3H24A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
267
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 267
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h24A00
1Q7QA 1TWZA 2DZBA 3H23A 2YCKX 2Y0FA 3H2AA 4D8ZA 4DAIA 3H2CA 1Q85A 3MCMA 3TYDA 4DJDA 4S39A 4MWAA 4C1NA 3H2EA 1TX2A 4C1NB 2Y5SA 4S3FA 4S3EA 4DJFA 4O1EA 1F6YA 3H2OA 3TYBA 1AD1A 3TYAA 4O0QA 2BMBA 3BOLA 3TYEA 1AD4A 2YCIX 4DJDC 4MWAC 3MCOA 1EYEA 1Q8JA 2YCJA 3TYUA 3NOYA 4D8AA 3H2NA 4S3BA 4CCZA 2VP8A 4DJFC 4NHVA 4DJDD 4MWAD 3H26A 3H22A 4S3CA 4O1FA 1TWWA 3H24A 4HB7A 4DJEC 2E7FA 1Q7ZA 4S3DA 4NILA 4MWAE 2VEGA 4DJEA 2H9AB 3TYZA 1AJ2A 2YCLB 2VEFA 4DB7A 4NIRA 4D9PA 2Y5JA 1Q7MA 2DZAA 2DQWA 3TR9A 1AJZA 3MCNA 4DAFA 3H2FA 3TYCA 3V5OA 3TZFA 1AJ0A 4S23A 4DJFD 4S3AA 1TWSA 2H9AA 3H2MA 3K13A 1TX0A 3TZNA 2YCLA 1Q8AA 4PZVA 4NL1A 3BOFA 4G9PA 4MWAB 4S38A 3H21A 5JQ9A 4DJED 2OGYA
chains in the Genus database with same CATH superfamily
4JTUA 4MADA 3RCMA 1L6YA 2DZBA 3BGAA 3NQ2A 4GZEA 5G2WA 3FKRA 2NT0A 5I6SA 1GOMA 4GCXA 1TWDA 1P4CA 3S6OA 2R82A 1HKJA 3LPPA 4L4PA 4QJ3B 4IFKB 4L5ZA 4CNSA 4DM1A 4AY8A 2V5BA 1SZFA 1VBUA 1XLEA 2CXGA 5C5YA 5C9WA 2ZZ4A 4GC4A 4K7YA 2VX5A 5U7SA 3QKZA 3P80A 3FXGA 4XIMA 1AMYA 1BXBA 2BY3A 2CWXA 4U3AA 3DEQA 4E5TA 2ZX9A 3G77A 1XP3A 4GG9A 4UFLA 5C2GA 4GACA 2E40A 1E15A 1QASA 1AFSA 1H63A 1EF2A 4AC1X 4MZ8A 4ZCWA 3HM7A 2R24A 4S3CA 5CZTA 4EAMA 4NJJA 3AHZA 1JYNA 5AYBA 3CHEA 3G1YA 5HMEA 3LXAA 3U0HA 5FJPA 1GKRA 1YTDA 3WCZA 1MQQA 1R38A 3FDGA 5LHEA 4NUWA 1TPC1 2OLAA 2HXTA 3VXGA 1ZGDA 2I1OA 5E6ZA 5KZEA 1ZBKA 4AYGA 4GBDA 3GXFA 3MCNA 5H8MA 2L5HA 3CPRA 3GIQA 1RUSA 1FHVA 1O5XA 2BVTA 4O19A 5G2IA 1DJNA 3GW0A 2TPSA 4C6QA 5A6SA 4WDTA 1BF2A 4ACYA 3WNLA 1XQLA 2Z0IA 3BG3A 4P8WA 1XCWA 2SFPA 3VNJA 2GGJA 3PB2A 5KTLA 5EL1A 3UXKA 1K9DA 1PXGA 2CLLA 1XI3A 3M5VA 4IGSA 1GQIA 1S46A 4HNCA 4CD7A 2Z1SA 4B90A 2A3LA 1JI1A 1LG2A 4HN4A 1T8QA 4F79A 3E49A 1QPKA 3BH4A 2QIWA 1MUWA 4QQ3A 3G1VA 1BYAA 3K1DA 3CIVA 1WO2A 4Q7NA 3BLKA 3FX4A 4ZMGA 5D8ZA 1H7WA 1VLIA 1XIMA 3QF0A 5A3HA 1EEXA 4GINA 4F40A 2P0OA 1G7VA 3P2VA 1PKYA 2W67A 1UP3A 3EBVA 3PPCA 5E70A 4M19A 1QPNA 4BQ3A 2YR1A 3T0DA 4FP1A 3KXQA 1W37A 4L6OA 1ZUAX 2PRMA 3DU0A 3VNZA 4DIAA 5I06A 3EWYA 5IRPA 4REQB 2BVDA 1XV8A 4DBDA 1D3GA 1BGAA 4JCLA 2WKLA 3AIRA 1F2JA 1AZ1A 4L1GA 3ARYA 4XB3A 1Q2SA 7PTDA 4YPJA 3MKKA 1M03A 1BTCA 2PDGA 1DJGA 3WK2A 3CQIA 3ZVHA 4B9YA 1HJXA 3M5ZA 4ZQCA 1UJQA 1TPDA 3MJMA 1BHGA 2OEKA 4LEQA 3T42A 1TKKA 1BXNA 3K30A 2FQIA 2EEXA 2WSYA 1Q6RA 3BCFA 4GI9A 1EJSC 1JCJA 3UR2A 5U4NA 4IXHA 3UGRA 3N2XA 1W9VA 1RP9A 3LCHA 3LCWA 4QIUA 4IPJA 5F4XA 5A8MA 3PK7A 4KWUA 2KX9A 5HATA 2ZADA 1D7FA 2G0WA 2ZC8A 1RQHA 4HZMA 2HVOA 2H90A 1OYBA 1TELA 3C8NA 4UWMA 1U2YA 1BKSA 2PTXA 3ZLHA 3L67A 1I1WA 4M8UA 5BOEA 3REQA 3S47A 4AU0A 2PEVA 4JN8A 3BL3A 1KFLA 4QITA 4DWSB 3ARRA 2ZUTA 1IWAA 2WV8A 4C6CA 4HHMA 3T08A 3NQDA 2C14A 2HSAA 4IPIA 1Q8AA 1YPXA 2PWUA 1FVPA 4L1XA 3WLIA 2QKFA 3WD0A 4BHYA 3VYLA 1OFPA 1NTHA 2J8FA 4UTLA 3QRHA 2R1LA 1GJWA 1JDCA 4PL2A 2GUYA 5FF7A 4TO8A 3KOYA 1WZKA 3TQPA 4PMRA 1FA2A 4DAIA 4H9YA 3PNUA 3Q45A 2G3JA 2OTDA 2EF9A 4P8VA 4C6NA 1C8XA 3QW4B 1QTWA 1ADDA 4E3VA 4M81A 5GNYA 4QDWA 3ZWTA 1W3HA 2OKTA 1KTCA 4KCTA 5DEZA 3QY8A 4YTSA 3LRMA 2NWRA 4AZCA 2UBPC 1A5KC 1YNPA 2ZVIA 4GPNA 1V0NA 2ABBA 4MM1A 3N15A 5JH1A 2OXNA 5CPLA 4WGXA 1RJRA 3EKZA 5ABEA 3TW6A 1K8ZA 5CGQA 3C0QA 2O9OA 1A49A 3TN4A 3VGGA 2HCVA 1G0CA 2W3ZA 4HKPA 3WSUA 4MTVA 4BKNA 3H70A 1GYLA 3BSHA 3CNYA 4W88A 3HN3A 4JTKA 3GW3A 4AD3A 2BTMA 2FZDA 1QDSA 4A21A 1HIZA 4MGGA 1A5SA 3WQ4A 3NA8A 1QATA 3IARA 1J2BA 2RJHA 4HCLA 2A21A 1V93A 1CGXA 2YDQA 1QPRA 3TXZA 1UQYA 1ZU8A 2DU2A 3TMQA 4PL1A 2VRQA 3N6JA 3H7RA 4XVEA 1HGYA 4NX5A 1F3TA 3WYZA 5D2VA 3BOFA 3N9RA 3PNZA 2X05A 1TV5A 3ARVA 1PHQA 4EANA 3P5YA 2BGQA 4BF7A 2DVUA 4QFUA 2PZNA 4IP4A 4Y2WA 2GQ3A 4JDYA 4DF2A 3B0YA 4CQDA 2YW4A 3T1GA 1XICA 3KEHA 4MB4A 3M0VA 2J7HA 5KMYA 5I2UA 1F05A 1YNYA 4GI6A 3QPEA 1GQNA 3WH5A 4KT2A 3TYBA 3GD6A 2QLYA 1BXCA 1FY6A 1TZ7A 4WJXA 1BQCA 3LXCA 4LUSB 4HU3A 1QOXA 2FH6A 3UJ2A 3GFXA 1I0DA 2AL2A 2B7QA 3VE9A 1NAL1 1FWDC 4IISA 2A0NA 4PC8A 3RJXA 1S2CA 2XH2A 3W1MA 1BFNA 3GFYA 3IV3A 3QV6A 2OYKA 3GAKA 1XIHA 3TC7A 1J12A 4LJ3A 2VC7A 3FVDA 5B7YA 1XIIA 3ZLFA 3NQ7A 5HNUA 5I03A 1ISXA 2E9LA 3SGGA 2UY2A 1JZ4A 2DZXA 5F4SA 2DORA 2QF8A 1VCGA 3EMZA 2GUBA 2D69A 3V0UA 3VGBA 1EZ2A 4DJFD 4DO6A 4ZTYA 1E1EA 1W2PA 4ICCX 1AA1B 1MW1A 3CPGA 3QPZA 1IR1A 4B5TA 3FY1A 2X7WA 3UG3A 1F3WA 1UUOA 2ZXBA 3QY6A 3NDOA 1GUVA 5IDIA 3CUIA 1KXVA 2VM8A 3MMWA 4OV9A 4H83A 2WJFA 1JRBA 3N9SA 4J28A 4GUFA 3V16A 1B4KA 3C0LA 3APTA 3OBKA 1MI3A 3ZR4A 3IGHX 7ENLA 4IIEA 1ISZA 3VTRA 3C0SA 2IXVA 1UJPA 4UXDA 1AG1O 1P0EA 1V0KA 2V5DA 3E74A 3NQFA 4GYJA 1BVWA 1O60A 3AZTA 3V1PA 4PB4A 2W63A 2G50A 4QCFA 4XX6A 4ERIA 4HJWA 7TAAA 3E0IA 1M41A 2JK2A 3D5HA 5J5DA 3SCQA 1GZGA 1LTDA 3UU0A 3UT0A 1XC4A 2DZUA 1V6WA 1TQJA 3BLDA 1TTIA 3P0XA 4MWAE 1W3JA 1EO7A 2W4XA 2FZMA 1CDGA 2YLAA 1HVQA 4X9YA 3WQOA 1VHCA 4AH7A 4QR6A 3FHQA 1K77A 3R8GA 2W6RA 5D4YA 2NX3A 4XD6A 3VUPA 1SFTA 3V0SA 4O52A 4PBFA 1YDOA 1VEOA 8RUCA 