3H25A

Crystal structure of the catalytic domain of primase repb' in complex with initiator dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
188
Chain Sequence
DRTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein B
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
molecule tags Replication/dna
total genus 57
structure length 188
sequence length 195
ec nomenclature
pdb deposition date 2009-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3h25A02
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h25A01
3H25A 3IN6A 2P10A 2G8YA 3O6QA 1FDIA 1FDOA 1WMKA 1ZMEC 1OMIA 3EWKA 1AJYA 3H20A
chains in the Genus database with same CATH superfamily
4HH2A 3T97B 1Q7YQ 1WUUA 3AXKA 1M90T 3LP2B 1X60A 2J5UA 4Y2MA 3ET6A 3IGVA 3TSIA 4DSIA 2FYXA 4NLRA 1CJUA 3CJ5A 4O44A 3EPIA 2A1BA 3L35A 4U7UK 5B0DA 3K5PA 1TK0A 4O3OA 4DU8A 4TU9A 2EEYA 1N7SA 1C1CA 4B17A 3E1RA 1N5QA 3Q2TC 3EXCX 3NMRA 3L37A 2G1DA 5LXRA 2KXPB 3A0BE 1PP9G 1JMMA 3HSJA 2QL7B 3FKBA 4RW4B 2MXYA 3K57A 2WVRA 2FVRA 4B9VA 3I56S 1V3RA 3RU0A 1J27A 2HHHF 1YRUA 2JVRA 1PC4A 3GFYA 5KFVA 3OSPA 4D6TJ 2MQOA 2DHHA 3J80U 2XCPA 2HNZB 3M1VA 4N78E 2YX1A 2ZVSA 2W2QP 1LW2B 4MTPA 5B7WA 1DLOB 3HVTB 4DSLA 1U6ZA 1FNMA 2NZCA 4RW8A 3MZWB 4NLYA 3OTOF 2FDNA 5CYQA 4RW6B 2AJFE 5F41A 5ETLA 3JQJA 1NYHA 5AJ3F 1UVIA 1N56A 3NMDA 1XJWB 2BV3A 2J0QD 1URRA 2BRKA 2VBWA 3S4RA 1UA1A 4ZVHA 4FYYB 1N73A 3DM2A 2FHMA 1Q8LA 4J37A 2RIJA 3C3LA 2D1CA 1P1TA 1A7GE 2NSCA 2V4JA 4NEZA 2FYUE 4PJ0H 3TQEA 2NYHA 2KUBA 3JAMY 1BGYG 4HHUA 4DWIA 5FJ4A 1P27B 5M2UA 1SKRA 1FJ7A 1IKYB 1S3JA 1XMQF 2V8HA 2B43A 1N32F 2CYYA 2WT7B 3W8GA 4YY3J 3F56A 2F4VF 1YJRA 4DDFA 1MU2B 3HO1A 1PP9J 1C2PA 2QFIA 2A06D 3C46A 3R1LA 2MKCA 2VZ9A 4A48A 3BGRA 2CRLA 4K4WA 3VZIA 2AV5A 4DV5F 1XMOJ 1ICEB 1Q82T 4RNHA 4D6TE 2ROEA 2ZYGA 3L09A 3NGKA 3RAXA 3PHTA 2FHJD 2E5YA 2BUNA 2BKOA 4DLEA 4N3YB 2BX6A 3K58A 1FESA 1OSDA 2HQIA 4IG0A 3SSQA 2A6MA 1PYSB 2Q1KA 3SCKE 3AOCA 5AT1B 2VKRA 2UUTA 3HX9A 3CJ0A 2I9SA 5ETKA 3I0SB 1WKKA 4RX6A 1R0BG 3SFUA 2YXLA 1KOOA 2XMMA 5FDLB 4B3MJ 1C0TB 2DO0A 2ALZA 5AW7B 1AFIA 2OEMA 2YBVA 1OWAA 3LWLA 3MEKA 5EWFA 1LWFA 2RKLA 3M8YA 3UN5A 4MK8A 1S9KD 2H4YB 2WSCJ 4MKYA 1RAGB 1MV8A 1KYOI 1BGYJ 3H25A 4JYAJ 3GSDA 4RUCA 2C1EB 1NJIQ 2GHPA 4J9LA 1U4BA 5D0RA 2NLWA 1X4EA 3AA9A 2QA1A 4ECUA 3R2CJ 4P9SA 4A8MP 1VMBA 1RT4A 3CC7S 2GCFA 3G82B 3V6DB 1FJPA 2FYUK 2QG9B 6FDRA 3BSOA 4N5SA 3M6XA 4I1TA 3PCOB 2CQ4A 1HNZJ 3PEJA 2B9EA 1RAIB 3AE4C 3IR7B 1TKDA 2W8ZA 1E79H 1UPPA 1H6KX 4B08A 2H51B 4I69A 4OV1A 5ETNA 3MMBA 1Y3JA 2B3TB 2GA1A 4I7ZB 2CJXB 4ZS6A 1JLEB 2ZH8A 2VUGA 3VOPA 2HHQA 5C2GA 4H44B 2WQYC 3KUHA 4KHPJ 2OYHB 3CCLP 1YJUA 1L3UA 4D3GA 3TNUA 3J81j 3KK2B 1PILA 4DUYJ 4WY4D 1NK6A 6FD1A 1S5LE 3FXDA 3KG0A 2QMWA 2LXFA 1R89A 3TX8A 1PKUA 4GC7A 1GXUA 5HL7Q 4Q5VA 2B9YA 3JB9k 4OLOA 4XAKA 5AVVB 2PGCA 2V68A 1L0NG 3IN5A 4TT3H 4L3KA 3D6FB 1HHQA 4DZDA 2LECA 2VC0A 2OEKA 1SC6A 5KG2A 2BM1A 1TFWA 5I4MA 3NCQA 4ID5A 3E2EA 4HEA9 5J2QB 4TY9A 1FXDA 4R0JA 1U2CA 1U1KA 1U6FA 1S72S 4ECQA 2RF2A 1HJBA 2QJPB 2OP5A 4FF2A 1HNXJ 5DS7A 2EFGA 1N34F 2FYNC 1NK5A 3L3CA 4EZ9A 3OBIA 2E5GA 2FXOA 3KHLA 3R7BB 4CYUB 2N1TD 4HDHA 1I94J 4R25A 2PMZD 3WMM0 5FLXU 3OW2O 1I1GA 2CPXA 2QG4A 3EGWB 1VQPP 1Q2NA 4ZN1A 5J1EA 2MKVA 1LWEA 1HBOA 1L0LG 3ILJA 4M1KA 4OI0A 3NGTA 2XB2D 2YNIB 1B0PA 3CCTA 1DARA 1QTMA 4WP8A 3E8OA 4GDOA 5HQ8A 3GCWP 3EZ5A 4BDPA 5APWA 4ED7A 4TLQA 2XDJA 2QLWA 3NWRA 1PCAA 5CZXA 1RT5A 5A76A 3DRSA 3MIWA 1EDIA 3B71A 1R6YA 1MLAA 3H0PA 3PRBA 2AXTH 2ZWOA 3M8PB 3RB0A 2J7WA 5L1JA 5CBNA 1ZS6A 1RE3A 1TU3F 4RJVA 3PO4A 3WUVA 1JX4A 3I0RB 3W62A 1HBNB 1BDDA 3PTZA 2Z56B 1NTMD 2JFDA 1O0PA 4LSNB 3V6HA 2BEFA 3FUYA 1HR0J 1L0NJ 3Q5PA 1JLFA 3D4JA 3HPOA 4NMLA 1DTQA 2APOA 3OXFA 2GAHC 2QLXA 4GKKF 5J2PA 4NLVA 1S77D 1FK9A 3GYXB 5EGYA 3V4IB 5D0GA 4ZNCA 3KJFB 2SPZA 5CJ4A 1S6UA 2QN6B 2O67A 2HODA 3SXLA 3MOJB 1FKOB 3IM9A 1WNEA 3LP0B 3SDEA 1RA6A 2ZZMA 1B4SA 1MWYA 2ZEJA 2M8HA 3WC2A 2CK3H 4C98A 3E51A 4KJIA 3FEZA 2DYAA 3IC1A 3JSYA 2W25A 5C24B 3CCSP 5AW9B 2L41A 2DIVA 2YKOA 2HBQB 4DCKA 3SSRA 5LL6d 2XQCA 1OVVA 1L0LJ 4DV1F 4GOFA 1IKXB 2MLYA 5HP1B 3W67A 1UFKA 1UETA 3OR1B 2KJVA 1SQPE 5L1LA 1YVFA 3ONQA 2W9BB 3CCQS 1BY9A 3HRNA 2L9WA 3AE6C 4EK2A 3H5UA 1TKZA 3AOAA 4DV4F 5KJ7A 2BJ8A 3V5BA 2B87B 1Q0NA 4ZJQA 3VMZA 3RL0D 1Q78A 3GZ7A 4C3LA 2Q43A 1NU1D 1PGOA 5BYQA 5GMEA 2YO3A 4TU7A 2B4VA 3A1YG 1DEEG 4E98A 4Q0BB 2FIUA 1FD2A 4R4LA 1FZGA 4R5PB 2RQ4A 3AB4B 5KFLA 1Z1ZA 4B02A 3G6YA 1RT3B 5ETTA 1M1JA 2H65B 2YNFB 2DD8S 2MJZA 2HVHA 4JPZB 4ZHRB 2WHOA 3G71S 1IFMA 2MMYA 4NA1A 5AW2B 3U1CA 4JI8F 1CW5A 3KLIA 3GYNA 1U7JA 3RR8A 5APXA 4ETZA 3IBWA 5KKZC 3OHAA 2Y1IA 8ATCB 4DEZA 2LQ9A 4PWWA 5F9NA 1RI7A 2YX4A 1SQXG 4QPTA 2X3DA 1HIYA 1JTHA 4ZVGA 2DR5A 2FB0A 3CJ8A 1OO0B 2YKMB 3DU5A 2OARA 1U0HA 3UCZP 2C2MB 1TL5A 2M3EA 3G4SS 2AF6A 2VG6A 3MR5A 2R2RA 2HLTA 1RTHB 4X65F 1U1PA 5KAFH 4F4ZA 2DO4A 3NL0A 4OFZA 4BHQA 4UOHA 1KR4A 1TFYA 4WE1B 3L72E 3T1HJ 5CJ0A 4A8FA 2XMWA 2R7WA 3W2WA 6AT1B 1X7VA 4KBIA 3L71G 3AEBC 2CVIA 2NXCA 4P2SA 4ED8A 3ZDMA 4X4OA 3NGDA 4DQSA 5C25B 3CC4S 2DH7A 1UJ5A 2AX1A 2W7PA 3D1OA 1SIWB 4U3FE 