ9A 5AVNA 2C1HA 3NZRA 3BGGA 1K7EA 1PKYA 1C3FA 1Q6CA 1E6NA 4Z1CA 1FOBA 1JAKA 2BY2A 2DV0A 1B31A 3E2SA 3A5VA 4D1IA 1OCNA 1E6ZA 4DEFA 3AIBA 4ZE4A 3GNRA 4S2BA 2J75A 1BG4A 2D2JA 2ZCGA 1QNRA 5L6UA 4JNYA 4O50A 1V93A 3PB2A 2FJUB 2E9BA 1EWDA 4WX2A 1BQGA 2PDXA 2DZWA 4KPLA 1T40A 2ZTJA 3WJWA 4XIMA 5AFDA 4DBSA 4J3ZA 4OHQA 3L4XA 3EX6A 4QQUA 4DWSB 1XLIA 3BSMA 3RX2A 3WLJA 2H90A 7ODCA 3H2NA 2TAAA 2EF9A 3B8IA 4IOTA 3LXAA 3NXFA 3OGVA 2WC3A 1GYNA 2FMNA 3FAXA 2D69A 2NQ9A 3NQBA 2WSPA 4Q8NA 1DIKA 4MUZA 2DVUA 5FEPA 1G94A 4O16A 1EBHA 4EXBA 4DXXA 2PWGA 1MFUA 2PTWA 4H9TA 4L4OA 5GJPA 3WENA 2QV5A 3DFSA 4HKPA 3W9ZA 2IKJA 1TTPA 2A3CA 4Z1DA 3LM3A 3TVAA 4W86A 1PKNA 2NZLA 3IGXA 2DGAA 3NQGA 3OGRA 4R27A 4HNCA 5EKYA 5C71A 4ZTXA 3URNA 4HCHA 1XI3A 2ZA1A 1H7PA 3OB8A 4TXEA 3KDNA 5E70A 1US2A 4FMVA 2CFFA 3ES8A 4EXAA 3EWWA 1A0EA 1NF0A 1VRXA 2WQPA 1WBJA 3TFXA 4HHMA 2PWEA 5REQB 5EMMA 2RAGA 1RH9A 4WDTA 4NYYA 2WCGA 3ONCA 1Q3NA 1R3TA 1W1A1 3AUOA 3TAOA 2DSVA 3RR1A 1CW2A 1W6TA 3PAOA 5CSSA 2FB3A 2GVJA 4R88A 1S2CA 2J6XA 2O9PA 5F1UA 4HNOA 2ZYFA 3SFWA 3IVTA 5E5CA 4OECA 3MUCA 2OZ0A 3CPUA 3HOJA 2W67A 4K6AA 3T05A 2A2IA 4DJDD 1T41A 2XUCA 5LHEA 1BGAA 1EF2A 3W2MA 2XVKA 5KETA 3V4BA 4O18A 3W4RA 2PDJA 3SUVA 2Y63A 2Z7GA 3P6LA 3VO0A 2REQA 2PODA 4O19A 1FWAC 2GZXA 1UKPA 1EO7A 4PMDA 5CKSA 3P8JA 4DWSC 1QHPA 4XBKA 3MWCA 3GD6A 4FOJA 1IV8A 2QCHA 3WQWA 3LMYA 3BE7A 1PBGA 1JCTA 1HP5A 4DJEA 4WDXA 3ANUA 1VYPX 4MYXA 3VYLA 1PTGA 4C60A 2AMGA 4TVDA 1LBMA 1F6YA 3KTCA 1SR9A 2WZTA 2WNNA 2CBUA 2ZA3A 3KZSA 1K9TA 2QCEA 4ZXLA 3N6JA 1RQEA 2WM0A 3GTNA 2NUWA 2CHRA 2PBGA 3K4AA 4ICNA 1YIXA 4M29A 3BMVA 1U1UA 1UKQA 4XUYA 5HNRA 3G1AA 2OX4A 1WDRA 4V27A 4V1YA 2BGNE 3GG0A 4YVVA 3E0WA 4A8NA 1AMKA 3K1GA 2OELA 4PB5A 3CUXA 2W62A 1RJPA 1P0EA 2YSWA 1AW1A 1ADSA 4L65A 3NGFA 4Q7NA 4TVUA 4AIEA 3F5LA 4PE8A 1ZJIA 3G0UA 4BY3A 2PDHA 1XRFA 2WJDA 2ADAA 4ZSTA 2E6DA 3AXHA 1VR6A 2VGIA 3GXNA 4PZVA 4OV4A 4F2TA 4LSBA 4ROQA 3EMZA 4FX7A 3TKFA 3OP2A 4AF0A 4LYRA 1HKMA 1H41A 4XK2A 3MDUA 4DM2A 2YFOA 1DHKA 2VD8A 4KFOA 1E4MM 1TQJA 3MP4A 1E4NA 3NPUA 2VI0A 4UTTC 4P5UA 1SPQA 3QQ1A 1QNOA 4C6FA 1Y0EA 1RA5A 3EGJA 4GK8A 4F8XA 1XYLA 1IEVA 3PHAA 4V2XA 5KITA 4GZ7A 5FACA 5JQ9A 3TOYA 5KSWA 1UR8A 3L65A 1TJ0A 1TJPA 1PUDA 1CDGA 4W9TA 1W3KA 1XLAA 3PZQA 1W5MA 4NZ5A 4HU4A 4ERAA 4GUFA 4LS2A 4EWJA 1ZAHA 3ITLA 3JR2A 3CO8A 4RL3A 2G3NA 4WJXA 4AEEA 1GVIA 1H7NA 1TA3B 2TYSA 3MSRA 4PSRA 2TRSA 4IICA 3LGEA 1H1YA 4HVXA 3IEBA 1SZNA 3UPBA 4UMCA 3AZTA 2VHLA 3P74A 2VDIA 4C5ZA 4PL1A 3TYEA 3T1GA 1LWIA 4F0MA 5HOSA 1XGZA 1PX4A 3LG3A 1BGGA 4NZFA 5BXTA 2BTMA 1YDYA 4RJEA 1JPDX 2ZE0A 1VD6A 3EWXA 1J6OA 3UGRA 4XKYB 4OV9A 3T0CA 4JKLA 2QJMA 1SFSA 4Q7IA 1UKOA 3NQ7A 4UTUA 1E6RA 4ZOAA 4OZOA 2QW5A 1YNPA 5C70A 4UTMA 3R94A 4WZHA 3H4WA 1UZ4A 3E2VA 2MUCA 1LL7A 2WNZA 4FLOA 1HF6A 5ABHA 4MGGA 1XLJA 3GHUA 1R8LA 3LXCA 3S47A 2J47A 