1VFLA 3EWWA 4ORMA 1VB9A 3RM9A 3N1AA 2ZC1A 2VEIA 3D3AA 3L5AA 3NVDA 1PWLA 5MHBA 1QNPA 2V8ZA 2JGQA 5E0KA 3WQ6A 1KBLA 3C4UA 3H2CA 4AUBA 4O13A 1OGGA 3MWAA 3W23A 4B9ZA 4RZBA 4IM4A 2ZTJA 3UETA 1UQZA 5LA0A 3MZNA 4PYSA 3UG5A 2E6AA 3BAJA 3W70A 1B9ZA 4E2OA 3C3NA 4MF4A 1Q6EA 2GVJA 3TJLA 1TTPA 2XN2A 3MUCA 4CEUC 1D8CA 5A6LA 3NOYA 4D8AA 3D0CA 3PR2A 1EC7A 4UZSA 5A6MA 4H7VA 5FF2A 1F6KA 1QI5A 1JQXA 5CZ0A 3O7UA 4JTIA 1S2WA 2QDDA 5AC5A 1JGIA 1W5NA 2QS8A 2VX6A 2Y7FA 3OVQA 1HTIA 4RCXA 2CC0A 1ENUA 3MSYA 1AODA 5JVLA 2Y6ZA 1XSIA 3EX3A 1ONRA 3W6LA 2V2CA 1VPXA 1P43A 5F2MA 3MSRA 3OPSA 3BQ6A 3MKCA 3CWHA 2YL9A 4W7WA 1UD4A 2GQ9A 3OU8A 2BY2A 1FCVA 5FKYA 3ZM8A 1XH2A 1JG9A 3RRXA 7ODCA 1DE5A 1EP2A 1U1JA 2VO5A 1XLDA 3NZ1A 1HL2A 3TV8A 2Y0FA 4GOAA 5J8LA 1TPUA 4ZSTA 2PU0A 4RUBA 5REQA 4F0SA 1UZDA 1T8XA 5E5CA 2DUZA 3M0XA 5KZDA 1AQMA 3AIEA 4NYUA 2D3LA 2V6AA 3F5LA 3W73A 1HP4A 3QMSA 4XZHA 1PTGA 5I02A 2NX1A 3VIMA 3GKAA 2C8NA 2A2IA 3DN5A 4JBRA 3M64A 3DC0A 2CLMA 1AH0A 3BMVA 5IFTA 1GVFA 1GVEA 4ENLA 4CCZA 3FA5A 3EPMA 2GUUA 5FCZA 1LT8A 1SO5A 4XKMA 3T05A 5SWUA 1A80A 3H24A 5KZMA 3STEA 4D8LA 4NZ4A 5D2WA 1K4HA 1FWGC 3LOTA 3WQEA 5H91A 1AJ2A 3ZT5A 2XVNA 4KEZA 2VEFA 3ITLA 3AJ7A 4HSHA 1CPUA 2DVXA 4DI8A 1I2PA 4OT7A 3A21A 3TA9A 3WUGA 2NW0A 2QJGA 4OQVA 4DM2A 1NOFA 4XZNX 4Q22A 1T40A 2VCBA 4JTLA 1ITQA 1XFBA 3WF1A 4O1DA 2BVYA 1EGMA 3GKFA 4HOZA 1VRXA 1UR2A 3LLFA 3UG8A 4HPGA 3COTA 1V77A 4XK2A 4TMBA 2AKZA 3SCTA 3N11A 3NQMA 4KCVA 5D2TA 3B0XA 4QE1A 1Z42A 4LWWA 4QE5A 1Q6QA 3RR1A 5I7GA 2C15A 4FOJA 3SRKA 3AMGA 2YCJA 3OA5A 1D3CA 2QJHA 4YXGA 4HK5A 3MC5A 4CVWA 2QAPA 1YW1A 1VS1A 1GOKA 4XKYB 1FWEC 4N6EA 3UCQA 5K4ZA 4HU8A 3BAIA 2YBUA 4ZOAA 1MEIA 3JZUA 3BARA 3BO9A 1MZRA 2IW0A 1I6NA 4QS6A 4C6DA 3OZYA 2PURA 4K7VA 1H61A 3TTQA 2Y5JA 4HZ8A 4QSHA 1FX6A 3TUUA 1Y8BA 2DT3A 1QNSA 3K13A 3NUKA 3R0DA 3FCPA 3EWBX 1ICPA 1FCQA 2OZ8A 4OKDA 3ZWSA 1EJ7L 3R2GA 1ZP3A 3NPWA 3AXKA 1M53A 3SY1A 3UWEA 2NUYA 2GJNA 3IRSA 4FO4A 1PZ3A 2GGGA 2OQYA 2J27A 1R46A 6XIAA 4XG1A 1CLVA 2VEMA 1RH9A 1JZ2A 1QW8A 5DMYA 2GZXA 1MNSA 2GJRA 3CUZA 2FGBA 2ZZ6A 5C9RA 1OADA 4U2ZA 1TREA 3NOEA 1TV3A 2ZRVA 4KRUA 1W3KA 3WNKA 5LNRA 1KV5A 4PCPA 1PKMA 2GOKA 3ABQA 3LXBA 4LYPA 3S5SA 1JJKA 4WXYA 2ISFA 1E0XA 3BJSA 5EBUA 3W6YA 2RGMA 3VDAA 1NFPA 2GVYA 1KLYA 1TUFA 1Y0EA 3OG2A 4M82A 4UCFA 5LHFA 3W75A 3ABOA 4S3DA 4AISA 1E3XA 3QV7A 4NAEB 4R7JA 4E8GA 3KZPA 1I8JA 3EPOA 3EMQA 3WQVA 3OZOA 1EL3A 4AZIA 1UR9A 5EY5A 3TLQA 1AK5A 4PUWA 3KVJA 3GM8A 4O50A 3GX9A 3NTYA 2XH4A 3ERPA 3NYDA 1EJWC 3MYOA 4GNJA 4V2XA 2RUSA 4Y8FA 4IMEA 4E2DA 3NQEA 3KL0A 1XIFA 3IACA 3M6DA 1WDPA 2CZDA 3W3OA 4QE4A 3B4UA 2VC6A 3GHTA 3ONCA 4E38A 2J75A 3CUFA 2BXYA 1P1MA 2VQTA 2AMGA 1FWCC 3TYDA 3CK5A 1E40A 4Y9MA 1UR1A 3SUSA 4I6KA 4PTDA 2P3ZA 4LCSA 3QGKC 4ATWA 4E6MA 5CSUA 3NWRA 2VHLA 4H8NA 4QNWA 4PCNA 1ZLPA 1QI2A 3TYEA 4CN6A 1AL8A 4AWSA 4XZLX 3ARQA 3ABZA 1UR8A 1W17A 3PBGA 2DT1A 4OV4A 1W6TA 3JS3A 1K8YA 1OGBA 3EAUA 3ES8A 3MS8A 4FI4A 3VIIA 2E4TA 1MWOA 4PRRA 1LDCA 6A3HA 4HU4A 3DFSA 4O17A 4I9MA 3LHVA 3IEBA 4CGTA 4IGMA 3E0FA 1TRDA 3C61A 4KH2A 1UROA 3QZEA 3VFLA 1W1YA 4XZBA 1ESWA 2WO5A 3EMCA 3I3DA 4Q8UA 1ZCCA 3P6LA 5DCEA 3WBEA 3DGRA 3IJLA 3BANA 3STCA 3IUDA 4XAFA 2PF0A 2YXOA 2ZUWA 1JGMA 2V68A 5D30A 2A3EA 2D73A 3ZXWA 1FWWA 5J5RA 1FWAC 1CLXA 3R10A 3WLSA 5JMUA 1R0MA 4LCRA 4HNNA 5CC5A 2VWTA 1IEQA 3QM3A 3KBNA 2HVNA 3OLIA 4O8AA 5DCDA 4GRSA 4DJFA 3OBEA 2CHOA 4O0ZA 1QBAA 3H4GA 1MFVA 4DWSD 4Q32A 1VJSA 5FESA 3E6EA 1OCJA 5JH2A 4M3PA 1IXNA 3MCOA 4LY4A 3VK5A 1E72M 1RQBA 1RVGA 3SCUA 3GS6A 1P0BA 4CD4A 5H6HA 4TR9A 5TNVA 4Y96A 2CHNA 2B7PA 3NSMA 3QR1A 1EGVA 2P10A 1XBVA 2TODA 3MHUA 1GT8A 2CLHA 1FFRA 5FAGA 3UERA 2NUXA 2CIPA 2WBGA 5HWNA 3GNRA 2IKGA 5KZ6A 2Z7GA 1D7KA 2IKHA 4A8IA 2R1PA 3PTQA 2OVLA 1W5QA 4TX6A 5K3VA 4D9PA 1B0IA 4J5NA 1O5QA 4OBRA 3FAWA 1PWMA 1WOAA 4O53A 3BQ5A 1RJPA 1H7RA 2DPEA 3WMLA 1FWRA 2BOFX 3OGVA 4L9ZA 3ENLA 3VGFA 3QHNA 2F9RA 3AFBA 3NQGA 1HF6A 3FXYA 3UF9A 4IQLA 1CX9A 2CLIA 3I3BA 2CZEA 1X96A 1K6WA 1JF6A 1UA7A 3WK0A 3BXWA 1BRLA 3ABRA 4D6JA 3WJSA 1Y65A 5BXRA 3NDZA 4W84A 1R6WA 4LAUA 3P7YA 5LNVA 3EEZA 2IPFA 1WX0A 4WDWA 1W9UA 1I2QA 3ITYA 4HQVA 2WW5A 1Z44A 4UQAA 3Q4DA 4MZ1A 1E5NA 2PTZA 3H2NA 4M1BA 3B8UA 3RNDA 3B9NA 1NWRA 2Z26A 1OGSA 5I79A 2YPIA 1J6PA 3P67A 3S5NA 4ML4A 1US0A 4L56A 1A5OC 4H9UA 4IIHA 2G8ZA 4I8DA 5XIMA 4B15A 4LUJA 3EDDA 2CETA 4ERGA 1GQJA 4Z0JA 1UHVA 4MUZA 4IJBA 2G3NA 3UCCA 4NT0A 2DZAA 2I56A 1LOLA 4DRSA 1XYAA 2FZ9A 5I00A 3G5EA 4N42A 1BEUA 2DUXA 5D2YA 2Z2UA 2AAAA 1F5ZA 3F4NA 4KETA 3G3DA 4I3GA 1HJSA 1PCWA 1OFRA 4FEZA 4LVAA 3DG3A 4JFVA 1RR2A 4MDPA 3BK0A 4FX7A 3UD6A 1UKOA 1IWBA 4AZBA 1HKWA 1PYMA 4K38A 3VKCA 4XAGA 2ZE3A 3W7NA 4XZ9A 4JIIX 3L65A 1XUZA 2VWSA 4G7FA 3RG6A 2IPGA 4FNQA 2YBVA 3AICA 2YDSA 1WAUA 2VVSA 1KRMA 1S39A 3N2OA 5C71A 3RRAA 3VOHA 3EA1A 1PIIA 5FSEC 3AHXA 1SZEA 1FWTA 3WEOA 4UMCA 3UYIA 3RF9A 4RDZA 2AGKA 1VAHA 5IDZA 3A24A 3WBAA 4GUJA 5JBDA 1UD8A 4B3KA 2UV8G 3GNOA 2JBMA 3JW7A 3APGA 3WNMA 3CL8A 4YIWA 2OX1A 2I5GA 2G3FA 6ALDA 4R9XA 1KFJA 3AXXA 1GOIA 4W85A 4DLMA 4QG6A 1ZB5A 4GI4A 