2IPOB 5EX3A 1YIJS 3D0HE 3CMAS 1FNXH 1P84E 2I38A 4RLEA 1N36J 1U2RA 5DDPC 1VDFA 4HACB 2QSFA 1LWUC 3UI3A 2DRAA 2XZRA 4DQPA 1HWTC 1SQPK 2ZYDA 2B5JB 3A13A 4WJBA 2FVQA 2CZ9A 4I7FB 1XIQA 4DMZA 5L38A 3I56P 3AD9C 5TISH 2L91A 1VQLS 3NOGA 1ZOTA 2CJ9A 2R7OA 4AE5A 3RBDA 4FXDA 4U9RA 4CO3A 3SCLE 2FBWC 1XN9A 3W3SA 1RTDB 1RGVA 2L3MA 4DR5J 2XZWA 3DRYA 4JI7F 4NRTA 3BJYA 5L39A 1N2DC 1T6AA 4FBTA 4TY8A 2PIIA 2E1CA 2ZC4A 1SFCA 4H4MB 2EKNA 5CXTA 4Q8FA 3PYEA 3C66A 3ZZZA 1HYSB 4C7QA 2N82B 3IRWP 1FE4A 2FYNB 2M7SA 3BCCG 1WSVA 1U8WA 4DV7F 1MKMA 5KFFA 3HSGA 3A0BH 2NXUA 2Z2YB 4DR4F 4WWSA 5AXKA 1UKUA 2KLUA 1RHMB 4F0MA 4JI3J 3E1IA 3THVA 3PYDA 2FVSA 3L75J 3G8TA 3F44A 5HSPA 4DR1J 3W9HA 3GHGB 2CPZA 1DRZA 2R4FA 5A8WA 3L73G 3IS9A 4LVNP 2LXUA 3OFEA 2PI4A 4JV5F 1TL7A 1B0TA 1GMUA 3IMQJ 4KC5A 1IR2A 3TWZA 3CJTA 3RJMB 3PNIA 3C14A 4DUZF 1RT1B 4I1LA 3U27A 3DXSX 2N9YB 4BWNA 4H44D 2HMIA 2ZOMA 4LF8F 4B9SA 3GIJA 3GYGA 1LOUA 4H4OA 3BQ0A 3TJ9A 1USDA 4Q2MA 5KG1A 5MLCV 1OMIA 3NXZA 4DBQA 3OVBA 1LW0A 4HKQA 5HJXA 2R8KA 3N4WA 3GV7B 1IR1A 3PEHA 4YR0A 2ZDPA 4DR7J 2VL1A 4IO9Q 2FJBB 4UB6E 2V8GA 2KDOA 2MZRA 3NMAA 4GKJJ 4DSKA 1JCCA 1NCLA 3B4SA 3H1IG 1WDTA 3M2RB 4DV6F 1PG5B 4F26A 2MLXA 1NK0A 1IFDA 5A8RB 2NPSB 3LW5J 3CCMS 2ZH3A 3DRPB 1JXEA 4NE9C 4F2RA 2ASYA 4WKYA 2MPUA 3PY8A 4OHVA 1PGJA 2WZ1A 4J9MA 4OGQB 2IDBA 3T19A 1FXRA 1FVSA 4C9DA 1SVDA 2HFVA 2RU3A 1QTNB 1IWAA 3GCXP 3BCCJ 3GB0A 1PGQA 3EVMA 1IWGA 2Q3IA 1U47A 1SKWA 2M8DB 1ZPWX 1SKUB 4OHZA 2MQ8A 2XZTB 3G8SA 2HGMA 3L75E 4P74A 3VGSA 2K9JB 3PDNA 2FY8A 2ZNYA 4IOCQ 1R43A 4V1Ak 3WUTA 2N1TA 2JEIA 1KILA 4OJGA 3CPWO 4J9SA 2DHGA 2AEFA 3HI9A 4CO0A 2K2PA 4QMAA 3L73J 3R3TA 1F60B 2YTCA 1OJ4A 1KFSA 2EI5A 3HHNB 1QVGR 1DJ0A 3R5JB 1D9DA 1X5PA 3NY0A 1F9EB 1LTJC 1KN7A 2KS1A 1HBWA 3GJRB 3NGRA 2O1JA 4L74A 3JSMB 2GVZB 5CCLA 3VAMA 4O3QA 5HK4A 2QA4S 3NRBA 5K5GB 5EX0A 1ZTWA 5LSLA 3CXHE 1UIIA 2I5JA 2G9OA 1QSLA 3HFZB 1J5EJ 2QEXS 4V19J 1XNQJ 1ZYQA 2YKPA 1FOSE 4USMA 4WPAA 2R32A 1FFGB 1M57D 1VRTB 2ZBIA 1M5VC 2Z0GA 1XK8A 5KAIE 4ES3A 3H1IJ 4Y0FA 4OI3A 1FDAA 5K8MA 5IM0B 2EFOA 2C3MA 1X4DA 1QLNA 1TMMA 3CCZA 1RWXB 2BDPA 2G0IA 3A4TA 2J0WA 4UY85 4DG1B 3E01B 3MR7A 1RTJA 2DR9A 2LQ8A 2HW3A 3V2PA 3ZNJ1 3MEDB 4M5GA 2XLIA 4QWEA 3TARA 1PGZA 4RUAA 3LGNA 1RCOB 1KYOH 4JB8B 1HI0P 5GADI 2XBPA 3T97A 1KV4A 2OD4A 1RF0C 4UF4A 1S72P 3TW0A 3ZZTA 3LP2A 5T7LB 2LDYA 1SB6A 3SYZA 2FLOA 4ZMMA 3V2NA 4ZJOA 1FKAF 2I1RA 4BC7A 4XIUA 2B4PA 5G4DA 2OPQB 3DCAA 2LEBA 3HJFA 1XC9A 1R31A 2CPHA 1H2VZ 4NRUA 2WPVB 2IBOA 3BH6B 2OUGA 4RW4A 1S1WB 1SVFA 2M5YA 2WZ7A 3JCUE 2J9CA 1FRKA 1X4CA 5DM7Q 1TELA 1LWUB 3M6WA 2R2SA 3B5NC 3MUTP 1LXNA 5HATA 3RBXA 3V4QA 3TA0A 3EGZA 1YI2S 2QE7H 3MAQA 2BE2B 4I64A 3QIDA 4ZVQB 2HNZA 3KDOA 3BN4A 2PEHA 4B3RJ 1URQC 4IFVB 3B4MA 2XC9A 4LFCJ 3K8WA 4DPXA 1LW2A 2H48B 2JO1A 1DLOA 3HVTA 1D8YA 4LF4J 2WWWA 1AVOA 1VC0A 2WSCH 4WK1A 1AFJA 2W2OP 2YMYA 3THPA 3PW5A 2Z57B 4RW6A 2GIFA 2CNOB 2VFRA 2XKMA 3CXCR 2UUAF 2DHXA 1S4EA 2KH9A 1SQQK 5AW3B 4PABA 2UU9J 4NYZA 4J9RA 4KGVB 1YX2A 4DL3A 5JMNA 1GTHA 1PIEA 4U7JA 3G6XA 5HROB 1GDTA 2XY6A 5AVTB 1S7IA 3GFZA 4DN0A 3KLGB 5ETRA 2D2CC 3K5MA 1S0MA 4C8OA 3U59A 4N78D 1T3JA 3QBCA 1R27B 2JX2A 3G6ES 1XTGB 1IKYA 4JBZA 3IGNA 3FEXB 1GFWB 3VGUA 2KZJA 2WT7A 3AD7C 4KPCA 3P4UB 3TA2A 3IBCB 1P1LA 4MYUA 3JC22 1MU2A 2BOPA 3LW5C 5E41A 2GQQA 1ZAXA 5DDQC 3MM9B 1T2KC 1R0AB 5CA5A 5KG7A 5IOLA 4ZN3A 3CCQP 2LA4A 4J91A 3HTKB 5BJRA 3VMXA 4YHHF 2ZITA 1TU0B 2VOOA 1NXIA 1T8ZA 1QDUB 5GAGI 4IQMA 3VP8A 1RHUB 2Y9ZA 3BB5A 3EZUA 1WEXA 2CJAA 5BYSA 2CJKA 1YJVA 1JY3P 4G1QB 4NLQA 5A8KB 1KFNA 4W7YA 1NTKE 3EFFK 1ZTTA 1LTTC 4F3QA 1AYEA 2FYZA 2ITAA 3G71P 1S99A 2OSRA 5FDLA 1C0TA 4DOZA 1KQFB 1KNZA 4I56A 5KFIA 4QIVA 3USSA 4ZLLA 3A12A 3BR9A 4AFFA 4ID8A 4D6TD 4GKGA 1DEBA 2KK7A 3MPUB 5KFYA 3W9JA 1UJ4A 2FGCA 2ZJRQ 1U7MA 5B0FA 3V4WA 3G4SP 1VHIA 1LJ2A 1GEHA 1Q86Q 4KRWA 4DX7A 3FQKA 1VF5C 4JI2J 1NGMB 2OPSB 1G2CB 4BS2A 2K7JA 3QYYA 4OHXA 3FSYA 1T3NA 3HHLB 1KVIA 3G82A 3V6DA 2Q3PA 2OELA 3HHKA 3JTPA 5U47A 2WPRA 2IIHA 4CLTA 5B09A 4O9BA 4LF7F 2J59M 3KLHB 2HAFA 2VFUA 1LTJB 2JR8A 2VDIA 2P10A 3JAMU 4YXDC 3CC4P 2RDDA 4RZRA 1U8SA 3QRRA 2MZJA 4P2XA 3W7BA 2CWXA 3T5KA 3EWGA 2YXRB 2DGSA 4C8ZA 1YIJP 4CTAB 1JLEA 1QGKB 3J7A1 2FVCA 4DN9A 3WIVA 4QU6A 4CO5A 4IUFA 2OYHA 2O01N 2F3JA 1Q53A 3T5HA 2MSSA 1FE6A 5F0UA 1JQGA 4L72B 2G0CA 3KK2A 1RXOB 2ZXEB 4H4KC 4XPEA 4WZQA 2OFGX 1SC3B 4A8SA 1KYOD 3WBZA 2QRXA 2ROGA 4CM2A 1Q81T 4PPDA 4HTJA 4OYIA 3W5YA 5D4PA 3DLKB 4C8NA 4I6YA 3EXYA 4CRJA 1NJWA 1NKEA 3UW1A 1CC8A 3SV3A 2J6TA 2XHWA 5KFPA 2YWKA 3V6IA 2XWYA 4OGQD 3Q22A 2A06G 5J2QA 2CPYA 1NTKK 2KFZA 3A3OB 1XWLA 3CW2C 4LVOP 2E9ZA 3IFEA 5SUHA 1WOSA 1BMQB 1DD3A 1TP7A 2LQJA 4A8WA 3Q8PB 3OXGA 3RK3C 2WBRA 4DPOA 4USVA 2OSQA 1TKTB 2ZC3A 2UXBJ 2VBYA 1FJEB 2JP3A 4RPFA 4CYUA 3FWLA 1GX5A 4QW8A 4C8MA 3AB2B 4M94A 4Q2LA 2QVAA 5J2MB 4HTIA 4YTPC 3K0JA 2ABYA 1WEZA 1F2HA 1QSYA 2A2CA 4PV1B 4ANEA 4BRYB 1FERA 2HBRB 2HS4A 1IVZA 3H5SA 1QM9A 1JUNA 4DFPA 4DV3F 2YNIA 1RY3A 1WDDA 4WU3A 2XNDH 4USUA 2C3UA 4J9KA 1DFDA 2KKHA 2YQ1A 2U1AA 3B5NB 1VQ8S 2DGVA 3DU6A 3IWNC 2GGPB 1Q8IA 1BGYD 5B0GA 3M8PA 4OYZA 2W27A 3AD8C 