3H25A

Crystal structure of the catalytic domain of primase repb' in complex with initiator dna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
188
Chain Sequence
DRTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
molecule tags Replication/dna
molecule keywords Replication protein B
total genus 57
structure length 188
sequence length 195
ec nomenclature
pdb deposition date 2009-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3h25A02
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h25A01
1FDIA 1ZMEC 1WMKA 1AJYA 3EWKA 3H25A 2P10A 1OMIA 3H20A 3IN6A 3O6QA 1FDOA 2G8YA
chains in the Genus database with same CATH superfamily
3PH0A 3CJKB 5CD4H 1LW0A 2RS2A 1S6QB 4L76A 4J9LA 1BE4A 1SC1B 4WFZA 2H3EB 4A8SA 2W01A 1BCCG 1YBKA 2OHDA 3IO1A 3WBZA 5EX0A 4FXWA 4B9TA 1OX3A 4IG0A 4OI0A 3SBMA 5T41A 2FFDC 4IOAQ 1WHXA 1WC0A 2DNPA 2JDJA 4OL8A 3V2NA 1FDBA 3PYDA 4KJIA 1RU2A 2D41A 3H0PA 5FJ4A 3L4BC 1HLWA 5B0EA 4JI4J 3L09A 5F8HA 2GV1A 1A6LA 4LGDE 3FK4A 2D9PA 3A8IA 2VDHA 3KHHA 1VMBA 4ZJLA 3AE9C 4WFXA 3FWNA 2Q5UA 1U1RA 4RNOA 1ICEB 3H1JG 1L0NE 1KHWA 4LFAF 4CLUA 3QWOC 1X5SA 2QLWA 1ITPA 3R2CJ 3Q5RA 2WPSA 4DPYA 2EXUA 2BE9B 4P72A 3L71G 5KT4A 1VQLS 1JY2P 3RL0g 1VL2A 4ED2A 4ER8A 2AKWB 3VTIA 3QJJA 2BEZF 3FNNA 1M1KQ 3AEEC 1UVKA 2GAGC 4DR3J 3HUSB 1LOUA 2A1BA 4URGA 2PSZA 4EZ9A 1S1UB 3RK3C 4K50A 1WHVA 4BXLA 4Y99C 2XMWA 4ZNCA 1MG7A 1T2KC 5HANA 1DD3A 1S5LH 1K05A 5CAAA 1EZZB 2J7WA 4NLRA 3OLAA 2GHPA 4U95A 5JVHQ 2BANB 1HW9A 4LF2A 4EYYQ 1HMVA 1L0LE 2OYIC 2I8EA 4KT0C 1G1XA 4XE5B 3P32A 1Q86T 5JUMA 2NYIA 2V8DA 2NPFA 1AVYA 3HF5A 3J7YI 4V1Ak 2MQLA 2QV6A 2Z2LA 1XR7A 5F9LA 2C3YA 9ATCB 4J7CA 2HKEA 3KLHB 2DRAA 3S01A 1FD8A 4R8UB 2BE7D 5KFQA 1X8YA 4N56A 3RBXA 3FMBA 2XM3A 3H1HJ 3BKTA 4PQAA 3U02A 2WTFA 1NB2A 4F25A 4F4AA 1QE1A 1IR0A 3G71P 4DV4F 3Q89A 3VN0A 2J9EA 3PJ9A 1HHSA 5AJ3J 2XWYA 1HI1A 1NDKA 4EYHB 4OLOA 2OPPB 1NU4A 1RXOB 4ZJOA 1ACMB 5GTIH 2K9JB 4LF4J 4PV1D 2E5GA 2CAJA 2YTCA 5L39A 1GL2C 2HGLA 3VMZA 5C25B 3UIAA 5KLVD 4NXNJ 4ELUA 2E5LJ 1XQIA 4K4UA 4ED4A 5KFGA 1GMWD 3P4UB 2JFDA 1N48A 1IR1A 2E1AA 5D78A 1RZMA 2M3EA 1S59A 1XNRJ 2DNYA 1VBYA 1Z2ZA 5CYQB 3PR5B 4JI2J 1T9VA 2R7RA 2D69A 2X3DA 3UDCA 5LSOA 4ZKAA 4DX6A 4KH1B 3ISZA 5C7PA 1ZW0A 2GHWA 3CJ8A 3HJFA 1W7WA 3KLFB 3LANA 1Q7YT 2EBGA 3IAOA 4U3FE 3DRPB 1NTKE 3M0DA 2BW2A 1MLAA 1YJWS 1VOMA 4KO0B 1CJKB 4ZLJA 1S10A 4X84A 2IZ0A 3D1OA 3Q5PA 1NH7A 1H89A 1SQFA 3NMDA 2X1FA 4ILRA 3D6TB 2XMJA 1P1LA 1K47A 5J2QA 4FDFA 2OH2A 1PP9E 1T9YA 3R97A 1AFIA 2YO2A 3BASA 3L4FA 2WOMA 2CPSA 2C2ZB 2P9EA 1R89A 2HQCA 3L35A 2GGPA 3E1RA 2Y1IA 2WVEA 5KOWA 5APVA 2KI7B 5D3GA 2DNMA 1NAYA 3R5JB 5EX3A 3AE6C 4WU2A 5M2RA 1I5OB 4B9NA 4HJGH 4YS2A 1PPJG 2J0QD 2UUBF 2C2NA 4MKAA 1D8ZA 2D3UA 4WYLA 3Q3DA 4USWA 4X4OA 1RWVB 1M90Q 3P7KA 1RI7A 2QL9B 4LBIA 2CJYB 2IFXA 2RRNA 4D3GA 1VQPP 1M5OC 3BGLA 1VRUB 1RF0A 2I5JB 1LTJA 4OYBA 3DI6B 4YMEA 1VQ8P 1QGKB 2FFDB 5DS7A 3TAQA 2MSSA 5KAIH 1FNOA 3OA7A 2YKOA 4DUZJ 4KHPF 4G6VB 2Z4EA 3ULHA 2AYGA 3POTA 2FYUJ 2H65B 1C2PA 1HGZA 3V2RA 1FRIA 1UCNA 4QWAA 3Q23A 3AD8C 1HYSB 2HYNA 2FXMA 1OSDA 3BDPA 1TKXB 3B54A 1YHQS 2MHEA 5D0RA 3C6UB 2VJUA 4U96A 1KSPA 1YQ4C 3T5LA 1TAUA 5CA5A 4H13D 4DFMA 2AYMA 2L9WA 1R7IA 2ZH7A 1ZPWX 3GIJA 1K04A 5D4NA 1GNKA 5KFTA 4MJKA 5L9XA 1JLCB 1MNEA 5AE2A 5AVQB 1VC5A 1NU1G 1T2KD 1D8YA 4Y0FA 4FYWB 4LF6J 5AVVB 3DNCA 2LP4A 5IOLA 3VAHA 2YKNA 4F4ZA 1S12A 4QR1A 3W5ZA 4DSJA 3X1LB 1RQUA 3TR5A 3DRXA 5L9NA 4CYUA 2J6TA 2HHTA 2OO4A 1T3OA 3OR2B 4B17A 1VF5D 2GVZA 2XGPA 4F26A 1J1DC 3CNQP 3ZZPA 3M2RA 4C6AA 3W7BA 4Y34A 4DF4A 3CMES 3MMAA 4KV8A 3A3PB 2WZ1A 3C46A 2C3OA 2DGSA 4UTGA 1N7SA 1RAGB 1NKCA 4K7QA 5LMNJ 2JZ5A 2FD2A 1X0FA 1G4CA 3KNGA 1HNVB 1RAEB 2W8KA 3KK2B 3FCWA 2WCXA 4YP3A 1LTSC 3UN2A 4N6JA 4MMOA 1RJJA 2CPDA 3BKUA 5KT6A 1VQYA 2ZOFA 2QMWA 1CJUA 1UWBB 3G6YA 2WZ7A 3S1TA 4NRUA 2OTJP 1ZTWA 3DRSB 1P84H 3CCRS 3MR3A 1OY9A 4K8RA 1T03A 2YPZA 5CYJA 3TRGA 2KO1A 2C2DA 2WSFJ 2HNZB 3LP1A 3HD7B 3H1HG 3IP0A 3K2YA 1KYOE 1S72P 3MM5A 1PL5A 2J8AA 2FUG9 1ZYQA 2CQBA 3HHLB 2UUTA 3G6VA 3LF0A 4USUA 2AXCA 1RA6A 3WX8A 3BQ1A 3R4YA 4ECVA 3ICLA 4M5DA 2HODA 2ROEA 3CJ3A 2VJVA 2V7QH 3WC0A 3KUGA 1XMQF 2I0XA 2JSXA 2NCKL 2VKRA 3M05A 4H13B 2R7SA 1OJ4A 2QEXP 2YVSA 1T3UA 4NLTA 4RBVA 1YTZI 2DR6A 2EBEA 4P7TA 2R8HA 1JLBA 2W9BA 3CWBD 3TYYA 2LDYA 2L08A 2AJ4A 1F9EB 1E6VA 3IGVA 5LMNF 1B7FA 3MGNA 5HK4A 3HFZB 6FDRA 4O9BA 4YN3B 1LTGC 1V9OA 4UT4A 4CZCA 1VQ4S 3BVHA 1UIIA 4EMDA 2G4BA 3H1JE 4JP8A 5KT2A 2A10A 3AEGC 2E1PA 4GIFA 3KTQA 4DZDA 3M0AA 4Z7YA 5A6PA 1S7HA 2YNIB 1DQAA 2WW4A 4CO1A 4RR5A 2M3DA 2QO3A 3WDOA 3FQKA 1QE1B 3D70A 4DOJA 3HLUA 3CMEP 4N5SA 2GGPB 2DXEA 1RGVA 2HR3A 2KL8A 3BM7A 2NUHA 2XU6A 4TT3H 2HODB 1KOHA 3KDOA 3JTNA 3UCGA 5H2FE 2EKYA 3BRVB 1U1KA 3H4BA 4C8YA 3HHLA 4B3SJ 2J0SD 1NGMB 3H1IJ 1RF1A 1OWXA 3RRGA 5B0GA 1YTZT 5CCHC 1JJ2R 2R8KA 5IT0A 1HVVA 1RY3A 4LFBF 2BASA 4USVA 3E8OA 1AJYA 3D2WA 2MZTA 3TZXA 3IS9B 3HD1A 3NP5A 1VQ5S 4NYZA 2IBZG 2JX2A 2EK6A 4QOTA 1JNRB 4MYUA 1F0XA 4A7PA 3CWBG 1RKIA 1FXDA 4PD4E 4U7UD 5B0BA 4BWNA 3DYAA 2E9ZA 4B3RJ 2CQ1A 3IRWP 2CPZA 4AD6A 3FQLA 4RL1A 2DGTA 5A8KA 1RAJA 