3VINA 1F6PA 2QJMA 2EKCA 5FOOA 2J7GA 2IKJA 2WNQA 1M5WA 1VJIA 3EXRA 1TQXA 3DUGA 1VHNA 5DQPA 3V35A 4BCEA 2IXUA 3WJZA 2G4FA 3BLLA 2FMOA 2Z27A 3WMCA 3PZTA 1IZCA 5DMLA 4EE9A 3W1UA 3H21A 5HINA 3CQJA 3SADA 1ME8A 4QLJA 3GDMA 1KCLA 1P6BA 3DHDA 1LP6A 1XL9A 3PSVA 3MMTA 1EF3A 2EJAA 3DYOA 3SCWA 2DSWA 1W9DM 3A9IA 5L9FA 4AD5A 5DX7A 3BOXA 4PUMA 1GGOA 3UZ5A 5BXPA 3ANYA 3VZZA 3E3HA 4A8LA 4RDVA 9CGTA 2FGLA 1HZYA 1XIGA 4WHBA 4IX0A 4LPCA 1WAWA 2P88A 3B04A 4IJRA 3MTWA 5EGRA 1YKWA 4E2BA 4J27A 3TW7A 1OM0A 3AIBA 3ZMRA 2B0MA 1IEXA 2W61A 3IK2A 3KRZA 3MJYA 4JTAA 2CBVA 1VKFA 2FVKA 2HDJA 3KCOA 3REQB 2CXEA 3W7HA 1H3GA 2B81A 5I09A 3LSBA 4ZTXA 3VOFA 1CGYA 2DP3A 2V38A 3SGUA 3WQ5A 4AFYA 5JU6A 4F9JA 1QT1A 2NXIA 4ILSA 4L1WA 3LI0A 1S5NA 3SY8A 4FNPA 2E67A 2NT1A 3PAJA 4ZB0A 3DYMA 4UCGA 1H5YA 3AHTA 4MNMA 2R1KA 1R47A 1OIFA 4R33A 4M56A 4LX4A 4ZOEA 3VPLA 3MBDA 3PBVA 3IGXA 4LAZA 2BHYA 3DYPA 2PTYA 1XLAA 3R1ZA 1JYWA 2WM1A 3DDMA 2GQAA 3ZJ7A 4DHGA 4L4MA 5G1TA 4K2SA 3N2TA 4NQ1A 4UTMA 2CITA 2ZCGA 1OC7A 3F4VA 1UA3A 2Y88A 1XJBA 3SUVA 4ZQMA 3NXFA 1Q2RA 1DORA 1F3XA 2GWNA 1Q3NA 1E55A 5K4XA 1TJPA 3VCNA 3U9IA 4WDXA 2O7SA 3WL0A 1EIXA 3G22A 3QYQA 2XIJA 3K46A 1XBXA 2FTYA 4NI3A 2QCCA 1BD0A 1MZHA 2BLEA 4C6LA 1H41A 4V15A 2XFYA 2PTDA 3GHRA 1NP0A 3GR7A 4NU7A 1V02E 2HXUA 2OEMA 3LTSA 4Y9NA 4O11A 2WVUA 4ZL1A 1UR3M 3TU9A 5CSYA 1PUDA 2DZVA 3UJEA 2BY0A 2D24A 2P0IA 2D2JA 1TPVA 1O12A 4JN6A 3E2VA 5ABHA 3UWYA 3B0PA 2A5HA 3NPXA 3T4CA 3LPOA 2W27A 2X1RA 4DJED 4JTEA 4JKKA 4HSOA 3P0WA 3KVLA 2J13A 3KVKA 5TAOA 3EWXA 2ZWYA 2YCKX 5D9OA 4O4VA 1IQ8A 4HK6A 4O12A 3ATZA 4N6FA 4WSHA 4JCMA 5IBXC 1E9LA 4R9OA 4AHOA 3K5XA 4GY7A 3U7BA 5A69A 2GVLA 1XYFA 5C70A 5KINA 1K9EA 1FH8A 4UZUA 2CPUA 4ZOBA 3GTHA 5HQEA 5CG0A 5HANA 3AWNA 1XLMA 1GYMA 1KM6A 4UFIA 4R27A 3I6EA 2C79A 2VDIA 3W2KA 1ADOA 3SCNA 1V6VA 3EWCA 1A3XA 2QCDB 2F6KA 1YTKA 1QI0A 2V81A 5C0QA 2BGNE 3MW7A 4GYPC 5GJPA 4BI6A 2VUYA 1FQ0A 4HPNA 3GO2A 2XVLA 4GVHA 3PPGA 1K8XA 2VXNA 4DXXA 3GNPA 1TWIA 1LWIA 4XD4A 2Q6ZA 2VC9A 3T78A 3D46A 5D37A 4PTNA 3F2DA 4GKTA 3WLNA 1DIKA 5A6TC 3BZGA 1S2TA 3SB0A 3VD7A 1FH9A 1X8CA 2D0HA 5T91A 5C7HA 1ODUA 4S1FA 3E2RA 3VD4A 3MV01 4ATDA 2ADAA 2ZUUA 4Q4SA 3FFSA 2E0PA 3URBA 1KRAC 1WKYA 4I5UA 5HR7A 3OIHA 1XDJA 3WNNA 1ZJHA 3D47A 4MWAA 1LL7A 1OHLA 2Y4SA 4LNCA 5HWJA 3AMDA 1UMLA 4A22A 4Y9PA 2YBTA 2XGBA 3CUGA 4Z2JA 4H7ZA 4QISA 2PP3A 1AD1A 1M04A 1ZBWA 2VFGA 3BWWA 3QY7A 4GH3A 4MNKA 4OBTA 3VOGA 4GIRA 5HWMA 3VO0A 3CBWA 1R9ZA 2D3NA 3S5OA 4LUTA 1VBJA 3GAYA 3RM4A 3H22A 1IF2A 3UNDA 1TPH1 3GVRA 5TQLA 1JVNA 4WF7A 3I6RA 4ZE4A 1IGSA 1XLJA 1IEIA 3PUDA 4K1GA 2HK1A 2ZZ5A 1XLIA 4IG2A 4JY9A 5I5RA 2BSLA 3QZ6A 1A4LA 3QC3A 3OGRA 1GWJA 1KD0A 3CHCA 3PVFA 1G1YA 5BOFA 3T6CA 1K3UA 2IPWA 3G6MA 5FIPA 2Q8LA 3Q94A 4J9JA 3BV7A 5AC8A 4CQ9A 4NSBA 4IL2A 3PBYA 3EX2A 3BVJA 4WSKA 5DT5A 1PHWA 2Q3OA 1WKFA 5CBIA 4LB3A 4RE0A 3NQ8A 4AEOA 1XR2A 4Q4RA 1QO5A 3SBFA 4MPKA 5AB3A 3O63A 1JZ5A 1RK5A 1KW1A 2PFHA 3GTIA 3FEQA 4RXFA 3B3DA 4AHQA 4S3JA 3BGGA 3HG5A 5BNKA 2PCEA 3PTKA 3E0WA 1BYCA 3M07A 4R5EA 5G4EA 3WDJA 2YCIX 4IQDA 3ES7A 4PCTA 5ECUA 2BVWA 3B0VC 5A8NA 2V2HA 2HWGA 3RCNA 3SN1A 1XYZA 3RITA 3BUVA 2J47A 3TCSA 3VD3A 4FAMA 3LBCA 1F74A 1L0PA 2X0HA 1GVSA 5KEZA 1QNRA 2NX9A 4NXSA 1XBYA 3FK4A 2JALA 4RW5A 3I10A 4CN4A 2WK2A 3S1WA 5A2BA 2EJ1A 5LGZA 2QXWA 1MNZA 1SMDA 1UKPA 1YMYA 1OFOA 4M7SA 1JDDA 4RL3A 1F61A 4JTRA 2P8BA 3TSDA 4QJ5B 4NI8A 4JFSA 4EWJA 4HMCA 2DUAA 4P7QA 3RR4A 4PEKA 4B5SA 3UJFA 5CJ5A 4LYKA 1WQ5A 5AKQA 1E4MM 3PPHA 5REQB 3QXBA 3W7RA 2VZTA 3CQHA 4EACA 3ARUA 4POCA 2OLHA 3N2CA 5BROA 4NF7A 3H7UA 3DHPA 4Q8NA 3I7SA 1ZALA 1EFZA 1G4SA 3HPZA 5AC7A 3UXLA 1QPOA 1SGJA 1ZJAA 3WF0A 4M6UA 2RGLA 2MUCA 3CXOA 3T2PA 2VR2A 3NPVA 4CCDA 1Q6DA 3VOJA 4NJGA 4GYFA 3QLDA 3UNTA 4LBUA 4LUSA 1DE6A 2QCFA 4JNMA 3B9AA 4MHBA 3W1AA 5HMFA 4OU1A 4O0KA 3WQWA 1UUMA 4JIRA 1B3ZA 2ZA2A 1O4UA 4G7EA 2H8ZA 1LRNA 1LYXA 3NURA 3E0VA 4RJEA 4BY3A 5HMSA 5DANA 3INPA 3KP0A 1NELA 4J3XA 1UZ4A 3EOUA 1QI4A 3QFEA 4UQEA 3GYEA 2QGHA 4AVOA 5G1YA 5HDRA 2GWGA 4TX9A 3DFTA 3ZOAA 2C18A 2IQTA 3SEPA 1EX1A 3VIGA 1LRTA 5EMJA 3PUEA 4I5RA 2PRHA 3BAKA 1ZENA 3VKJA 4RV8A 1SMAA 3AYRA 1YXDA 2VFDA 3THQA 3L21A 4KCWA 2NQJA 4E8DA 9RUBA 3CZ8A 3D6NA 1FWJC 5T9BG 2RHGA 4GD0A 2DW6A 5CAKA 4FLSA 3DFNA 1E5JA 1C9DA 3CZKA 1O7AA 5F2LA 1KBJA 4OFCA 4FPSA 3PF3A 4AWEA 2JE8A 4Q7BA 4UFMA 5D02A 4NZFA 2AGTA 3PFMA 4OOUA 1AQFA 3FSTA 1AW1A 1XYMA 2J6VA 2OEJA 2QCNA 3LRLA 4UTKA 5XINA 3GH7A 3L68A 1JDEA 1VYPX 1JD9A 3W81A 1PJ9A 3QTPA 3WK1A 4M80A 1LT7A 4XZIA 2ZFAA 5CSSA 3B06A 3HGJA 1TJ0A 4J1OA 2Y8UA 1CB7B 2INZA 2FB2A 3FLUA 2WANA 3VGEA 1G69A 2ISSA 2GLKA 4O54A 3WO8A 2A6NA 3A13A 1CNVA 3CWNA 2PDIA 3CEPA 5CEWA 5I3GA 2F61A 5A5WA 4TTGA 4IPPA 1NP2A 3QLLA 3PZ9A 1GONA 8TIMA 4DYEA 4YWSA 1CT5A 3L4XA 3I65A 4Y6GA 3STPA 3VFCA 2QJIA 3QSTA 4QAIA 3A5FA 4ZXLA 1JF5A 1SO6A 1I1XA 3L0GA 4NNBA 4KFPA 1I4NA 1XFCA 2DIJA 4H3DA 4XV0A 3HTWA 2FVLA 4PUEA 4FF5A 1S38A 1NFBA 4BR1A 3O16A 1OFEA 1LZOA 2WB5A 3UXDA 4N4PA 4IFRA 1WUEA 4AIBA 3A3XA 2ZXQA 1EYWA 3TN6A 1G4EA 1SJCA 2VKZG 4DO7A 1OZMA 2NUWA 1DWAM 2QUTA 