2HVDA 4ZVEA 1VL2A 2WPSA 3CD5A 1B7FA 4DR2F 1URQB 2YIUB 2ZM6F 4J9QA 3I0RA 2BA9A 1PAEX 2HPCB 1HBNA 4F04B 5EHHA 1K73T 4ANDA 1NAYA 1YK9A 1RCXB 2VFTA 4LSNA 3I55S 3MMCB 3CUNA 3SV4A 1XTCC 4AQYF 3AEEC 4C7NB 1HARA 5G0RB 2JEJA 1VRUB 4OZ3A 1FDMA 4PD4I 3HM9A 4Y28J 2YVSA 1PIXA 3V4IA 3V2RA 2OMLA 3FK4A 1LFPA 3C9IA 1S10A 3LQVA 3JSRA 3UDEA 1RF1C 3CCMP 2F8HA 5A6WA 1FKOA 1TUVA 3LP0A 1FX2A 4QYZJ 1M5KC 1HFEL 1VS3A 3D1HA 3CJRA 2WOMB 5CCHA 4YR2A 5ETMA 1GW3A 5C24A 4BWJA 2UUBF 2OPPB 4EMDA 1MROB 1BCCG 5H2FE 4IDKB 2M0GB 4W98A 4HR2A 1IKXA 5HP1A 4H13C 2W9BA 2WMMA 4WTYA 4WFAQ 2KL8A 2ZH1A 3HVWA 2F9DA 1YJWS 1KQGB 4ZP6A 2HWHA 4O3RA 4GO5X 2DNGA 2AEJA 2B87A 4YDDB 4UB6H 1BSNA 1K05A 1NSKL 4WF9Q 2A2DA 4Q0BA 2BBEA 3ADAC 4URGA 4MMOA 2QA4P 1LTIC 3OLBA 4JV1A 4FPRA 3R4YA 4R5PA 4EYHB 1NLKL 1UWAA 1RT3A 2GIQA 2YNFA 3F41A 3R27A 1SLQA 1RUSA 2PP6A 4ASVA 4ZHRA 1RJJA 1F9FA 4ELUA 3N0VA 3TQ1A 2RKIB 4E8UA 4W80A 4X4NA 1VJQA 1I6JA 3QAEA 1PBUA 1KLMB 1AV1A 1BDCA 2LEPA 2CQBA 2M4MA 3RRKA 2YKMA 3AQPA 2DR6A 3JQMA 2J0XA 3R6LB 5B66E 3NS7B 5KFZA 3CCES 3KHUA 3IAM9 2PA3A 5E3QA 1HNVB 3K89A 2XMTA 1RTHA 2FGOA 3BQ2A 1OY9A 2FJAB 3DLJA 4N77A 1A02J 2VRSA 5I3PA 1L0ND 3AE3C 4WE1A 4LRDA 4ALZA 2GMHA 1IUJA 3AODA 1BCCJ 3V81B 3FFIB 3TOQA 1WF0A 3LIEA 4LIRA 3JSBA 5BR8F 5C25A 2EK1A 3AQOA 2Z2ZA 4X66J 2R8IA 2H4WB 1VQKS 1EQ7A 5DJBA 3CJ2A 2QZ8A 4K50A 2WSFJ 1VQ5S 4ZA1A 1IJEB 1UIXA 1S2EA 3HSZA 2HHVA 5KJ7C 2V0NA 2XI3A 3II6A 4PYAA 2OHDA 1N86A 4ZCMA 4FYWB 4HACA 3SSSA 2L48A 2V34A 1XMQJ 2JEGA 1T9YA 2PAJA 3ELHA 4JV0A 2RE1A 2B5JA 3O8WA 3LW5H 1S59A 3KUGA 3VGVA 3PHEA 2F4VJ 4I7FA 4O0IA 3PW4A 1M1JC 3HD1A 5B0CA 3K5BA 3UDLA 4DT0A 5IWAJ 4LF5J 4N8NA 1X5SA 3FXEA 2ZBQA 4OYOA 2WSSH 5ETPA 1H89A 3HLUA 2L9DA 1UW9A 2IYOA 1X4AA 3ITKA 1HWIA 2QX0A 1RTDA 3QO9B 1SJFA 3ABVC 1SQBE 4FYVB 2VOPA 4B3TJ 4LFAF 4GO7X 1XEZA 3W9IA 5ETOA 4IQXA 2KB7P 1M5PC 4H4MA 1O6XA 2R7XA 3ZZ0A 4ERDA 3TGUE 3BPSP 2M3BA 1HYSA 3SQGB 4LRAA 2ZH5A 1MMDA 3GJQB 5IZHA 1ZV8A 2M2BA 2V7QJ 3IG1B 4DPYA 4NXMF 1Q1KA 2PMWA 1FWLA 3MMAB 3D66A 4IL6H 2DY1A 3PRDA 2CA9A 4LUBA 1ZRTD 5AXNA 2ZDOA 2K9YA 5DO2A 2CNKB 1PYOB 3TF5A 2DITA 3RW6A 1FJKA 3C16B 5H1SV 3GSIA 2BE9B 5BYRA 3IWLA 2UZAA 4FS2A 4KTQA 3GHGA 4H0LC 1TL3A 3BRTB 5EUHA 4ZVSB 4X4VA 1RQVA 3ILOA 2BQ3A 4Y28C 4GIFA 3W5ZA 1VYAA 1JXLA 2KG1A 1EX8A 3B54A 2C3PA 1RT1A 3QNWB 4NPFX 2O01J 2V6AA 3CDWA 1W2BR 2Z8QA 4F36A 4GVLA 1WORA 4OZ0A 2F63A 3UPFA 3S1TA 4WBAA 4WK3A 2ZFHA 1KQKA 4HYTB 3NAHA 3P96A 2Y8YA 3CDEA 3KHGA 4UB8E 4QWBA 3JQKA 1NDCA 2R8HA 1QLED 3KFWX 1NH7A 2MY8A 3EUNA 4KH1B 1GMWD 2F8EX 3HUSB 1X9SA 4WFNQ 4JI4F 3KHHA 2GJ2A 3FQLA 1CULB 4K4YA 3M2RA 4MT1A 1CC7A 1HKAA 2W9AA 4ATNA 1SFCC 2NPSA 4CLFA 4TYAA 1Y5LB 3W63A 3DRPA 5CCMA 3UNGC 3TK1A 2A3JA 1N8RQ 3EICA 2E1MC 2GUSA 1UEKA 1RF1B 1GAOA 5CBOA 3M0DA 1RBLA 3OTDA 1S6QB 4ZDNA 4TXSA 4IH7A 3CL3D 2Y8WA 1SQBK 1OFCX 4IR1A 4EIJA 5AVZB 1X4FA 4P71A 2RMLA 3Q8SB 1OYEA 2CQIA 4ZPVR 4ED1A 2K9JA 2RB7A 2VHGA 3RB4A 1YBKA 3EMTA 1ZA2B 2PFDA 1FA0A 2VG5B 1IQTA 5APQA 2P6TA 2FHKA 1NOHA 3QRQA 3IFMA 1M1GA 1YTZT 4D3HA 4H13B 1FEHA 2HVEA 1BSHA 3I6PA 2DXDA 3Q5RA 3RW7A 2FXPA 2YMKA 2B6AB 3B5ND 4YR3A 1HQ2A 2C3YA 2IVMA 5KFGA 2W01A 3BM7A 2EBEA 3JSMA 2GVZA 2RRNA 2MLZA 2LU1A 3A0HH 1U0SA 3VAHA 4O4GB 1URQD 1NTZE 2PEBA 1DHMA 3L75D 3D71A 3ZO7A 3TAMB 5D78A 2JWNA 5DLGA 2NZ4A 2E74B 1T03B 4ZPDA 2QC3A 1VRTA 2W4DA 5D0EA 4U8VA 1GX6A 4N41A 5AVSB 1T8EA 2QL9B 2PD1A 2DNRA 1SQXK 1JJ2R 4LF9J 1R8CA 5IM0A 2WSFC 2HG5D 2EBGA 2IRXA 5KG4A 2IRUA 2LLZA 4DG1A 2DBBA 3E01A 1EQMA 3MEDA 1SJ4P 4BBYA 2D2CD 4K4TA 2XSJB 3M06A 2HFOA 1TK5A 4C8YA 5AW1B 3TAQA 1Q7YT 5HVFA 1EETB 5T7LA 1NMEB 1ZZNA 2BJDA 2BCCE 2R7QA 3OT9A 1IJFB 1KILC 3RRHA 4NLWA 2AMCB 4EBEA 2WAQD 1U48A 4FXWA 5GTHH 1RWNB 3CX5I 2OPQA 2BEZF 3M2UB 1T2KD 3NFQA 3U1AA 1SJ1A 3WU2E 5I3QA 3LANA 3JYTB 1IO4A 5F8MA 3K5OA 4ECSA 1VQ4S 1W5CE 3CX5E 3BCCD 1T0TV 1S1WA 2BZ2A 1WWHA 3CWJA 2HNYB 2DNOA 5HMXA 1LWUA 1YQ4C 2WVBA 2NRGA 4ZLPA 1D9FA 1WG5A 2KG0A 4NCGB 2CZVC 1PZQA 1X22A 4X64J 2W2MP 2BE2A 1BQMB 4DV1J 2FJWA 4BLGA 3M4XA 4L6V3 1HNWJ 1OX3A 1AT1B 5IV4A 1UEUA 4IFVA 3L73D 3EFGA 3HD7C 3W61A 3HMJG 4YY3F 2AJ4A 1S1VA 3FBFA 2C2RA 3TANA 1CJKB 1YWXA 1NTZK 5H9FK 2NS1B 3PH0A 2HFSA 1VQ7S 1XBWA 1EDKA 2IBZI 4ECWA 5CABA 1AQTA 1GXLA 1YDLA 2QA2A 3HE5B 3IM8A 3EGVA 3RUBL 2O01C 1XMOF 1ZZFA 3FCWA 3UVJB 5DGBA 4CH7A 3UFCX 2KT5A 3BSAA 2IBZE 1N48A 1DQAA 1R6VA 5HROA 4A8KA 4TLFA 3IP0A 1NHLA 2D69A 2R3VA 1KVKA 2GJFA 1AB8A 1HHSA 1PPJE 2POKA 3KLGA 3WX8A 4F2SA 5AXLA 2FKWB 1VF5D 2AGOA 1RA7A 2LMIA 5A6PA 1I51B 2FTRA 4K5RA 1L3VA 1Y5NB 1U49A 3TYTA 4M5IA 4H0LB 4PAAA 1MFZA 2FC9A 1X9VA 1DAXA 1T9XA 1IBKJ 4B3MF 2KNCB 3MD1A 2KZZA 3EPGA 2UXDJ 1KB9E 5APVA 3I32A 4ASWA 2OTKE 3J7Z5 3MM9A 1GQEA 2LVWA 1SQVE 4PWUA 5D0HA 2CIMA 3EJMA 1R0AA 1YRTA 1ZW0A 4P2FA 2FUG9 1X4BA 1IKVB 2IFMA 3BSNA 3HTKA 1SV5B 1FKPB 1RZMA 2E66A 5HO4A 1RBOB 4NYPA 2N7YA 4FF1A 4JYAF 4K8RA 2MZQA 4FNIA 2XULA 2I6WA 3CIMA 2KRBA 1J1EC 2XGPA 3QPIA 1QUVA 5AE3A 1KBRA 4G1QA 4PEOA 2IC3B 4AXJA 5A8KA 4DV2J 4QW9A 2KXFA 3ULHA 2CG4A 4XDDA 3H1LJ 4IOIH 4NEYA 2JLGA 4PD4H 2CJBA 4F7VA 3MCOA 1HNZF 3VR1A 5LSOA 2OGUA 5IFMA 1H74A 1EP4B 1S4FA 1JJCB 2XS7A 