The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
195
|
structure length |
188
|
Chain Sequence |
DRTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb |
| molecule tags |
Replication/dna
|
| source organism |
Plasmid rsf1010
|
| molecule keywords |
Replication protein B
|
| total genus |
57
|
| structure length |
188
|
| sequence length |
195
|
| ec nomenclature | |
| pdb deposition date | 2009-04-14 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Single alpha-helices involved in coiled-coils or other helix-helix interfaces | Single helix bin | ||
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
