3H2CA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
257
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNGSYNEVDAAVRHAKEMRDEGAHIIDIGESTRSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 84
structure length 257
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2cA00
4NIRA 1EYEA 4DB7A 4C1NA 2YCLB 4DJDA 4C1NB 1Q7MA 4DJEA 3H24A 3H26A 3H21A 4MWAA 4S38A 2VEFA 3V5OA 1AD1A 3BOLA 4G9PA 3H2AA 3K13A 4S3BA 3NOYA 2VP8A 2OGYA 1F6YA 4O0QA 4S3EA 3BOFA 1TX0A 3TZNA 4S3DA 2YCJA 4S39A 2DQWA 1Q85A 2YCKX 3TYAA 2Y5JA 2YCLA 2Y5SA 4MWAD 1AJ2A 4O1EA 4NILA 3H2FA 4DAFA 2DZBA 3MCNA 4NHVA 4DJFD 3H2OA 3TR9A 4MWAC 3H2MA 3MCMA 1AD4A 4S3CA 3TYEA 4D8ZA 4DJFC 3MCOA 4PZVA 2H9AA 4DJED 4NL1A 3TYUA 1Q8JA 3TZFA 3TYDA 2VEGA 4S23A 1Q7QA 4DAIA 3H2EA 1AJZA 4S3AA 2Y0FA 2BMBA 4CCZA 4DJDC 2DZAA 1TWZA 1TWWA 4S3FA 4HB7A 4DJDD 5JQ9A 4MWAE 1AJ0A 2E7FA 1Q8AA 3TYCA 1TX2A 3H22A 1Q7ZA 1TWSA 3TYZA 4O1FA 4DJEC 3TYBA 4D9PA 3H2NA 3H23A 2YCIX 4DJFA 2H9AB 4MWAB 3H2CA 4D8AA
chains in the Genus database with same CATH superfamily
2X0HA 3I65A 2X42A 3IJLA 3WUFA 4Q33A 4P7NA 4JX5A 1UH2A 3SCNA 1VIWA 5EMMA 2QVHA 3ZLHA 1BD0A 1JYVA 4AY7A 4U5KA 2DDXA 4C1LA 3WIJA 3H2AA 3MU7A 4IJCA 2VEKA 1OJXA 1TJPA 4WKFA 1X1NA 1UASA 1NARA 4EP8C 4UIOA 3RYSA 5AC8A 1LWJA 2C6QA 2BG5A 4M56A 1JPKA 5CG7A 3Q65A 3M0MA 3L9CA 1RA0A 4WY0B 4KWSA 1TRDA 2J27A 3APYA 1FQ0A 3TTYA 5CZSA 1X6LA 2EPMX 2VR2A 2WWCA 1UPMB 4LB3A 2ZX8A 3N4FA 4K8HA 3LXBA 1I9CB 5CC7A 4HHMA 1E56A 1F6PA 3GD6A 3EA3A 2OYKA 3GTXA 5U7SA 1RVGA 1XIFA 1CXLA 4OGZA 4HNNA 3TE9A 2PGWA 4XB3A 1Y65A 3H70A 4Q8VA 3VUSA 2PCEA 1PAMA 2E40A 4E4UA 1B3VA 1QDSA 1M3UA 3AIUA 4RL3A 3K1DA 3LLDA 1F3WA 4PUDA 1W1A1 3L2MA 5E1QA 1OC5A 5IRPA 3FN9A 1EQCA 3EOUA 4L9YA 3UESA 5FEXA 4YTSA 3CHCA 2H9AB 3XISA 3R11A 4GD0A 1WQ5A 5CKSA 3W2LA 2XIOA 1ME9A 1QI0A 2B0MA 