4DSEA 2KFNA 3HCXA 3C1LA 5IT4A 3GE9A 1N54B 3FSXA 4XO0A 3N7NA 3RK3D 4KHPF 4J9VA 3MUVP 3WZ0A 2IFNA 1SQFA 2JKVA 4K2JA 3CCEP 2F8MA 1FAVA 2XO7A 3VV2B 1NJIT 3SSUA 1KD1Q 3L74E 4RUBA 3UCGA 1VQOS 1SH3A 3M9OB 1V3SA 2AWZA 1FFWB 2OPSA 1G2CA 4J90A 3AE5C 3MPVA 2W9CB 1B99A 1OVRA 3LO3A 3HHLA 1DQ8A 3BVHA 1EARA 2GQ2A 2VPZB 2CFXA 5HN0A 3KLHA 3T1YJ 1BWVA 1GMVA 3V6JA 4ZJLA 1LTJA 3CGIA 2DT9A 1RTIB 2BVZA 2PFFB 1EXJA 5LXYA 3CCJS 5F8JA 4N7TA 3F5HA 1VQKP 2FJEB 4HI2A 4K35A 1RQ0A 2Z5HA 4ZPTR 1HNXF 1VQ5P 3H7HB 5KT6A 4CTAA 2O3DA 2FHOB 4ED3A 2MKSA 1MUUA 3CDAA 4XDCA 1SQVK 2ZVNB 3KDNA 3AE1C 1KHWA 1I94F 2HRYA 3H2UB 2C42A 1NDPA 5KFSA 2KYXA 3H1LE 1GK8A 2OEJA 4U67Q 4J9UE 2V5HG 2WITA 3PYFA 3CVKA 4OQJA 1S6PB 3DI6B 4OX6A 4EBCA 1MWQA 4Y3CA 5B66H 3BO3A 4USJC 3DLKA 2IA0A 3OQ2A 2RNEA 1BLUA 3CCWA 4JV2A 4TYBA 1RHRB 2F1FA 2LP4A 4A8OA 2LA6A 1FFSB 4AL7A 1H98A 2ZE2B 5KLIC 2OO4A 1UPMB 3QIPB 3FJ2A 2XYPB 1Y0HA 2RT3A 3Q8QB 1UVLA 1OVUA 1RF0A 1OY6A 4QBUA 5DQGA 2E7XA 4PPZA 1TKTA 3E3XA 3CMES 1SBRA 2FYUG 2ACYA 1X0PA 1S79A 2VF3A 4YB7A 1NH4A 3SIPB 2K8GA 4O3NA 2XHCA 4K3AA 1HR0F 3NAIA 1ULRA 2KT3A 4OL8A 1JLCB 5JVHQ 4DL6A 2OYIC 4H13D 5J2MA 3HE4B 3R8YA 1ROFA 4BRYA 5DJUB 1YJNP 1RHZB 4KV8B 5EFWB 5DG8A 2MQQA 4OX7A 3VTIA 2E5LJ 1VIXA 2L08A 3AJ1A 4I7ZC 2YH0A 3B5NA 4TKTA 2GGPA 3IR9A 1NK4A 1FRMA 1WI8A 2HHTA 5M1BA 2M88A 1NDLA 4D6TG 3BQ1A 3N9UC 4OX9J 4HLBA 4AYBD 1K1QA 2RRBA 4LQ9A 3OVAA 4ECXA 3P8MC 3CCUS 1URQA 1RTZA 3UN3A 1AUSL 3HD7B 2FJVA 1VBXA 4AD6A 2HPCA 4OJHA 2V8VA 2PRRA 2MY7A 5B0AA 2G3AA 3VAGA 1SJQA 1Z56A 3M6VA 2E76C 3AEFC 3KKFA 1HWKA 3R6GB 3MMCA 4CZCA 1AA1B 2MTLA 2X7IA 2FFDB 2DKOB 1E6YB 2EXUA 4NZ7A 4C7NA 1HNIB 2KFYA 5G0RA 1VRUA 1HW9A 1U7LA 2EPIA 1R8EA 1JLAB 1FZEA 2OTJS 1TK8A 4LFBJ 5I3UB 4RBVA 5F8IA 3RRGA 2V4HA 4ES1A 4A7PA 1S6OA 3KLFB 2WSEJ 1QAXA 3DOKB 1CZQA 2QJPC 5GADU 4KHXA 2MEWA 1DURA 5MAOA 1FJGF 3L7PA 1LQ9A 2AZ1A 1ELOA 3BN7A 2PGDA 3T41A 1ZM9A 3Q5SA 2AEMA 2FYUJ 2WOMA 3VTPC 3OJSA 2WSFH 1NAFA 1GXTA 1OQ6A 4DR3F 2WK4A 4IG3B 5IT9Y 2GHWA 2CPJA 3B8EB 1RAFB 3M8RA 2O66A 1RABB 2AYGA 4FN5A 1OW8A 2OPPA 5APUA 1WHXA 3MECB 5LMUJ 1MROA 1NZAA 2E75B 4GRSA 2LFVA 1S9EB 2EFPA 4IDKA 2FLPA 5KJ7D 4X2BA 1T05B 2HHUA 3D6TB 3P3DA 2YWWA 2UV8A 2CQGA 4P6QA 1AUDA 1H72C 4PD4D 5K5MA 3ZTSA 3GJTB 3G9CA 2MQNA 3Q8VA 1JB0J 1UA0A 2QSWA 4ZVUB 5L46A 4HT5A 1VLYA 1X79B 1J1EB 4C0BA 1W2EA 4N76A 4F3OA 5CD4A 3T1HF 2BJEA 2C2DA 4CO1A 1B0VA 2Y0BB 4ZPAA 2NUUG 1IXKA 2KM8C 3L70E 3WQPA 1TL1B 2V7QH 5D3GB 1VQ6S 2RKIA 4Y2AA 3PHLA 4PR6A 3JTNA 3MTUE 1RWPB 3JTOA 5KTBA 1IKWB 2Q6CA 2YWGA 3CEDA 8AT1B 2ZH7A 3KK3B 1A0OB 3N79A 2QT7A 4LRBA 1KLMA 1N36F 1NRKA 4KGKA 4R8UB 2ZHAA 2CPDA 1RAAB 2P9GA 2VPWB 5KAKA 3CC2S 4LGDE 1EHWA 2R44A 3TX0A 2N3OA 2G4BA 4CDIA 5HLFB 4Z7YA 2QMUB 3CSKA 4B9MA 3AECC 2OAUA 3TUJC 3AE2C 4HI1A 5CCHC 1HWUA 3H98A 1HNVA 4HT7A 3O1LA 2CKWA 2YKQA 3OD2A 3KG4A 3MFIA 4H0LD 1LKZA 2O01H 4HVZA 2K1RB 3TUPA 4MN4C 4A47A 4Q43A 4ZIVA 5CQGA 2JNJA 4QQBA 3V81A 3FFIA 4DR5F 2YPZA 1JY2O 4W92B 2K3RA 3D54A 1RT2B 3ENWA 5AVWB 2K3IA 4K4VA 1NKBA 3BR8A 4PXDA 1REGX 3RGUA 2DJWA 1YZ6A 4EBDA 5ETVA 5ITHA 4BXLA 2OMOA 4ELVA 2V63A 3Q0AA 2YWEA 1YGYA 4DSJA 5E79H 1EB0A 2RQMA 5D77A 3I4HX 3D70A 3RB3A 1Q4RA 3EYZA 1FCAA 1UP1A 3RK2C 3DOMB 4RBTA 5AVQB 1VQ4P 4P52A 4CLKA 2PFXA 4KPYA 5GAGU 2ZHOA 3AE9C 3BBFA 3UCUP 1CEZA 3SWFA 1T9VA 1MN7A 3K59A 1H0TB 2QV6A 1OIAA 5AW0B 1MWZA 1B7YB 2VICA 5LT5A 4H4KA 4ER8A 5HQLA 2VJUA 3L4BC 4DR1F 1HH0A 1EXIA 2BOAA 4OHYA 1VLOA 2K88A 2M5AB 2J76E 9RUBA 1SFCD 3ZTPA 1U25A 3QO9A 4LBHA 4Z7CA 1N0VC 1OMSA 1O5JA 2Z4PA 1FD8A 3SFGA 1CJVB 1YKWA 2XMJA 4EZ6A 2XLKA 2IFXA 4NXNJ 4U7CA 2UUCJ 2H5IB 1DZ5A 3PKYA 5KG6A 3AT1B 4IYQA 1TVRB 4JYCA 1VQ7P 4KO0B 2MSTA 5KLIB 2ERRA 4DF4A 4G6VB 2NYIA 3IF4A 1FS0E 5IC4B 3SQGA 5C39A 3H1HE 1TTHB 2E5JA 4YOEA 3IG1A 2VDHA 4NPDA 3MMAA 2CG8A 1LT9B 1RE1B 3C15B 3PW0A 2ZJQQ 1H3DA 4NA3A 1N33J 1OW7A 3GILA 4OI1A 3CX5H 3GLMA 4HH1A 3QMQA 3C16A 1UWBB 1IM6A 4GKJF 1NKCA 3D68A 4KY3A 2OYIB 2IM0A 2MQPA 3C6UB 1QUPA 5D6GA 4BCAA 1OY8A 3FZBA 4E0DA 4E2FB 4Y2IA 4CLZA 2YX7A 2ZJPQ 1XMBA 1SQPG 2FZGB 3UIAA 4AQRD 2VODA 2K37A 2WSEC 4KQZA 3J81Y 3TGUD 1JO5A 2BKNA 4C7RA 5BXIA 2WTFA 2ZT9C 5APSA 5HAOA 3OFHA 1NK7A 3AEDC 1YYCA 1FZCB 2MZSA 4B9LA 3WIUA 1VHFA 3N28A 3CJKB 2UVUA 2W7AA 1BCCD 3VAIA 5HQMA 1OPIA 2EFNA 1WTBA 3BYRA 1RWUA 1AVYA 4MIAA 2E76B 1RE4A 5E5NA 2JSXA 2V9KA 2XNQA 1F2GA 2GJIA 1PYTA 4F4KA 2PO4A 4IFMA 4NASA 3HUSA 3PJXA 3W64A 1CULA 3S9OA 2POHA 1QEXA 4USTA 5AVUB 1LXJA 3KZIH 1L3KA 2FVPA 2R42A 1RF1A 3CJ4A 1C0UB 2X3GA 3H1JJ 1U1MA 1KMIZ 4O4RA 2KIKA 3X1LB 3AE7C 5IQ6A 2CADA 1BE3J 2YY3A 1JB0C 1S6QA 1NTME 1WTFA 4GVBB 4PCQA 1JLGB 2V67A 2WCXA 1HMVB 3CPWR 1NM2A 2XZDB 1KILD 5DM6Q 1J5EF 4OYBA 1KFDA 1KWMA 2P1JA 2GS8A 3NEKA 4WXWA 1CLFA 3L72G 3GHGC 3I82A 2BEQD 1I3OB 2VG5A 2C2OB 3BBCA 1X0FA 1VQOP 4FKXA 1G2EA 1VBKA 1SQPJ 2BKPA 1WT6A 5KFKA 2QYCA 2B6AA 4OZNA 3QSIA 2DGQA 4U3FG 2NCKL 4TN2A 1L4AB 1NB2A 3VQTA 2XG8A 5C5JA 4OVNF 3OAKA 4YXWH 1GK6A 4IRCA 1J2VA 1N88A 3UN2A 4K0KJ 1OSCA 3KNGA 4K5SA 5HMZA 4O4GA 4DPUA 1Y3KA 3HD7D 2B88A 3M8QB 4CLUA 5KOWA 4Y6IA 3J7AN 3TAMA 2OQQA 2B4UA 4M5JA 1VQMS 2R7TA 1GTWA 1V9OA 5KFAA 2Y0SD 