1DEDA 4E8CA 5M2FX 4MLJA 1LROA 5T8GA 3BK0A 1DJHA 3ZLFA 5HQMA 1JCYA 3UETA 1KO0A 1XBZA 4TMCA 1VLWA 1EGVA 2G5WA 2D2HA 4IHCA 4DLFA 4LVFA 1H49A 1JAEA 1PAMA 2XJ7A 5I7GA 3N3MA 3O6DA 3R7MA 1XQKA 2VJXA 2ZRYA 5I78A 1RK5A 3RIKA 1EBGA 2QT3A 4Q8MA 1C8YA 3VMPA 1LQAA 4C1NB 3KRSA 4U2ZA 1V08A 5LNSA 5BCAA 1VAHA 3OQ8A 3A21A 4A3QA 2YW4A 1Y5WA 1K9EA 2VCAA 3W1AA 3MI6A 2P8CA 3QQWA 3UBPC 3GIPA 4U4MA 2IUZA 4S3KA 4P61A 9XIAA 3QBUA 3R8GA 2OFJA 1KBIA 4GKTA 2Z2UA 2GGHA 2CYGA 4CCCA 4JL2A 4X2RA 3AXXA 2QPSA 5I79A 1KGUA 3NG3A 3W7JA 3FGCB 5LA1A 2H3BA 2TSYA 1REQB 4I6VA 5K9XA 1XYBA 3W73A 5I3DA 1HO4A 4OUIA 2BOFX 1X98A 3FVDA 3VOCA 4W88A 3N2TA 2BX7A 3HQPA 5LIYX 5A95A 3VKKA 4AEOA 4ZB2A 3AAMA 4QQ3A 4GD0A 3NL3A 3NZQA 1A49A 1AW2A 3ZT7A 3CYJA 3WFAA 1NDWA 3UJEA 4AD2A 4F40A 1HKJA 1BAGA 3C86A 4JX4A 3P0XA 1DIDA 2CZVA 3LENA 1LOSA 3G5EA 3GBEA 4NZ4A 1K8CA 2P53A 4DF0A 3ARUA 1JD7A 1BF6A 5KZ6A 4GUGA 2VWTA 2ABBA 2ZA2A 1X6LA 1TTJA 4GHRA 1C29A 4TOQA 4QS5A 2XISA 2GL5A 3D47A 1EEPA 2ABAA 3M7WA 3NXLA 3ITYA 4GO9A 3DG6A 7A3HA 4JCLA 2FVLA 1FWBC 5JH1A 4PUMA 2J6VA 4ORIA 3REQA 2MANA 1GVYA 3PZOA 4EACA 1JEZA 4R9OA 3TN5A 3H55A 4HMNA 4H8NA 1WUEA 2QCDA 1WDWA 1BFNA 1QWGA 3AC0A 1SSDA 2NSXA 4NIRA 2OG9A 5C7VA 2E0PA 1DWJM 1GK8A 1UHVA 1G7VA 2W63A 1E3XA 3VUPA 4M7TA 5ENLA 2NV9A 3ZXWA 4AAJA 4LRTA 1CGWA 1NFBA 2J7CA 2Z0IA 1XH1A 1BG9A 1TCDA 3RX3A 5HINA 2D24A 2Y4SA 3AOFA 3EKZA 3H7UA 3B0PA 1HGYA 2NV2A 4BWLA 1S2AA 3FIGA 3AUJA 3A64A 4H2HA 3KCOA 3LTYA 3QYQA 3SECA 3TUUA 2RDUA 4GX8A 5HWMA 3FSTA 4A2SA 4CKQA 3DYOA 2OPJA 2HPIA 2X1UA 3S1UA 3BG9A 2WVUA 5D38A 2VL4A 4G1KA 4CVUA 4YNGA 4TTUA 3DHFA 2OTDA 4B90A 3WF4A 1MDLA 5E0CA 2QPXA 4W5ZA 1RK6A 4RNJA 1TV3A 4QJ4B 4HCDA 3OG3A 4RPPA 3TXVA 4W8LA 1B5TA 1W54A 1ZCOA 1AFSA 1VJZA 3F4DA 4XTIA 3QZEA 4G2DA 3T55A 5HJXA 3B0VC 4K1GA 2PCQA 1JPIA 1DBTA 4JYFA 4J35A 3II1A 1OC7A 4QROA 2F7FA 3DFYA 3A4WA 3WQGA 1OY0A 5CJMA 3R25A 4ZE5A 4PB3A 4Y9AA 1A0CA 1J96A 2QUMA 1P7TB 4IP4A 4C6BA 3KBJA 1PIFA 3IGUA 1QAPA 5A69A 2BDQA 4IQJA 1HKIA 3CZKA 3W74A 4AY8A 1CXLA 3RM8A 2QUVA 2C7FA 3OZMA 1H61A 4LUSB 1U1JA 1J11A 3TSMA 2HEJA 4CCEA 2I56A 3BV7A 1EYWA 1JZ6A 3LRKA 3F5KA 5CSUA 2ON3A 1CWYA 2PSNA 3M46A 4AVOA 5M3WA 1ZRQA 1GKRA 3E2QA 1IEXA 2X1RA 3RXZA 2XN0A 1W9PA 2GPTA 1BQCA 4F66A 1I9CB 2P50A 3DOPA 4M1RA 1VBHA 2UY3A 2QF7A 4AMCA 4KCTA 4DX3A 1M7JA 3H70A 3CUFA 4XAZA 3WCZA 4P7LA 3ARXA 4AZCB 1LCOA 3KBNA 2R1KA 2CZ5A 4F9DA 5G2HA 1YBQA 7XIMA 4ALDA 6REQB 1R86A 3BQ6A 1TCMA 5T91A 4O57A 3FA3A 1YNQA 1V4YA 1V6UA 3NQDA 1CBGA 5IBXA 3QPEA 4LB3A 4QLJA 2WMHA 3WUFA 3LGDA 3CHFA 1LTDA 4AX7A 1ZJAA 4DY1A 3T8QA 3PPHA 5I3HA 4MY8A 3WK1A 4DBEA 3STPA 2Y62A 3TR2A 3RYSA 4D6EA 2YCJA 3ALFA 5LXEA 3G6MA 2E5BA 1TPWA 1TYGA 1HQTA 1PKMA 3W0KA 1ISZA 1E9YB 2OJPA 4GXPA 3UWQA 1WAUA 4UFLA 1HVQA 3TN4A 3BTNA 4HYVA 1G7UA 5BOFA 2OQHA 2QLYA 4PTXA 1AVAA 3DXIA 2WKLA 1FKXA 4QE4A 3TSDA 1PSCA 