2Q8XA 2PDUA 5G4HC 1A50A 4E8CA 3P8JA 5T26A 5F7UA 4A3HA 2ZRUA 1KXHA 3IIOA 2HEJA 1QXLA 4XZMX 2EPHA 1M6JA 3P5ZA 4DJDA 3LCXA 2V2DA 5FEWA 3FS2A 4NG3A 3GVGA 5AHFA 3O15A 1GHRA 2Y8KA 4MVAA 1OG6A 1JL8A 2VQUA 3GTXA 2WPGA 1W2VA 4U5IA 4GKLA 3ONBA 4JX6A 4NP7A 3MUXA 3MSDA 1D3HA 3CL7A 3WKZA 2CBUA 5CGTA 2ZRYA 4QG9A 6PTDA 3KWSA 5C9XA 1XHGA 2ZRZA 1L8PA 2A7NA 3T55A 3LPFA 1NDWA 3QHOA 2PA6A 2J7CA 3VOIA 5I24A 4EXBA 3FNDA 1VYSX 1SUXA 3M0HA 1S2VA 2Q71A 3PZOA 4O1BA 2OB3A 3BDKA 4JPGA 1OZQA 1TVPA 2XU2A 1D2KA 2E3ZA 2AAMA 2GGHA 2ON3A 2RAGA 3DKLA 2BGSA 1E0TA 3PZUA 3TR2A 3A12A 5DRCA 5EMYA 1FBAA 2ZYFA 1JZ6A 3BC9A 3N29A 1KBBA 1XLKA 4B92A 1JUKA 2CERA 3GXPA 3G2GA 2VURA 2XUCA 3I3EA 3WDHA 2ZE0A 5CAHA 1JZ8A 1MSSA 4AZ7A 3CMFA 1QHPA 3GIPA 2J7BA 3S6DA 1TV7A 2ALDA 1JDAA 2QEZA 1C8YA 1JCYA 3DG7A 1H51A 4FB7A 1Z3NA 1FWHC 1UKQA 1RALA 3UWWA 2OO6A 3ARSA 3ARZA 4WD0A 4G2DA 2YA2A 1XSKA 2WZIA 4KEUA 1RJQA 3MPGA 3TC6A 3WH7A 3C2YA 3S4TA 1DJIA 1SZRA 8A3HA 2GGEA 3LYEA 4JTFA 2HPIA 3B4YA 3N4FA 1HKKA 2DH2A 4C5YA 4KFOA 1WBJA 3H4WA 4EAYA 1VQTA 2XIQA 3V0TA 3BGJA 3ZVIA 4JYEA 1W54A 5FF3A 3P8IA 4WX2A 3OO2A 2CEQA 5JIWA 2NQLA 4LS1A 4WY0A 2NV1A 1VRDA 3W7IA 3AC0A 1TJRA 1UWQA 3RJYA 3DESA 4B5UA 2TRSA 3EWUA 4H41A 1K9TA 3H7VA 1UH4A 1KLZA 3AO0A 2E28A 3KBSA 3OTRA 4H01A 3F2CA 2BXVA 2Q01A 4MPQA 1ITXA 4Q6JA 3TTOA 3NL3A 4ATLA 3B03A 2HS8A 1PX8A 1H1YA 4NJIA 2QUUA 2Y5SA 4GVFA 5D9NA 4YYFA 3S6TA 3AIUA 5M03A 1UD6A 4EP8C 2PP0A 3KTCA 3USZA 5BWAA 4JDBA 2E6FA 3RN6A 3H4XA 4A29A 3NQVA 1QR7A 3DFPA 2VJXA 4GXPA 4WVXA 4HMDA 4JTGA 4Q8QA 2YGYA 1RXOB 5C6MA 1E4IA 4PMYA 1UZ1A 4L80A 1THFD 1F8MA 5AFDA 3W7QA 4LAMA 1B9BA 2GSEA 1CTNA 2Z2BA 2J77A 5LIXX 4M29A 3W7OA 4AEEA 1RVKA 1I60A 1PBGA 4C7GA 3CAKA 4X9SA 3MP5A 4K8EA 2FFCA 4TOQA 2OSWA 3TFXA 1XD0A 1PV8A 3GNXA 1L2QA 2FGZA 3CUHA 4K36A 1EBGA 1SSGA 4N02A 3SFWA 1GKQA 5BXSA 2CKRA 2ZUSA 2YCLA 1G4TA 3RX3A 5E9XA 5GJMA 4E3TA 1Q6FA 1VBHA 3N19B 1BRLB 3GXNA 5AN7A 4H6RA 2VEKA 5HJLA 2QCEA 3MDUA 1EHNA 5G5IA 4INFA 2Z2AA 2WHKA 2YZ5A 4NYYA 2WAGA 3WG6A 4MDOA 4B5XA 4U5KA 4M7TA 4J3ZA 1UCWA 2YYUA 4S39A 5MF5A 4EKJA 2XFRA 1L6WA 3GXDA 1AQ0A 1DEDA 1FWIC 3USBA 3RCYA 3L9CA 1TUXA 3QOMA 4ZO7A 3AXIA 1NARA 2QW5A 1PTDA 4IQEA 2D2HA 2HBVA 2VT0A 3CO4A 1B2YA 2D2OA 5K2ZA 5EFDA 4QDPA 1HJVA 1DHKA 4WK9A 1HQTA 5T8GA 3PPFA 3ITTA 2WSRA 2PE4A 1JNDA 3HQOA 3WD4A 4W87A 2NQZA 4O1FA 3ZFHA 2YDAA 4CKQA 3LHZA 2ZWZA 3AXHA 3OEXA 1DXIA 4AC7C 1L6FA 1TV4A 1NU5A 3W6MA 1UP2A 3VKDA 2XSBA 4I7UA 3WFLA 1YPIA 4Q6XA 5E1QA 1R7AA 3EOSA 4LGXA 4PH6A 4LV9A 1RPKA 3W25A 4DVOA 3GSMA 1EPVA 4GHRA 1A0CA 2E1WA 4RE4A 4XUGA 2FFIA 3OLEA 1VD6A 4AWUA 1SQ7A 1WXJA 2ESCA 3UQNA 4HN8A 1CGTA 3R0KA 1KM5A 4YTUA 3C52A 3PZVA 3Q58A 1EPXA 1KBKA 2OQLA 1KV8A 1E51A 1KCZA 4IUGA 2C0HA 1XRVA 2V69A 2J88A 2OWCA 2QPUA 4XISA 2ISDA 3KDOA 1PDYA 2QIIA 2BFGA 2V3EA 4UR9A 4C1NB 2HNHA 2JF6A 5FD0A 3CT7A 2FLIA 3N4EA 4LF2A 4L64A 2QNEA 1XGEA 3KL5A 4M6VA 1EOKA 5F2IA 1GJPA 1C7TA 3ITGA 1FHLA 5AECA 5MKGA 5BU9A 2F6XA 3EYPA 5AVHA 3G1AA 2VTFA 4N9DA 1C8QA 1J2WA 3DERA 5AVNA 3KOFA 4UMBA 4NKCA 5TF0A 3SCOA 3OGSA 4X61A 1XIBA 3VIJA 4YHGA 1VLWA 3S42A 2YXGA 1M7PA 1OEPA 4QEEA 3GRIA 4CD5A 4RNIA 5CZKA 3QJAA 1X1OA 4KW2A 1C9WA 1ZAJA 1LL4A 4OUEA 5K9XA 1JZ3A 4PBGA 4HPXA 3EOLA 3W02A 2WXDM 3LU2A 4YTQA 2Z7KA 1NFGA 1QOPA 3W53A 1XXXA 3ID7A 3VM5A 2W91A 2OZ3A 1VGAA 2HE5A 4LYQA 2PMQA 2BXZA 4TMCA 4WKAA 1UR4A 3H2EA 3GLCA 3A4XA 3QOKA 4B5NA 4S3EA 1FHDA 4UQBA 3FJ6A 2Y85A 2PI6A 1W32A 3VDCA 2YYTA 3URNA 5JIPA 2V3GA 4P8UA 3R79A 4IOTA 1LORA 1CLKA 3PBWA 4UB9A 1KXQA 3C6CA 2YL6A 1J0YA 4AWTA 3MANA 5C2XA 3W0KA 4O10A 3OOQA 3UY7A 5E93A 2R1NA 1YEYA 4HHPA 1JCNA 3NXLA 2CLOA 4X2RA 3GR4A 1ZPTA 4QBXA 3DX5A 4W5ZA 1QK2A 2F6UA 1IR2A 2G41A 2WNZA 1UBPC 3MO7A 3W7LA 5AHNA 1JAKA 1A3WA 2GGIA 3LI1A 3ITVA 5I3HA 3P82A 3UPBA 4MY1A 2Y2WA 1TX0A 1R9XA 4F8XA 1XKYA 5HJYA 1H5VA 5CG7A 3VM7A 1TRIA 2PDNA 1XIDA 5FACA 1QBBA 4ZVJA 5AOUA 3KL3A 2GOUA 4CVUA 1V02A 1ZHAA 3M5XA 1X39A 2A85A 1W5PA 2HNEA 5HNRA 2GJXA 4N9BA 3T0TA 3LA4A 4PRWA 2DSVA 3FN9A 3W85A 1OK6A 2YA0A 4DN1A 2DT0A 4PCFA 3KVMA 3F5KA 5FJTA 1RV8A 3OHMB 3FOKA 4XBKA 4RXGA 3E0LA 3IRDA 2PLCA 3DBNA 4PSRA 1Z69A 4FX8A 3VNIA 3F2BA 1DXFA 3PM6A 2C13A 1WPCA 2J79A 3S1XA 4HHHA 2V5JA 4C6BA 1ZNNA 3VCRA 5D32A 3KTXA 3EEGA 3HGRA 2VOMA 4Z0SA 2G97A 4JGDA 3AYVA 4FF7A 2HVMA 1E70M 3UXAA 4URIA 2QDGA 2WHMA 4JL1A 2TMDA 3N4AA 3R25A 2ZA1A 1BSIA 1KM1A 3GDTA 4MJ2A 3WLJA 1F3EA 3M4HA 1LOSA 2NSOA 3TYCA 5A8PA 3NVTA 4ICNA 3GG7A 3IIVA 1NIUA 2B31A 2Y5EA 4KMQA 4H4IA 3U5YA 4IMCA 1FCUA 4ROPA 1E6ZA 3S2CA 4Z2GA 3H23A 5F4WA 5CBJA 1JPHA 1E4NA 3DFOA 3L7RA 4AMAA 2EPKX 4F2UA 2XYLA 1BQGA 1VENA 4FR6A 1TPB1 3PC0A 3ZO9A 1TYGA 1P5BA 2Y7EA 1JXKA 4GUIA 3VZYA 4XTDA 2ZBTA 2OJPA 3LLDA 1H1NA 4A6GA 4KGLA 2XVPA 3MUAA 4GBUA 2NXGA 2XIIA 1R3VA 2VZUA 4LTSA 4F66A 1UP0A 2Y24A 4O1AA 3WQDA 1HP5A 3SN0A 3ZT7A 4QLKA 3LCIA 3ZZ1A 4AW7A 4DYJA 1W3TA 3OZMA 2WC3A 1N2VA 2PGEA 3DCPA 3LQLA 4V1XA 1Q6CA 5FJOA 4DO4A 4GZJA 5I0DA 3WFAA 2NV9A 2CLEA 1SVDA 2Z00A 4Q8TA 3G1HA 3EA3A 2VR5A 4M1RA 4ZZ9A 3UESA 1XRTA 2OX4A 2VYOA 4Q4QA 4MWAB 2RFGA 5F1UA 3SFKA 3L4YA 4HP5A 