2BBEA 4OYWA 4U9RA 5H9FJ 3ITHB 4CO5A 1FNXH 1PP9G 1KQKA 1FJPA 1NTMD 3DDNA 2B7CB 3KJFB 2ZZNA 4D6TE 4ZVRB 3E01A 4J9PA 1RP5A 3RB3A 1M1JB 2YKQA 3TQEA 1CSJA 2DR8A 2XKMA 1HPZA 1SB6A 1KB9I 1CQMA 5HMWA 4OZJA 1FJGF 2W9CB 4FP9A 2V6AA 2KDOA 2DNKA 3IC1A 5IQQA 1R0AB 1HKAA 1FEEA 1U1LA 5B0AA 3S4RA 2V2QA 4CLZA 3K89A 2E42A 2YKMA 1VK3A 3QO9B 4LF7J 3L70E 5H9EJ 2V50A 4NXMF 1U24A 1RF1C 3GIRA 1CEZA 4NLQA 3VGTA 4H0LD 2V34A 1J1DB 4OZ3A 1LWXA 1VIOA 1HWLA 1KVIA 2XHCA 4NCGB 1Z2LA 2OEKA 3D66A 4WIIA 2FKWB 1S1XA 2E1CA 2KRRA 3KK2A 1T7PA 4DR5J 3FBFA 4I1LA 3QLHA 2Y3YA 5KG4A 1HNVA 3OW2R 1S4EA 2ZH2A 1FE4A 3L37A 1NB7A 2KXNB 4PEOA 5HROA 4JI6F 1QAIA 5D8HB 1S5LE 1LV5A 4Z37A 4NZ0A 4ZS6A 1UWBA 4LVNP 3PHLA 4JQ0D 4OI1A 4I67A 3AA9A 4ZP9A 2DGXA 3ZZRA 1NU1D 1M5SA 3QJPA 2YX7A 4ZP6A 3QGPA 3KMSA 1O5JA 2MKYA 3UVJB 2HAFA 4K4ZA 2QRRA 4O4GA 2HFSA 3LA0A 2P7JA 1W2BR 3O44A 1SQQK 3M2VB 2W83C 5ETLA 2RKIB 1JOCA 3MMAB 5I3PA 2XO7A 1PJ6A 3CL3D 1IJFB 2J59M 2AGPA 2HRUA 2GZOA 2OPQB 2BKOA 4Y28C 2GMJA 3QSIA 3FX0A 4LLHA 2D2CB 3ET6A 3QLHB 4F8RA 3UCZP 1O0PA 1SQVJ 5IT4A 4QWEA 4NEYA 4NX9A 1X9VA 1JLQA 4OYIA 3K0JA 1HA1A 5T7LB 2MKCA 1RT3A 3NAHA 2Z4PA 3CJ0A 2FZCB 2C42A 1K0TA 4RUAA 2OMLA 2DW3A 3VV2B 2IAJA 3IWXA 2YNGB 4DR4F 3LQVA 1GMWA 1IR2A 1KFMA 1QD1A 1X4BA 2CJBA 1RQ0A 1QSLA 1URRA 1NJXA 4HTIA 2WK4A 5K8OA 4Q5VA 1YBUA 2H4WB 2BQUA 2HZCA 2K1AA 7FD1A 3L71E 1WUUA 1QVGR 2Q6BA 1IFDA 2PMHA 2IDEA 3I0RA 2ZOMA 1KORA 2J7KA 3KK3B 4DPXA 2WVRA 3W2VA 4QIFA 4IDKA 4LF4F 3HVAA 2FLNA 1RAAB 1TUWA 3N6NA 3Q8PB 2BE2B 1YX2A 1S6PB 2R3SA 4C3LA 1L3KA 2UUCF 1PGOA 4DU7A 5C42A 1YRXA 3VQTA 4DFKA 3AE5C 4K35A 1AQ5A 2KRBA 1VRTA 3Q8YA 2GVDB 3MDFA 4JBZA 3PG9A 2DO4A 1VFJA 1JNMA 3W65A 2VONA 1APSA 3GE9A 3TO8A 4ENOA 2BM0A 2ZE2B 3T19A 1WOSA 2V63A 4OYMA 2UXBF 2ZVSA 3JB9k 2E7VA 3KYLA 3KPEA 1A02F 4LRFA 2UXBJ 2JOQA 3K5PA 4ECSA 1VI7A 3NWRA 1ELOA 1JO5A 1HNWJ 1YJ7A 4A8OA 4KGXB 3JSYA 1CPZA 4ZHRA 3J7ZT 3PEJA 3NS6A 1KVJA 4GKKF 3AOAA 3RAMA 4B3MJ 4LT6A 3GFYA 4IUFA 5GTHH 1C0TB 2QL5B 2YQ0A 4F3QA 1QSYA 3HX9A 4MK8A 3A8EA 5LT5A 3OTEA 3SV3A 5KG5A 4DL0C 1DQ9A 4P2XA 3EICA 5A8WA 3A4TA 2QX0A 5CCGD 1R8AA 2PN6A 3DXBA 4HT7A 4ZMMA 2HQIA 4I2QA 4FYYB 1URQA 5KLVG 3ZTRA 3H5SA 1CJUB 1U47A 3Q5SA 3B4MA 2EFOA 5KFYA 1OMSA 5ETRA 4J9VA 2XNXA 4H44D 3OL7A 1VQ6S 4PPZA 1W26A 3LP0B 2HPCA 2O01H 3JSVC 2VICA 2VG7B 1N33J 2B9BA 4PQUB 2DNOA 1TAQA 1IM6A 1FRHA 3M4XA 3HHKA 4ICLA 4ZCKA 5IV4A 3MR6A 2B8QA 2MJZA 3N28A 1QLNA 1LK7A 4PRFA 2J8SA 4DX7A 4GO7X 2H9ZA 3DLLQ 2JWDA 3CCEP 1R5LA 2H54B 2V4RA 3PW4A 4RUHA 4FXDA 1YJNP 3SWYA 3EDRB 1YZ6A 1EX8A 1K8AQ 1SKRA 4AQYJ 3OTBA 1UW9A 3TNUA 3OPKA 4UOGA 5HO4A 2K88A 1N34J 2ZBIA 2E5TA 5APUA 3T1YJ 1S72S 3EGNA 1NNDA 4BCAA 4I6WA 4DL7A 4O0NA 3ZZUA 1EXIA 1NSQA 2VG6B 3HP6A 4FYDA 2PGDA 4OV6A 4RJVA 3JQJA 3BEGB 4YTPC 2ASLA 3QYYA 1QTNB 3H5YA 4HHJA 2X51A 3QIDA 1S9EB 5KTQA 3LP1B 3PEHA 2FYUK 1S6PA 1U0HA 1B0TA 4FXVA 2D3ZA 5C24B 1WKJA 3KZIH 4CM0A 2N3OA 8ATCB 4DN0A 4IDKB 4KE5A 3R3TA 4Y3CA 3BB5A 4IQXA 2OPQA 4IFDK 4PQUA 2EFPA 3TYTA 2WSEH 1SH0A 4GC7A 2V9KA 3TZWA 3IR6B 1TZ0A 4KRWA 1XMBA 3D3CJ 3MTJA 4RW7A 5F3TA 3BQ0A 2M70A 2UUCJ 3A3NB 2IBOA 4HKQA 3I9ZA 3AE8C 1YITP 1Q86Q 3GHGC 3UE2A 5F8LA 3NRBA 1FKAF 1CJTA 5TISH 3RBDA 2FZGB 3I31A 5J2PA 4J9KA 2GCFA 4QQBA 3H1LG 4PKDB 2BJ7A 3QAEA 5J1PA 3FUYA 2GQ2A 5ADZA 2VPZB 3BSCA 4I4BA 1RCXB 2OD6A 3B8HA 4F50A 4YY3J 3GIMA 4M8LA 3TI0A 1BC6A 3DU6A 4F02A 5CXTA 2FHJD 2BKNA 3WIUA 4E2FB 1F2HA 1Y5NB 2A45H 3UNGC 4OIXA 4FPIA 2K2PA 3NS5A 1PC4A 3R5GA 4CH7A 1WC5A 2JH3A 1SQXD 4NWBA 3HZEA 4I6MC 2HRTA 2BCCE 1YHQP 2VBYA 4NLGA 1U1OA 4JI1F 1FJCA 1WC1A 3RG6A 1BGYD 4QIVA 2DHAA 1BDCA 5FDLB 2FQQB 1JTHB 2AU0A 4IL6H 2QGFB 1CC8A 4DV4J 3FEZA 2DCLA 3OBIA 1RK8A 1V5IB 1VQNS 2UV8G 1P84D 4RWWA 1IBKF 3KYQA 1KKHA 3DDKA 1QL1A 4HI2A 4TNOA 1NJWA 4OX8A 2Z58B 2KP8A 3R7NB 2HHQA 5F8JA 4DQRA 2QG9B 1OS5A 1EZVI 1I1GA 2JL9A 2C3PA 2HHSA 1L3VA 3AD9C 5K14B 3GB0A 3KUHA 3MCNA 1XK8A 1XR5A 5AVZB 3CE8A 5A8RB 1EIYB 4RW9A 3JYTB 3SWKA 3ETMA 1DTTA 2P6TA 1RTJB 1JTHA 2FJAB 3W63A 2M8RA 5CABA 4IFVA 4RUCA 4QIWD 4ZLPA 1L5UA 3TVZA 2YKPA 2HZAA 1PYOB 2JWAA 2IAJB 4RKUC 3C6TB 4BLGA 1B0VA 4XA4A 4ID8A 1IKXB 1FRLA 2XLKA 1OVUA 3C66A 5AVRB 3RK3B 2IM1A 1MMNA 1ULRA 3V4IA 4Y99B 4PG7A 2AP6A 1NK5A 2AIRB 2DO0A 1AFOA 4I69A 3KLGA 5E33A 2IPPA 4JV2A 5M2UA 2V7QJ 4ASWA 1PPJD 1HPZB 2Z0GA 1SJQA 3IG1B 4ELVA 3EXYA 4DCOB 1MN7A 2O67A 3BREA 1SLQA 1C0UB 3V5BA 4BWJA 1JXEA 1KILA 2DK2A 2HFED 3BV8A 1D3WA 4NYPA 4O3RA 3H1ID 3A0HH 3SSRA 4DU8A 3EFFK 3MECB 4F0HA 3DLEA 1NK9A 1IKVB 4DPOA 3FCHA 2NZCA 4QPXA 3HHEA 4DFJA 1QY7A 3GFHA 4OHWA 3M8PA 2H5IB 5F8MA 4B3TF 4A8FA 3BN4A 3W9IA 4X64J 1LGHB 1CS4A 1N36J 4A8MP 1IKVA 2LXFA 1SL2A 1X9SA 1SI9A 1ZAXA 3BYRA 2VUGA 4QYRA 1KILB 3CCSP 3IS9A 1JLCA 1U4BA 3M7VA 3IR7B 5H2FH 1RISA 1VQLP 2W4CA 2HK2A 4UZBA 4CRJA 1SFCD 4EGLA 4QYZJ 2N82B 3R5BA 1HBUA 4O23A 2NRGA 5KT5A 1U45A 1NTMK 2H48B 2B7BB 5C2GA 4DSEA 1VRTB 2LXUA 2BUNA 2QA4S 5DG7A 1N8RT 1M90T 4C2MA 1GXUA 3TUIC 2COLA 2M5AA 3N6MA 2KHCA 1I94J 1HNIA 2IM3A 4CO3A 2JEGA 4USJC 3MI7X 3U1LA 1WJ9A 4K4VA 2WPVB 4Q2MA 1HW8A 5D4OA 5K5GB 2RE1A 3VAKA 5KJ7C 4Y65A 4IO9Q 1FE6A 4YFUA 1BGYG 3P8CD 3PZPA 4A4JA 