1IN0A 2KM8B 1T03A 4CT8A 4DFMA 3CO9A 3PXGa 3GF3A 2CDRB 2NPSC 2MQMA 1ZBTA 4OJ3A 1NU1E 5B5EH 4LSLB 2R3CA 4WFBQ 3OTCA 1VQ9S 3IR6B 3H1JE 3D1QA 1BE3E 2XU6A 3W2VB 4OGQC 3O3LA 3DHXA 4DPTA 3M0DC 3DLLQ 3GWCA 4N47A 4FPIA 4DR2J 1ZM3A 5F8NA 1JY3N 1QSSA 2IYGA 3EGNA 4O23A 3HKZD 2H54B 3MTKA 3OVSA 2XSJA 2DNMA 1NTZD 4OI2A 1R8BA 1P8GA 2DGWA 1T94A 1YLXA 4B3RF 4EI2A 4JUZA 2KVIA 2Q66A 1EETA 2W2NP 4DSFA 3SFDC 1R8HA 4LFCF 3LF0A 1L3TA 4YPCA 2FQQB 5A2QY 3L72J 2HYNA 2D7SA 4IO1A 3NNHA 2KSEA 4LF4F 1NTMK 2ZUAA 4ZK7M 1N5TA 2RDJA 4I68A 5LMNF 3TZYA 3H32B 3AAWB 3M2UA 3RBZA 4UZBA 1L3SA 3U1LA 7FDRA 4WVZA 2XCAA 4F4XA 2IRYA 3JYTA 2YNGB 1YJ9S 4U3FJ 3HULA 1PBAA 2OKQA 2VPXB 2VV5A 1UFWA 2KXNB 4KHMA 3RK2B 3NP5A 2GX8A 1F3VA 2HNYA 4EOTA 1UVJA 3CWBJ 1TKXB 1JNMA 4CT9A 4L73A 4M8LA 4NCGA 1UVKA 2WW8A 4UT4A 3AFGA 1BQMA 4DL7A 3DLBA 1G6BA 3CE8A 3MAAB 2RAQA 3S01A 2CPSA 5FD1A 1X8DA 2CUYA 2QTWA 1CJKA 1S7HA 4TNOA 2HFUA 1EZVI 1RB0A 2A45G 1IK9A 4QWCA 3GFXA 4B3SF 3PR5B 1HGVA 4NZ0A 4N8OA 1HTLC 1YRXA 1RKJA 3CX5D 1N6QB 2O3JA 3PM9A 4PG5A 4QYRA 1MW7A 3HE5A 3G86A 2JEEA 2D9PA 1EZVE 2E5TA 5CCGA 5CHXA 4I2PB 4YS2A 1TZ0A 1SQEA 2HK3A 3UVJA 2I8EA 1NU1K 5GTIH 3D9BA 1FO1A 4YN3B 3M30B 4YUDA 3JXOA 1CQNA 1RAOA 2R9LA 1XR7A 1MNEA 3KWMA 1A6LA 2KJWA 4IRKA 2ZVOB 3N6MA 4RNMA 3TZZA 3L75G 3AOBA 3US5A 2JEFA 1P84I 4JI0J 2JH3A 1K9MQ 4KR0B 3CCLS 3EM1A 2KYVA 2CPBA 3MI7X 5CHCB 3OFFA 3UR0A 3MF5A 3W65A 4UOFA 2KNCA 5BVZA 3E7KA 4EO8A 2DNPA 1RISA 3CWBE 2NZ2A 4QCLA 4UUXA 4HB1A 2ZT9B 2XMAA 4Y99B 2IYPA 1IKVA 3UD4P 2I1JA 5F0WA 1DX7A 2IBZD 1SV5A 1FKPA 1KQSR 1Q8KA 5K20B 3D0IE 3G6VA 2XY7A 3P5BP 1PPJD 2ZD1B 4M5HA 1IC2A 5AE1A 2JDIH 3MOZA 5D4NA 4X62J 4JI2F 5L9NA 1UZDA 5E0OA 3TRGA 1H7WA 4C6AA 2IC3A 1Y00A 1NSPA 2GIRA 4LF2A 2ZBCA 1PC5A 9ATCB 1D8ZA 3DOLB 2ASLA 2HHXA 2ACMA 2MQLA 3RAQA 4DV0J 2KSJA 4CLPA 2CVEA 3BBBA 4PRFA 3A8JA 1EP4A 2UV8G 1VQ6P 2P67A 2P58A 2PN6A 4LLHA 3FNNA 3R5DA 1FRJA 3Q89A 3L95X 1RBAA 3I96A 5EWEA 1Y11A 4A8XA 4WFYA 1KQLA 1SC4B 2RVJA 3CC2P 2MYFA 2QO3A 2AZ3A 2BJ1A 1C1BB 4Q8EA 3VMYA 1J5OB 1LEOA 3W1YC 3R5AA 1TL3B 3LGHA 3QGIA 3DDIA 5DG9A 4EEYA 3POTB 2JFKA 3M9NB 4QOTA 2VA3A 1WI6A 3BATA 2W9CA 1GZLA 3MR6A 1S1CX 1JJ4A 2QJYB 4NPOA 5HJYA 3KQGA 3OSNA 2O5DA 3KJQB 1RAJA 2DW3A 2B7BB 3MTJA 3PW7A 2ZH9A 3M2VB 1A9NB 3LGMA 4DJGA 1Q16B 4NLDA 1RTIA 4U8YA 2VD3A 4WY4B 2E42A 3H5XA 2QE5A 3FX0A 3LAKA 2CQPA 1M8OB 1VK8A 3BASA 2PA8D 4KSEB 1NPPA 1NK9A 2A45I 1HW8A 1SH2A 4GODA 4USIA 4NPEA 4WWIA 2H1YA 2Y9YA 3OJAB 2JL9A 2UXBF 3WDOA 2M8RA 1L2PA 2AP6A 4DQRA 2HQFA 5IC6B 2KTQA 3L74D 3VVTA 2E76D 5DDRC 2WSEH 1VI7A 3O44A 1NNDA 3MPWA 4DXLA 3EZOA 1SQQJ 3EDQB 4QIFA 3VAFA 1G4CA 1S6PA 4ES2A 3DI6A 3VGTA 2XY5A 3A8KA 4CH1A 2B7CB 2NQPA 2D3O1 5SZTA 2AGQA 3BDPA 4I0WA 2JJLA 5B0BA 4ED2A 1GL2C 5THWA 4G1IA 1NK8A 2BM0A 3THTA 1SUQB 2J8AA 3MMJA 1YJ7A 4YDXA 1F6TA 4L3NA 4QZVB 3R7NB 2ZE2A 5AE2A 3D3BJ 1M5OC 3QIPA 1X9WA 3QT7A 2B0GA 3A2AA 5HVGA 2KO1A 4LBPA 3H1KJ 1OS5A 2DXFA 3A7OA 3KJVB 2NPIA 3QFWA 1FJCA 2Y1RI 3SZ2A 1EAYC 1TUWA 3KK1B 3H2VE 1F3FA 3H1LD 1SXLA 5CYJA 2Y0EA 4HYKA 1HJ0A 4EWTA 3CTRA 3S6EA 4F3MA 3DKDA 3TVZA 1GU5A 1N5SA 3HHLC 1JLCA 4ANCA 4P72A 1KTVA 2QJ3A 4LMZA 3BO4A 3MP7B 2X1BA 1VDHA 2E7WA 3CC7P 1FDNA 1VQSA 3Q8RB 3HE4A 2QFJA 5J2NB 3PR4A 3A8EA 3CXHI 2GC8A 4KV8A 4M63A 1QAYA 2JDJA 4ETXA 2LQ5A 1Q90D 1HWJA 4U7UD 1NWQA 4ILRA 4P73A 2UVVA 1D3WA 5FIIA 1X9MA 4CO4A 4R4MA 5KLVE 1APSA 4ICLB 1S49A 3MGJA 1RWVB 3PFEA 1FZBA 3D2WA 2ZUGA 2IYIA 3WX4A 2BQUA 2XSFA 1SQQE 4ZLJA 2D74B 4C48A 3HD7A 5E7OB 3ILIA 4JQ0D 3LP1B 2MKJA 3J7YI 2GW8A 3NNAA 2G1HA 3K8VA 2YO2A 1U02A 5AXMA 3P5TL 1U2FA 1NTKG 4B86A 2FFDA 1S57A 4ZCIA 1E6YA 4ZKUA 5CMZA 2CQDA 1Y8AA 1HNIA 2Z5IA 3KPEA 3P8CE 2RHSB 2XLJA 1R5LA 1JLAA 1OYDA 1WHWA 5I3UA 3SCJE 2EFVA 3KLFA 3DOKA 4M5LA 2UXCJ 4F4YA 5CCHD 3H1KE 1JCDA 3PYGA 4WBFA 1H2TZ 4UY8T 1JKHB 3FCHA 2IPPA 3ISNC 4K4XA 3P8BB 4OHWA 2B89A 2R2UA 2H8PD 5KFCA 4ILMA 2HG4A 1VCTA 2PC6A 4IG3A 5LSRA 4JI5J 4CNYA 3H2LA 1IFJA 3QWOC 3R97A 3MECA 2EC2A 2V8DA 4PV1C 5JJBA 2QLBB 2LKZA 1B64A 1S9EA 1D1UA 4IL6X 1FRLA 5AW6B 2XWXA 4I2QB 1RHQB 1RLDA 4WCEQ 3RL0B 2RH0A 3M05A 3GIMA 2JWAA 1QJHA 1S5LH 1T05A 4PXBA 4FVCA 3RK2D 1U57A 3UWTA 1XTZA 5DZ7A 2J9DE 1JY2N 1S48A 3MZIA 4DR6J 1SS1A 1FRIA 1DH3A 2QLJB 1LTSC 2HBZB 1QE1B 5EDWA 4V19X 5LM7E 4NZ6A 1F5CA 4UQGA 3CT9A 2M52A 2YIUC 1A02F 4XPCA 2BANB 1DIPA 1KHVA 2HZCA 1S1VB 3DFEA 4ENOA 1M1KQ 1FTCA 1IBLJ 3TDKA 2D3OR 5KLVK 2Q3EA 1VOMA 4NLTA 3CDBA 1NTKJ 1MG7A 1NJYA 1TL1A 3I9V9 2DNLA 1VQMP 3HHEA 4NYOA 5D3GA 4RBUA 4X66F 2G2ZA 2G8YA 1F5BA 1QAIA 1KN6A 1H73A 4KE5A 2XNXA 1IBMJ 4JI6J 1P9YA 2MJUA 3PJSK 4DCOB 1IKWA 3KK3A 1KC8Q 3NNCA 2C9LY 3RGIA 2COLA 3BDEA 4R8UA 1RT6B 3O6QB 4MKBA 1VQ9P 3B82A 5H9EK 4I2LC 2VQEJ 3H42A 4WP9A 5HLFA 3A5TA 4KAIA 2GMLA 4EYYQ 4ECYA 4P10A 5HMWA 1FX4A 4W4MA 4OWFA 4ZCLA 4LF5F 5IWAF 3HZGA 5GAEI 1T9WA 2ROPA 1S1UB 4ZCKA 1PAUB 2G13A 3L70D 3A3NB 1NO4A 4C4WA 2K1RA 1YTYA 1NHKL 4NWBA 2DHAA 4N6JA 4B3OB 2HIQA 1WC1A 2B51A 1RWKB 4LF6J 1ZAWA 1BQNB 1RT2A 4B3TF 2EWHA 3MM5B 4CM0A 2Y1JA 2EVZA 3QT5A 4Q44A 2OJ3A 2ZT9D 3C8VA 2OPRB 3QWPA 2BJ9A 3QJPA 5IT9U 4IKAA 4DX6A 1YJ9P 4EFAC 1R8AA 3DOMA 3AY0A 3N4XA 2FYUD 