3HMJG 3CTTA 1WXZA 1TR1A 1KCXA 4GWEA 1F76A 4DI9A 2MANA 3GTNA 3ITCA 3W7MA 1FP9A 1POJA 4ZO6A 4NJKA 4G1KA 3UZWA 1KXTA 3WLOA 1L6GA 2ZXDA 1WOBA 1K03A 4IH3A 1FH7A 3WBXA 4MJ4A 7A3HA 1FP8A 3JUGA 2A3AA 2J8GA 4KRZA 4LUTB 3CYVA 1UC5A 3NYZA 1A3HA 5D9PA 3W01A 1GVOA 5HR6A 1N8FA 1QW7A 2Z1BA 1OFBA 3U57A 2AQWA 3P84A 4C6PA 8XIAA 4F0HA 2D0FA 4D2JA 2X2YA 4IG2B 3H26A 1A5MC 1EH9A 2JIWA 3OJGA 3BG5A 1JPKA 2C1HA 5I3DA 3BZJA 3WF3A 3BMWA 3ITXA 4OUIA 4F0MA 5A6KA 1XIJA 3ABXA 3NNTA 5DY2A 1R30A 1TZZA 1X7IA 4TVCA 4UNKA 2BP1A 1DKWA 4DYKA 1H4PA 4ECLA 1LQ2A 4QAWA 3UG4A 3SECA 3VNYA 1W5OA 3VKAA 2PS2A 1UD5A 4YNGA 1XDMA 4WDUA 3U8GA 4R34A 1J10A 4PR4A 2CZFA 4H8UA 3AHVA 3Q65A 1OINA 5I77A 4YMZA 3H54A 1J79A 3GVVA 3L4TA 1U1HA 1KC7A 1PEZA 2EG6A 4YS1A 4JQ4A 3O6YX 3ARTA 2BMBA 4QROA 2OWWA 3LG3A 4WJEA 1RBAA 3SQLA 4H9XA 1G6CA 3QGAC 4AQLA 4DJFC 1WXYA 3PY2A 4EPKA 2FJUB 3UYCA 2QUVA 4X0VA 2WOQA 3TQVA 1FDZA 1GCYA 3IANA 1AUSL 4IQJA 2QJNA 2VL4A 4FOUA 5CQ1A 3WFZA 1Q7ZA 4ORIA 4HZ6A 4Q4MA 2C0AA 1KTBA 5AYZA 3R8RA 3ZQ9A 4LAOA 2WMJA 7REQA 1QW9A 5A95A 4ONVA 2PDWA 2UY4A 4WIWA 1O5KA 1EP3A 1L8NA 3I4EA 2OOGA 1YDVA 3U2ZA 4S23A 3N14A 1UC4A 1U5JA 1TZ9A 4Q33A 5K9DA 2VZVA 1KM2A 2XISA 4BJHA 2PDQA 4NZCA 4Q4OA 2F2KA 3VIPA 3KBMA 2PDCA 4J3TA 3BSMA 3AU6A 3SGZA 1OK4A 1TJ2A 4UFHA 3T9PA 1JXJA 3B97A 3CL6A 3WUFA 4DUWA 5HQLA 1KFKA 3A9BA 3QN3A 1W1B1 5TBOA 1R85A 1J0ZA 5DO8A 3IAQA 3R12A 2VI0A 2QGYA 4N9EA 4PE8A 4G7EB 3BTNA 1VC4A 4A3UA 4IJCA 3RLUA 4MNLA 4JNZA 5CC3A 3WLPA 5BYWA 3SCSA 1MW3A 1CXEA 1DPMA 3W72A 4A3QA 2ZICA 4O0QA 5D04C 4AIEA 4PGLA 1B90A 4N4QA 3NL6A 4FLQA 1PX3A 4K1WA 4R88A 1TVNA 3P62A 2QCDA 4C6IA 1WKDA 5TIMA 3V18A 1MXSA 3MSGA 2Q02A 1PIGA 1ADSA 4J4KA 3FV9A 3MUZ1 1Z9AA 5IHSA 4HB7A 3ALFA 3RU8X 1J0KA 5EFFA 3MUIA 4AVFA 1ISYA 4HNVA 1H7XA 3A4AA 3NO1A 5DFAA 1T99A 3GE7A 5EKYA 3EDEA 2D22A 3LCFA 2RH9A 4CQCA 4LT9A 1QWKA 5M3WA 4MSSA 5A8GA 3WNOA 4YTTA 3XINA 4L9YA 3SRFA 1T5AA 1PIFA 2O55A 3A23A 1OWQA 2P1FA 3WNPA 4HVXA 4G56A 4RE3A 4HYVA 2WMIA 3AISA 1CEOA 2CWNA 3BLEA 3NSNA 3DAQA 3KFTA 4P7LA 4IPNB 5CPTA 5CXPA 4CNTA 5DLCA 4L65A 2O9TA 4JHZA 4UTWC 4O14A 2JKAA 1VEPA 2EG8A 2OELA 4XAZA 3ZYZA 1P48A 1WBHA 1IIGA 4GFSA 3W28A 1XGDA 2D0GA 2PD5A 3B8SA 1SM9A 1RCQA 3LERA 3W71A 3ZSTA 2VGIA 4LC6A 5ABTA 3SQMA 2OQHA 4UTTC 2PWFA 5AYYA 2YSWA 4L6HA 1VJZA 1DJHA 3BLOA 3PWGA 2E9MA 2G37A 3HB9A 4UTHA 2ZX6A 4CQBA 4DBWA 5CLWA 3BW2A 1QWGA 4GFIA 5F2GA 4AD0A 3MY9A 5LKYA 1VFTA 1DJYA 3DHUA 4S2BA 2GYIA 4ML9A 1A0EA 1J0JA 2WKJA 2H8XA 1RY0A 4TXEA 4DWDA 1YE6A 3N73A 4D1IA 1Q66A 1HKIA 4LH8A 5KETA 1RA0A 2X16A 2FPYA 3R6IA 3MQTA 2FDSA 4DF1A 4HPJA 3TYZA 3KW3A 3WX7A 4ZODA 1HW6A 1UH3A 1K6AA 4RZ5A 2VCCA 3SUUA 4HIBA 2J74A 1TMHA 3CPUA 2ATSA 1W91A 2I9UA 3DIPA 2GVGA 4U33A 4HBKA 3SIZA 2A79A 3GHSA 3PUGA 3VUSA 3PFRA 1KGXA 3CU2A 3KBWA 1JQVA 3GVQA 4QRNA 3SURA 3FW6A 3GFZA 4NL1A 1G01A 3GH4A 4XSMA 4AXKA 1MW2A 1JDFA 3BSGA 3TNOA 4RNFA 1N8IA 4N9CA 3WLQA 1EZWA 3I7RA 5HJXA 2YB4A 1JPIA 5HXMA 1EKOA 3K8KA 1JNEA 2Z25A 1EQPA 3BAXA 2Y89A 3V75A 2NVAA 2DT2A 4GLEA 5CZJA 1U1UA 1TG7A 3AS3A 4RW3A 3U4AA 4IZGA 5JBFA 3QV9A 3UW6A 1E73M 1MMFA 5CGMA 2PU1A 3A6OA 1RD5A 3PZGA 3EB3A 2X2GA 1YNQA 1B54A 2BDQA 3RHGA 1V3IA 1Q8JA 3R58A 2P76A 4P61A 4P7RA 3GB6A 1SJDA 1XS2A 3GIYA 3W88A 4V27A 3TMLA 2ZXAA 3KS6A 2CFFA 1A5NC 1NVMA 3HBLA 4LYRA 3ZR6A 5BMWA 1NQKA 3T81A 2WSKA 5G2HA 2WLYA 1W9PA 3LGEA 4X0NA 3SRHA 3AOFA 3L12A 1UD3A 4AF0B 1XCXA 2GDQA 1PX4A 2OMAA 4WR3A 4QDMA 4GQQA 3VC6A 3VC5A 4IMDA 3SM0A 3PZMA 3WLHA 1VFMA 4C65A 1KQZA 2VOTA 1QJWA 6XIMA 3E38A 1EJTC 4FS9A 1LROA 3E2QA 3K4WA 1S3HA 5CC6A 3GDBA 4DPQA 4C5ZA 5CKSA 3TROA 3NZRA 4RKAA 2R94A 1Y7VA 4W89A 1P0KA 4KWSA 3WIJA 4P8XA 4PMQA 4F0KA 3LM3A 4ACZA 3P61A 1V8EA 2C6QA 3B9EA 1TIWA 4WSJA 1RLCL 3N12A 1PO9A 4BF5A 1R8LA 2GSJA 3DGBA 4JTTA 1QCWA 5BXTA 3HMCA 3HPSA 4PFHA 4PMOA 4UQ9A 4G1NA 5M5DA 4MJZA 1C8VA 4ERAA 4YVPA 4UTJA 3WENA 3SO7A 1LLZA 1XM3A 3BLIA 2PDHA 4RLIA 1RSCA 1WKEA 3TXVA 3URAA 3G0SA 2WMFA 4AHPA 3UZXA 2MNRA 3WH8A 4TU1A 3LHTA 4AEFA 3AZRA 5CZSA 3R94A 2REQA 1OX5A 3RO6A 4L7ZA 5T9CE 1W1TA 4WY0B 3QYSA 1VR6A 4CNUA 3L4VA 3BG9A 2QVHA 3RX4A 3M0MA 3O8AA 1EP1A 4IP7A 1BLIA 2R14A 1V4YA 2O9RA 4GYPA 5C2CA 3J7HA 1SR0A 3W1QA 4C7DA 1GQLA 2IQDA 2J62A 3MV11 2XH0A 3P74A 4LOCA 3F4WA 3S1GA 1F4HA 4R3UA 4FA3A 3TFCA 1JCMP 2VVNA 4HA1A 3FGCA 1QHOA 3SCVA 1WZLA 2OYLA 3EA2A 4ZEPA 1W3LA 3A3WA 1OT2A 4I90A 4DY1A 2J9YA 4JFWA 2J7EA 4XBJA 1HO4A 2WC7A 4E4FA 3WQ8A 3CWOX 5HPOA 1B3VA 1DBTA 1JPMA 5DRIA 4F0LA 2TSYA 3TK7A 3ZLGA 3TSMA 4QS5A 1GJUA 3F4DA 3AIQA 2X42A 2P5NA 4MLRA 2WCSA 2NZLA 4I9JA 4F2TA 1EOMA 4YU1A 3G24A 2PGFA 1TCMA 1F6YA 1AH3A 2WHJA 3MZ2A 1OCBA 4XD3A 1SZNA 3WLRA 2HQAA 2BWGA 1RPXA 4H9ZA 4BEQA 2DSZA 1GEQA 1G94A 4DELA 1DOSA 4EVZA 2VP8A 4NHVA 3E5BA 5GJNA 4O1CA 3THUA 5CBBA 3NL2A 4BEUA 1Q65A 2PWVA 2JGYA 4IIFA 1QNOA 3PJWA 5HA7A 1O95A 3N2MA 4KIEA 4DO5A 3IV8A 3QV8A 2WCAA 3ORWA 1Y5VA 3IPWA 2YCLB 2W5FA 4W9TA 2VRJA 5FSDC 2QCMA 3EGJA 1FCBA 3B05A 2F84A 4HPHA 4YVVA 2VFFA 3C2VA 3NQBA 2ASHA 1ICSA 4KBXA 4YWIA 2OCZA 2CHRA 4WOZA 3RO8A 3M6YA 4MFEA 2DIEA 4A8RA 5M17A 1P7TA 1IV8A 4Z1CA 4DZ5A 