1ZM9A 4HYTB 4WFNQ 2N1TD 3LPYA 3QFHA 4FPRA 4XTTA 3V4QA 3K7RA 2UV8A 2YX1A 3MURP 5H1SV 2W2OP 2R3VA 4UF4A 3L73G 4IFMA 2MQNA 1HIYA 1Q90D 3H32B 1JB0C 2DT9A 3D0GE 3PW7A 2PFFB 4M5KA 4HACA 1LTJC 5CCGA 3NNHA 4N8NA 2B6AB 4XAKA 1NTMG 3R9LA 3NL0A 2Z30B 3WIVA 1TL1B 2LCWA 2MGZA 2FB0A 3MR2A 1RTDA 1YJNS 3W5XA 3D6FB 2N4CA 3G9CA 1NJIT 5B5EE 3JSRA 1F60B 3CJQA 1CQNA 5A0YB 3HE5B 4JI3F 4ZIVA 3SMZA 2G3AA 1LWEB 3VZIA 2DNGA 3VGSA 2MYFA 2DBBA 3Q86A 4NLXA 5KG6A 1YK9A 4LMZA 4ZMDA 3HJVA 2IBZD 4U3FJ 1DFDA 2GIQA 3NG8A 5E3CA 4B3TJ 1G2EA 3GR0A 3FBEA 3QSYB 4MK7A 5L8RC 4WU3A 1IK9A 1TL3A 1Y4ZB 2D1CA 1LWEA 4U67Q 3CF5Q 1JXVA 1VQMP 3MFIA 3TQ1A 4QIGA 1N7LA 4OGQC 2HGNA 3HE4A 5ETTA 4X4QA 2R7OA 3MEDA 3CIZA 4FZVA 1D7MA 4GODA 3MIWA 1S76D 5DETA 3H32A 1NBEB 4OJ1A 2ASJA 3M9BA 3UDEA 3MM6A 1VHIA 3Q0AA 2F8EX 1USEA 2LU2A 3J7AN 2M0BA 3DXSX 5E3QA 4JI8J 2J9DA 4KPYA 3A12A 1JWWA 2ZKUA 1DTTB 2DR5A 2FZKB 3I9V9 3O6QA 4GVBB 3BKFA 2KHDA 4AUKA 5LMUF 1QSSA 2KJWA 4ZPWR 2UVWA 1N73B 4ZVGA 4RNMA 3BN7A 2ZH4A 3PV8A 1USDA 2P1JA 3OD2A 2RDDA 4PD4D 1S9EA 2HAIA 4F4KA 2ZWOA 1B70B 2ZITA 2C3MA 5KFJA 3PW0A 1KQSO 2ZT9C 1FXRA 1S5LX 1NVOA 3H1JJ 1V6HA 1KB9E 2N7YA 4FKXA 2G8YA 4JBCA 1T8ZA 3OFHA 3DOLB 4DX8H 2JO1A 3SIPB 2W27A 4JI7J 2RHQB 3VYIA 2FFDA 1ZRTE 1PYSB 1Y8AA 4TVAB 1YLXA 1KILD 2OGUA 1SQPE 1MROB 2ZH5A 4W92B 3H1KE 1UETA 3OFFA 1TMMA 5BJRA 2YQ3A 4DEZA 3GJTB 5DDPC 1UMJA 3UQSA 3IFEA 1L0LJ 3MHYA 3H5UA 1ZBTA 5D0HA 2M8DB 2QC3A 3ZTQA 4YQWA 1Q81Q 5KFDA 4AYCA 2GC8A 3D6YA 4O3NA 3TA1A 4X65F 1WRGA 1X0TA 1HR0F 4NXMJ 4DV3F 5CHXA 4LF7F 4OZ2A 1RTHB 1R8CA 3L9ZA 2OPSA 2G13A 2MDAA 3IMQJ 2B4VA 1VQPS 4NPDA 1KLMB 4ZLLA 3RRHA 1TL4A 2R8GA 1X4AA 3N5FA 1YRTA 1LWUB 1D0EA 1SJ1A 3H1JD 3CPWO 2DKOB 1WHYA 2OLWA 2KZZA 3OHAA 1N0UA 1JY3N 3N4XA 4C11B 3AEFC 1URQB 1F3VA 1PILA 2IDBA 2PMZD 2BA9A 3B4DA 3K5MA 4QW8A 2ZXEB 1R8BA 1IFNA 4TU8A 4JYAF 4RBTA 3HUSA 2HFNA 2VOOA 2F8HA 3PTWA 4O44A 3HULA 2E74C 1O51A 2ABYA 2FY1A 3MOJB 1L3TA 3C6TA 2F4FA 4ZVHA 2XYHB 2QG4A 3RL0C 3O8ZA 4JI1J 4HEA9 2MEWA 1DRZA 1HQEB 4AYBD 3CCLS 3CEDA 3L73D 3KZIE 3U7JA 1R8EA 4OH8B 3TNVA 3I56S 1T0TV 2ZOGA 1B99A 4WTOB 1MWYA 5ETNA 1LKZA 2FHJA 5EUHA 1XMOJ 2DHXA 2LDIA 4LRCA 3WU2E 2NPSA 3PVXA 3C6UA 4DV2J 7AT1B 2HMIA 5ETMA 2ZD1B 2P9CA 3NXSA 1RT1B 4HHUA 4Y2MA 4X4VA 1CLFA 3SSSA 2V5HG 1IFJA 3IGNA 2G0IA 1AA0A 2OYHB 4QR0A 1NMEB 1SIWB 2VFUA 3CCRP 5HVFA 2VA3A 1LTJB 5L46A 2FJXA 3MXHP 2HHUA 4ECYA 5CYQA 2DNRA 3H1HE 5BR8F 4I6YA 2IM0A 3CB4A 2RVJA 3M8ZA 2RUSA 2YH1A 4DSKA 1VQ6P 4GOFA 4U7CA 2E9RX 2FXPA 2VFRA 4Y2IA 2IA6A 5T14A 1Q7YQ 3HFKA 3HVWA 1R6YA 2NUUG 3H90A 2HHVA 3CJTA 1HWKA 5D6GA 3BH6B 1FKOA 2WAQD 5GAEU 4NCBA 1XWLA 1B4SA 2LXIA 4P2MA 2UWJE 1VQMS 3WU2H 4X64F 4F4YA 3G71S 1NJYA 2FJBB 3EQ2A 3LALA 3R1LA 3MZWB 3VAJA 1KS2A 3PJWA 4LREA 1W2IA 4P2FA 5KG2A 5HAOA 3AAWB 1S9KD 1ZP0C 1NEEA 1SPBP 1RH5B 4F04B 5J1NA 2EK1A 3JAMY 1Y0HA 3HSJA 4KYZA 5D3GB 1QAYA 2Y9ZA 2ZZTA 1MKMA 2VFTA 1WOOA 3V4WA 2WSEC 1SFCC 2ZBPA 3CCSS 4J91A 2C3UA 1E5WA 2MLYA 2R7WA 1BSNA 2N1TA 1SQXG 4DHVA 3OT9A 1G2CA 1UIXA 3UN3A 2M0GB 3OTOF 1K73Q 3KK1A 4ERDA 3KWMA 1YQ3C 3EZ5A 2B87B 2HGMA 1RT4B 1RHRB 3QT8A 4ECZA 4DPUA 2UZAA 1D1UA 1X0PA 1RTDB 2AZ3A 3CCWA 1QLED 3QWPA 3HO1A 1JLEA 4KR0B 3QQCD 2KIKA 1DLOB 1WEXA 2M5YA 3W60A 4OJGA 2XMVA 3H1LD 3F5HA 3VGUA 3HKZD 1HJ0A 3VHQA 1FBMA 2QLJB 4HDGA 1KOOA 1ZMEC 4A47A 3KLEB 3Q8RB 4FNIA 3EJMA 1VF5C 1GXLA 3FMWA 4J9RA 5F8GA 2ZVNB 4H4KA 3MCSA 1IKWA 2XZDB 1H7XA 4YPCA 2YKMB 1MWQA 5K9FA 3I4HX 1D9AA 3D9BA 3N79A 1W2EA 2HVEA 2H88C 4QMAA 2VC0A 5D77A 4WFAQ 3S6EA 1SH3A 1X9WA 3TVYA 2DITA 4LIWA 5HMZA 1KP6A 3HPOA 2XMAA 1HNZF 1PV3A 1Q95G 2CPFA 2XYPB 3ZTPA 4PD4I 1S1TB 3BGOP 3K57A 1B7YB 1PP9D 1JXLA 3U1AA 4OHVA 4KC5A 2ADCA 1NDLA 1S1CX 2HVIA 3KHGA 1WF0A 3J80U 1IN0A 2V4QA 4RW6B 4ETXA 3G2XA 1H2VZ 3FKBA 2IVYA 1IBLJ 3DHWC 2ZVOB 1FJ7A 1CSBA 1WI8A 4WP9A 2EFNA 1ZTTA 3M9OB 1NTKD 2HLTA 2MLZA 1HD0A 3LO3A 3SCIE 3EFGA 3Q8SB 5EGYA 1YJUA 3NBPB 2P67A 1LXJA 5CYMA 3GILA 1FWKA 1FWLA 1LT1A 3BS9A 4NZ7A 1TKZB 2HVDA 1FS0E 4ZJQA 2QEXS 4LBPA 1URQC 1EJ7L 1UW4A 2U2FA 2N9BA 4DG1A 5F3ZA 2L9NA 2H89C 3VP9A 1KD1T 4B3OA 1FK9A 1G1IA 3RK2C 5DRKA 2E5JA 1N5TA 3RAQA 3L71J 1YJ9P 1HUCA 3I32A 4ZVQB 5GAGI 1SQPD 3AECC 3CX5I 5HATA 3G82B 2MGZB 1BWVA 3B5NC 3CO9A 3V6DA 4A8QA 3HVTB 1S9KE 1LWFB 2YMYA 1FAVA 3HE4B 2HS3A 1IO4A 2VU5A 4M1KA 4CLLA 1BXNA 1PO6A 2KLUA 5IQ6A 3CT9A 4JYBA 4JYCA 1H2TZ 4H44C 3IM9A 2R7UA 3LW5H 4KGMA 5U47A 2YY3A 3PNIA 2R2TA 4WYWA 1DD4A 1VQOS 2B56A 2IC3A 4YHHJ 2RILA 5IM0A 2CQ4A 4R4MA 4PUOB 2QSIA 3MMCB 5IC6B 2KJVA 2YNIA 1T9WA 1PPJE 4O4RA 4F0MA 4OYAA 1S1XB 3UO0A 1FXLA 4C8NA 3IBCB 5FLXU 2EC0A 4ANEA 4HACB 4NLYA 1N2DC 2YQ1A 3SFUA 4EFAC 4LF6F 1OYEA 5APYA 1TFWA 1VHFA 2HVZA 2EFGA 1AUDA 3H4DA 3GLMA 4GKJF 2NXJA 2XBPA 1Z56A 2CKWA 1ZS6A 4PABA 4PG6A 3ZNJ1 2FYUD 1C1CB 3BF4A 3H5XA 5KFZA 1BQMB 3FGAD 3GJQB 1Y10A 3DLGA 5JMNA 1LFWA 4YY3F 1PJ5A 3L74E 3D1HA 2DIUA 3MUDC 3X3UA 4QU7A 3I87A 1KN7A 1IM4A 1CBKA 2P8IA 1X8DA 2O1JA 4DR6F 5APXA 1FT8A 2R7XA 1IBLF 5TJHA 4X66F 4L3NA 4ZCLA 1QTMA 2A2CA 3BSOA 2JVOA 3QBCA 3CMAP 4O3PA 3N5BA 4TU7A 1BCCJ 4UW2A 4HKZH 3CCLP 1CS4B 3A8JA 3DRRA 2DEJA 1R0CB 1GW3A 3AEDC 1U1QA 2FGCA 