3DDMA 1RCQA 4JIQA 1CPUA 1D8WA 3W7JA 5D38A 2ZX6A 1TPEA 1TFVA 4K38A 5I7GA 1R30A 1XLLA 2BLEA 3P62A 1RSCA 1I6NA 2RDTA 3ARXA 1XCXA 3EDDA 2OU4A 4FLOA 3SQLA 4MLRA 1PHWA 3WQWA 4F66A 5H2ZA 1E4IA 4C5ZA 3CEPA 4NILA 2VCAA 4Q4MA 3SY1A 3URQA 4NSBA 2QS8A 1EGVA 3WKZA 1UR2A 4WJXA 3CHFA 1JD7A 1U5VA 2JIWA 1FDYA 1DOSA 1KFBA 4GY1A 1CGWA 3W6YA 2AQVA 2A3AA 3LBCA 1LM1A 4DAIA 3OLGA 4DZAA 1A53A 4G1NA 2V5LA 1GQNA 4RXGA 5CPQA 3NSMA 1KW1A 2J25A 2PTDA 5MHBA 2EGZA 1L6FA 1UD4A 5C8BB 1E0UA 4RUBA 1VPYA 2G8ZA 2J7HA 4Q32A 3R13A 4JTAA 4ZQRA 4LUSB 1PV8A 4GHRA 5I06A 4HYRA 4ZCWA 2WC3A 2NQ5A 4LUTA 1D3CA 3NDOA 1B3ZA 3JUGA 1AW1A 3B97A 3J7HA 1A5MC 1BYCA 3RK8A 3E5PA 3GKAA 2AAMA 5I3IA 2KAUC 3A23A 1V3IA 4MZYA 5FJIA 3E1F1 4UFJA 5FF0A 1BHGA 3UWEA 1C8VA 3IGHX 4Q8PA 1O5XA 4XIAA 3S6DA 3Q67A 2POZA 7TIMA 2YR1A 2E6AA 1QOPA 3QH2A 4AFYA 5I03A 2PBGA 2FKPA 3H7UA 4ZOEA 5DXXA 2QUNA 1PUDA 1ALDA 1FWSA 3RM4A 5M03A 3U2CA 2ZXAA 3LDVA 1GVEA 1UKSA 4JIHA 1TPC1 1OX6A 4WSKA 4HA1A 2NLYA 3QFWA 4KT2A 1MEIA 2CERA 1NY1A 3W7LA 3VPLA 3ZLFA 3LHTA 4C60A 2A21A 4B9ZA 2VVSA 1HVXA 1FFRA 4HMEA 4LFYA 4JTHA 2QT3A 4JIPA 1UKPA 3QRHA 4IIBA 4FF7A 1VFLA 3BAWA 1GVFA 2GVJA 1O12A 3W1PA 4QQ3A 4OKDA 3LPFA 4L9XA 5FEWA 2VX5A 4KW2A 2B7NA 4PE8A 4YL2A 2YCLB 3STCA 1B2YA 3BMWA 4POCA 3TFXA 2J74A 3O07A 3T08A 4MAZA 1FHUA 3ZMRA 3K13A 2G4FA 1C8QA 1JF6A 4J3VA 4UUIA 3QYSA 3S6TA 4GVFA 2VI0A 4PCPA 3IJDA 1XH1A 2QPSA 4NRSA 1K9DA 2R24A 2Y89A 4FF5A 3GIYA 3W82A 3UCDA 2V38A 1ONWA 4AEFA 3NQAA 4H6EA 3AU6A 3GX9A 2CFFA 4O4VA 2OPJA 3GU1A 1W6TA 2Y63A 3MCNA 4LNYA 3PWIA 1R7OA 1V02E 4IP7A 2X7WA 3CB3A 1VJIA 2WSQA 4S3CA 1JZ6A 3EKLA 2GGEA 1JYWA 3W0KA 1UMYA 5ABFB 1UZ1A 4GC4A 3K5XA 4KFNA 5AC7A 3WLRA 3NEVA 3CTLA 4GY7A 4HTBA 5D30A 4G7EA 5FAGA 2VC6A 3CHVA 2FH8A 1F74A 1Q66A 1RLCL 1QATA 5ABHA 1R5YA 2Q01A 2P3ZA 1TCMA 1UMLA 2VCCA 3WQFA 4CNNA 3BH4A 