5JQ9A 4D6HA 1V6TA 1LG1A 3AZSA 2CU0A 3S5ZA 2ZUNA 4A3YA 1QNVA 4TV6A 1C3FA 4U2YA 3WY1A 2WZMA 2ZX5A 4DLFA 1UBSA 1UH2A 4Y9OA 3TTYA 3EPNA 4JFTA 3M0ZA 3N3TA 2VCAA 1PVNA 3CMGA 4M0XA 2FYMA 4B3LA 2VFHA 1A0DA 2VRKA 1TTJA 1KCKA 2A6LA 4MWAC 1JUEA 3VILA 4OBSA 3TDFA 3CEUA 2QQ6A 2PDBA 3LRKA 2AL1A 3KRBA 4XD5A 4FXJA 3W2MA 2PC8A 4BZYA 3OYXA 4N0RA 1J11A 3UZYA 1JI2A 1BPLB 3WQFA 5CJMA 2E7FA 2ACSA 2I57A 2G3IA 2PF8A 1XLCA 2CLPA 3GNDA 4GO9A 1H7OA 2Y7DA 4FNTA 1NJJA 3KRUA 5DBUA 3VDBA 2PCQA 2A7RA 3O0KA 2DQWA 4Y7EA 3MBFA 5D33A 1KFBA 4EOUA 3OG3A 2J8TA 2OO0A 2ANUA 4DWSC 4PMUA 2V5KA 1HGWA 1BG9A 3I6TA 3MA8A 1VYRA 3WUEA 3WMSA 3N25A 2QCHA 4J2MA 1SFJA 3GH5A 4DUVA 1DQXA 2DY3A 2QV4A 3PG8A 2CBIA 1YPFA 4M24A 1X38A 3KAOA 4D72A 1SSDA 4B2DD 1PZ1A 2B4GA 4K8GA 2PP1A 1J6OA 2FIQA 4UOJA 3MU7A 1Z89A 3B8IA 4FR1A 4E0CA 5MKGB 1T6MA 3M0YA 3WMBA 4JD4A 3A47A 2OKOA 4H6QA 3UP8A 3GTFA 4O1EA 3FJ4A 1J18A 1ECQA 4V1YA 3AYSA 4YLWA 5E6YA 3OVPA 2FHBA 2OT0A 2YB1A 3SN4A 3GUGA 3IK4A 4IXXA 1MYRA 1S2AA 4K8HA 2OSXA 2ONEA 3W2NA 2DSKA 3VGDA 3VE7A 3K8LA 4WEVX 4UQDA 4AZ5A 4JIPA 2XPKA 4MWAD 3MI2A 7TIMA 3TC3A 3U3HA 4CNOA 4TQTA 3HG2A 1P6WA 1IXOA 4AY1A 4Q8WA 3CO8A 3MI3A 6ENLA 3VNLA 3PAOA 4LALA 3S2LA 4Z2IA 4GISA 1XKJA 3SR7A 2W9MA 2ZX7A 4HU0A 3EKGA 4C6FA 3EWDA 3MHFA 1P0NA 6CGTA 3OHIA 4AZGA 2OZTA 1JAEA 3T0CA 4G6CA 1EO5A 1IEWA 4PRTA 3TQKA 2VD9A 4YCOA 2C19A 4M6QA 3BCDA 1OD8A 1TO3A 2DJLA 4IIDA 4NZJA 4QCEA 2POZA 2OODA 3WN6A 1P0DA 1RHCA 2CLKA 1DWHM 2E25A 1POKA 3WF2A 3W1PA 1UPMB 1X6LA 4X22A 1J0IA 3IWPA 4FXFA 1M68A 5I78A 1R86A 4UMAA 4IGNA 5FJIA 2OPJA 4ALDA 1EQCA 3AROA 3PB0A 3I68A 2GDUA 3IGUA 4IWWA 2WPBA 3QPYA 2ZRXA 3UR5A 2J4GA 1PTAA 3DFHA 3IJ6A 3GG0A 3IJDA 1T96A 1E56A 3IVSA 3B9OA 1EXPA 1ODZA 1HL8A 3AXMA 2PLJA 1M1BA 2QZRA 2PDKA 1WDWA 1RK6A 4FK9A 5CLTA 1B5TA 1M7OA 1MQPA 4DEFA 3ZJKA 2QV5A 3M0JA 4PUUA 2PDMA 3UWUA 3WDIA 3NAVA 3OLDA 4Q8PA 4ZSUA 4PULA 2V30A 3LBMA 4I9TA 3NZQA 4PUDA 1NDZA 1OJXA 1PB0A 1OF8A 1KWGA 3GXIA 4UFKA 1LWJA 4MNJA 1V0LA 3NGJA 3V1HA 3S1UA 3JZEA 2WVVA 3MMDA 4IPLA 3RLVA 5IOBA 1HT6A 1RA5A 2GJXB 1WA3A 4H2CA 4Z1AA 1UMYA 3R8HA 3AU2A 3FSUA 3LY0A 2QCLA 1DIEA 4QG8A 3P14A 1R3YA 5DY3A 4GXWA 3MP4A 4TUFA 2PDJA 1Z8AA 1DIDA 4Z17A 2OGJA 3ECQA 1KFWA 2YFOA 1LWHA 3EKLA 4JL2A 2QAFA 1TJ1A 2WSPA 3BLFA 1GOXA 2Y70A 2QF7A 2PODA 3PJXA 1F7BA 1S5MA 3UPMA 3A22A 4CN1A 3PP7A 3ARXA 1Q6GA 2INFA 1OFDA 1QK0A 2Z29A 5F1VA 3W2LA 1XINA 1DTUA 3W7DA 3VNDA 3O6AA 5GQBA 1XBZA 4AVNA 2DIKA 4AG0A 1GORA 1TPEA 1EDTA 1OFQA 1JZ7A 1B3XA 4H7CA 4TIMA 5BW6A 1WE5A 1GOQA 1JYVA 3ARWA 2VZOA 4MYAA 3CH9A 3ARPA 2PDYA 3QMRA 1XF0A 1UWAA 3QZAA 2NLYA 1OIMA 1ZQ5A 4LCQA 3CIXA 4WQ6A 3W4RA 3CZEA 3NM3A 3LEPA 1O6IA 4JY8A 4GX9A 1CXKA 4BQ5A 1EHAA 1EJXC 1SPQA 1DHPA 1M01A 2H9AA 4JTQA 2V3FA 1G67A 4H9VA 4GK8A 4LU0A 3TP4A 1LL6A 1X8FA 4XBSA 2OGYA 2BHUA 2WM0A 3DFYA 2EPOA 3FJLA 1VFOA 1SJAA 2G4JA 3WELA 1DP0A 1RBOB 1H50A 3O06A 2UY5A 2CCRA 4I7WA 2AMXA 5DBTA 3W37A 3KHDA 4C1NA 3DC8A 3G1FA 1GHSA 2NV2A 4NNAA 1XYLA 3TW9A 3GWQA 3WZ0E 2RJGA 3S83A 3OQ8A 3VIHA 4H8HA 1LLWA 3SCRA 1W1IE 2HPMA 1J93A 4Z1DA 4S3GA 3ZSSA 1AD4A 4DJDC 1W1VA 1Y5XA 1W3NA 1E6RA 1BYBA 5GNXA 1YXCA 3CMJA 2DFAA 1UIOA 5B80A 4OIFA 1FUYA 2VFIA 3BW4A 1YQ2A 5BRQA 3T07A 2PUZA 3U2CA 3UCDA 3HG3A 5HULA 3NM1A 4GIEA 3FHAA 4EF9A 3DENA 2F38A 2QDHA 1PDZA 3VVGA 1GZJA 3OYZA 2XIOA 4QEHA 3GZ3A 4F4RA 3T0BA 3QBUA 4RPQA 3PUOA 1RCOB 1YE4A 2E8ZA 3L0NA 5DXYA 4AXNA 4XSLA 4ADTA 4X2PA 3S2JA 2BASA 4FIRA 4CU7A 4WLCA 1Q5MA 2HZGA 3W87A 3N34A 4HT3A 4DAFA 1DXEA 5AZ0A 3W82A 4GUGA 5A6BD 3F5JA 1XCFA 3V7PA 5LNSA 3M7SA 4RPPA 3SJ3A 3WJWA 4BWLA 3UJSA 2PDLA 5EB8A 1R87A 2VGBA 2VD8A 1NWTA 2GQ8A 3LLXA 3M41A 1UUQA 3CTLA 3V3WA 3JVAA 2ATMA 2G96A 2W66A 4Q3MA 4W8LA 1YLVA 1E6QM 2WZTA 4C6EA 4MUPA 4FSAA 3CAVA 3E5PA 3TJIA 5AHLA 1V79A 2B7OA 5FEXA 1E9YB 4H2HA 3KOZA 3WH6A 3GBDA 2XGIA 4HTYA 3CUXA 3HU7A 4DJDD 4WOQA 4B91A 5EMMA 1ZS2A 4V33A 4JTDA 3LTYA 1E0VA 2PLKA 3KTSA 4BQ2A 5D03A 3SIMA 4DJEC 3HOJA 3VD9A 4HNUA 3W27A 3N13A 3T0AA 3LENA 4KEMA 1KTNA 4MZYA 1ME7A 3UVAA 4JTJA 1SO3A 3AUJA 4D6FA 5M2FX 4U31A 1O68A 4Y90A 4DUOA 3OQEA 2PPGA 3CIWA 3CQKA 4HOWA 4LEFA 4GO8A 1E1CB 3M5YA 3SRDA 2ZUVA 3TA6A 2D20A 2H3DA 4KIRA 3UWZA 3LX9A 5LIYX 1TSIA 5CCZA 1B1YA 3DFQA 4IF2A 4FHAA 2DGAA 1XG3A 2XJ7A 4CCCA 3L2LA 1KNWA 2WMHA 2J7DA 4P7OA 3ZS4A 1PL9A 2PSNA 5LIWX 4Z2KA 4JR5A 4ICMA 3W2UA 3MKVA 2Z1WA 3SSJA 4O16A 3KRSA 2BX7A 3VA8A 3NQCA 5E9AA 4C60A 2NXHA 1S3TC 1EA9C 1IZJA 1CGWA 3ME3A 4PB3A 1I45A 3TNBA 3G0UA 3T8LA 3L23A 5CC7A 4MB3A 1ZCOA 1L9WA 4PTMA 1EYEA 3EOEA 1Q13A 1R3RA 1W56A 2V82A 5KSWA 3M9YA 4DNMA 4DPPA 5H1WA 3U6WA 4BA0A 3W00A 1IYXA 1V08A 7REQB 3WJYA 3R43A 1EXBA 1MUMA 4OOZA 5E09A 3LNMA 1XLHA 3NJ3A 2X0YA 4K68A 2NLIA 4IMAA 4MG4A 1E4LA 1E9IA 3QTGA 4XWUA 4LVGA 3MVTA 4NIRA 4UUIA 1R2TA 2PWEA 4OE7A 1TR9A 4F48A 3THCA 1K1DA 3W1XA 5FEPA 4C6JA 3EWZA 4IIBA 1DV7A 1J01A 1VFUA 2OOFA 1TFVA 1NF7A 1OCNA 3VIKA 2V0TA 1TV8A 4K37A 1R2SA 3HV9A 1JYXA 3S9IA 1VPQA 5ENLA 4M6PA 1QI3A 5C9UA 2Y61A 3TN3A 3MCMA 4QP0A 2HE8A 1V7AA 3LNPA 4EF8A 3LHWA 1NOWA 3BPWA 3AIWA 1DJZA 5FI8A 1NWSA 4LRSA 4GMEA 1WDSA 