2ERRA 2HIQA 1H74A 4C4WA 3GV7B 2Y0EA 4LF8J 4PWDA 2V8HA 5DM7Q 1MN9A 3AJ2A 4M5LA 1OQ6A 4PXCA 4I7ZB 1RQVA 1WG4A 1WG5A 1IZNB 3QIPB 3CCES 4LRDA 4AL5A 4GOEA 3M30A 1LTBC 2C2KB 2VIHA 1JLEB 3QZ7A 2B4UA 3J81U 1F5BA 2FLOA 5KFHA 4LSNB 1JM0A 3AJ1A 2WMMA 1VK8A 2BCCD 1SL1A 1FFWB 4B3RF 1VQ8S 3NLCA 4QU6A 4OX9J 5IWAJ 2WSCJ 2JEIA 2OTJS 1T11A 3EGWB 1M0SA 4I2PB 3PW2A 1EETA 1RWPB 2HQDA 1YITS 4I2PA 2WSFC 1OW8A 1L4AC 2N7CA 1YJTA 3C9IA 2PO4A 3TAPA 3FSIA 1GTWA 2NXUA 3TW0A 5SZTA 4A8YA 1LP1A 1FD2A 3D3BJ 1FTCA 4UY8T 4DSIA 1F6TA 1MMLA 2DGUA 3AY0A 2HFZA 1W2BO 1VQOP 5KLIC 4PG8A 4IR9A 4G1IA 1NDPA 3QRPA 4IYQA 2ZHOA 4A48A 3WC2A 1SQBE 2E5YA 1ZR4A 1Q5YA 4WF9Q 3CIMA 2GO8A 2E43A 3PR4A 2ZUAA 1BLUA 1A7GE 3H98A 4NZ6A 5AVYB 2AHOB 2OP5A 1YJWP 4B9VA 2AMCB 4HH0A 4FBTA 4ED1A 3BGUA 2ZXXA 2QE5A 4FF3A 4NE9C 5FDLA 3HD7A 2A2DA 3MEGA 3OTCA 1Q5VA 4IG0B 3AE2C 1F1BB 1L3SA 2HRYA 1N5YA 3KUEA 1N52B 3L72D 2KYXA 2QIFA 1VYAA 3PYFA 1BQNA 1TVRA 2GJIA 1S0VA 2IYIA 2NXNA 1BGXT 1AB8A 3C16B 1KBRA 3P5TL 1RE1B 2Q6QA 5E3AA 4HVZA 2OYIA 3P5BP 1GAOA 2HSEB 3AT1B 4ZCMA 4WY4A 5RUBA 5KFFA 1SC4B 1RT2A 4ZA1A 2RH3A 4PD4H 1AA1B 3V2PA 2MZRA 4IG3A 3IFMA 3DHXA 5HLFA 2WHOA 3GTYX 4GRSA 1PGPA 2W2PP 4NMLA 1JY3O 1R43A 2MLXA 5KLVE 2X1GA 3MD1A 2VBWA 4NOHA 2CIMA 4IL6E 1I6JA 3FGVA 1FRJA 5E79E 4IOIH 1S9GB 1XN9A 2IJRA 5L1JA 1ZM2A 2D74B 1HBMA 2FVSA 3UR0A 1DTQA 4RW4A 1SBRA 2BDPA 2NPSC 2XS5A 2IPOB 3ZTSA 1OSCA 1SVDA 5K8MA 4KY3A 2DGQA 1EETB 5LSLA 1I94F 3RRKA 1OFCX 3HXMA 4DI6A 3OSNA 5CJ4A 3J80Y 4CPGA 2M7SA 3KG1A 1S1UA 5ETOA 3OTDA 2F1FA 1FRMA 3SSQA 1GT8A 1WOPA 1RWWB 2DJWA 4XFJA 1D9DA 4UOHA 3M6WA 1J2JB 3HSZA 4JPZB 2ZH3A 2EI5A 1HBNB 1MU2A 1S2EA 3Q2SC 1RU1A 1Y9BA 1URNA 2C2RA 1HQUB 2POHA 4RPFA 3TA2A 1GX6A 4C3KA 2YNHB 3CDWA 2YWFA 3CC4P 5KG1A 4HLBA 3OVBA 4MKYA 3GONA 2HVHA 4RW8A 3MMJA 3OQ2A 2VC1A 1KC8Q 2J6UA 4XIUA 2UXCJ 4WVZA 2HZVA 1WC4A 4CNYA 3W2WB 1NPPA 2ASYA 3SZ2A 3O5TB 1N4LA 5M1BA 2BYCA 1NHUA 2CQDA 1CC7A 4YEAA 3KHRA 1M5KC 4EO6A 2HLUA 1S6OA 4FYXB 4ALZA 3IAM9 2V69A 1BUXA 3FZ2A 5C25A 4JF7A 1Q78A 1UVNA 1LW2B 4C8OA 1TKTB 1QEXA 3PKYA 4M5DB 3ABVC 4F67A 1DZ5A 5GADI 2CDRB 4J5OA 1QAXA 4AL7A 3NMAA 4USIA 2LQ5A 2A06G 3EVMA 3DOMA 3GG1A 2KKHA 4ZP7A 3WMM0 3SFDC 1GQEA 2VQFJ 3H25A 2QM8A 4UOFA 1T05B 5AVSB 2HFOA 1S4XA 1X4EA 4RZRA 3BGFA 4V19X 1NSAA 1HNXJ 2H4YB 2E1RA 2KXPB 1JY3P 1SQQJ 3V6IA 4DL3A 1HBNA 3NXZA 3L70J 4EBEA 3ADAC 4CLTA 1VQ7P 1SL0A 2HBRB 2JC0A 1CZQA 2E1MC 4N76A 4UQTA 4IFYB 2ASDA 4MT1A 1WC6A 3FFIB 3G6XA 3HHLC 3ZTOA 2F40A 3JQKA 5D4PA 2QFIA 1SQEA 2J9DE 1BHNA 2FJWA 2HHHF 2BJEA 1WDTA 1Q2NA 3TDKA 4URQU 1RBOB 1YDLA 1HBWA 4WFYA 2KOGA 3GMAA 2PFXA 2YBVA 2AWZA 2MQMA 4DPWA 2YWGA 2WT7B 3C14A 3HI9A 1KNZA 4NCGA 2WB4A 4CO2A 1XNQJ 1L4AD 3PDNA 2L3MA 1OPIA 1VQ5P 1S77D 4LR8A 3PIOQ 3J7Z5 2N1TB 1S79A 2QL7B 2V67A 3RW6A 2VQFF 3CGIA 4N77A 3DRRB 2LFVA 3RJMB 2FYXA 5A6WA 4X4UA 2O3JA 4F2RA 2OYHA 2GX8A 4LJMA 4MIWA 4CT9A 4U7JA 3B8EB 5E0OA 4BDPA 2BRKA 4NYOA 1T05A 3BJYA 2JNJA 1TUGB 2V2ZA 3THTA 3VMXA 1PC5A 1RHZB 2W90A 5DGBA 3L75J 4K2XA 3V6JA 2JLEA 1J5OB 5AT1B 1BCCD 1M5VC 2BRLA 3CLQA 4YHHF 2HG5D 1UZHA 1XTZA 3PFOA 2HFVA 4ZLNA 4K4XA 3R5DA 3GYNA 3POTB 4LF1A 3ZZYA 3OJUA 3J81Y 4NLOA 4B9SA 1RTJA 5KAFE 4AT1B 3AB4B 4ECUA 1J5OA 1RADB 2YKAA 1N54B 1SQGA 4P52A 4ID5B 4KQZA 3HRNA 2PC6A 4EOTA 2XSJB 3ISNC 3AE4C 1HQ2A 1WHWA 2IA0A 2W2MP 3OVSA 1RF0C 3AOBA 4LF9F 4WY4D 4MFBA 3UFCX 3OL9A 1VRUA 1SQXJ 3PACA 1C4AA 3DMJA 3C19A 3KHUA 1QUVA 3E01B 3MCMA 3KLHA 3I0RB 4R0EA 4PUOA 3J81j 5CQGA 4L75A 3I6PA 3CWBJ 3K5OA 3H1HD 3ENAA 4RNHA 3ELHA 1IK7A 1U26A 2XULA 3ZNUA 4FBUA 2C2MB 2AXTH 4CTAB 2LQBA 4K4WA 3W8GA 3DLKB 4C11A 4F7VA 4OI4A 5T7LA 1O8BA 3G8SA 5AW9B 5GMDA 3HSDA 2BEQD 3MPDA 1FE0A 5A2QY 3HSGA 3PJSK 3V2QA 4TY9A 1Y5IB 2D3OR 3SDEA 1ZZFA 2VPWB 4X4RA 2JEEA 2M8HA 2XS7A 3BO2A 1U57A 1NKNA 2W1BA 4C7NB 2ZT9B 1RHQB 4AQYF 3M2VA 2MKJA 3CXHH 2ZYDA 1Q82T 1OIPA 2VBXA 1Q82Q 2LQ9A 3M8YA 3OXGA 1G3OA 1QM9A 2Q3EA 5B5EH 3T1HJ 3BRTB 4DBQA 4MIBA 3I5BA 4L6V3 1DHMA 3NKYA 2CYYA 2CQ0A 2OPSB 3R5CA 2KZIA 4FYVB 1PKUA 2DNHA 3BGRA 2VODA 1P27B 3CX5D 5E3PA 4RU2A 3BCCD 2C2OB 1NKBA 1RWXB 2XMMA 5E79H 2DHSA 2W6BA 1FDIA 1N7SD 1U1MA 4W4MA 2RF2B 3VP8A 1S1VA 4CNZA 4RNNA 2HQFA 2DRBA 3BCCJ 4TN2A 5L8RJ 3GPAA 4TKTA 1WG1A 1F3FA 4DZ6A 1J2VA 3TJ8A 2KFNA 3G8QA 2P2UA 1T9XA 3EWKA 4DLEA 5AW0B 5FD1A 2R44A 2W9BB 5ITHA 2E29A 1WF1A 2HMIB 2IBKA 3RB4A 1PAEX 2YWKA 1ZA2B 5KFXA 3DCAA 3USSA 2YPYA 1VDFA 1SKWA 5I3QA 1FFSB 2HQGA 2B5JA 1RAHB 4PAAA 1NTKK 2WVDA 1I51B 1UA0A 4PXEA 3LWLA 4I7FB 2Q3IA 3GQCA 2AGQA 1NK4A 4GDOA 1YJVA 1OQ3A 4HH1A 2PA3A 2CNLB 2C9NY 3UWTA 4ED0A 3K8WA 2CZVC 3W66A 1HGVA 3C1LA 3TSIA 4DJGA 5HMYA 1JNZB 1KQSR 2V9WA 2PFDA 3W1YC 3QFWA 3CWBE 3D7SB 5E7OB 4KSEB 4UB8E 4PJ0H 2XDJA 1NDCA 4Z2XA 2I8DA 5IM0B 1UVMA 5AW7B 3W5YA 1YI2P 1CI6A 2R7TA 3ZZTA 3ITHA 2I5JA 2GM4A 4B9UA 4ED7A 2LEBA 1C1BB 4NASA 4O44B 1H3DA 2R7QA 2UVVA 3KG4A 5BR8J 4YOEA 3L75E 1XMQJ 1RWOB 4N7TA 4UQGA 4ZVTB 1CVJA 3GHGB 4NA1A 1KB9D 1TP7A 1RTIB 2HNDB 1P6TA 3DLEB 1GFWB 5DO2A 1G2CB 1P8GA 1X22A 2HHHJ 1HQEA 3JQMA 4DCKA 3VALA 4HT5A 4WTYA 4ZK7M 5H9EK 2YMKA 1U1PA 2V4HA 2ZH6A 3U1NA 3D54A 4H4MA 1IBKJ 2XMTA 1S97A 4X4PA 