3N25A 1DE6A 5A8QA 2CBIA 3BOFA 2PWVA 3G1RA 3C2VA 1AJ2A 1VBUA 2H9AA 1MEWA 1FWIC 2DEPA 4GRSA 3LZ3A 1GONA 4O8RA 3DC0A 4UTLA 1FWTA 4MJ2A 3VNYA 5I3JA 3OO2A 3AISA 4PTVA 3DCPA 2ZKMX 2XIQA 2PLJA 1E0WA 3OODA 1TJRA 2XGBA 2NXHA 3VMOA 2F6UA 5FIPA 2EKGA 3QV7A 1CB7B 1XLKA 4F4RA 5LHFA 4JEJA 5HJLA 4C6PA 1JJKA 4EPDC 3FAWA 1D8WA 3I3EA 3WJSA 4M51A 3S5NA 4XUGA 4IX2A 1IT7A 1YTDA 1RD6A 4EE9A 1OC5A 1X8FA 3N4EA 4QRNA 2XM2A 3DFQA 1OFRA 2F6KA 3FY1A 3QFEA 5CCZA 5F2GA 1O1ZA 1TVPA 1XBVA 4XBSA 4A6GA 4CEXC 2JKPA 3LBCA 4PCNA 1DJGA 3HA1A 2FIQA 5XIMA 3EB4A 4KCVA 3F2CA 1CXFA 3S9IA 2PURA 2XSAA 2YOCA 3H2MA 3MMDA 5KZDA 1XH2A 1ODZA 1K9DA 3VKJA 2V3EA 3P80A 3W7GA 1E43A 1E1EA 2RGMA 3GC2A 5BMWA 3WD2A 1IWBA 4WOQA 1EH9A 2JEQA 3A9IA 1GVRA 5I3FA 1JPHA 5BXPA 1HO1A 3CAKA 1G5AA 2VC7A 1VP5A 4MUPA 4HU3A 2FQIA 2Z24A 2B31A 1RJQA 4IH3A 1FRBA 5A8MA 3NIYA 3KZPA 2WMKA 4HN8A 2PTDA 3ZSTA 4IXHA 1L6GA 2GGJA 3WH5A 3SGGA 1E6XM 1JL8A 1LL6A 2V69A 2WNWA 1X7IA 1X6NA 3ITOA 1XIFA 4P7NA 2P8BA 2ZDRA 3TCSA 4AD4A 3PBYA 1QBAA 1OGBA 4ES4A 1LBFA 3RLVA 4HSHA 1GG0A 3GIQA 2X09A 3BG3A 3SUWA 3PC0A 3QM3A 3E6EA 2YBUA 4HHHA 2QV4A 3W75A 4O11A 1FCUA 1KBJA 4KERA 2FTPA 5I06A 1UR2A 3W2LA 2F6XA 2YLAA 4DJDA 2J7DA 1EDTA 1QMLA 5DELA 4HSOA 1CPUA 3GHTA 5JH2A 3S9ZA 3AMGA 4CNUA 4JQ2A 3TQPA 4Z42C 5K4ZA 1K8YA 1B90A 5G4WA 1FCQA 3GR8A 1SO6A 3ZJ7A 4MAZA 3E0LA 3SAZA 3KDOA 5DQPA 1OX4A 3E2RA 3WEZA 4MFEA 3QZAA 4QISA 3B0XA 4NYUA 4K39A 4POCA 1VGAA 1LT7A 1KRBC 2GYIA 2TPSA 2VOMA 3O1NA 3TLLA 5JBEA 1R9XA 4GH3A 3UA3A 1FWRA 5EMYA 4Z1BA 2ZX9A 1J2WA 1PKLA 1Q6FA 3MY9A 5G5IA 3LPGA 4OT7A 1M41A 3LM7A 1SGJA 2EAWA 3GVWA 5BRPA 1QPQA 1CT5A 2VMFA 4QR6A 3UW6A 4O14A 3VD3A 4K68A 3S8HA 3UWEA 1ZLPA 3BCJA 4IPPA 3W1NA 3GDBA 3R6IA 4FZIA 1AQMA 4GJJA 4P7RA 5A6MA 2OWWA 1TVNA 3GG8A 3DG7A 1E9LA 3C6CA 3QR1A 3KBSA 1RD5A 3QTPA 1WCGA 4MKVA 1SO3A 4PCTA 3AS2A 2PZNA 1CYGA 4D8AA 1ME8A 1ECEA 2X2YA 1D3HA 1P6WA 1B30A 4FR6A 1LQ0A 2F8QA 1XYCA 4I9JA 4K3ZA 3CIXA 4AU0A 4O15A 4AC1X 2P0IA 3PG8A 4JN6A 1JYNA 3J7HA 3ZYZA 4QSFA 2VC9A 4E4FA 3NOEA 3R79A 2R24A 3O7UA 2WVVA 2Z1BA 1QK0A 3BMXA 2ZFAA 1EIXA 5A94A 4GZEA 3PAJA 3WK2A 1XGDA 4GXMA 3GHRA 3VIKA 2ACSA 4KMQA 3V1PA 2O0TA 3HQOA 2OSYA 1JI2A 1NIUA 2NVCA 2X2GA 3WQVA 4S3FA 4QCFA 4UWMA 1MNZA 3NO3A 1OD0A 2IQDA 2Z00A 3B9DA 1U83A 4XX6A 2EGZA 4UCGA 5C5YA 3CTLA 3UG4A 1NELA 2WVSA 5TIMA 3QSRA 3PTMA 1MW2A 1HL9A 5JU6A 4PC8A 5EMKA 2NVAA 2OKTA 2DH3A 4EF8A 3ZVHB 3TTYA 2NSOA 4MZ1A 4P7QA 3SGUA 4X9SA 4YHGA 3GM8A 2QNEA 2FTWA 3RCNA 4GI4A 4WSJA 3SW6A 4JTDA 1Q8JA 3GNNA 2ZRUA 2POTA 3BAYA 5FA5A 3G3DA 2BY3A 2RFGA 1XIMA 2V9DA 1AQ0A 4L6OA 2PDIA 1TV8A 4QCEA 4C6OA 3MUZ1 3H22A 4NZJA 2R14A 4MJMA 3VIHA 1PZ0A 3PJXA 1V02E 3A47A 3VD5A 3Q67A 2V0TA 4XO6A 2C13A 3STFA 2QMJA 3EDKA 4KWSA 4NAFA 3POCA 2BP1A 2VQUA 4GKLA 2C79A 1UR1A 4HPHA 5DF0A 1ZAJA 2H6RA 5HR6A 1QR7A 4AD3A 1YTEA 2YCLB 5ABTA 1FH8A 