1Z48A 5AYBA 1YNYA 3R8RA 3W37A 3LX9A 4BQ4A 3W7IA 5DT5A 3N6QA 4O15A 3E9AA 4DJDA 1SZRA 4I5XA 3RUBL 4I9MA 3EA2A 3AU2A 2WNWA 3KOFA 4QCFA 1GCYA 1QPNA 4TQTA 3P7YA 4U33A 1Q2SA 5RUBA 5FJRA 2Z1KA 4F9JA 5IFTA 4DWSC 2V5BA 3W73A 3C2VA 1K4HA 3O2LA 3GDRA 1PCWA 3UR2A 4C5YA 2VWSA 3SBFA 3FYPA 3WF4A 1XLCA 2J7EA 3UPBA 3O6YX 1P43A 3MZ2A 4E4PA 1PZ2A 4O12A 1W9XA 2E68A 3DZ1A 2J13A 3DU0A 3KOZA 4KRTA 5D09A 4H01A 4ZOCA 3ZWSA 4MB5A 4F48A 3RX2A 1NAL1 4NYYA 4RW5A 1E71M 2PDIA 1Z41A 1X6NA 4NXSA 2VZVA 3PTMA 5TD4A 1NIUA 2FZ9A 2O9RA 5LXEA 4WRHA 1PDZA 3DFOA 5BW6A 5LGZA 3A22A 1Q4WA 3SRKA 4FNQA 1FHDA 3V75A 1MQQA 3KBMA 1XDLA 5BXPA 1BTMA 1CGYA 3T2OA 1Y5WA 4XAZA 1XFCA 4D9PA 3KBJA 4JZ5A 3NL5A 1WDRA 3OA5A 4ZFCA 3ZYZA 1KLYA 4RX0A 3AC0A 2OT1A 1FY6A 4QHRA 4W9TA 4GUGA 4GYKA 2PPGA 3R10A 3CIWA 1B3XA 1B1YA 1TIMA 3H4GA 5HBFA 3E2QA 3EMCA 4W4QA 5BYWA 2JKPA 1DJGA 4BWLC 2D22A 3QFEA 4UFMA 1EJ7L 4I9JA 4JKMA 3NQVA 2EBNA 2DEPA 3CAVA 4EPKA 5CZTA 4ATWA 2PC4A 3KCJA 1OT2A 1DEDA 3AS0A 2GGHA 2YYTA 4KBXA 2ZA2A 4DYJA 2WMHA 1RALA 1AMKA 2YBUA 3M0LA 3WFLA 3PC0A 4N7QA 3T44A 1P6CA 2CLLA 1E15A 4GNVA 3SCRA 3PZTA 2WQDA 2Q71A 4GINA 1LRNA 1W5OA 1E73M 1V6XA 1XRVA 4TVDA 3OO2A 1MW2A 4PSPA 1Z42A 4B9YA 3AS1A 3SECA 3DI0A 4GQRA 5D04C 3OGVA 3ONCA 4PSRA 3MV11 4DJDC 1EC8A 1EC9A 2VELA 1HW6A 2RFGA 3GAYA 1FWDC 1BTCA 2WJEA 1W0MA 1JAKA 2EPLX 4EPBC 1Q8AA 1TE1A 4W5ZA 3PUDA 4PB3A 3A21A 2C1IA 5AYXA 3ANYA 3IUDA 4FXFA 2I5GA 1W5QA 4FA3A 1GKRA 1I4NA 2W6RA 3FOKA 4KQNA 3AICA 3GUGA 2NZLA 5C9XA 1QPQA 1KRCC 1UH4A 1S2UA 5K4XA 1KM0A 2FB3A 4PH6A 3W1TA 1A5CA 4GZEA 2ZRWA 3HQNA 2V3FA 5I5RA 1J93A 3VX0A 1XUZA 1V7YA 2QJIA 4E3VA 2XZ9A 1H51A 2X1RA 3QZ6A 3RMJA 2XGBA 3W7CA 4UQAA 4Y9MA 3TIMA 3LSBA 4ALDA 4GQGA 4M6VA 4QLJA 3Q2DA 4HKPA 5EBAA 1JZ4A 3ARRA 4JX6A 3GLCA 4X2RA 2O9TA 4CQ9A 2H3BA 2GJLA 4RZ6A 3VNJA 1A5AA 1XR2A 4MWAC 