4TYAA 1HBMB 5AXKA 3BYPA 3O3LA 2Y0CA 3BPSP 3MEDB 3II6A 3LPEA 4HB1A 4DR1F 3M8WA 4NPOA 4DPTA 3PKMA 3NOGA 2QYGA 3H20A 4B08A 3FWLA 4YB7A 1N5SA 2QJ3A 2IYOA 1ZLLA 1Q8LA 4IR1A 2MQQA 4QYZK 3F41A 2K9YA 3CD7A 3RB6A 5KLVK 1U09A 2ATCB 2DNQA 1J27A 1RWMB 1TKXA 3C2PA 4NPEA 2IYPA 5KFNA 5B0CA 2LECA 1EDLA 3KJQB 5KAIE 5KFKA 1Q8BA 1GL2A 2UUBJ 3NNCA 1K0VA 1GH8A 4R25A 4AXJA 1X4GA 1OPZA 4U8VA 4OZ0A 3T6JA 3A5TA 2OEJA 3OV7A 3L71D 3AQPA 1SUQA 4CO0A 3ILJA 2ZD1A 3NY0A 2Z2MA 1NYHA 2QLBB 1FDOA 3NNAA 1LQ9A 1S6QA 2M3BA 5D0EA 1IKWB 4WY4C 2GMLA 1NUEA 1WMKA 2DNZA 1PYTA 3AJDA 2VG5A 4ZPTR 3M9HA 3PM9A 5LJ3Y 1VBKA 5JVGQ 2OUGA 3IBWA 2YNHA 4L72B 3CX5E 1VR6A 5THWA 1U02A 1ZM4A 2IY5B 2KXHA 2FVQA 5HMXA 1HBUB 1F9HA 1FA0A 5GAHI 4N78D 2YNFB 3W9HA 3HKWA 4M5NA 4TLQA 2BACA 3AXMA 5L1IA 1HWTC 1N88A 4CLWA 2QJKB 4KIAA 2QJYB 1NJZA 2IX7C 2E66A 1X60A 2IRUA 3RYLA 3QT6A 1N7SB 1YJRA 4WZMA 4LC1A 3QWUA 3NAIA 2QIWA 2HK3A 1L4AB 1YIJP 1FZCB 3HD7C 4HHHA 5GADU 4OJHA 1KQFB 1LJ2A 5JXSA 4W90B 2RKLA 1GD2E 3MUDA 2EVZA 4DV7J 4A46A 4J9OA 2KZJA 1NXIA 1X5TA 1SQVD 2V4JB 2HWTA 3PRDA 2HW3A 4DQQA 3K59A 4M5IA 4B3OB 3IXQA 4DOZA 2B9WA 4CH1A 1YZ7A 4K4TA 4OZ5A 3AQOA 2SPZA 3H1LJ 3EGZA 1RTHA 1QVFR 3IR9A 1IKXA 3H42A 3P8BB 5LXRA 4IOCQ 3IG1A 3PTZA 4G65A 5LMUJ 2H43A 1H98A 4IH5A 2RDIA 1RT6B 1NTZE 2B6AA 4KJMA 1NH8A 3TA0A 3A7OA 5SUHA 1NH4A 1NAFA 1M1GA 1TL7B 3GZ7A 1S1WB 4X4NA 2VQEJ 1UFKA 3H2VE 4OX6A 1LWCA 1DEEG 1X4CA 3JYTA 1LT9A 3IRXB 5E3RA 4N41A 2WQYC 4IRDA 1JCDA 2MB0B 4WP3A 3VF0B 2W4DA 2O01C 2JLFA 1TVRB 1EP4B 1KYOD 4C46A 2C1EB 3CXHE 2LA6A 4JOUA 4B86A 3M1VB 1G1JA 3EZUA 3W2VB 1YQHA 3VVUA 3PYEA 1VBZA 4DR7J 4E0DA 3IBFB 4H0LC 2V2VA 3FRYA 3QGHA 3HD7D 3EGVA 2QJPB 2WSFH 4P74A 1L0NG 1WACA 3VGVA 3HTKA 2Y1LB 4GKKJ 1OYDA 1EDJA 3GFXA 4ANCA 1BWEA 2X7IA 4F3MA 3Q22A 4D6TD 4RBUA 2YIUB 1AT1B 3CD6S 2M2BA 1RLCL 4ED6A 4WXWA 2PMWA 2PGCA 2DXDA 3BBBA 2QSFA 4MTPA 1E6YA 2VV5A 3NOCA 1B64A 1GK4A 4H44B 4FF1A 1VQ9S 3DOKA 3H59A 1U48A 2LMIA 5G0RA 2DH7A 1WC3A 3MEKA 2ZC4A 5HVHA 1M1JA 1FZGA 4AL6A 1NK0A 3KXDA 1SQQD 6AT1B 1SS1A 2APOA 1ZETA 1TK5A 1L2PA 3R7BB 4C0BA 4PWWA 1EQ0A 4LR9A 3A0BH 1LWCB 2D7SA 2Q3PA 4OYPA 1UP1A 3IAS9 1S1WA 1RTIA 1X31C 4JI4F 2RHSB 4NCAA 1S9FA 2HURA 3MM7A 2CWXA 4WKRA 4YB6A 5AW1B 4CLYA 1CULA 1JLGB 4LBHA 1NLKL 4DV0F 1WELA 2A6OA 3MTUE 2VPXB 2F4VJ 4A8WA 3VAGA 3KLVA 2QTWA 3GCXP 3OXFA 5HN0A 2WOMB 4I64A 4YDXA 3C15B 3ZZZA 3RUBL 5AW6B 2DGOA 3P8CE 2KM8B 3U59A 2ZC3A 1YGYA 2KVIA 1SV5B 3H1KG 2OKQA 3DM2B 2Z5IA 2QFJA 3N7NA 3OR1B 2ILYA 2AYEA 4RWXA 2PDAA 4LSNA 4DR7F 3LP2A 4C8LA 2LKZA 2W2NP 3R8YA 2XNQA 2MJUA 3WZ0A 2ZYAA 2XCPA 2K7JA 4C3MA 3CULA 1HYSA 3OJSA 2OYOA 2KT2A 2R42A 3SXLA 1Q4RA 1S1TA 2QZ8A 4O3QA 2N4DA 4ED5A 4YB1P 2Q66A 2HWHA 3MAQA 4KAIA 3PRVA 4QWCA 5IC4B 1M1KT 2WVFA 2YWEA 1TV6A 4X66J 5GMKa 1GMUA 2RMLA 1GW4A 3BCCE 3AOCA 5HQ8A 3NMRA 2VF3A 2M52A 4DMZA 4PG4A 1ZRTD 1TELA 2G2ZA 4UB8H 4H54A 3P45B 1EARA 3KJVA 2ZH1A 4K0KF 2OSRA 3VAIA 4Q43A 1YTYA 4ECXA 2CA9A 1VC0A 2F63A 2NPSD 4KKOA 3DGVA 2I2YA 3TAMA 3VVTA 5HP1B 2QJYC 2FLLA 2CQPA 2R4FA 1GMJA 1BE3D 2O1PA 1LWUC 3MUTP 2FHOB 2V8VA 3ZZ0A 4AE5A 3KG0A 4RO0A 3QRQA 2YNYA 1YWXA 2DGVA 2HNZA 3PXGa 4LSLA 3C14B 1UPMB 4RLEA 3FVYA 3JAMU 3NGSA 1PZQA 3LIEA 4YDDB 5GTIE 4R8UA 4EBDA 5AW5B 1IFIA 3M32B 4QW9A 2RQKA 4M3LA 1NPKA 3W64A 1M5HA 3S9OA 4EDFA 1RE4A 1K1QA 3IR5B 2QE7H 2ZJSE 5I3UA 4C7QA 4JI7F 3R1HA 2FVCA 1N6QB 4TQSA 2CJ9A 3SV4A 1BMQB 1S1VB 3RL0B 2I38A 1ZA1B 4EBCA 1CULB 2FTRA 4DN9A 2W7PA 1L4AA 4C98A 3CUNA 4QWBA 2O1KA 3CO0P 1HFEL 4U3FG 4OYOA 3T5HA 5KG3A 4NPFX 4ZPBA 4QCLA 2XMUA 1M57D 4JI6J 3GG2A 4BRYB 2OQQA 5CHCB 3IA0A 3M32A 2QN6B 3HMJG 4OFZA 4P10A 3DLHA 2CRLA 2E5HA 3M6XA 2POKA 2MKKA 4H4MB 1FC2C 4GVLA 3D28A 3A1YG 1CG2A 3M2UB 4YUDA 1H88A 3EE3A 1RDRA 2A45I 5C39A 1H2UX 1EZVG 4K4YA 4K4SA 3DKDA 2DTJA 3TX8A 2GIFA 4I0WA 1JUNA 3CCQS 2VHGA 5CCLA 5KFEA 2PA8D 1ZOYC 1YBAA 3L72E 3IN6A 3TX0A 3RZAA 1N34F 1XIQA 1KTMA 2OSQA 3G6EP 4IOBA 3J7YU 3MD3A 2DY1A 4NLUA 3L74D 4R4LA 4DV1J 2XG8A 4ZKUA 2YWWA 5IT9Y 2VKZG 3GP9A 2WSSH 5IT9U 1FDAA 3CD6P 2FYUE 1R5SA 1FJGJ 1UL3A 4ZVUB 2BMBA 4JI3J 4OQJA 4YR3A 4LQ3A 1W5CE 3CX5H 4YR2A 3JTOA 1SQBJ 3LGMA 3O1LA 4U6PA 3D0HE 1DEBA 3HCXA 3ISND 2J0WA 4K0KJ 1TK0A 3LIDA 1X79B 4ECTA 2G2YA 3HHNB 1RLDA 4LFBJ 3MPWA 3VR1A 1SQBD 3NTNA 3G4SS 2W8LA 4WKYA 2RMZA 1PIXA 5HP1A 3PCOB 4JI8F 5DLGA 3Q24A 1RHUB 2IJNA 2W24A 1SFCB 2J76E 2ROGA 4OYXA 1TKDA 5EHHA 2B9XA 1AV1A 2RJZA 2HPCB 1B3TA 1KN6A 1IQZA 1RT6A 4BS2A 4OI6A 1FTRA 3SCLE 3TGUG 5HL7Q 1IBMF 1NCLA 2GA7A 5APQA 4JI0F 2HS0A 3PJXA 2RUGA 1P84E 1G7CB 3DM2A 2XZWA 4DFPA 1SCJB 3RW7A 2NYHA 2QYCA 2Y9HA 1PGQA 2JEFA 1ZXGA 2EEYA 2BR0A 4BRYA 1IJEB 2XY7A 3GU0A 2E75C 2QLXA 1JMBA 4RUBA 3GSIA 4RW8B 3DFEA 2HLOA 3T1AA 2RQMA 2XB2D 3T1HF 4P2SA 4HI1A 4AXIA 3M8PB 3MM7B 1NTZD 4DLGA 2Q79A 4CT8A 5F0WA 3FXEA 5J2QB 4OX7A 2G0JA 2AGOA 3M6UA 3T41A 1T6AA 1UPPA 2HIYA 3PY8A 2Y8WA 1MW7A 1WEZA 4RX6A 1XERA 5KG7A 4X4SA 4F4XA 5DJBA 4PG5A 4LF9J 3L7UA 3N6LA 1GDTA 1OVRA 2WW8A 1S0NA 3WHIA 1H0HB 1S9GA 2H8PD 4R5PB 3T5JA 5F8NA 3UD5A 3OFEA 2CK3H 2HBQB 2ZJQQ 3T9ZA 1TR0A 1ZN5A 3C16A 4WCEQ 1NSPA 3UDVA 2ZT9D 1FRXA 3US5A 4ZOSA 1L3UA 5CCHA 1WI6A 3ZO7A 