1VFSA 2YX0A 4WJ8A 4HK7A 3WD1A 3WQCA 2PZ0A 5K7JA 1R3TA 3DG6A 1KRCC 3A4WA 1WDDA 2QYGA 2W92A 5BZAA 1RCXB 3RX2A 1NDVA 5LIUX 4GQ0A 1QMLA 1YADA 3AALA 4CU8A 4D6DA 4B2DA 2PD9A 1PZ0A 2KZHA 1A5CA 3HO8A 2NQ9A 4UR8A 1OG0A 1R9YA 5IHRA 1K7XA 3LPGA 3AMCA 5B7ZA 1GNXA 2ALRA 3HA1A 4HD5A 5ECVA 3LN3A 4BK9A 2WMIB 1AMKA 3UFYA 4CEXC 1B57A 1T7LA 2DV0A 3PSWA 2J25A 4IT1A 3UXIA 3SQSA 3APYA 1NDYA 2VEPA 3BAWA 1MFUA 1HN1A 1CB2A 3EB2A 4LW7A 4NZ1A 2EO7A 4Z08A 1PE1A 1CZ1A 3W7EA 2GDVA 2NWSA 3FVMA 1B4EA 3QR3A 4MAZA 4NVTA 3M47A 1WNOA 3U5UA 2RDWA 4MB5A 4PSPA 1G5AA 1R3QA 2Q8ZA 2Z1VA 5ABFB 2ACRA 3NPUA 5HNTA 1DJWA 3AYTA 4HCDA 2WC4A 3CHVA 1PYFA 3GVWA 4FX6M 1L2UA 3VOCA 2E68A 3RU6A 1I9CB 3TSBA 1G4PA 5AC4A 4GUHA 4DF0A 1XGZA 3U4FA 1SR9A 1M7JA 4PODA 1ONXA 4H8VA 4L9XA 1V03A 1G9HA 3GHUA 3IIPA 4YHEA 4RDYA 3FJNA 3RLHA 4IMGA 2FZNA 3TAOA 3AHYA 4W86A 4EX4A 2ZZ1A 4XO7A 1WDQA 1E0WA 2CNCA 3WUBA 1I2NA 4CLMA 3F7JA 1V3HA 3RPMA 3ICJA 3TTSA 3QMTA 3HF3A 1X6NA 2YA1A 4KS0A 4BI7A 4D1JA 3OVGA 2DDXA 1OB0A 1EC9A 1QO2A 1C92A 4F0RA 4IICA 1PKLA 1V3KA 1TA3A 1GOOA 4JTHA 4N7QA 4AAJA 4Z1YA 3IIZA 5LXXA 3H2MA 4W4QA 1YHTA 3S2NA 4G9PA 3E12A 1HJWA 3T44A 5RUBA 1OSEA 4CNPA 3N6HA 1KFCA 4QGCA 3M1ZA 3NQAA 4WXZA 2Z1XA 2HRWA 2G95A 3SAZA 3W22A 5BMXA 4AD4A 4G5DA 4JEQA 1XC6A 1XSJA 3IGSA 2YL5A 5LNWA 4HNTA 4O57A 4OVXA 4GJ1A 1JUBA 4DXVA 3S9YA 5C54A 5HUOA 3POHA 2OT1A 2EAWA 2DW7A 1TMQA 4LS0A 4PUKA 1OC6A 4Z1BA 4QQUA 3HJZA 3QVQA 1FOBA 1KGUA 3PZIA 3S5YA 1Z48A 4DBUA 1LUCA 2HV5A 5EMKA 3UWQA 1IWPA 3W7JA 4QJ4B 1QAPA 1JFXA 2WJEA 1KFEA 3CV1A 3HQ1A 3UWVA 3PBMA 3VNKA 3IUIA 4GQRA 4NRSA 5I3FA 4EWND 1V7YA 1X1NA 3BJTA 4JFUA 1E6PA 4IIGA 2BOGX 1KKRA 1LF1A 4H9MA 5I3IA 1ZBVA 2QPSA 4J2PA 4XZWA 3AMKA 4D6IA 2RDXA 5DMNA 5EMUA 1KKOA 1NEYA 4FXSA 2E1DA 5H2ZA 3CHFA 3VMOA 3STFA 4W5UA 2ZDRA 3R89A 4ACZB 2XSXA 4GZIA 3L66A 1XRFA 5XIAA 5FEZA 1E9ZB 1A5AA 4JKMA 1SW3A 3NSXA 3ANVA 1R7OA 3B8WA 2PTWA 3WK3A 1XG4A 4EXQA 1U5VA 4GGHA 4NX0A 4DBEA 2FTWA 3C2RA 3K8MA 4LF1A 2GJLA 4HNLA 1OBAA 4ZXOA 2AOSA 4MYXA 2UZ9A 2F7FA 3Q37A 1DWFM 1A47A 1U5HA 2REQB 5K9CA 1AH4A 2O7QA 5I23A 3G18A 4PMZA 1QRQA 4LANA 1OQFA 1HXJA 4UNLA 4HA4A 1V3JA 1L6SA 4NY2A 3RFAA 2VX4A 4HGXA 4JEJA 3RXZA 3NO5A 3PTDA 2VX7A 3PWAA 1XX1A 2J6XA 1XD1A 1KB3A 4HZ7A 2NSXA 1N55A 3RLGA 3NDYA 2EKGA 2NQHA 2BOEX 2VDGA 1E71M 2PDFA 3N18A 1K9FA 3FGCB 2XIBA 1CYGA 2JEPA 1A5UA 2Q3RA 3G8RA 4NZ3A 4E4PA 3WF4A 3HGSA 3W26A 1VZWA 3CZGA 2VENA 1TE6A 1GQKA 4OWGA 1NWUA 3QH2A 4TTUA 2I14A 2WJZA 3LHUA 3AQUA 3R4IA 4WGHA 2ZTKA 1B3YA 4YCPA 1XYCA 2WCGA 3U7VA 1DIOA 2H3BA 1DJQA 1KM3A 2XSAA 3FYOA 1C7SA 2DH3A 4OECA 5A6AA 2BB0A 2QULA 4GJJA 1WUFA 4C1KA 1N7KA 1ZJBA 2WJDA 3QQWA 2E5CA 2JKPA 1JCXA 3VMNA 3PS7A 3A5VA 3H2AA 3VDGA 2PLMA 3AAMA 1Q85A 3TE9A 2WLZA 5GNZA 2BY1A 1I2RA 4GNVA 3E96A 4S3FA 5IM51 5A6BA 2XG9A 1EDQA 3BJFA 1MEWA 3O05A 3G1RA 2XINA 4GZ7A 3QFWA 2FHFA 4A4AA 2AQVA 5BU6A 4Z42C 1VPYA 1E6XM 4UOZA 1OVDA 1DJXA 3CM4A 1ALDA 2LLEA 2HMCA 4P2VA 3H8AA 3TOYA 1US2A 4JTSA 1M7XA 1V6UA 2YDRA 2BV9A 5HBFA 3UGVA 1CXLA 4US6A 3VX0A 1H1ZA 5I07A 5H8PA 3PJUA 4X60A 4B5WA 1BTMA 2EG7A 3GDRA 1VH7A 3W1LA 3FYYA 1P7TB 2ACQA 4QLLA 3UR7A 2C91A 1IE7C 5E0FA 4DZHA 1AJ0A 2HISA 7XIMA 1JRCA 1WDRA 5HQMA 4P7NA 2E5DA 4PTVA 4GIAA 3W07A 2FJKA 1XPGA 2WVSA 2IQ0A 2E09A 3OZPA 2GVEA 2HTMA 3GU1A 1WP6A 1XRSA 3UZZA 3WDPP 4TV5A 1EWDA 1CXFA 1K4GA 3LQGA 2DVTA 4DUXA 1FWSA 2WMKA 4DX3A 1HKMA 1KBIA 2R9RA 3K4AA 4XVDA 1R3WA 3PANA 2E6DA 4TVUA 3IIXA 2PBGA 2FZ8A 4I6VA 1H0GA 4J7RA 4A3RA 2A3BA 3B40A 3ZJ8A 3H2OA 3NR0A 1NSJA 4LFYA 2J9XA 1XDLA 4BI5A 2CBJA 2HBXA 2P8CA 1OF6A 2Z1KA 3ZIZA 8XIMA 1V3MA 4JAWA 2GK1B 5DCBA 4CU6A 4AB4A 1KA9F 2V3DA 2WZEA 3LHYA 3C3UA 3TJ4A 2PDPA 3HURA 1EC8A 1W1PA 3PHAA 2E77A 5JBEA 4AF0A 3CB3A 3KCLA 4IUOA 1W5MA 3TIMA 3I7QA 4ZB5A 2VUNA 3AS0A 3PJTA 5JUVA 3LV5A 4P5UA 3KM8A 4ZO8A 2TAAA 1N8WA 1REQB 5D9MA 2YZRA 3KE0A 4KCUA 1AJZA 3NIYA 4ZE5A 1YBQA 3RMEA 4GE8A 2QT3A 1UPPA 2OLSA 2A7PA 1QOQA 3C8FA 2QUMA 4H04A 1U83A 4GJIA 4GY1A 1PS9A 1SU5A 3DOPA 3NQ6A 2W62A 4JX4A 3CV7A 3DI1A 4JIEA 2Z4GA 4FOKA 2Y8VA 3B8TA 1B3WA 4NAFA 3ANUA 1GVIA 1KR0A 2ZQ0A 1ML1A 5HPCA 2XHYA 3IJ7A 5D05A 3KZSA 3LCGA 3TYAA 3H12A 1BG4A 1HG3A 2Y62A 3H6OA 2CW6A 2Q09A 1MUCA 3DHFA 1HKVA 4Y8EA 2ISVA 4I9AA 1IIHA 3GG1A 1HO1A 2OSYA 2I5QA 3RK8A 4BF9A 1TB3A 2XM2A 2EXOA 1FWNA 3UEQA 1CWYA 4FNSA 1QNQA 3UY8A 4WUIA 4E2VA 4H6EA 3EX6A 4UTIA 3GY1A 1HX0A 4HNOA 1K8CA 2GFTA 1KQYA 1LLOA 4Q4PA 3O2LA 4RR4A 1SO4A 1MXGA 3TVAA 4XTIA 4C6MA 1IGWA 3GU2A 2G5WA 4JOMA 5FL0A 3GDLA 4U3CA 1RZMA 1TWSA 1XIEA 2YFNA 3TTEA 5BOOA 3WLKX 4WZHA 3RILA 4B4HA 1XLGA 5LNUA 2CESA 3NFUA 3HFTA 2YW3A 4Y9AA 3KLKA 3EDKA 1MQRA 1OY0A 1LCOA 3FKKA 5AHEA 4UTWA 1K7EA 3VKKA 1A53A 2YXXA 5DMMA 2X40A 5ABGA 1XISA 3NL5A 3ZR5A 2XN0A 2OG9A 1J9YA 3O0FA 1DQWA 3LS9A 1DWIM 1X7FA 3S9ZA 4C1LA 1TVLA 2J78A 3DH7A 5D09A 1Q4WA 3SSZA 3EX4A 1YDNA 1JFHA 5EA9A 1GG1A 4HYWA 4UTTA 5I3KA 1IT8A 3T40A 3VMPA 1GYNA 2ZUMA 6REQA 4IMFA 1OX4A 1PSCA 4CD6A 5HOSA 1X6UA 2R8WA 2W0UA 3QQ0A 3R0UA 1U30A 1XLFA 1LQAA 2V67A 4GABA 4QNEA 1XQKA 2V9DA 3M16A 3P60A 5H8UA 3PZQA 4R7OA 4FNRA 4TVDA 3W7CA 