5FESA 4LVBA 4BQ4A 2W91A 2GQ9A 1SJBA 3M5VA 3ZJ6A 2ZE3A 4A4AA 1TB3A 1V03A 5M03A 1C92A 3MCMA 1GOWA 2X05A 2BOEX 2CERA 4ICMA 4GVHA 4LF2A 3HB9A 1CXEA 1GZJA 4LEQA 4F0SA 1DL3A 1P4CA 4CD5A 5CAHA 2FHCA 2VZSA 1KC7A 2V3DA 1BWVA 3EPNA 2GUYA 4Z0SA 3L2LA 3P84A 1OGSA 1GJUA 1O95A 2BGSA 3FS2A 2PDPA 3BWWA 2AAMA 3NL2A 1PDZA 4H8VA 3QY8A 2ZRXA 1ONXA 1EJVC 3HM7A 3VCNA 2ASHA 4C65A 2PDCA 5DRIA 3W1MA 4IFOA 5HANA 2GVYA 1R9YA 3N2BA 3SCRA 1DE5A 1DORA 4O54A 1A0DA 4IPJA 4PFMA 4NT0A 2Q8ZA 1V3HA 3O6AA 1BPLB 1NF7A 3JVAA 3ZLGA 1J0KA 3BSGA 3SADA 3UXLA 1LORA 2IMRA 1J6PA 5DMYA 4Y8EA 1ENUA 2FHBA 3R0KA 4IG2A 1JULA 3NL5A 2YBVA 1R3SA 3BW2A 2ZC1A 3H2CA 4Z2LA 3QEZA 5L9FA 1BKHA 1FDZA 1MMFA 3KOWA 4U3CA 4KCUA 3F4NA 1TV2A 3TNBA 2GQ8A 1KCKA 5H6HA 3HN3A 3T0BA 3IUIA 4ML9A 1YHTA 4BEQA 3LHYA 3LCXA 5JVLA 1IXQA 2QUTA 4GCXA 3GW0A 5BMXA 3IJ8A 3H6OA 2DZPA 3UR2A 1DJYA 4W5UA 1G4PA 1VFOA 3IIXA 1IR2A 1G69A 1FHUA 2J7HA 4HCLA 3MJMA 4IJCA 3E9AA 3VILA 1T8XA 5E0KA 5J5DA 4BQ5A 3LK6A 4O53A 2WMJA 3ZR6A 1X7FA 1PHWA 3WLSA 5AYXA 1KCZA 4O52A 2Y70A 3QXBA 3K2GA 3OLGA 2WZMA 5FJPA 5KZMA 5FSDC 5LZLA 3WQDA 3F4VA 5D30A 1RLCL 2VX7A 2Z28A 3WDIA 4GNVA 6ALDA 1LZOA 3PS7A 3FDGA 2BY0A 1TSIA 3NVTA 2A6NA 3ZFHA 5DCDA 2X1IA 4PL2A 5D09A 1P0NA 3T6CA 1IE7C 1HTIA 4W4QA 1BWLA 3KE0A 4CQAA 1OK6A 4M19A 1EJUC 3PB0A 2NLYA 3PUDA 4CUCA 3WD3A 4S23A 2OT1A 1QDSA 5H1WA 3G1YA 3KVKA 4HNVA 3W82A 2ZX7A 1GQJA 4LUTB 3SIMA 3TJLA 1I1WA 4F2BA 5AYBA 3AIWA 2G8ZA 4RK8A 4U3AA 1JFHA 4H04A 3CYVA 1A3WA 3MPGA 4DZIA 3UEQA 5MF5A 1CZ1A 1TVLA 3KHJA 5D03A 4EF9A 4GACA 4BJHA 5HMSA 3GR4A 3CV1A 3M6YA 3G8EA 2VVSA 1FWNA 4R5EA 3EMCA 2VEIA 5HPOA 3A23A 2Z6IA 2R91A 1YPXA 1H62A 1YPIA 2Y2WA 2LLEA 4KFNA 3WKZA 4TMBA 3KL5A 3W84A 4M80A 2F2HA 2CKSA 4FA3A 1QK2A 2QCFA 2VFEA 4CN6A 4LAKA 1S2UA 2Y5EA 2C15A 1L6WA 1J18A 4JEQA 2JGQA 2WJEA 3C56A 3H2AA 4JX6A 3VOJA 4MJ4A 1UWTA 3KTXA 3W7NA 4MYAA 3EWCA 4PMQA 2D23A 4O8AA 1E1CB 4W89A 1HW6A 2UWFA 1O1HA 1GPFA 3LHZA 2WJZA 4GFSA 2HE5A 1XC4A 2ZUWA 3G18A 4JICA 4ZQNA 5HWNA 2OGYA 2Y88A 3A5FA 4QLKA 1FCBA 4IGSA 1FTXA 3GLCA 2VC6A 6A3HA 5I0DA 1UD3A 1AK5A 1WZAA 2BHUA 1UP0A 1DYSA 1J12A 3TC7A 1IZCA 3TX9A 4Z2IA 1XINA 5DY3A 1TTQA 3KRBA 3UWZA 4MHBA 4H00A 2BWGA 7REQA 4ZEPA 4AZBA 1H0IA 1X96A 2HVOA 2C91A 1H60A 3RPTA 3VNJA 3NR0A 2HE8A 1KFCA 4NAEA 5DT5A 3FA4A 5CC3A 2Y5SA 3AXKA 5CC7A 4NJJA 3AZSA 4N6EA 3OYXA 2YDSA 3I3DA 4O1FA 1ZBKA 1V0MA 3CNYA 1WAWA 3EPMA 3BLEA 1AMYA 4QDPA 3UVIA 4C6MA 1UBPC 2Y7FA 4GINA 2XZ7A 3LLFA 2C8NA 1ZY9A 3KXQA 4YPJA 1CEOA 3U4FA 3QFWA 4J9JA 3U5UA 1LBLA 4PTNA 3CUGA 1XPGA 4JQ1A 2I1OA 4ZSUA 4F0RA 1OK4A 3THAA 3PBWA 3PY2A 2EEXA 3VNIA 4IMDA 1QATA 4TUFA 1X8CA 3LZ5A 2X1SA 4JTRA 2L5HA 4W7UA 3LCWA 4GYPC 4J3WA 3G0SA 4E8GA 2O55A 4DELA 4IPIA 2GQAA 1OM0A 4LALA 3LSBA 1EC9A 1H11A 2WAGA 4W84A 3NUKA 1NFGA 1R3QA 3EX1A 2A79A 1R46A 4JR5A 2W4XA 1ISVA 2I5QA 1WKEA 3TR9A 1HIZA 2H8ZA 