1N5YB 2UWJE 1H8AA 2RJZA 1S1TB 2IY5B 3AJ2A 2LU2A 1H0TA 4AL6A 1QVFR 1KZUB 1SIZA 3BEGB 1XERA 4PG4A 3OL7A 3V4MA 4L76A 4BC9A 1KQSO 2VONA 3T3FA 4TVAB 3RB6A 1UCNA 4CIOA 1UVNA 2Q9IA 3KYLA 2OD6A 4MH8A 5GVQA 2XEXA 2LQBA 2Q6BA 4UTGA 2M5AA 4M5DB 2J7KA 1JM0A 2MKKA 2LXIA 3DMJB 4DL0C 2Q1LA 1GL2B 3R2PA 2JRSA 1URNA 1CJVA 3W5XA 1YSJA 2QA4G 2WBMA 4X4QA 3HHDA 1UL3A 2Q7CA 3GMAA 1TVRA 2GM4A 4KO0A 2IVFB 1JNRB 3FCVA 2BASA 3DC2A 5B08A 2W4CA 4C0OC 1KYOE 4X84A 1PP9E 3QWUA 4DOJA 2A18A 4HL9A 4KGZB 2RH3A 2YH1A 5J1PA 5KFDA 1FEEA 1LT9A 2F4FA 2NXNA 3SQOP 4AXIA 3C15A 5LJ3Y 1FXLA 2BACA 4AYCA 4KGXB 4WIQA 2W83C 1RT7B 4I4BA 1LK7A 4PQUB 2Y0CA 1BQXA 4OV6A 2DRDA 1UWBA 2OYIA 3PTWA 2R2TA 3K5LA 3C6UA 2DEIA 2XMKA 3PACA 2EG1A 1XNRJ 3QGPA 5K14B 3W60A 5CZVA 2G0JA 2CDQA 4W7ZA 3SFEC 2KN4A 1QD1A 4YFUA 2R7SA 3PJWA 4NLGA 3CMAP 1AJYA 3C8YA 2BRLA 3ZZRA 3A3PB 3H1HD 5EWGA 4UOCA 1FBMA 1FZCA 3Q86A 3U7JA 3CJKA 1SP4A 3FVYA 3D5MA 3UD5A 2VQFJ 2HFNA 5IQQA 5C7PA 1H38A 3D3CJ 1YHQS 1VQYA 2E9TA 3D28A 4JI1J 1VQLP 1GK4A 2R5BA 3CMQA 2D41A 4ZVRB 4KHRA 1VQNS 2YQ3A 2NPSD 1DD4A 4XFJA 1T9UA 2PI5A 2CJQA 4LSZB 3U1MA 4YP3A 2IVYA 3D6YA 1BGYE 4ZVTB 4F50A 3VMAA 1IR0A 4FYDA 2DIUA 2EC0A 3TP2A 3DGVA 3MCNA 3QT8A 3BF4A 3MURP 4QR1A 2HQGA 1VR6A 4F4WA 1N8RT 4CI0B 3R1HA 1HBMB 1C0UA 3M32B 3CJ3A 1PL5A 2AYMA 3FMBA 3JSVC 5APTA 3KMSA 4F8RA 4J7CA 4GVBA 2JZ5A 4RNFA 2HNDB 2VKZG 4J9PA 1JLGA 1D7MA 3SBMA 4O3SA 2P2UA 1HMVA 1PO6A 2XS5A 3EVWA 3MM7B 1CI6B 1P84H 3KYQA 3ENVA 3RTVA 1K8AQ 1HPZB 3NBPB 5K9FA 1YTZI 4RU9A 1JMBA 4FYXB 4C0HA 4I6WA 4LF9F 3VCDA 3ZTQA 4DS5A 1Q7LB 2HK2A 1OWXA 4M95A 2M9KA 2MZTA 1D09B 3TUZC 4FXVA 3GPAA 2MGZB 4ZPBA 2ZHBA 1HWLA 3B78A 1FRXA 2HQDA 1L4AA 3H20A 5EN1A 3EE3A 2FJDB 2N3LA 2P9CA 1UTAA 3M6UA 3DLEB 4DJBA 3GU0A 3UDCA 1GMJA 1D0EA 2GAGC 2H3EB 1TAUA 3V5RA 2AYEA 3Q23A 3M8QA 4K4ZA 1U1LA 1RE4C 4CP5A 1YBAA 2HQCA 2M3DA 3HUSC 1KSPA 3L36A 3M7VA 2CPIA 1DTTB 4F67A 4EGLA 3HT0A 3J81U 4XE5B 2PE8A 1M90Q 2LKMA 4CO2A 3I5CA 2DK2A 3CNQP 2CXEA 1RACB 3OR2B 3TA1A 1T9TA 4LSLA 2HIYA 4DL5A 3TVYA 2DISA 4DCPB 3VN0A 4M5NA 1SQBG 1S1XB 3CULA 1LK5A 2P2CB 3EDRB 3FBBA 3W2VA 3PKMA 2GVDB 4W90B 3CDUA 2H89C 3KOAA 2KT2A 3NS6A 4ITSA 2C28A 2Y3YA 3TGUG 2R7VA 3FDSA 4LR9A 1MSWD 1EKSA 1X31C 2DCLA 4X64F 4HJGH 2WVFA 3W8PA 2VPYB 3T1AA 2V9WA 1HNWF 2VA2A 1TV6B 2DHSA 3A3YB 2E29A 4LR7A 3D0GE 3I5AA 2YXQB 4PQAA 2AJ1A 2ZOFA 2DNZA 3Q8YA 4MJKA 1JK9B 2VFSA 4FZVA 3H32A 2ZBRA 2WSCC 1WC5A 1IFPA 3CCVS 2HVIA 1FJGJ 3KUEA 3H1JD 1NHUA 2YNGA 1BE3D 1B70B 4KGMA 3RZAA 2CZ4A 4DFKA 3H6PA 2DNNA 1KS2A 3P6YC 3UNYA 4DR3J 1L0NE 2WB4A 4KKOB 1RYSA 2H88C 2A45H 1TKXA 1GU4A 3K5NA 1CVJA 5DDOC 2Q5UA 2HHPA 1FDIA 3RL0g 2ALYB 1LFWA 2I0XA 2BABA 2HSEB 1MMNA 5DETA 1X5OA 3ILLA 5IXUA 5JXSA 2IAJB 2E74C 3GV5B 3ITHB 3MAAA 2QEXP 3FGAD 4ZPCA 1WOPA 4IOBA 4TLRA 4CCHA 1IZNB 3M8WA 1F0XA 5L8RJ 4LRCA 1SQPD 2ATLA 1IBKF 4YQWA 1FRHA 2HHHJ 3DN9A 3CJSA 3GMGA 2UXDF 4Y00A 5KTQA 1NJZA 1ZH5A 1SQBJ 3SWKA 1J2JB 3Q2YA 2ZKUA 2AT1B 1N6QA 4DU7A 4ED6A 4WZMA 2W7OA 2NUHA 3M91A 3TGUJ 2VBZA 1L0LE 4I2PA 3H40A 3FRZA 2HRTA 3OTOJ 2C2EA 3M30A 1M5HA 2HS3A 2BJ7A 3MGNA 1U1OA 5AJ3J 4NLPA 5DZ6A 1FI4A 3VWSA 4DV2F 2NXEA 2EFQA 3M0AA 2XYGB 2HZVA 1Q82Q 2KOGA 4WKRA 1ZM4A 3AHPA 1R3NA 5ADZA 2B56A 4RNOA 1WKLA 2O1PA 2FPHX 1NPKA 2WW4A 1S0OA 3CXHH 5GMKa 4ECTA 1F5AA 3LPYA 5T14A 2K06A 2Y1LB 3M8SA 4LBIA 1EZVD 1HQEB 2FHJA 1X5TA 1N32J 1ZRTE 2RD5C 5ETSA 5KAIH 5A2QU 2X1AA 2FLNA 4OH8B 4K4UA 3GIKA 1KDNA 3T6JA 4FDFA 4FS1A 2B8PA 3MEGB 4ED0A 3L72D 5HI7A 2ZD1A 1RHKB 1YI2P 2G2YA 1NTZG 1SQXJ 1QVFO 2E5HA 4ZKAA 1L0NK 1IJDB 4EUVA 1HD1A 1QL1A 2MKHA 4DV5J 3R2DJ 3DHWC 2JHEA 3DOLA 1GL2D 4U3FD 2YWHA 4P75A 1P84D 5KG5A 5CD4H 3T1YF 3FEYB 2YKNB 4MK9A 1REVB 4DUTA 3CWBD 2N7CA 5AVRB 5KT7A 2AD9A 1S97A 5CCGC 1RKIA 3Q2SC 3IAOA 3MHYA 2GV1A 3P49B 1VFJA 4IOAQ 5F9LA 3L71J 3PRVA 1JY2P 4G3IA 1GW4A 4JP8A 4WB4A 2DNYA 1C1BA 2RQCA 5T41A 1BGXT 2CQHA 1J5OA 5KFOA 3JCUH 3HHLD 2WTYA 1R7IA 1L0LK 2BCCG 3GLJA 3LOUA 1KD1T 3G6EP 4HHJA 2RSQA 3M9QA 2G2OA 2J6SA 3H90A 1TQLA 3POTA 4U6PA 2RDIA 2JOQA 3BPDA 4OX8A 2SXLA 3KLEB 2BYCA 4J9NA 4MFBB 3BGFA 3VAKA 2W8KA 3M2VA 1JLQB 3ZTRA 2ZH2A 1TMJA 3HKWA 3U1NA 4WY4A 3QGGA 1EDJA 1AA0A 4QR0A 3Q83A 4LIWA 2HLOA 1SQXE 2OI2A 1GH8A 1NTZJ 5H9FJ 1FWPA 1OPZA 1HI8A 5KT5A 3GIIA 4PUOA 5HBMB 1FZAA 4RW9B 4PXCA 2ZZTA 4ZKPA 4Y65A 2GFFA 3BO2A 2IM2A 1GT8A 7AT1B 2HHSA 1JIHA 4ILLA 1U1QA 5A0YB 5I42B 3UO0A 4F4AA 2E5LF 3VF0B 1SUQA 1Y5IB 1G7CB 4DS4A 3NWGA 4K2XA 1N5VA 3L71E 2KXHA 1SC1B 4NI2B 3ISND 1KONA 2JJ4D 2JVOA 4OX9F 2Z2MA 5GAHI 2IBZG 4GT1A 3KJVA 4IFDK 1VK3A 2KP8A 4PWDB 5C42B 1K1SA 4HHHA 1PPJG 3I31A 2QM8A 3KK1A 1UJ6A 2BCCJ 1VJWA 3FC9A 4ZVFA 4PV1D 3QQCD 3LIDA 2E1RA 5L8RC 4MAKA 3S1KA 2IX7C 3ZZPA 3FBCA 5M2RA 4IR9A 4LC1A 2QM7A 3TUIC 4DQQA 1EZZB 1N34J 4NCAA 3V2UC 1RU2A 5J2NA 4RW7B 2WRMA 4LFBF 1FT8A 3RG6A 5KFHA 3PX6A 1RWMB 1SQVG 2RS2A 4M3LA 3GTYX 4HDGA 3TI0A 4ICLA 1H7XA 1VPCA 5E2QA 3CD6S 5KKZB 1HBUB 3T9NA 1G3OA 2LEAA 2OTLS 3GF7A 1W25A 4KYZA 2PSZA 1YITS 3R7SB 2W2PP 5BU8B 5IV3A 3LP1A 5LMUF 2H5JB 3BCCE 3KMQA 1WC3A 1YHQP 4YB5A 3GFHA 4CLWA 2VBXA 3K2YA 3JS9A 1HVVA 1VQNP 4OZLA 2IDLA 1UAWA 1HLWA 5KFJA 1T02A 1S9GB 