4KTQA 2WB1D 3MTKA 2LEAA 4TLFA 3R7SB 3DGPA 1WTFA 4IO1A 2NQPA 4J9MA 3O8WA 5CCHD 2XO6A 2BEFA 4CI0B 2VG6A 4OI3A 4RW9B 3M8QA 2XY6A 3ZDMA 3CTRA 1SP4A 3L3CA 2ZYGA 4N78E 3AD7C 4LRAA 1RA7A 3VTPC 2V94A 2R2UA 4Y6IA 4G3IA 3NS7B 3KJNB 3NGRA 2DGWA 2MKIA 4XO0A 1M5PC 5F8IA 2M5AB 5ETSA 2GUSA 2QMUB 2OARA 4Z7CA 3B5ND 2VRSA 1SXLA 2HFUA 2J7UA 4IKAA 3RK2B 4DXLA 1LW2A 4ES2A 3R5AA 1K9MT 1AROP 4URSA 3CXCR 1FO1A 5ETVA 2J0XA 1VBXA 1M56D 3D68A 3B5NB 1N86A 1L0LG 3AE7C 2OPRB 3CC7S 3MM6B 1XMOF 3CCUP 5HI7A 1S5ZA 4H4OA 3QMQA 4MYTA 4H13C 1X5OA 4GVBA 3L72J 1MZ9A 2FYZA 2M88A 2O66A 1RE4C 2N1TC 2E76B 1KHVA 1BGYE 5KFOA 1Q81T 1DH3A 5KJ7D 1IQTA 2SXLA 4R5PA 1JB0J 2WBRA 3L95X 3DC2A 1VQ4P 3EPGA 4DUYF 1N32J 2RU9A 3ZXWA 2E76D 4DR6J 1VGYA 1FJEB 1RABB 3AHPA 1FERA 3A0BE 4C97A 1OMIA 1RSCA 2NZ4A 1XEZA 2XSFA 4G1PA 4HTJA 4WP8A 1YRUA 3RTVA 3EWGA 3K5LA 1HWJA 2D3O1 1NTMJ 2HHWA 2DR7A 3T97B 1FKPB 3FJ2A 2ATLA 2CFXA 2KSJA 4Q8FA 3V81A 4DR5F 2B43A 3DYAB 2R8JA 1RT2B 3JSBA 3TZYA 2HBZB 2WSEJ 1U8WA 2P2CB 1UA1A 2YNFA 1EHWA 2MTLA 2WWWA 1L0ND 1T02A 1T94A 4P75A 4L3KA 4C8KA 2EW9A 3TOQA 2RN0A 5LJ5Y 1B0PA 4AQRD 1SQBK 4ZCIA 3UVJA 4DV7F 3KLGB 4WXOA 2KYVA 1YVFA 3MEGB 2BJ8A 1IJDB 2OPRA 4USKA 3DLKA 2KTQA 2RT3A 2G0CA 3CMQA 3KLFA 2KU7A 2I6WA 3CC4S 2JHEA 1CW5A 1S48A 4QIEA 3UCUP 3BATA 4HYKA 2X1BA 1Y9OA 1BQNB 4PXBA 3S1KA 4EWTA 2PP6A 2XI2A 2WSCH 4ATNA 1KWMA 8AT1B 1C1CA 2OYIB 3MMBB 5L1KA 2OIHA 1KDNA 1RUSA 4PZVA 5CCMA 3G9RA 4OWFA 4NMXA 3GLJA 1DARA 3UNYA 3BR8A 1WKLA 5AXNA 2ACMA 1SQPK 1REVB 2KZMA 2V2KA 3ITKA 1FDNA 3TF5A 4X62F 1S0OA 4NI2A 1VRQC 3IN5A 3P3DA 4ZPAA 3H6PA 3NGKA 4GO5X 4GMKA 2WRMA 5DG8A 3QGIA 5KJ7A 4V19J 1Q16B 2V68A 1OWAA 4FNHA 2AJ2A 2ZZMA 3EZOA 3QPIA 3MWBA 4I7ZC 1JMTA 2QA1A 2UUAJ 2OFHX 2D2CD 3L36A 5KAFH 2ZJRQ 2F4VF 3W67A 2CQ2A 1ZOTA 1FZCC 1RYRA 5KFRA 2XC9A 2MKVA 5KLIB 2KSEA 8RUCA 3VCDA 1K8AT 2YXQB 4GT1A 4CLPA 5KG0A 1RTZA 2OD4A 3K8VA 2DISA 3GF7A 1F5CA 3CCVP 3OL8A 5K20B 2LVWA 4M94A 1OW6A 3W61A 2KN4A 1VF5B 2A3JA 5IXUA 2H51B 4Q8EA 4BBYA 3I0SB 1RWKB 2QSWA 3D5MA 1DJ0A 2IRYA 4IFYA 5KTBA 1AUSL 1O6XA 5E5NA 3PRBA 3OSPA 2IVFB 4OZNA 1SQQE 2KLVA 1Q0NA 2UU9J 3TGUD 1PSDA 2A0FB 3KFWX 1Y11A 2IDLA 2V0NA 1U2FA 2CPJA 1SV5A 3LW5C 3MECA 1V3RA 5HBMA 3VAFA 5AW3B 3GWCA 1ZH5A 3M30B 1KZUB 1GU5A 1C4CA 1SIZA 2YXRB 3PX4A 4B9LA 5AJ3F 1C0UA 2I1JA 3MPVA 3MD0A 3DMJB 3EVOA 2B0GA 4CYUB 2ZM6F 2KB2A 2AEFA 5BYQA 3TARA 3BDEA 2DB1A 1NU1J 3DLGB 4WBAA 1FHTA 4ED8A 3N01A 2R5BA 4TU9A 5B09A 5AVTB 4CTAA 3RGIA 3GYGA 2FGOA 3TUZC 2MSTA 1PBUA 1SKUB 5A8RA 4RU9A 3FSYA 2XWXA 2H5JB 1MMDA 2OFGX 3HHLD 5AE1A 1MROA 2LR2A 1C1BA 1LXNA 2QMXA 4PWUA 5GVQA 4DV0J 2CNKB 2CVIA 3S7RA 1QUPA 3M9MB 4LQ9A 1R0AA 4B3SF 4OV1A 3M9NB 4LR7A 2Y0DA 2LKMA 4L74A 1DURA 1TFYA 2P9GA 3L75D 4LFAJ 2NPSB 3L70D 4Q0BB 5B0FA 2MQOA 5DDOC 2VBZA 5DDQC 5KT3A 1KTVA 3RGUA 2K37A 4N3YB 5G4DA 3V6HA 4I7FA 5KKZB 4XDCA 2W25A 3C8VA 3W2WA 2C9LY 3CDEA 1ZAVA 1KFNA 1DX7A 2FYNB 2HNYB 4CLFA 3TK1A 1MSWD 1SUQB 2NXEA 3I4PA 2IIHA 1JJCB 4WFBQ 1FZEA 1U2CA 3MM5B 3DGPB 4RKUJ 2HG4A 3IM8A 3I5AA 1A9NB 4YB5A 1SQVE 2EC2A 1T03B 3RR7A 4OGQB 4LVOP 2XEXA 3F0NA 5AVWB 1GK6A 3KHLA 4XPEA 1RKJA 1KLNA 2CPEA 5HQLA 4CM2A 2QRXA 2FC8A 2CADA 2K1RA 5KAKA 3CMAS 4DCJB 5ETPA 1QX8A 2R3CA 5DJUB 2KM8C 2ZBCA 2KXFA 4OHYA 1KD1Q 4UUWA 3D6MB 2ZHAA 4OX9F 3ENWA 4IH6A 2WITA 2LYVA 1OZHA 2UP1A 5DLFA 3H1KJ 4TQRA 3MZIA 4WB4A 2HHPA 4X2BA 1P84I 2C0XA 1UJ6A 4ZIWA 1GX5A 1IKYA 2DH8A 1UTAA 1VQKS 3DN9A 1PAUB 3FRZA 4KV8B 3KQGA 2KVQE 2AXTE 5I3UB 4KH0B 3F56A 5D0GA 2RU3A 4BWMA 3LAMA 2UVUA 1VQSA 3HT3A 1LWFA 2QA2A 5B66H 2MXYA 1EB0A 4J90A 1GZLA 3S8SA 2EFVA 1NU1E 3A3YB 1Q1KA 1YIJS 4M5GA 4TY8B 1VQ7S 4K59A 3DRPA 3B4SA 2ZAEB 3CCJP 3BQ2A 1UVLA 5C24A 2MZ1A 5L38A 2KK7A 4KFBA 2XZRA 4N47A 2AD9A 1URQD 1OIAA 4K2JA 2E9TA 3Q83A 3HUSC 3J7A1 4K5SA 2OI2A 3TUPA 5CJ0A 1IFMA 2OJ3A 4JV0A 3T3FA 4K3AA 4KKOB 5IV3A 5HLFB 3H1LE 2DNLA 2GUVA 2AEJA 5LOQA 3LWMA 2CNNB 4IG3B 1RAOA 2OELA 2GA1A 2BKPA 1SFCA 5BYRA 4Z1MH 4K5RA 3F44A 2RRAA 3CJ5A 4WY4B 3GSDA 2O3DA 4XK8C 1EZVE 4D6TG 1JKHA 4DF8A 1DAXA 1JKHB 2RQCA 1Q7LB 2UU9F 3MMBA 1EXJA 1NZAA 3BBFA 2XLIA 2DXFA 3ZC4A 1ZV8A 2JR8A 1JIHA 2FIUA 4FS1A 4P9SA 1SVFA 2B8PA 4DUTA 1FDMA 2ZHBA 4I6AA 2WBMA 1UJ4A 1CJVB 2ROPA 1JCCA 1GL2B 1N56A 2RRBA 3JXOA 5D15A 4LF5F 2PIIA 5E41A 5CZVA 4L73A 3E3XA 1K9MQ 4C9DA 4R0JA 2I1KA 3R6LB 1RT3B 1AYEA 1NZ8A 2VG7A 2FLPA 4LRBA 4JV5J 4KFBB 1KFDA 3K5NA 4LSZB 2RIJA 1OW7A 1JLFB 1NTME 1NPRA 4ANDA 2DH9A 4J9UE 1XR6A 5KFCA 1RBAA 2BANA 4TY8A 3PX6A 4OVNF 1BE3J 1ROFA 4GKGA 3JTPA 1LT9C 2L5GB 3EVWA 2CWKA 2B51A 3MR7A 2MMYA 2Y9YA 3M2UA 2KT3A 2J9CA 2A18A 2RKIA 3GJSB 1XC9A 7FDRA 4DQIA 2JVRA 1XTCC 3H1IE 2MQPA 1HI0P 1KRPA 2Q6CA 1RT5A 1KYOI 3MPUB 3RK3E 3L73J 1NOHA 3CWJA 2K1RB 2AV5A 4KGZB 2PRRA 2C0WA 3E1IA 2ZFCA 2CG4A 2GVZB 4W7YA 1U8SA 2YIUC 1XNQF 1K1SA 3MM8B 1SQVK 1FNMA 2ZBQA 1OY6A 2K3KA 1IC2A 2BCCJ 1NTZG 5BYSA 2BABA 2R2RA 4UY85 3GCWP 2XSJA 1HJBA 5TISE 4DG1B 2DIVA 1U6BA 3ZFVA 1E6YB 2H1YA 3G3ZA 1VCTA 5GAEI 4H0LB 4KGKA 3BSAA 2RNEA 4NL5A 4CQ1A 2IBZE 2CDQA 2GHVC 4DQPA 2EG1A 1W25A 2A6MA 4DV6J 5HQMA 4KO0A 4FKYA 3BZQA 4J37A 2QLFB 4DR1J 4LFCF 1IWAA 2VFVA 2HWIA 2ZH8A 3NGTA 3TAMB 