4IISA 3E38A 4MM1A 1EP3A 2J9XA 5A6LA 1KB3A 3N25A 2OZ8A 4S3AA 4YMZA 4GO8A 4QP0A 3OU8A 4LXFA 1RP8A 1IWBA 2WVUA 2X05A 4HSNA 3NQEA 1ICSA 1RR2A 3A3HA 2ASHA 3V5CA 3MUXA 1JFXA 2BVTA 1VH7A 3QJAA 3LCIA 3PF3A 4UBPC 5AYIA 4J27A 3SQMA 4C6NA 4EWND 2XH7A 4JDYA 1C3FA 1BGAA 5KEZA 1HKVA 5JBDA 5HULA 3WQ8A 2PWHA 3B06A 1QT1A 3HG4A 3TQPA 4AZ7A 4NNBA 4LF1A 5T91A 4ZZ9A 1T41A 3RM9A 3MUAA 1Z89A 3BLIA 3QPEA 1ISWA 4DVOA 4MADA 3UXLA 5EMYA 4IPIA 4PCNA 3BMXA 3POCA 3FAXA 4GISA 3W1QA 1RHCA 2FTPA 3ZT5A 3PBGA 4DXKA 1JDEA 3GIPA 1Q85A 1F61A 3ITTA 4F0RA 1AH3A 1UR4A 4I8DA 4O1EA 3OEXA 3B0VC 4AHPA 1I2RA 2Y2WA 4FOKA 3C4UA 3M6DA 4XBJA 7TAAA 2HRWA 2PF8A 1UCWA 4N9BA 1E9YB 2BVWA 1H61A 1UBSA 3W2UA 3G0UA 4J40A 5A69A 1YW1A 3U4FA 1FDJA 3W84A 3GYCA 3SUSA 2ZVRA 3CIXA 5E6ZA 3HB9A 3PZ9A 2VWTA 3ATZA 3P0WA 2HXTA 4N4PA 3KW3A 1QPKA 2YJQA 3W2KA 1P48A 2PDHA 3T81A 1XCWA 4FPSA 1RK6A 3LHWA 4IQEA 4Z2IA 1E6RA 1VFMA 1UWRA 2RAGA 4M6UA 1J6OA 3UY7A 1NP2A 1V7AA 3W7HA 1DJQA 3N2BA 3V16A 2NQLA 3F7JA 1ZBWA 2GFTA 3GC5A 2DIKA 1VFUA 1W5MA 5DMYA 2EJAA 2JF7A 5BXRA 3MO7A 1ZJBA 1E0TA 3MPGA 1QJWA 3W7EA 3PJXA 4P61A 4YJ5A 4LC6A 4HPHA 1TTIA 5HA7A 1V0LA 2NQHA 4B3KA 4OQVA 3S83A 4W87A 4JTKA 1HKJA 3KP1A 2Q3RA 1RQHA 1UQYA 4UC5A 3DYPA 4BKNA 4US6A 1AL7A 4ZODA 2XFYA 3O16A 1Z44A 1S5MA 3L4WA 1YDNA 1MNZA 4ICCX 4EOUA 3LZ3A 1T99A 4LYRA 4BHYA 2OWXA 3I3BA 2P50A 3M5YA 4NX5A 1IEXA 1PDYA 2X0YA 3OLEA 3S1XA 1BXNA 1E72M 1R3WA 2J7BA 2PDJA 4ZB2A 3R0KA 4UTKA 4UWMA 3CZGA 4HA3A 1TYGA 3ZSTA 2C0AA 1NU5A 3MW7A 1PBGA 3UWQA 2WMGA 3VZYA 3ES7A 1V3HA 2VGBA 3DCPA 4GI8A 3URAA 2Y85A 1FOBA 1JQVA 3PBYA 1WCGA 4KIEA 3IGUA 1ZALA 2OQHA 5LYRA 4UCGA 1NFGA 4RNJA 4DHGA 3BOLA 1R8LA 3EXTA 5LHEA 2WO5A 1RK5A 2D1ZA 3UWZA 4Q7BA 4MSSA 3FK4A 1NVMA 4WCJA 4YTRA 3MS8A 3IANA 3G0SA 4OBTA 1S39A 3IJIA 4OBRA 2PEVA 5E09A 2QCMA 5KZDA 1PWMA 1F76A 1G9HA 