2AW0A 2Y0DA 4Z37A 2FD2A 5KLVD 2WONB 3L73E 3P45B 3CXHD 3TEHB 3B6BA 1LP1B 1X0TA 5LJ5Y 4FNHA 2E7VA 3DDKA 1NB7A 1OQ3A 3NGUA 1KFMA 2KZIA 3N6LA 1JKHA 1SQQD 3O8ZA 1XR6A 4GKKJ 4IL6E 1BE4A 3SCIE 4TQSA 4UOGA 2DNQA 1FDBA 3MM8B 3L74G 2KVQE 1CS4B 1YBTA 3K7RA 1PJ5A 3QZ7A 1KP6A 1WEYA 2HKEA 1U24A 3P8CD 1NU4A 4I2QA 1ZP0C 1JEKA 2LDIA 4OYWA 3MM6B 3GQCA 3EWKA 1X4HA 1SQVJ 1G1XA 4NCBA 3MR2A 3HFKA 1U1NA 4USKA 2MB0B 1LV5A 1LNQA 3H1KD 3H1IE 2KI7B 3GG2A 4URQU 4H54A 1VQ8P 1UMJA 7FD1A 1QE1A 3M9BA 2AX0A 5HVHA 5LMNJ 5HMYA 4F0KA 3KG1A 2BANA 2IJFA 3QZ8A 3I9ZA 3KTQA 3O2IA 1ZN5A 2K1AA 1GD2E 2P5VA 2E1AA 1EIYB 3H1LG 4IFFA 4CNZA 4DV4J 2FFDC 3SEOA 3VHQA 1BD6A 3I55P 2ZFCA 3BZQA 2F40A 5TJHA 1LWXA 1LT1A 4MIWA 1YZ7A 1KTQA 3C6TB 4OYAA 1M7LA 2W4PA 1TUGB 4GOEA 3N01A 4IH5A 3AE8C 1SJ3P 5F8HA 1JXVA 1UW4A 1Q8BA 1RT6A 3O6QA 1N0UA 1Q5VA 3ZZYA 3P7KA 2ZJSE 1N7SC 4JI8J 3QGHA 2MHEA 2MKYA 2E43A 1UVMA 2LXBA 3H4BA 3CO0P 4ED5A 5E3AA 1NJXA 3DNCA 1KB9I 3OTEA 4B3SJ 2RRAA 3HVAA 1Z2LA 2YQ0A 2YNYA 3L74J 1S1UA 2C0WA 3CD0A 2CWKA 2E75C 1S4XA 4B3OA 3KHRA 3HSDA 2DCUB 1YQHA 3NXSA 3S7RA 3RK3E 3QLHB 3LWMA 4QPXA 3NTNA 1BQNA 5E3CA 4X65J 3PW2A 3MM5A 4C97A 2VIHA 2UUCF 4NXNF 4A4JA 2P8IA 3L7UA 4LRFA 1K47A 2ZBPA 3CCVP 2OPRA 1YJWP 3K17A 4RKUJ 1NEEA 1H2UX 1DY3A 3J7ZT 4ZIWA 4PYDA 1WF2A 1N5YA 2DH9A 3IO1A 2HLUA 1FDDA 1S1TA 3D6ZA 3A0HE 1JLBB 3UQSA 2C2NA 1CJTB 4QJVA 2IHR1 1OXZA 3I0SA 4FVMA 2ILZA 1N33F 4P2MA 1TR0A 3U02A 2FXMA 5KG3A 3MEEB 2AKWB 4DHVA 2XMVA 1N73C 2ZZNA 2CQ0A 2J8SA 2LR2A 4EDFA 2PT0A 1E6VB 2QL5B 5F3ZA 4ELTA 4M5DA 3RAMA 3V6KA 2VG7B 3VZHA 5RUBA 3DMJA 3IRXB 4OJ1A 1GL2A 3A8IA 4WTOB 2KZMA 3MUDA 2A10A 3H4DA 5K8NA 3DDNA 4ED4A 3D6MB 3ZZOA 5KFBA 2C2KB 2FJXA 1S0NA 4JYBA 4OYPA 3BKUA 2U2FA 4CLYA 4X4PA 1S5ZA 5H2FH 2GMJA 4ZP7A 4JBCA 1YQ3C 4DUYF 3PRJA 4ZVOB 4JI7J 4R0EA 4LJMA 2V50A 4X4SA 2HFZA 1Y9OA 4YEAA 4WU2A 3MDFA 4QU7A 1EJ7L 1NTKD 2JC0A 3LUYA 2C2ZB 5B0EA 3PG9A 4JOUA 3CCRS 3D67A 1M5SA 1RT7A 4PG7A 4QR2A 4PQUA 5GTHE 2UUWA 2P6SA 3AXMA 1WKJA 3NG8A 1U6BA 1Y7PA 1LGHB 2KB2A 1S76D 3LAMA 2DB1A 2Q6QA 5K14A 4DV7J 3MWBA 3OLAA 1N7LA 3IXQA 2J6UA 1DBDA 1FC2C 2LYVA 4DR4J 2RMZA 4WFXA 3VAJA 3VYIA 1V6HA 1HQUB 1HL6A 3HP6A 1RU1A 1YBUA 1PP9D 5ETQA 1NO8A 3FBEA 1QAJA 3KLVA 3IWXA 4RU2A 1NBEB 3MR3A 4LF1A 1V3ZA 3SWYA 1SJRA 4P7TA 2VC1A 2DGTA 4JV5J 1N52B 1RAEB 2ZKTA 3QSYB 3MAHA 3G96A 2MDAA 4WFZA 1SCJB 4DUZJ 3I5BA 4DQIA 1T11A 3L70G 3R9LA 4LF8J 4QWAA 5AVXB 5KG0A 5CYMB 3MXHP 5CAAA 4XK8C 1V5IB 3SMZA 2VB6A 3O5TB 3Q3DA 3QFHA 2WVDA 3WHIA 2IM3A 2FY1A 2E44A 1K04A 1AXQA 2WPQA 2I8DA 2D3ZA 4NLXA 1Q5YA 3TZWA 1LWCB 2ZH6A 1MN9A 4K7QA 4KFBB 2V8PA 1NVOA 1HBMA 2DH8A 3M32A 4K0KF 2ADCA 4X4TA 4ZPWR 3J80Y 3DLGB 4OYMA 1HI1A 2HNDA 4Z1MH 3TAPA 4DV6J 1LT9C 3B4DA 3PZPA 1KVJA 4DI6A 1ZMEC 3NKYA 4IRDA 4NLUA 2VH7A 3MM7A 3V2QA 1CI6A 3T5LA 4RJTA 2IDEA 5E33A 3BKFA 1M1HA 1HPZA 3NBPA 5M2PA 3LH2S 1QVGO 1BXNA 2YNHB 2I2YA 3SI8A 2DTJA 1MZ9A 3DRRB 4C11B 1ZLLA 4QWDA 4NLOA 4K59A 4ZVPB 3BH7B 4NLSA 4ZITA 2MGZA 1RHJB 2GO8A 2IZ1A 4BWMA 2DY9A 1AZSB 4M5MA 4IFYB 2AJQA 1FZCC 3DLEA 2BQRA 3UDVA 4WYWA 3MPYA 2RUSA 2OFHX 2E74D 2DNKA 3S8SA 3MFHA 3J7YU 3ZXWA 4C2MA 1BUXA 2Z58B 3OUYB 1NKZB 3DYAB 4UQTA 3DGPB 5F8LA 2B9XA 4CH0S 3L70J 1DTTA 1WSRA 3LPEA 2AIRB 4PD4E 1R0CB 4S0MA 2MJNA 1P6TA 3ET6B 3OR2A 2D2CB 1CJUB 2E5IA 3GONA 1S1XA 4O44B 3KXDA 3VP9A 5CH7B 4RKUC 1T95A 2BJ3A 2GVDA 3GP9A 3R5CA 5KFNA 1N7SB 2MZ1A 1C1CB 3Q8UA 2V2KA 5DQIA 5KFEA 2R3SA 3BREA 2XMUA 2J5AA 2CPEA 2V2QA 1Z2ZA 3MD3A 1Y47A 3H1HG 4AUKA 4XTTA 1TV6A 3IN6A 4X4UA 3OR1A 2IA6A 2GZOA 3GR0A 1SQGA 4YB6A 3PFOA 3MCSA 2C22A 2OLWA 4NOHA 3OFGA 3ENQA 3TEGA 2HGLA 2KHCA 5C2CA 3Q1MA 1F9HA 2BMBA 4URSA 3T6BA 1LTGC 1TL4A 4TU8A 2CJYB 1RP5A 4USHA 3ETMA 2HQ3A 2HWIA 3ICLA 1RE3C 3G8QA 4N56A 1P9QC 2AXCA 3M1VB 4UB8H 1L4AC 4AL5A 4DFJA 2L5GB 3L9ZA 2AHOB 3HXMA 2EKYA 4RW8B 4DX5A 5AW5B 3BS9A 1DQ9A 4KKOA 1PJ7A 2P9EA 5CYQB 5AW4B 1OIPA 1ZAVA 1HD0A 1NH8A 1S9FA 2A06E 2ZWPA 4C3KA 1WHVA 3QT6A 4JI0F 2IAJA 3OL9A 1N73B 3CD6P 2HZAA 2Z2LA 3ITHA 4CLLA 3DM2B 2WVEA 2OTLP 1IBCB 2GHVC 1JNZB 4Y2CA 1C4CA 1M0SA 2XI2A 4A8QA 3HJVA 4KB7A 2QJKC 2HFED 1H88A 2NPFA 4F0HA 1YITP 2XM3A 2V4JB 3DXBA 2EW9A 5CCGD 4A8YA 2ADBA 1WELA 3AEAC 2C0XA 2KYZA 2J9DA 1VF5B 4B9TA 4RWXA 3PIOQ 1NHVA 3H1HJ 4O0NA 3TR5A 1NTMG 4IH6A 5GAEU 4ECVA 4QIWD 1W7WA 2D3UA 5KT3A 2UUAJ 3HZEA 4X62F 3BGRB 4C8LA 2DVIA 3HF5A 1VGYA 1AROP 1AW0A 2R8JA 1EDLA 4OI6A 4C46A 2IMWP 5IS2A 2ZVIA 3VVUA 1S9KE 1K9MT 4DV0F 2FZKB 1RYRA 2JWDA 1RWWB 1VISA 1BC6A 2J9EA 2X1GA 4IG0B 4KIAA 2V94A 4ZP8A 3D7SB 2QIFA 3RBEA 1GTEA 4NA2A 1HQEA 1ZM2A 3ETOA 1L0LD 4QIGA 2N4DA 1W2IA 2BW2A 3G3ZA 3OJUA 2J58A 2DGOA 5KFTA 2HAIA 4FP9A 1PSDA 2RHQB 4CWBA 3MEGA 5FLXY 4JI3F 2CPFA 2DXEA 5L1IA 1IQZA 8RUCA 1LTAC 3BV8A 3EQ2A 1LWFB 3R5GA 2ILYA 1Y4ZB 2F7VA 3HK2A 3ZZUA 4CQ1A 1K0TA 2IJNA 2QIWA 4YHHJ 3I4PA 5KT4A 5K8OA 4I67A 2F5GA 2RUGA 3RK3B 1ZA1B 4DX8H 3KNAA 2YKNA 2WB1D 2CQ3A 1NU1G 4Y34A 4HKZH 2CQ1A 1REVA 2AGPA 3H1JG 1BCCE 1WACA 2LCWA 4QYZK 3PV8A 4RUHA 1BE3G 3MHVA 1RT4B 1WF1A 2BR0A 1FZFA 4OYXA 3AEGC 2XGQA 1NSAA 2AYBA 1NTMJ 1YJNS 1UFLA 4Q7AA 4HH0A 3NS5A 2V4RA 3WU2H 4QIEA 1SL2A 4DR7F 4ZLNA 5K8PA 1C4AA 