4LAMA 5CBJA 4PUWA 2QAFA 3ECQA 4H8HA 4B3ZA 1TX2A 3K5XA 5A1AA 5DMNA 4HA0A 3F1QA 4Z2JA 4KETA 4MWAE 5ABEA 4KESA 5B7ZA 1UD6A 3MYPA 3QV6A 4MOZA 3AO0A 3AIQA 4AHOA 4FOUA 4OBTA 1ALDA 3SCUA 2J9ZA 1I75A 3TMQA 3MDWA 4GUHA 3V18A 1C91A 1DJWA 3Q94A 4GZIA 1Q45A 1QOXA 1F73A 5FJJA 4ASTA 5AHLA 1U5JA 4Q33A 2J88A 3B06A 4B5TA 1J0YA 3WD1A 1LLOA 1W1B1 2CZDA 4E5TA 3KOZA 1KV8A 4DLMA 4LAOA 1EGMA 1XLBA 1EXBA 1OX5A 4AIOA 1N2VA 2DT1A 4B15A 3MUY1 1LRQA 3VE9A 4RX0A 1W1IE 1QPOA 5LNRA 1V3MA 5EMLA 2J7BA 1WQ5A 3EA2A 3D0CA 1ME9A 1JDAA 3MHUA 4HOZA 3RM4A 4J4KA 3MYOA 3UVAA 2RUSA 1I60A 3VVGA 4IFKA 3SCPA 1Q6LA 2IKGA 2IPJA 2DSKA 3FN9A 4XSLA 4K7YA 2PRMA 3LN3A 3SRDA 4GVIA 5E09A 1GW1A 4NHVA 4F79A 1QO2A 3N29A 2Z1WA 4MF4A 4WR3A 2VDHA 3A13A 2WZIA 1IGSA 3ZLHA 2DDXA 1NJJA 2DQWA 1NP2A 4AHPA 1UR0A 2WJFA 3DI1A 4LV4A 5DFAA 3KRUA 3WLPA 4DUVA 5AOUA 3S83A 2HCVA 4AIUA 3EA1A 1OVDA 3AWOA 3BSHA 2V2HA 2QCCA 1XUUA 4XZMX 2PLKA 4BEUA 5I3KA 3TTQA 3W7QA 4RZ6A 3GU1A 3SCNA 3WNNA 3VDHA 3DFHA 3LV6A 4GI9A 4XZNX 4JTSA 1XKYA 2Z1KA 1V3IA 2A3AA 2GDQA 1EX1A 4C6IA 2GFTA 2RJGA 2HZGA 3IUHA 3HGRA 3FXYA 4ERGA 4I8YA 3VOHA 3P61A 4J27A 1ADDA 5IFTA 3LD5A 3NAVA 1TUXA 3L4TA 2YB4A 1PL9A 4NVTA 2VC5A 5AN7A 2NQHA 3UYCA 3HV9A 5CJ5A 3W70A 3VZYA 3UFYA 1XICA 2E77A 4BF7A 1W5NA 1IXPA 1S3TC 4S3BA 1SM9A 1XCXA 1HP4A 1OINA 1A3HA 4YTRA 3NQ2A 4H3DA 2ZXAA 1E0UA 1SJDA 2O4MA 3RCYA 4NKCA 4AY7A 3NTYA 2W0UA 3HG4A 3F4CA 2XVLA 5GNXA 1H1NA 1Y5VA 4KF1A 3GVRA 3HG5A 1WB0A 4NNAA 1DP0A 3RX4A 3ABZA 4R53A 1N82A 1FVPA 4GABA 4ZL1A 5HMFA 3NGJA 3OZYA 3MW7A 1JI1A 2ACUA 2NXGA 3VGDA 1UD4A 4YL2A 3JZUA 1UC4A 2V8ZA 3JRKA 3AI0A 4JFSA 1KNWA 4CNTA 1O66A 3SQMA 3BURA 1FA2A 3WF3A 1EO5A 3G1SA 1NOFA 2GUBA 2OEJA 2HXUA 2WSQA 1C9WA 2V2DA 2V5CA 3KX6A 3NFUA 3PF3A 3WSUA 1TJ1A 1EZ2A 4M6UA 3OLEA 2XSBA 3WDJA 3VNKA 3UWWA 3TC3A 3ZR4A 3GDRA 4CD8A 3UWUA 4FR1A 1KCXA 3QC0A 2AL2B 3NPWA 1O5XA 2CLEA 1PYFA 1BLIA 4FSAA 2BY1A 3AROA 5GQBA 2J7GA 4JFVA 3S5YA 3WMCA 1V3JA 3W7MA 1T99A 2TODA 1NOUA 1O60A 5BROA 4BQ2A 4KEUA 3OGSA 1FWWA 3KWXA 3MV11 4FS9A 2J62A 4NUWA 3QPYA 1Q7MA 5FOOA 4JIEA 1J93A 3EOLA 3AIEA 2OOFA 5KEZA 1OIFA 3R12A 1TFVA 1GOOA 2JE8A 1ITQA 1GHRA 4F0HA 3E0VA 2W61A 2VD9A 1AL8A 3OPSA 3TN3A 2C3ZA 1TPDA 3GC4A 5F7UA 4DHGA 1QNSA 4ADUA 2BSLA 1JPMA 3ARSA 4CCDA 1CGXA 4UQDA 3LV5A 4Y8FA 5CPLA 1EOMA 4MY1A 3SQSA 4M81A 2V3FA 1KM6A 1Z6KA 2B7OA 4JTTA 2TMDA 4R34A 1IZJA 1EHAA 3GDLA 3W7RA 5D9MA 4WDUA 4F3HA 4HHPA 1V77A 2QPUA 3LY0A 4I7WA 3K4WA 3AYRA 3KM8A 3CQJA 1OFEA 2DZSA 3UZJA 1PCKA 3HGJA 4LJ3A 3MO4A 4EXQA 3GWQA 1EA0A 2IXUA 4E2BA 2PWHA 1PX3A 4TX8A 3P7YA 4Q6JA 4HZMA 4A8LA 3HMJG 5DRCA 1EJSC 1TIMA 2XYLA 2OYLA 1Q2SA 4GBDA 2J9YA 3WO8A 8TIMA 2QDEA 4YWIA 3FHQA 3KEHA 1QUMA 4O28A 4R3UA 3B4UA 2XGZA 4JYEA 2E8YA 1ZZMA 2XH2A 4DWDA 3RMJA 3JU2A 4NILA 4MNKA 4JBRA 2ZX6A 3SCQA 2P0OA 1SMAA 3UR5A 8A3HA 2ZZ6A 4KEVA 4MM1A 1RJRA 4U5IA 