3EX1A 1M03A 5JMUA 1TJ0A 1KFWA 3K4DA 3TK7A 3WEZA 4Q4QA 4ROPA 5LNRA 1ZS2A 4WLCA 3H2MA 3B4UA 1UR9A 3P82A 4LALA 6ENLA 4NZ1A 3D6NA 3L12A 1PSCA 1QFEA 3PFRA 1OZMA 6CGTA 1IZKA 3MSGA 5D05A 3AIEA 2BOGX 4IH3A 4QX4A 3GR7A 4A22A 5HMFA 2OOFA 3U5UA 3CXOA 5C9UA 4HZ8A 1WOAA 1B9ZA 4CVWA 2B7QA 5JIPA 1XLIA 2WQPA 2CLPA 2QDGA 3VNDA 2HE5A 3EOEA 3NQCA 4IIHA 2XN0A 3HPFA 3LYEA 1BVZA 3IJ9A 1EP1A 4CNSA 1V0NA 3R2GA 1AH0A 1FHVA 3BAYA 3N12A 4PMDA 2RDWA 4L61A 3F2BA 1FKWA 1WAWA 2E9BA 2DIEA 2FPTA 3AMDA 4PMZA 9RUBA 2W66A 1UG6A 1NQKA 2WW5A 3I3EA 4GO9A 2NLIA 2XISA 4YN5A 5EL1A 2CBVA 4M80A 3I4KA 1N8FA 1LUCB 4U3AA 1NWSA 3AALA 4AYGA 2W67A 1W2PA 3BK0A 2Y5SA 2YX0A 4HK5A 5K4ZA 1UOZA 1XKJA 3H2FA 4ZL1A 1XIDA 3G1XA 3PR2A 3GG8A 1R3QA 4KCVA 4W89A 1AD4A 6REQB 2VFFA 1L2QA 2C7FA 3NURA 4MB4A 4E4FA 3IJ8A 3LY0A 1EWEA 4Q3MA 1ITCA 4K7VA 2Y0FA 4B92A 3HPZA 2YL8A 1KCZA 5DRCA 2WPBA 1EJSC 1BWKA 2DSKA 2PRLA 4OHQA 1EA9C 4DYKA 4QJ4B 2NQZA 3T0DA 1MSSA 4DBWA 5BRPA 3GYEA 1EFZA 3CTTA 3W1NA 1L8PA 2A3CA 1PXGA 4PEEA 3URBA 3NZPA 5SWUA 3OHIA 5I24A 5LHFA 5PTDA 2AL1A 2FHCA 5I78A 4FLSA 3PNUA 3W81A 1R2RA 3R58A 1QPOA 2Q3OA 2G4JA 1BSIA 1LJYA 3DHDA 2W9MA 3VGDA 5EPDA 1QVBA 3BURA 1G67A 3GXMA 3BICA 4EACA 1H1ZA 5LNVA 4QFUA 3ARUA 3NL6A 1RXOB 2XGIA 3MBDA 4WZHA 5DQPA 4P5UA 1MW3A 5A6JA 1EHNA 2J7CA 3O9NA 1A80A 2VC7A 3T4WA 1XYAA 3N18A 1NDVA 1UZHA 1EC7A 3F03K 3AYRA 4HSHA 2YZ5A 3MWCA 3K4AA 5D37A 5BRQA 1IXNA 3TONA 3CM4A 3KTXA 3RLHA 5FD0A 1EUAA 1Q8JA 1YXDA 3T40A 3EDFA 3M7SA 3LENA 1LL4A 1JXJA 3T55A 3CASA 3CPGA 2VEMA 3SJ3A 1FVPA 4TX6A 1W3HA 3PBVA 3QC0A 1XICA 4TR9A 4L6OA 3HO8A 1VD6A 2FJKA 2ZZ5A 3VKCA 1KTNA 4TTUA 4URIA 4E0CA 1JL8A 1HJXA 4KS0A 3RRXA 2BVDA 2QKFA 4UTHA 3B0XA 1FCBA 1E1EA 5HOSA 4P7LA 4FOJA 3APTA 3K8LA 1XYMA 3FVDA 3FDGA 4NKCA 1EB3A 1IZJA 3RF9A 1I0DA 4PODA 4HCDA 3AROA 4IMEA 1J01A 2JFEX 3S6OA 2GDUA 