3TUJC 5KKZC 1U2RA 1TU3F 4Q45A 4DDFA 1DY3A 3DU5A 5C42B 1L0NJ 2B4OA 3CJKA 2K9JA 1S4FA 1GEHA 4QR2A 2W8ZA 3A0HE 2UXDJ 2RD5C 1GTHA 3QJLA 2OPPA 3GFZA 5AXLA 3B82A 4DJBA 3W68A 3G6ES 1BQMA 3A2AA 5AW4B 3CW2C 2O01N 1QJHA 2B89A 3KK3A 3HHDA 4XDDA 4OI2A 1SC3B 2D9OA 3MUMP 3ENQA 1QAJA 1MV8A 5GAHU 3CCQP 4ECRA 1T8EA 3DI6A 3QGGA 1N33F 3Q2TC 2Q7CA 4DX5A 2AX0A 2KYZA 1YG0A 1FI4A 3N9UC 4USTA 3ILLA 2DEIA 2XQCA 3Q1MA 3L74G 3EUNA 5GAGU 3HVRA 3ENVA 1SC6A 1FEHA 3RU0A 3OW2O 2JKVA 1NKEA 3QRRA 1VISA 3H8YA 1MUUA 5A8KB 3V2UC 2BOPA 4MIAA 1HNZJ 1BGYJ 3L74J 4M95A 5KFIA 4MKVA 4DR3F 4PYAA 1KR4A 2XYGB 3CD0A 4S0MA 1JX4A 1A0OB 4JI5F 1C0TA 1KILE 3I55S 2K3IA 3F73A 3NFQA 5J2NB 2E5LF 3CJRA 3KKFA 3UPFA 2UVRA 4WK1A 3SYZA 1ZM3A 3T6BA 3THVA 3P8MC 4C0OC 3AFGA 3HVTA 3V6KA 4ZPVR 1TU0B 5HROB 3THPA 4XPCA 1T95A 3FBCA 1IUJA 3CC2P 3AEBC 5J1EA 2WVBA 2VPYB 1RCOB 5EFWB 3GV5B 2IMOA 1BQXA 1DQ8A 1JLAA 1QL2A 3KNAA 4C7RA 3CCVS 1NTKJ 3CDAA 4ASVA 2KI2A 4ZN1A 4UZCA 5CBNA 1VPCA 3KDNA 2BW7A 3SQOP 4EK2A 5E2QA 5KOXA 1FU1A 3BO4A 3L7OA 4DR2F 1RE3A 2AEMA 3A8KA 1X5PA 2O5DA 1HNWF 2F3JA 4KT0J 1DTQB 4H4OB 1AZSB 3H40A 4Q7AA 3DOKB 1TL1A 4LSLB 1M8OB 1PP9J 1NKZB 2CZ4A 2Y0BB 4QBUA 4ZVSB 2ZE2A 3NCRA 3PRJA 3EPIA 3B5NA 1NTZK 4NI2B 3TGUJ 4I1TA 1T9TA 1REGX 2GIRA 2CUYA 3CCMS 1BCCE 2A45G 3KMQA 1QDUB 5IWAF 2BVZA 1R8PA 3OLBA 1KQGB 1TV6B 1JJ4A 2L48A 2KG1A 1NTZJ 4A8KA 4ZDNA 4IRCA 2PI5A 1KILC 4ZN3A 1GU4A 2I9SA 5A2QU 5BU8B 2W7AA 4WWSA 1RHKB 4TYBA 2AYBA 1WWHA 2WTYA 4ZVEA 3DRYA 4C8MA 4Q2LA 5AE3A 1HQUA 3R6GB 4ES3A 4W7ZA 3CCUS 1SQXE 1SJRA 5B7WA 2NR0A 1N5QA 2PI4A 1LT9B 1UZDA 4JB8B 4DV5F 3CJ2A 4PV1C 2LXBA 2BOAA 2F9JA 1VLOA 1WSVA 3BSNA 2Q1KA 2HQ3A 1NAQA 3P96A 2ZNYA 1N0VC 2VH7A 3OAKA 5A76A 3I0SA 4DT0A 4RJTA 3RBEA 4M5HA 2UUAF 1P1TA 2E5IA 4OMFG 1Q53A 3OR1A 1J1EB 3BGRB 4IRKA 4AFFA 4ZKPA 3CC2S 4KHMA 1MU2B 1HTLC 2AQ4A 3KDPB 2K8GA 1L0NK 3SCJE 4F0KA 3WUUA 2HBYB 2MY8A 3V6DB 3FDSA 4DS4A 1HR0J 1SH2A 4NA2A 2Y1JA 2QM7A 2MKSA 3N4WA 4USHA 3M1VA 2MQ8A 1R8HA 4EUVA 2BM1A 2CQGA 2R5DA 3MM8A 3UN5A 1RACB 2W6JH 2GAHC 2XZTB 1Y7PA 1IBCB 1BE3E 2K3RA 2B87A 5F9NA 4ECQA 2IMWP 2H5EA 2G9OA 3V5RA 5K8PA 2PAJA 2V4JA 3AA8A 2BJDA 3QT7A 1HF9A 1IKYB 3C8YA 2KT5A 1KFSA 4WZQA 2KS1B 3UW1A 1LP1B 1UFWA 1Y5LB 3T97A 1FKPA 4QWDA 3A3OB 3PHTA 5DG9A 1XBWA 4ECWA 3CDBA 2ZEJA 3HE5A 2FJVA 4P6QA 2QT7A 2IVMA 3OR2A 3V4MA 2DPIA 3MEEB 3FC9A 4IFFA 4KBIA 3TP2A 2AJFE 3SSUA 1SQQG 2MHNA 2ZNZA 4ZITA 2DHHA 4D6TJ 2Z57B 5CH7B 3W8PA 3HK2A 3OXLA 4Q0BA 1FKOB 3M8SA 4OHXA 1JK9B 2GVDA 1UJ5A 3O2IA 2IM2A 3LW5J 4U7UK 4O0IA 5DGAA 5EN1A 2DVIA 1NJIQ 1I3OB 2F5GA 4PXDA 3AE1C 4J9NA 4EEYA 4I56A 1IBMJ 2U1AA 2KFYA 1H0TA 2HS4A 2Y0SD 1D9FA 1ZR2A 5FIIA 1JMMA 1Q79A 1KB9H 4X4TA 4ES1A 1IXKA 1PIEA 3W3SA 3I82A 3MPYA 4Y2KA 2YO3A 3IF4A 4PPDA 3CJSA 4QJVA 1EAYC 3M8QB 1PBAA 3NGUA 2R32A 3VWSA 3Q8UA 3TWZA 4GC6A 2CZ9A 3M6VA 3CSKA 5LSRA 1DIPA 3W62A 1UFLA 3L70G 2IHR1 1P9QC 1N73C 3G4SP 2GJ2A 2LA4A 5GMEA 3IRXA 1YJ9S 1HH0A 1U0SA 3GG0A 1RT7B 4OZLA 4WJBA 5CMZA 1DLOA 4BC9A 4HH2A 4FN5A 1WNEA 3AB2B 2WVCA 1CJTB 4DQSA 3H7HB 4NRTA 2JJ4D 2J5UA 1FESA 1HMVB 1T3NA 5J2MA 3HZGA 4OZ1A 2CXEA 5AW8B 3A13A 2PD1A 2OTLS 5BVZA 2X3GA 1PG5B 1OXZA 2H7HA 5IFMA 5GTHE 3DRSA 3OUYA 3V4IB 1RF1B 4UUXA 4EIJA 3R2DJ 3UR3C 3EXCX 1MFTA 5A8WB 3VZHA 1VQ9P 3TANA 1RWNB 3D67A 5CYMB 2EWHA 4WWIA 4M63A 2PEBA 5HJYA 2KNCB 2B88A 2FDNA 2WONA 3JSMB 1U0HB 3TEGA 2UXCF 3KLIB 3EDQB 2OTLP 1LWUA 4CCHA 3RK3D 3QATA 1RT7A 1FF2A 3CC7P 4UB6H 5D4LA 4LUBA 5A0YA 2BJ1A 2GS8A 3IWNC 1KEKA 2D2CC 2DRDA 5J2PB 3L7PA 3OUYB 4ZHRB 4DCPB 3Q8QB 2GMHA 3CXHD 1X4FA 3QT5A 2IYGA 3MM9A 4J9SA 1FOSE 1WSRA 1FZBA 2XGQA 4NLVA 2PE8A 4DUYJ 1N32F 1VDHA 1PGZA 4IFVB 3RB0A 2ZH9A 1UEVA 2NXCA 4DV5J 4MK9A 2VDIA 2ACYA 1E6VB 2W7OA 2AJ1A 1N5YB 5DM6Q 2L91A 3L75G 1HL6A 2F7VA 4J9QA 5ETQA 4PV1B 3QNWB 3TVKA 1CJVA 4QPTA 4P7VA 4KHRA 3LH2S 4Y2AA 4RESB 4C0HA 2N9YB 2OEMA 4NXNF 4EZ6A 3RR8A 2HEKA 1NHKL 3NEKA 1X4HA 5KFBA 5L1LA 4FVCA 2FVRA 4WBFA 2FYNC 2DY9A 4E8UA 4ZP8A 3BR9A 4PCQA 3FEYB 1U6FA 2DR9A 2ADBA 4ZPCA 2NSBA 5CBOA 2CQCA 3MEEA 3AODA 3RL0D 1HBOA 2ALZA 1SQPG 4WIQA 4JUZA 3K58A 1TMJA 1NK7A 3BO3A 3SFEC 1EZVD 3N0VA 1X9MA 1Q8KA 3WX4A 2ZM6J 3CCJS 2G1HA 3TZZA 2EPIA 1WF2A 2MZQA 3Q8VA 2NREA 3NCQA 2AJ0A 5KT7A 4B02A 2KS1A 4JV1A 4OGQD 3M91A 2GQQA 1DBDA 2K7KA 2NPIA 1AQTA 2FVPA 2XS2A 1NTKG 2NS1B 4KB7A 3U1CA 4CP5A 2WPRA 2FJEB 3LGNA 1NK8A 1TQLA 3PO5A 4NA3A 1K44A 5EWEA 2L9DA 2R2SA 2BXJA 2F65A 5KFLA 1IVZA 4D3HA 1FJKA 4Q44A 1F5AA 2C28A 4JI5J 2HHXA 1YSJA 2HNDA 4LF8F 1KVKA 5J2MB 1RT5B 4RW4B 4C7NA 1Y00A 5IS2A 2IFMA 2ZJPQ 5I42A 2WONB 3JSMA 3D6ZA 2A06D 3GW6A 5DQIA 2LQJA 3CCZA 5APWA 4WE1A 5M2PA 2BQRA 2G1DA 1KONA 2XNRA 4DR4J 1NRKA 2YKNB 2R8IA 5B0DA 3EM1A 4IQMA 1VQNP 3GJRB 1YBTA 4E98A 3NCPA 3B78A 1FRKA 2VQEF 2FJDB 3G82A 2DPJA 2Z2YB 3TJ9A 4JI0J 5KFPA 1WORA 3RK2D 3B6BA 4F4WA 3FEXB 1NM2A 3AE3C 2EG2A 1J5EF 2NSCA 1U7MA 1FCAA 2CJQA 3EX7B 2W9AA 3QIPA 3JCUE 3QH9A 2GO9A 1Y47A 5KLVJ 2B5JB 2LEPA 3MAHA 4JYAJ 3DOMB 4PWDB 3CCTA 1S3JA 1TK8A 1YYCA 3MCOA 5BU5A 2Z2ZA 4MN4C 1HWIA 4ZVFA 1IFPA 2FPHX 3L72G 1GK8A 1RAIB 3R2PA 1UVJA 1HHQA 4FF4A 4O3SA 9RUBA 1F2GA 1KC8T 2MZJA 1Y3JA 5BXIA 2RS8A 4BC7A 