2PE4A 5HR7A 1XSIA 4HJWA 5GVJA 4I9TA 4DXKA 4A2RA 3HPZA 3NQ6A 1FP8A 2GVLA 2QHAA 1WO2A 3OIXA 2NLIA 4ZO6A 4FX8A 1EF3A 2A7RA 4YJ5A 1SJAA 4HPNA 4UR7A 1K70A 2OYKA 2UY4A 2ZWZA 1PIGA 2B81A 4FI4A 4PEEA 2PGEA 1A47A 2J13A 4N4QA 2J7FA 5A6TC 3SI9A 4UC5A 4AQLA 4ACZB 2VX5A 2JKAA 3NL6A 5M1TA 3WQ4A 1HFBA 1FWEC 2NQ5A 1DTUA 3STEA 3VKDA 3KRZA 2QJGA 4AWSA 2FPYA 1US0A 1V7AA 2C16A 3HMCA 3R43A 5KMYA 4ML4A 3NO1A 5I24A 1Q13A 2RHGA 3W7PA 1IWAA 3ME3A 4O0ZA 4FB7A 3W1QA 3LTSA 3W88A 2D0FA 4LCRA 4UZUA 4MPQA 4JTJA 3NOYA 1UUMA 1JZ8A 1V0LA 3EMQA 1U22A 4FK9A 1J9YA 3RO8A 5AC4A 2EPHA 4RW3A 1O6IA 2ZIDA 3H4GA 1EP1A 3I7RA 2NUYA 4IUGA 2Y61A 5I77A 2HV5A 1E5NA 1MQPA 1YPFA 3THQA 1GWJA 1XW8A 1JUEA 1PWLA 1XFBA 1VFFA 4NP7A 3ONBA 1DQXA 1W1ZA 3RDKA 3CHCA 4L9YA 2PDFA 2YCKX 3APYA 3PVFA 2E3ZA 1ZPTA 4JTEA 3NDZA 2ISWA 5RUBA 4J5NA 4DWSD 4GJ1A 4G5DA 5FF3A 3O06A 3V75A 2ISVA 3P62A 2CZFA 2PUZA 3FLUA 4Z2KA 5KTLA 1IQ8A 4AC7C 1HG3A 1R6WA 5F4SA 3U0HA 3GDKA 5CXPA 5K9DA 1EP2A 3L0NA 1NEYA 2E40A 4IPNB 1Q4WA 1JUKA 4UNLA 3NM3A 1UW9A 3JUGA 3AHYA 4JL1A 4QDMA 2ZZ4A 4B5SA 3LOTA 1EPVA 2PBOA 3IAPA 3L0GA 4IMEA 3LLXA 1OADA 1TR9A 1AG1O 3QHMA 2BNJA 5LA0A 1I8JA 4NSBA 1W3JA 1EIBA 4FXRA 4F48A 3EXTA 4S3EA 1HJUA 3MKCA 3S1GA 3TV8A 1PDYA 2WWDA 2VUYA 1TV4A 2VCCA 3UP8A 4CGTA 1XRTA 2QDHA 2Y8VA 4JDBA 3P67A 3L23A 2DZUA 2JIWA 1W2VA 3W37A 3LS9A 4JIHA 3UERA 3MT1A 3URBA 4PBFA 5JMUA 1TWZA 3P14A 3VOFA 4C6LA 2YXOA 4PTWA 4KGJA 3CMFA 1R2RA 3CZ8A 5CJNA 2WLZA 3NDYA 2PEVA 3GTHA 4C6EA 4HZ6A 3THCA 4KWWA 1HKKA 3ITXA 3NPVA 3MSYA 4S3JA 3KS5A 5LIUX 4Q4QA 4WOZA 2WHKA 1CNVA 4MWAB 2FYMA 2VT0A 1VC4A 2GDUA 3C4UA 3UA4A 3PZGA 4XZ9A 3IIOA 1RLDA 5EFFA 1DPMA 1I4NA 3OG2A 2V5LA 3TONA 1RQHA 3FW6A 4NRSA 2GDVA 2POZA 3PUGA 1MQQA 4QEEA 3AQUA 3MTWA 3RU8X 4WKAA 4P7OA 3TA6A 1BSLA 3SSJA 4IL0A 1HT6A 1GEHA 3CZGA 4Q8WA 4PTMA 2WKJA 4UOQA 2Q01A 3W7OA 4EOUA 2DSZA 1RUSA 5LIKX 4WRHA 4HGXA 2G95A 3NEVA 1IIGA 2PAJA 1XQLA 4WEVX 4JHOA 1B3VA 4QXIA 2V6AA 3MP3A 1JVNA 4IMAA 3UR7A 1QHZA 5AHMA 1J8VA 4QAWA 5FL1A 4LYPA 1OX6A 2VZTA 1HN1A 1PZ1A 4WHBA 4CVWA 5IHSA 2AL1A 1WZLA 4G1NA 4WF7A 1LG2A 1W5PA 1KLZA 1BXCA 3LPPA 1KFEA 5LIXX 1FX6A 2JF7A 2E68A 2EPLX 2ZXQA 1A5UA 3FK4A 3NSXA 2OB3A 3AMKA 3TJIA 3MJYA 2F84A 4B5VA 1J0ZA 4XAGA 1P0BA 4MVAA 4GQQA 1TWSA 3UZXA 1I2NA 4YYFA 1BVWA 5ABFA 1OYAA 3UR8A 4H6KA 1M68A 2G3FA 4JQ4A 3PP7A 3GVGA 2XH4A 3FFSA 3ZJKA 4A3YA 1EGZA 3A9BA 1WZKA 2W79A 3O8AA 1FXQA 3QLDA 2NX3A 3T09A 3M1ZA 1JCJA 2ZZ1A 3G1XA 2NW0A 1LUCB 1NWTA 4D6GA 4B2DA 1ZL1A 1JZ7A 5LYRA 2A6LA 3URAA 3BGJA 4DYEA 1O5KA 3CAVA 5C2XA 2XVGA 4H19A 3G1FA 1YQ2A 4F0LA 2HSAA 9CGTA 4ZO9A 1OBAA 3OOQA 5E0FA 4AEFA 3WQEA 4X0NA 3BPWA 1S2TA 2X42A 4E4UA 3T7VA 3PJTA 1TWDA 3QW4B 1UP2A 3N6QA 2F2KA 4MWAC 2W27A 3N4AA 2WSRA 4XD6A 4CQ8A 3BW4A 2V5BA 2Y85A 3T4WA 4H4IA 1OSEA 1VCFA 3UJSA 2PP3A 2OEKA 4Q8PA 3BAWA 1X39A 3C0QA 4W85A 2CXEA 2WNQA 5DX7A 