1E3ZA 3RPTA 2HJPA 2X1SA 1HUVA 2WVVB 4W8BA 5D2XA 4FIQA 1GVYA 5DF0A 2Z28A 1OT1A 1GG0A 2ICSA 2DZWA 4UQCA 1F8IA 1CBGA 3LZ3A 3MB9A 1R3SA 2WZHA 4UTUA 2E5BA 4DZAA 2WKGA 3RYSA 4GA8A 1CI1A 3TH6A 5EPDA 4XQ6A 2J24A 1XPYA 4S38A 1WZAA 4EXAA 1ISVA 2P3EA 2A4AA 3C56A 1FDYA 3ZVHB 3E02A 4ZOCA 4G8TA 4NNCA 1PZ2A 1ITUA 1K70A 4DZIA 1KGWA 4DNHA 1IHIA 5EBAA 1HNYA 3C2EA 3CS2A 3DECA 3ZJ6A 4XAPA 1EDGA 2DJXA 4KWOA 1ISWA 4W8AA 2YLLA 2QR6A 3SCPA 1YTEA 1OYAA 3L0KA 1S5VA 4LUIA 4GY0A 4B3ZA 3HV8A 1Z7AA 4I8YA 2QUNA 2NVDA 2ABAA 2J7FA 1AW5A 4CD8A 3HIJA 2QDEA 4RK8A 3O6CA 1WV2A 5FA5A 1DTNA 3U48A 2XZ9A 3K1GA 2F2HA 4MY9A 2ZZ7A 2X09A 2FHCA 3AWOA 2XFFA 3LMZA 3WQGA 4HHLA 2X8RA 3WBYA 2V5CA 1IXQA 3FEMA 1GOWA 2H9AB 3UVIA 3KHJA 1W3IA 4LV4A 3SI9A 1VCFA 2NVCA 3II1A 3BV4A 1Q7MA 4LS2A 1X1ZA 2PWHA 5DN1A 3G8EA 2D23A 4ZO9A 3GNNA 3RIKA 3R5EA 1GZ1A 2X1TA 4M51A 3PN8A 1EEPA 4CQAA 1TE1A 4JXCA 3R7MA 1N82A 5LGXA 1ICQA 1W9XA 1TV2A 3WLLA 3C2FA 3CZLA 1BF6A 1VFHA 3VDHA 1QUMA 1U22A 3R11A 1W1A1 2X0SA 4JN7A 1V0MA 1XLBA 2C7FA 1H2JA 1WYIA 2PAJA 4JICA 4S3KA 3ZT6A 1DVJA 1RLDA 4R7WA 4GQGA 5CPMA 5LSMA 4GI8A 3NZGA 1NF0A 1BVZA 3UR8A 1J4EA 4IFKA 3G1DA 1W31A 3KS5A 1VBGA 4QM1A 3KOWA 4WY0F 2ODOA 4AZCB 4DBSA 3AS2A 4S3BA 3C5QA 4K6AA 4CNNA 3KX6A 1W8GA 4JS3A 1LBFA 1O5RA 4WKFA 1KM0A 2INEA 2PWDA 3RM8A 3KBJA 5C8BB 3SW6A 1ZZMA 3H55A 4OHQA 2JKEA 2E9BA 3MMUA 3F1QA 5GPRA 4YN5A 4AX6A 5DELA 3PULA 3AUOA 4ZFMA 2EBNA 3EXTA 1JEZA 5LYRA 3IVTA 4PMXA 4KWVA 1TTQA 3E1F1 4D6EA 1UWRA 3VCCA 1VF8A 2I17A 4MLJA 4ROQA 5CSRA 1UOZA 4Z2HA 1RP8A 5LXEA 3B8VA 6TAAA 1F73A 4JYFA 5HUPA 3T09A 3M46A 3H53A 3GC2A 3R13A 2Y1HA 1XH1A 5C7VA 1MO0A 2WWCA 3CH0A 3C0JA 3CQ0A 4HJFA 4PMDA 2FVMA 1J96A 2XWDA 4GQBA 4JHOA 1RBLA 3V5FA 3CLMA 4XO6A 3NZPA 3RDKA 3BAYA 3IJQA 4RV3A 2A1YA 3WQPA 3HPFA 5FF4A 2PGWA 3FDKA 7CGTA 2O0TA 1H11A 2H6RA 5A2CA 2EPLX 3OBAA 1BSLA 5CPSA 4PMVA 2VNCA 2AQOA 4H1ZA 4GNKB 4B16A 1C90A 1JR1A 2DSUA 3GU9A 3IS4A 4DQWA 1TPWA 3W84A 1Q4NX 2AL2B 2OWXA 3OODA 4KWWA 1B3OA 1Q63A 1MW0A 5FJJA 4O4WA 1H0IA 4YTRA 2QVNA 4PEEA 1NH6A 1QVBA 3BICA 2WWDA 1SJBA 5KITA 2C1IA 4MFDA 1RD6A 3GXMA 4AZ6A 1P6CA 2DZPA 3LTPA 3KP1A 1DWGM 4LUYA 4GX8A 4FALA 5IFPA 3W29A 1J0HA 3TCEA 3MHGA 4KF1A 1K7FA 4S3AA 5D38A 1EJVC 3UA3A 3LBOA 4OTKA 2VMFA 2OR2A 4JQAA 4REQA 1EJUC 2I7GA 3IJ8A 1D9EA 4YVXA 3OA3A 1H09A 4GH1A 1TWZA 2VGGA 1V6YA 2X1IA 4J3SA 1CXHA 3VABA 1UWIA 2PWGA 3OW1A 1F4AA 4NJHA 4GC3A 1TX2A 2WQDA 2WNNA 3GYCA 1R5YA 3DBPA 1UWSA 4L4LA 1OFAA 3M0LA 3SY5A 2V63A 1JULA 4WKHA 3AJXA 4HMEA 4IL0A 1EBHA 3K4DA 4JTCA 1RY8A 3VU2A 4K3ZA 1WZMA 2Z6IA 4RDWA 3LM7A 2IKIA 3O1NA 1E43A 1GTEA 2UWFA 4C6OA 4UR7A 2OZ0A 4JKLA 1MEHA 2WYSA 4AZHA 2VR4A 2QPXA 2W79A 3VNMA 1M65A 1RQEA 2VFEA 3FA4A 4Q8OA 3ABSA 3T7VA 1FXQA 5PTDA 2BNJA 3VGHA 4U28A 2PDXA 4B5VA 1SFSA 4F2BA 4LBRA 1QHZA 1SZGA 2X1UA 3WD2A 1E6NA 2HK0A 1O1ZA 1KWKA 4JHMA 1LM1A 5FAJA 3QC0A 5CPNA 2XN1A 3TZFA 4C91A 2XGZA 3KOXA 1XW8A 3KUMA 5CJNA 4CQ8A 1MDLA 3PTMA 1T0OA 3ISIX 5A94A 1D8WA 2I16A 5LA1A 3AMLA 1T41A 2C1GA 4DWSA 4Q8VA 5AHIA 5AC6A 1TMLA 3HQPA 3T2QA 3AIVA 2NQ5A 1EUNA 4ADSA 1LOQA 4ZBCA 1JCTA 1AZ2A 3P81A 1PCKA 5FJUA 3OVRA 1ZTVA 1ZSXA 2ZOXA 4RZ4A 1ZJIA 1EIBA 1FKXA 1IT0A 3L5LA 4PBEA 4FZIA 2WQPA 3NO3A 1B31A 1CGVA 4GVGA 3L2IA 2E8YA 5I3JA 4X63A 2XFWA 4GVIA 3EDJA 4C7FA 1TPFA 4UBPC 4ZQRA 1WCGA 4D71A 3KDNA 3NCOA 2VC5A 4XUYA 3MUY1 1YXYA 1BWLA 1LRQA 2JFEX 4ADUA 5AY7A 2BZNA 3CUJA 1OABA 1W0MA 2EQDA 3VZXA 1FWBC 2YKKA 4PA8A 3AS1A 4AIOA 3PBUA 1UOKA 1KM4A 5CPOA 4ASTA 3N04A 4C90A 3HZ3A 1JD7A 2I5IA 2XH7A 3QSRA 3Q2DA 3BE7A 1V3LA 4L6DA 5CPQA 2ZZ3A 4J35A 5FF0A 4PZVA 4KFNA 4H19A 2FDMA 3C2OA 3OLGA 4PTXA 2WHLA 2X41A 2CYGA 4YJ5A 1MDRA 2GL5A 3O6DA 1UYQA 3DKJA 3W1TA 2BG5A 3CJPA 3TN5A 1BAGA 5J04A 2XZ7A 3WD3A 5DXXA 5CH9A 3NG3A 3EB4A 5GVJA 2C3ZA 3V4BA 1A5LC 3TJXA 1ZY9A 1AW2A 1OYCA 4GXMA 3HPXA 1J8VA 2C71A 2ACUA 4C6KA 1EJRC 1UWUA 3FYPA 1CXIA 4V28A 1S1RA 4F3HA 3ATYA 4XIAA 3GBEA 3THAA 2VDHA 3THDA 3WBWA 2JIEA 3QGVA 1BGGA 4J3WA 1R2RA 1J5SA 1SFLA 4RZ6A 4CCEA 1ZBCA 2ISWA 3CYJA 5G4WA 4MKSA 5HMDA 3IJ9A 4LY8A 1GKPA 3SUWA 1TA3B 4ZFCA 1P1XA 4NILA 1UR0A 1ME9A 3UBPC 2OU4A 1VFFA 3A4JA 3CAQA 4EPDC 1I75A 2ZDSA 4HSNA 5BRBA 4AD2A 4OJYA 3N17A 1VEMA 4IFOA 1E1CA 1X98A 4FLOA 1S1PA 3MWCA 2EPMX 2A3HA 4JIHA 3K2GA 1NOUA 1UW9A 1GEHA 3CV6A 5A1AA 3U2EA 2IUZA 5A8OA 1Q7QA 4HOXA 5C9ZA 3IJIA 4JX5A 1FHUA 3W83A 4MOZA 1O1HA 4PUNA 3HPAA 5LIKX 1UB3A 3QW3A 1H7NA 3S1VA 2ZA3A 4US5D 2JQXA 4BQ4A 5BRPA 3POCA 1LUCB 3P93A 1I0BA 5EYWA 3V5CA 3SDOA 1M3UA 4HA3A 1M9HA 2D2GA 4W7VA 2FZBA 3IAPA 4Q7IA 1EB3A 3TOPA 3WEZA 4BS0A 2E6YA 1BVNP 1YYAA 4R53A 2CZ5A 4LVBA 3EXSA 3FIGA 1HL9A 3S8HA 1GW1A 4WCJA 3L4ZA 3G0XA 3G1XA 3CLWA 3CHDA 1VIZA 2IPJA 3JR2A 5A6JA 1IT7A 1TWWA 3AI0A 3W74A 1ZAHA 4JZ5A 4LRTA 1TCDA 1KR1A 4D6CA 3KCJA 1ZL1A 4HCHA 5FL1A 4I5XA 4IP5A 4RE2A 4LVFA 1HFBA 3QQ1A 3RUBL 2DZSA 2XTKA 4DB7A 3ITOA 1ONEA 3MO4A 3GG8A 3E9AA 2DEPA 3V5OA 1ELSA 1H49A 4UOQA 2C16A 3B9DA 3CV2A 4EK7A 4NZ5A 3LZ5A 3F4CA 2IMRA 2FTPA 3DXIA 9XIMA 3W7KA 2B7NA 3N6QA 5A8QA 3S2MA 3HQNA 3TX9A 1B30A 1QFEA 1Q6OA 4Z2LA 4W93A 2OYMA 2WSQA 2ZRWA </