4X65J 2M4MA 1PGJA 2GQCA 1FWPA 3VAMA 1JLQB 2RAQA 5KFSA 3CCMP 1S99A 1NU1K 1HNIB 2I1RA 2RF2A 2UUWA 3NWGA 4P71A 2CJAA 1SJ3P 1VLYA 1X4DA 2ALYB 5ETKA 3OFGA 5MAOA 2ZWPA 3FZBA 2KFZA 4MKBA 4ITSA 2GW8A 2LXCB 5CZXA 2DYAA 4DV2F 4O4GB 2CJKA 1OO0B 2WPQA 2JEJA 2BX6A 2CPYA 1NSKL 2JWNA 2ZDOA 2P58A 4NLDA 2AT1B 5LXYA 4PYDA 3KLEA 3PW5A 5HJXA 2DHGA 1N6QA 2XNDH 1S49A 4YR0A 2G2OA 1FOSF 1KLMA 4ELTA 1EKSA 3BCCG 3GYXB 1U6ZA 1LTIC 3SDEB 1NK6A 2UXDF 1U7LA 3GIKA 3SCKE 3OJAB 5H9FK 4WPAA 3ILIA 3ET6B 4MH8A 1WTBA 1ZAWA 1JY2O 2XV5A 1RT4A 2VZ9A 3UD3P 2CQ3A 4FS2A 2EKNA 2QJPC 1G6BA 2BCCG 5K5MA 2X1AA 1QVFO 1GL2D 2E7XA 5CD4A 3TJAA 4PR6A 5FLXY 4OYZA 2YWHA 5EDWA 1MWZA 2FY8A 2Q1LA 4Y28J 3SI8A 4DV3J 1FDDA 1XJWB 1GMVA 4CDIA 2F9DA 2MZSA 5KFAA 1NWQA 4RW7B 1SQPJ 4O3OA 5AXMA 5LM7E 1OVVA 1WKKA 1SKSA 1Q8IA 4ILMA 1HNXF 1PFIA 2Y8YA 2MY7A 2WSCC 1LEOA 4CWBA 4LF5J 2HNYA 2NLWA 3WQPA 4CLSA 2W9CA 1TKZA 3PFEA 3H2LA 1FX2A 5CCGC 4MFBB 1UWAA 1N5VA 3GR1A 1S6UA 1H72C 3NBPA 3PX0A 3FBBA 4IH7A 4BHQA 1XNRF 2HYIB 1VJWA 1R6VA 1EDIA 4ID5A 1RAFB 1TKTA 1RT1A 1TUVA 2JFKA 2BZ2A 3MHVA 4CLKA 1V3ZA 1UVIA 5K8NA 2XTJP 2LU1A 5MLCV 2XCAA 3B71A 3CDUA 1LW0B 1M1JC 2FBWC 2VD3A 3OVAA 5APTA 1KMIZ 4RNFA 1EC5A 2FXOA 5DJTB 1KYOH 1FZAA 3IWLA 3QO9A 2K06A 4NLPA 2P10A 3G87A 3HT0A 1BDDA 2RSQA 2L41A 3HTKB 4PJ0E 1JJHA 5DZ6A 4DZOA 1SJ4P 1UKUA 2BQ3A 1M7LA 1L0LK 1AFJA 1NO8A 1PJ7A 2JP3A 3HDSA 5HBMB 1R3NA 5LL6d 3MR5A 3PLNA 1RBLA 1P9YA 3VMYA 2E44A 2E75B 3MM9B 2XY5A 3KOAA 3SWFA 5J1EB 1H73A 4M5JA 3LUYA 3MGJA 3V81B 2XI3A 1JLGA 4ZPDA 2YNGA 4EI2A 3MUVP 4HDHA 1Z1ZA 2PEHA 4ZVPB 2FHMA 5J2NA 2YX4A 2Z8QA 4OHZA 4DSFA 1D09B 2LQ8A 2RDJA 1OY8A 2W4PA 2KG0A 1SJFA 2O01J 2IJFA 2JRSA 3FCVA 4TLRA 5DQHA 2BJ3A 3DLJA 3QZ8A 5B66E 3AH6A 4WK3A 3LP2B 1FFGB 2M9KA 3MAAB 2R9LA 2VASA 2E74D 4C48A 4DL6A 4W98A 1A02J 3JS9A 4DL4A 4F36A 3D6HB 1BSHA 3M0DC 1VS3A 3E7KA 2KH9A 4I2QB 3KK1B 1Y3KA 2GJFA 4MAKA 2IFNA 5EWGA 1EDKA 1JY2N 3MP7B 1RYSA 4WE1B 3M2RB 4DL5A 4USMA 2CVEA 1U49A 2ZKTA 5B08A 2BV3A 2ZUGA 4CO4A 3CPWR 2KNCA 2CNOB 2GNKA 4KPCA 4DS5A 2Q43A 4YXWH 5C5JA 5EWFA 2J6SA 2MKHA 2FYUG 3BPDA 1M1HA 4EO8A 1KTQA 1VQKP 1F9FA 5DDRC 1R31A 2Z5HA 2EFQA 3BH7B 4B3MF 4G1QB 2R7VA 4NLSA 2QA4P 2ZFHA 3F89A 1UAWA 3FSXA 1T3JA 1FVQA 1J5EJ 2QA4G 2B4PA 2JLGA 4AUWA 1YKWA 4QZVB 5G0RB 2ILZA 4TXSA 5AW2B 2ITAA 2E76C 3JC22 2V8PA 1MFZA 3OTOJ 2Z56B 1TTHB 1SQBG 3P6YC 2AJQA 2CQHA 3U27A 3EMTA 2C2EA 4NEZA 2NZ2A 5I4MA 3SEOA 2VOPA 3RBZA 1VC6A 3D1QA 4F2SA 1KV4A 5HSPA 3PP5A 3L73E 1YI2S 1FZFA 1RWUA 3TGUE 1V5VA 2BE2A 3DLBA 5DZ7A 3UD4P 2A06E 3GV8B 3P49B 1AZSA 3ZZOA 3ONQA 4LIRA 2P6SA 4ED3A 3O6QB 1RHJB 4ICLB 1BE3G 1J1EC 1S7IA 1RHMB 1KQLA 4KHXA 1UEKA 1JLBB 2IC3B 1H8AA 2J5AA 1EQMA 2XLJA 2CPBA 3G8TA 1U7JA 1TL7A 2AW0A 3BBCA 1VIXA 1AVOA 3SQGA 3CI9A 5JJBA 4DR2J 1N73A 5KFUA 4G1QA 3NGDA 1WT6A 3LAKA 3M8RA 1GXTA 3D4JA 3DDIA 4Y2CA 4W80A 3UI3A 4OJ3A 3VMAA 4ILLA 2BJ9A 2CPXA 1IWGA 4DUZF 4KHPJ 3WUTA 1N36F 3LP0A 1HWUA 1U25A 2WT7A 2P5VA 4FVMA 2J58A 2E7WA 2OYHC 4OLPA 4UOCA 1S57A 1WEYA 1EKRA 4GKJJ 3CD5A 2VB6A 4U3FD 1S0MA 1FZCA 1X7VA 1LTTC 2FHKA 4C8ZA 2GFFA 3C15A 3Q2YA 1AXQA 3CJ4A 1HARA 5KFMA 3K17A 4YXDC 3FFIA 3ETOA 4EYIB 2N3LA 3SQGB 2ZBRA 4DWIA 2XHWA 3H1KD 4LFCJ 2OTKE 2VL1A 2XMKA 4M5MA 3MF5A 3MOZA 2Y1RI 2CQIA 5IZHA 3AXKA 4IL6X 3I5CA 3D71A 3PO4A 2YXLA 2KB7P 4UB6E 4F3OA 1WD6A 1TL5A 5KFVA 2CPIA 5K14A 2CPHA 3VQSA 2RH0A 3QAUA 4Y00A 3I55P 4DSLA 1JLFA 2JC1A 1H0TB 2RQ4A 2VFSA 1H6KX 1GTEA 1BY9A 1H7WA 4RW6A 3FXDA 1HI8A 2KUBA 3I56P 2B3TB 2IZ1A 3U1MA 3SFGA 2YH0A 3E51A 1HD1A 1RB0A 1E79H 2RB7A 2VG5B 2PT0A 3AEAC 1R0BG 2QJKC 1N8RQ 3GF3A 1JQGA 4ZVOB 1HHTP 3MFHA 5AVXB 1N7SC 3KJVB 1LFPA 1PCAA 5HVGA 1REVA 1H38A 1VJQA 3TNUB 3HD2A 6FD1A 2CG8A 1LTAC 4NLWA 3K5BA 1UEUA 3DOLA 4JI2F 1R27B 3TEHB 2FC9A 5APSA 2DCUB 2JJLA 3LOUA 3CVKA 3H1IG 2OMOA 2AX1A 1JLAB 1SQXK 3R27A 4JV5F 1L0LD 2B9YA 3D0IE 1EP4A 2HPUA 2IBZI 4I68A 2V8GA 3GIIA 1ZZNA 1ZPVA 2ZDPA 4CIOA 3VOPA 1EQ7A 3M9QA 2AZ1A 3T1YF 1TL3B 4DV1F 4FF2A 3HM9A 3WUVA 5KFWA 3KLIA 4X62J 4P73A 4A8XA 3OL6A 2Q9IA 5I42B 3PIPQ 3CXHI 4DV6F 3G86A 1BD6A 1NHVA 4ETZA 1Z4UA 3LGHA 4DL2A 1V3SA 2F8MA 1FX4A 2VA2A 3MAAA 2IRXA 3T5KA 1CI6B 1NHLA 2C22A 3MMCA 4N8OA 4HL9A 2W6AA 5DQGA 3M06A 2E75D 3PHEA 5C2CA 3T9NA 3G96A 3I96A 4B9MA 1NO4A 4I2LC 2AF6A 4U8YA 1FVSA 1LK5A 2OAUA 1FK9B 1CJKA 1K73T 1WDDA 2MPUA 3HFVA 5AVUB 2CJXB 4HR2A 2B9EA 3C3LA 4EU0A 4CH0S 3JCUH 2W2QP 3OHBA 2JDIH 4KGVB 3ILOA 3E2EA 1XTGB 2QVAA 3H2UB 1U1NA 3GHGA 1SQVG 2E74B 1JEKA 3EYZA 2MJNA 3RAXA 1QVGO 2DD8S 3W9JA 2ZVIA 1HBOB 3GMGA 1RE3C 3UDLA 1T9UA 3PYGA 5F41A 2LLZA 4H4KC 1AW0A 2DNNA 5F0UA 1LNQA 3LTOA
chains in the Genus database with same CATH topology
1RTIB 1XNQF 3K7RA 3CJKB 1K1SA 5CD4H 2HNDB 2UV8A 2YX1A 3MURP 1P6TA 3DLEB 3MM8B 1FNMA 1LW0A 5H1SV 5DO2A 2RS2A 1P8GA 1S6QB 2K3KA 1HQEA 2MQNA 4J9LA 3VALA 4WFZA 5BYSA 4HT5A 4WTYA 2BABA 2R2RA 4ZK7M 4UY85 4A8SA 1Q90D 2YMKA 1JB0C 2ZH6A 1U1PA 3U1NA 2XSJA 3D54A 2DT9A 3IO1A 3WBZA 5EX0A 4FXWA 4B9TA 4IG0A 4H4MA 4DG1B 3D0GE 4OI0A 3PW7A 2PFFB 2DIVA 1U6BA 2XMTA 3ZFVA 1S97A 1E6YB 5T41A 4TYAA 4X4PA 1HBMB 5AXKA 4IOAQ 5GAEI 4H0LB 4KGKA 3NNHA 1WHXA 3BSAA 3O3LA