1UWQA 5TF0A 1DIEA 4E38A 4WCJA 3K13A 1LG1A 4J2PA 1OD8A 2XN1A 2DUXA 4PTDA 4WLCA 3LHTA 4HU8A 2WSYA 2BBFA 4Z0JA 3TZFA 4YHEA 3CUJA 1UWSA 1RV8A 4Q4PA 4IISA 3M5ZA 4PRRA 4GIYA 4XG1A 4LBUA 1NU5A 1B2YA 3W7EA 1QNPA 4JD4A 3PTQA 4A05A 3FKRA 3WNMA 2YB1A 1FUYA 3UU0A 4P2VA 3M0XA 2ISFA 3CWOX 1ZP4A 2XU2A 3AMCA 4AZHA 3ARZA 4YYCA 2E6YA 1IEWA 4URIA 1J79A 1XL9A 4IPLA 2GJNA 2Z2BA 1EFZA 3STGA 4NJGA 3B8WA 4EPBC 3ZT5A 4AG0A 4CU6A 1XLLA 2E9LA 1VKFA 3RAOA 3DIPA 5FEWA 4FOKA 2YL5A 4EP8C 2D1ZA 3WNPA 2BVTA 2DQXA 2WHMA 4OBSA 4QAIA 2HMCA 1Z89A 3T81A 1W8GA 3W29A 1S5MA 2OMAA 4IQEA 3AU2A 3TYDA 3LB0A 2YCIX 3PPCA 3URQA 4L6HA 1S5NA 3G6LA 5FF2A 1D7KA 1BTMA 2A5HA 3W76A 4YU1A 2VXNA 4FEZA 3APTA 4RKAA 1L9WA 4TX9A 3WBXA 1RQBA 1HJWA 1GKPA 2AGKA 2OU4A 2H8XA 2JF6A 3UXDA 4ZBCA 1AL7A 5C8BB 4B4HA 5MKGB 2HPMA 4N2YA 4QG6A 5BU9A 4Z2HA 3IRSA 5C2CA 4EIVA 1WDDA 2J8GA 1VENA 4QE5A 3P8IA 1P6BA 3BAJA 3BVJA 3PWAA 4H9UA 1TMHA 4K7VA 2WMIB 4WGXA 2I5GA 2E1DA 4DJFC 5I3GA 4MJZA 4JGDA 4UFJA 3UWYA 3I4KA 1W9UA 4H2CA 5KINA 4B9YA 1Q7ZA 3N2OA 4B5UA 4O17A 4NF7A 3Q65A 3LPOA 3PN8A 3QKZA 3GY1A 1VFTA 2O7SA 3TWBA 2VCBA 3S0CA 2Z6JA 3A4AA 1KGWA 3W72A 5CC6A 4IQDA 4LANA 3HFTA 4ZOCA 1V6XA 3IS4A 5C7HA 3H4XA 3LI1A 4RXFA 1UUOA 1ISWA 4DI8A 1WV2A 3W7KA 1XYAA 4C90A 3D3FA 1OFDA 2CU0A 4IIGA 1RP9A 1WKFA 2W66A 4Y2WA 1NQKA 4GO8A 2C0HA 4IM4A 3WL1A 1WE5A 2GGIA 3TU9A 2GGGA 1T6MA 3QKEA 1XM3A 1SZFA 2Y1HA 2F9RA 2RDXA 6XIMA 3W1RA 4MAVA 1TZ9A 1B3OA 2YXGA 1PTAA 4XD5A 2V63A 3OYZA 3I65A 3AIVA 4GPNA 1W5OA 3CGTA 4PFHA 3WQFA 3O6YX 3U7BA 4HTBA 4S1FA 4X63A 3MKKA 4IIEA 2QAPA 4W93A 4O1CA 4Q8UA 1A5AA 1Z3NA 3PUOA 1M7PA 4ZCWA 2DH2A 4LVDA 4Y9OA 1U5VA 4IP7A 2PWDA 3N1AA 4HZ7A 5A3HA 2ZOXA 5C0QA 1FWGC 4MKNA 4HPGA 1QI0A 1Z44A 3M0KA 4WY0B 4HA4A 3CEPA 4DYJA 1H0GA 2OO0A 1HKWA 1EL3A 3EWZA 4Y9PA 5I6SA 2XDFA 4IGMA 1F5ZA 2PTZA 3M16A 5M17A 2AKMA 2ONEA 1AW5A 1TRDA 4KEZA 3OLDA 3AIRA 1YYAA 3L4VA 2PDUA 1A80A 4KCWA 3LYEA 5BW6A 3HZ3A 4CN1A 4RE4A 4H9XA 1K8ZA 3LEPA 1JCLA 2RKXA 5FEZA 2I9UA 4MNLA 1J0HA 1E72M 3G1DA 1HL2A 3SY8A 4KIEA 3N12A 5D4YA 1JDEA 5A6SA 1GVOA 1IXOA 3AHTA 4H9VA 4DF1A 1FWFC 1DWFM 3ZS4A 4O1BA 2DY3A 4CNSA 3SM0A 3TW9A 1QI3A 2OSXA 3BLKA 3ABOA 3S4TA 3HPXA 4UFMA 1WX0A 3SJNA 3NZPA 4OTKA 1WNOA 1MSSA 2IS7A 1EUAA 1GQNA 1F6PA 3WNOA 1I2QA 2CLFA 1K7XA 2RDWA 4RXGA 1EP3A 4NY2A 3VZXA 4K8EA 4AYGA 3RGTA 1KFLA 4HIBA 1JZ2A 4Q3MA 4Q8QA 3CK5A 3PTDA 4I7VA 3QMRA 6REQA 1XV8A 3KVMA 1FFQA 2NWSA 1AZ1A 3S5SA 1ZCCA 3LCHA 1TV7A 2A21A 3D5HA 3HPFA 5AC6A 4FP1A 3MHFA 3W25A 3D3AA 4XAYA 1NWRA 1GGOA 3DAQA 3IJQA 3CUIA 1AA1B 5D33A 2BVDA 1M5WA 1OT2A 1E9ZB 2PRHA 4PYSA 1WOBA 2I17A 1OYCA 4L1XA 2XIBA 5G2IA 4W8BA 3WLTA 4RR4A 1CIUA 2JIEA 5E1QA 3GO2A 3AWNA 3G2GA 2F61A 3T0DA 2OX1A 4Y7EA 3WNKA 2D22A 2BOGX 2HNHA 3DGBA 3QN3A 4WK9A 1KGXA 4PUDA 5EBAA 4FLSA 1QOPA 1C7TA 3EEGA 3S5ZA 3ZWTA 3KS6A 2Y8UA 3BUVA 3W7DA 3PFRA 