2KLVA 2JLFA 4FBUA 2WVCA 2XTJP 1FOSF 1RH5B 1JOCA 1ZETA 4U96A 3MMBB 5AVYB 3FSIA 4YMEA 4I6MC 3ZTOA 1PFIA 1UEVA 3C19A 3AA8A 2VASA 2Q79A 2HYIB 4KT0J 2DGUA 2J0SD 2JLEA 1J1DC 5E3RA 2UVRA 3TJ8A 1SQBD 3H8YA 4OI4A 3TNUB 3WC0A 3KLEA 3AJDA 4MK7A 3PP5A 1WC6A 3PIPQ 1VRQC 4MFBA 4OZ5A 1IM4A 4Z2XA 4OZ2A 1K0VA 1K44A 1CSBA 1KILE 1JLQA 3LTOA 4TQRA 1T7PA 1Q81Q 4Y99C 1NUEA 1RAHB 4USWA 3G2XA 4J9OA 2ZAEB 4C3MA 1S5LX 1EKRA 3BGUA 4WYLA 3CLQA 4LF7J 4ID5B 4FKYA 4NL5A 5KFUA 4KH0B 2B9BA 5A8RA 5HBMA 1VBZA 4RW9A 5DGAA 2KI2A 1H0HB 4C8KA 2RF2B 1CSJA 5KFRA 1U45A 2HVZA 1QL2A 1CPZA 2H9ZA 2N4CA 3L4FA 3CIZA 5A0YA 1WHYA 1NU1J 4CPGA 5I42A 3W68A 1FTRA 3HDSA 1XQIA 4L75A 4NX9A 1NKNA 2CQ2A 5L1KA 2C3OA 5J1EB 1R5SA 5D15A 1LWEB 2H43A 1HBOB 1EZVG 1AFOA 4OIXA 3OXLA 4PJ0E 1ZOYC 1Y10A 4NI2A 1SQXD 4GC6A 3Q24A 1XNQF 2R7UA 1KB9H 1PV3A 1OW6A 2QMXA 4PWDA 5C42A 3BSCA 1X4GA 4A46A 2ATCB 5GMDA 2W8LA 1RT5B 1T3UA 2H7HA 5KFQA 2XO6A 1PGPA 2CNNB 3DRSB 2I1KA 1VC6A 3F73A 2QJYC 1U09A 2RILA 3CCRP 3FZ2A 1O51A 3FWNA 2A0FB 2AU0A 1WMKA 2IZ0A 4RW7A 1K73Q 5KOXA 4ZOSA 4LT6A 2ZNZA 2ZXXA 3L71D 4WY4C 5E79E 1X8YA 1WRGA 1WC4A 2UXCF 3CWBG 3CCJP 3AH6A 1JLFB 1JJHA 4PG6A 3OL8A 4Y2KA 1DTQB 2QGFB 3TZXA 3LA0A 1FF2A 1I5OB 4WXOA 5J2PB 1FK9B 1HBUA 4G65A 4YB1P 2B8QA 5HANA 4DV3J 3MPDA 1KTMA 3TJAA 4F02A 2HODB 1SH0A 2NSBA 4JI5F 2EK6A 3R5BA 1NZ8A 2D9OA 2W1BA 3KJNB 4DL2A 3SDEB 3QAUA 4OLPA 2QSIA 2QJKB 1BWEA 1NAQA 4NMXA 2EG2A 1KLNA 2DGXA 4DZ6A 2DR7A 3BGOP 3ZFVA 5BU5A 5APYA 2NR0A 2ZM6J 1F1BB 3C2PA 1N7SD 4DR6F 1S9GA 3ISZA 4LREA 2N1TC 1IK7A 4DCJB 2HURA 4DLGA 3GG1A 2BXJA 2WONA 1Q95G 1LP1A 2DNHA 3D6HB 4AQYJ 3OL6A 1V5VA 2HGNA 3IAS9 2GO9A 1KOHA 1IBLF 2BE7D 2E75D 1TKZB 1HF9A 4UUWA 3CMEP 5DLFA 3MM8A 4XA4A 3HD2A 3HVRA 4PKDB 4PXEA 2JC1A 2UVWA 1CS4A 2X1FA 3GR1A 1PJ6A 2BW7A 1M56D 3PLNA 1IBMF 5KT2A 4JI6F 1RADB 2VJVA 1S12A 2UU9F 2P7JA 4JF7A 3MCMA 1HGZA 3MM6A 1CQMA 2CAJA 1M1JB 1WD6A 2ZH4A 1RLCL 1FHTA 4EO6A 2GNKA 2HBYB 3BRVB 4GMKA 1ITPA 5DRKA 4ECZA 2VQEF 2UUBJ 3KLIB 2DR8A 4RNNA 3RYLA 4RWWA 4AT1B 3UD3P 4MKVA 1CG2A 2KRRA 1RSCA 3GJSB 3G9RA 2J7UA 2BCCD 2IJRA 1WG1A 3NOCA 3FGVA 4RESB 2IMOA 4K4SA 1AQ5A 1JY3O 1O8BA 1JTHB 2M70A 3TNVA 3FRYA 2GQCA 5DJTB 4RO0A 2RQKA 3CCUP 1U0HB 1M1KT 1JMTA 4WP3A 4KT0C 4B9UA 2VG6B 3T5JA 1B3TA 3BGLA 3W66A 3QH9A 4LF6F 5L9XA 2KHDA 1R8PA 3C6TA 2H5EA 2HWTA 3GG0A 2HHWA 1NDKA 4LQ3A 2OTJP 3W2WB 2HR3A 1KC8T 3KZIE 3H1ID 1UZHA 3PX4A 1ZR4A 1NPRA 4I6AA 2K3KA 1ACMB 2QRRA 3EX7B 3M9MB 2CQCA 1FWKA 4DF8A 5E3PA 2OIHA 1KORA 1RQUA 5J1NA 2E9RX 5D4LA 1J1DB 1IFNA 4M5KA 2FZCB 2F65A 3CI9A 1FVQA 3HT3A 2GA7A 3RL0C 1RK8A 2VFVA 3MUMP 4ECRA 2RU9A 3QLHA 2O1KA 3TYYA 5DQHA 2W24A 5LOQA 2QLFB 2NXJA 5JUMA 2C9NY 3GW6A 1D9AA 3H5YA 2AXTE 2YKAA 1CBKA 4EU0A 1FE0A 1U26A 4U95A 1SKSA 5KLVG 4PG8A 2W6AA 3LALA 1JLBA 4RL1A 4TY8B 1CJTA 1ZPVA 3BYPA 5BR8J 1USEA 3M9HA 3TO8A 1SFCB 3NCRA 3TVKA 4OMFG 5F3TA 1SQQG 3MEEA 3N5BA 2FLLA 2ASDA 1EQ0A 1T3OA 3HFVA 2VU5A 1ZXGA 1KB9D 3OPKA 2DPIA 3ZNUA 2GUVA 2YWFA 1XNRF 3GIRA 2YPYA 5KFXA 1U1RA 3NLCA 1E6VA 1G1IA 1SQVD 2B4OA 2RS8A 2VG7A 5B5EE 1FU1A 3DRXA 1VQPS 3IRXA 3PO5A 4CLSA 2Y9HA 2DRBA 3GV8B 3PJ9A 1WG4A 3X3UA 4OZJA 2UP1A 2Z4EA 1KKHA 5AW8B 1SL0A 5A8WB 4DPWA 4DL4A 3H1KG 3IS9B 2OH2A 4RR5A 2RN0A 4MIBA 2V4QA 3NGSA 2ZOGA 1KEKA 2R8GA 2VQFF 2FC8A 3B8HA 1TL7B 1GNKA 2XYHB 5F8GA 3OA7A 2LXCB 1Q86T 4JI1F 3I87A 4LFAJ 3EVOA 2M0BA 1VC5A 3C14B 3F89A 1LTBC 2PDAA 2K7KA 4LR8A 2AJ0A 2HMIB 4WIIA 1YG0A 4MYTA 2Z30B 1OZHA 3CF5Q 3QJLA 4H4OB 3H59A 4P7VA 1LW0B 4NXMJ 4OZ1A 2V69A 1IFIA 1TAQA 2B9WA 1W2BO 3NCPA 4PZVA 2HEKA 2W6BA 4UZCA 2MKIA 2ZYAA 4ZP9A 2N9BA 3CJQA 2DPJA 1SL1A 3P32A 1HQUA 3BKTA 5KLVJ 1Y9BA 3N6NA 2IM1A 2XS2A 3UE2A 2XNRA 2L9NA 1Q79A 4PUOB 2R7RA 2V2ZA 1GMWA 3KDPB 1HHTP 1MFTA 1S0VA 1BHNA 3PX0A 4FF4A 3QJJA 1SPBP 3MD0A 1FNOA 2MHNA 3IBFB 1HA1A 1L5UA 4MKAA 5CYMA 4O3PA 5H9EJ 2X51A 2HRUA 3CCSS 3MUDC 3OW2R 1SI9A 3N5FA 2V2VA 4J5OA 2XV5A 2KU7A 4EYIB 3WUUA 3G87A 2AQ4A 3L7OA 2N1TB 1HUCA 3RR7A 1LWCA 1KILB 1G1JA 4KFBA 3OHBA 2HS0A 3QATA 5GAHU 3PVXA 5KAFE 5GTIE 3DLGA 4JI4J 2OYOA 3VQSA 2W6JH 1VIOA 2ASJA 2IBKA 3IA0A 2A6OA 4DZOA 1WJ9A 2KS1B 1QX8A 5IT0A 3UR3C 2QYGA 1MMLA 1RWOB 3CD7A 4B9NA 3FMWA 1K8AT 3ENAA 5KFWA 4Q45A 2YNHA 3IR5B 4H44C 2I5JB 2OYHC 1L4AD 3DRRA 4C11A 1RDRA 1WOOA 1FDOA 5D8HB 2R5DA 4FF3A 2E1PA 3OV7A 1NSQA 1XR5A 1YJTA 4G1PA 2F9JA 5DG7A 4F25A 3ZC4A 2AJ2A 5KFMA 3DLHA 1AZSA 3OTBA 1ZR2A 1KRPA 1VBYA 4IFYA 2W90A 5D4OA 3QRPA 3VALA 4ZMDA 2CNLB 1Z4UA 4X4RA 5TISE 1WC0A 1JWWA 5JVGQ 1N4LA 2HPUA 1RTJB 1QY7A 3T9ZA 2DEJA 1E5WA 3OUYA 4UW2A 4KJMA 3DYAA 4AUWA 2NREA 3DGPA 1W26A 1EC5A 3F0NA 3M8ZA 3CB4A 2PMHA
chains in the Genus database with same CATH topology
2F8HA 3T97B 5A6WA 4OGQC 3O3LA 3W2VB 3DHXA 1FKOA 4OZLA 1M90T 1TUVA 3DLLQ 3GWCA 4N47A 3LP0A 3LP2B 1UAWA 4QYZJ 1ZM3A 1M5KC 5F8NA 2J5UA 4Y2MA 2IYGA 1HFEL 3EGNA 5KFJA 1QSSA 1VS3A 1T02A 4O23A 3D1HA 1S9GB 3IGVA 3HKZD 4DSIA 2AW0A 4NLRA 4Z37A 2WOMB 3MTKA 3CJ5A 3OVSA 2FD2A 2XSJA 2DNMA 2WONB 4OI2A 4O44A 3EPIA 1R8BA 1P8GA 2A1BA 4U7UK 5B0DA 3K5PA 4YR2A 2DGWA 1TK0A 5LJ5Y 4FNHA 4O3OA 1T94A 3DDKA 1NB7A 4TU9A 4B3RF 1OQ3A 4JUZA 2KVIA 5C24A 2Q66A 1C1CA 4B17A