1KRMA 1FP9A 3M41A 3VKAA 1Q65A 3PBGA 2ISSA 3TA9A 1QPKA 3MCOA 1O7AA 1EJ7L 3MSGA 3GH7A 1UD2A 1OFOA 3RUBL 4QDWA 4PBGA 4UTFA 1KM4A 4L5ZA 3LMZA 1XLHA 3V7PA 3VNMA 3IANA 4DZ5A 1P0DA 1NDVA 3ARTA 3SBFA 4UMBA 3HFYA 2ODOA 3QGVA 1UJQA 4GQRA 2HJPA 4ZQCA 3H23A 4D2JA 2IKIA 4G7EB 3MUIA 1BWKA 4REQB 3MO7A 1CGTA 1HX0A 3C2RA 3EWUA 4TU1A 4D6FA 2OQYA 1ZBVA 2GK1B 3VXGA 2QMKA 3GE7A 2Y89A 4LX4A 1VS1A 3CH0A 3L4ZA 3MB9A 4GBUA 3GAYA 3H24A 4OBRA 2OLAA 4PMUA 3WDHA 1Q63A 5D32A 2UV8G 2YIHA 1O94A 1VFUA 2ZUVA 1EZWA 3W6LA 1SW0A 3MVTA 1FFRA 4MB1A 1KQYA 3EWDA 3NA8A 1NP0A 2G3MA 5D8ZA 3CU2A 4N9DA 4DJED 3V1HA 1RPXA 1TIWA 1SQ7A 1HJXA 3W1LA 3N11A 4U31A 3W7HA 1KM5A 2FVKA 1V6WA 4OIFA 3EXSA 2ZC8A 3T2QA 1R47A 1VRDA 3THDA 1K3UA 2JFEX 2D20A 1Y8BA 1RAKA 4N9CA 1LP6A 1VEOA 5JBFA 1ZALA 1ZNNA 1TUFA 5C9ZA 2EG6A 1J0JA 4CN4A 1FKWA 5CPOA 2AMXA 2GSEA 3AFBA 3APGA 2GJXB 3RM9A 4QTGA 4E2OA 4LS1A 1K4HA 5F4WA 3OVRA 2R1PA 2E25A 2HNEA 4S38A 3BOXA 3QV9A 1K77A 3RRAA 5HWJA 2J66A 1V3LA 3ABRA 5FJUA 2DT3A 1DWGM 2CCRA 4JNZA 1C8VA 3NQEA 1EJTC 3CH9A 4GIAA 5TQLA 4PRTA 4DWSA 4MMWA 3T08A 3MVIA 1GZ1A 5LNVA 2QVNA 3B9NA 1QVBA 1EUNA 4RDZA 3OZPA 5DY2A 3DECA 1YW1A 4UTWC 3R8HA 3GXMA 3QH2A 1Z9AA 3VX0A 4DXVA 3VKBA 3IJ9A 1LWHA 3QTGA 3GS6A 1VZWA 2HK0A 1DWAM 5I07A 3LHUA 4ATWA 3NCOA 5G1TA 3GXDA 5F1VA 3RITA 1UOKA 2Y7DA 1Q7QA 4ZQPA 3TP4A 2OOGA 3PZUA 4AISA 2CESA 3S2LA 1BVZA 1DIOA 2QCMA 2FJKA 1UA3A 1KLYA 3QQ0A 5DCBA 1BRLB 3NO5A 3SZ8A 1CXHA 2PMQA 1WPCA 3VM7A 2DJLA 3NSMA 4WD0A 1WZMA 1GEQA 5FAGA 3B3DA 1TZ7A 2OYMA 5LXXA 3WLIA 2GQ3A 2NUXA 3QR3A 2OGJA 3W01A 1D3CA 1WA3A 2E1WA 4GI6A 3EOSA 5DXXA 3OEXA 1JUBA 2QEZA 3DGRA 3HQ1A 3UWVA 3VDCA 1GNXA 1AH3A 3SCVA 3PPFA 5REQA 2D73A 2YZRA 3EYPA 1GVQA 3EWBX 1DVJA 3MCNA 4KGLA 4PMVA 2R1NA 3TYZA 5AZ0A 3UJFA 3WH6A 3VGFA 4QG9A 2X41A 1OC6A 5A8GA 3GBDA 3BO9A 5E6YA 2J8FA 4D9PA 1OG0A 4JTHA 5LA2A 2VGBA 2VFHA 3B0UX 2XIMA 3KBWA 3KUMA 4WSHA 3V5OA 3QOMA 3U2ZA 1G01A 2XM1A 2XVNA 4UTTA 4ZVJA 2WPBA 3IPWA 3VE7A 1MO0A 3FJNA 1H09A 4TV5A 2VEPA 1XD1A 2XN2A 3E0FA 2E6AA 4GQGA 4Z08A 1D9EA 1NOWA 4US5A 4LF1A 4MY9A 5LNWA 4GVGA 3S2JA 2DP3A 1B3XA 1W3HA 2DU2A 4PR4A 4BCEA 1IGWA 3FX4A 3OHIA 3U7VA 1XXXA 3CPRA 4D1JA 2X16A 2Y7EA 4MDOA 4AH7A 4GG9A 3WLRA 2SFPA 4BI6A 3PJWA 4QIUA 4IIHA 2O9TA 2QXWA 1UA7A 2Z27A 4GIEA 4LB4A 2E09A 4D6DA 1VFSA 1A5KC 5DEZA 1LF1A 1VIWA 3C5QA 4IMFA 4H7ZA 1F4HA 4IXXA 3WBAA 3WQ5A 2HISA 4JIPA 3WQ8A 1H50A 1UH2A 2O7QA 4LYKA 3KWSA 3UXKA 3GVVA 2W6RA 3WH7A 3CO4A 3PZTA 3QGAC 2G3IA 2OO6A 2VURA 4FNPA 4PB4A 4J3SA 3UXIA 4HNTA 2VX6A 5A6BD 1XIGA 3WJYA 2JKEA 1R3RA 5A8NA 1TZZA 2IPWA 2VQTA 2CBJA 2PTYA 1ESWA 3H54A 4RDVA 1BSIA 1W1VA 2OZ8A 3WJZA 3ZOAA 2BZNA 3LERA 5MHBA 1FWSA 1Z41A 3RR4A 3R1ZA 1GW9A 1OABA 2I5IA 1W5QA 3AIUA 5CGMA 3WJXA 1D3GA 2XINA 4BFAA 1OHLA 5HATA 1F4AA 1QCWA 4G56A 4IMCA 1D2KA 5LGXA 4GFIA 4UQBA 3RG6A 3MSDA 5A6AA 1KKOA 7TAAA 3S3GA