2VRJA 2PDNA 5LNWA 4ERGA 1M53A 5BXTA 2EQDA 3GB6A 2OJPA 3WD0A 5CEWA 5TF0A 1DTNA 3E2VA 1OGGA 1G0CA 1QWKA 4AIEA 4NQ1A 4BI5A 5HINA 2WHJA 1G4TA 5LA1A 4ADSA 4LCRA 4K1WA 4P7QA 5B7ZA 3PZIA 1AW5A 4HMNA 2DT2A 4J35A 3JZUA 3HGJA 1DJWA 3L68A 4HSOA 1TZ7A 4Q8NA 5HJXA 4D8ZA 1TMHA 1U83A 4AF0B 2HJPA 2C79A 4KPLA 1G4SA 2WKGA 5C2GA 4LRTA 2G3MA 4IIFA 2FTYA 1KCLA 1LT7A 2QUVA 3DG3A 5I07A 2ZOXA 2HSAA 3TW7A 2W4XA 1QPRA 3VM7A 4UR8A 3L2IA 4AVNA 4CU8A 3UZXA 3CPRA 4CD5A 4PRRA 1VYSX 1ZP3A 3MMTA 3WUEA 3O7UA 1WX0A 4QSFA 4FOUA 3WH5A 1MQPA 2F6KA 3QMRA 4LWWA 4XZIA 2C8NA 5HK4A 3BCJA 5FAJA 4KERA 3R5EA 3BOXA 3LMZA 1JFHA 3GSMA 2RDXA 4O16A 2P1FA 3SCQA 3C0SA 3HQPA 5EMLA 5I3JA 2ZXQA 1KTCA 3QGAC 1CEOA 2XVGA 3EX3A 4L1XA 1VCGA 5AHIA 1GK8A 4WX2A 3CMGA 4TUFA 5M3WA 2QZRA 1J12A 2QF8A 3EB4A 1H7OA 3IJ6A 4PRTA 4CCEA 2PDLA 1VHNA 1U1HA 2PLKA 3LV5A 1XBZA 3GXTA 5D2TA 4FZIA 5LNSA 4BEUA 2HQAA 2EG6A 2O4MA 4H9TA 4QGCA 5ABGA 1V4YA 3AZSA 3SR7A 2WCAA 3AYTA 1EJVC 3UZWA 4K36A 2IW0A 4C6IA 3CC1A 1H41A 5IBXA 3WG6A 3HBLA 3Q37A 1Y5XA 4QE1A 2Y5EA 2WWDA 1SMAA 3W7OA 1UR0A 3W71A 5DY2A 1RBOB 4ZTYA 1ADOA 3T2PA 2IXVA 3W1AA 4IPJA 5HJLA 1O68A 1FWBC 2WJFA 2DZWA 3LXCA 1JEZA 1H11A 1W3TA 4ZO9A 3O3RA 4WXYA 3ITGA 6PTDA 4ICNA 3W2MA 4WXZA 1K9FA 4HMDA 2WHLA 4CNUA 3CPUA 5LIYX 3O05A 3PNZA 5AFDA 3GVWA 1YDYA 2V68A 3IV8A 1AD1A 2GJRA 4AEOA 4GE8A 2C3ZA 1VCFA 5REQB 3EXRA 3B4YA 4S2BA 4S3BA 5AOUA 2O56A 4UTTC 4H2HA 4D8LA 2YCEA 4R9XA 5HUOA 2WVVB 2QW5A 3WL1A 5E9AA 1V5XA 2V6AA 3WMLA 3UW6A 1GQKA 4LEQA 3RILA 3PBWA 2Q8ZA 2QDDA 2OEKA 2IKJA 2GK1B 4MFEA 1ZJHA 3P14A 4JICA 1IGSA 1OF8A 4UMAA 2V5KA 2DZBA 1MZHA 2RJHA 1JG9A 4JKKA 1MFUA 3RAOA 3AMLA 3OIHA 4DBEA 2BVYA 1OVDA 1TPB1 1EX1A 3W1LA 4FR6A 5DEZA 1G5AA 3FLUA 1GJPA 3DESA 3WQGA 1B0IA 3VNZA 4QJ5B 2J62A 1JZ3A 5BZAA 3MP4A 3D3FA 3QVQA 1GZGA 2CHNA 4MB3A 1YE6A 3S4TA 3N9SA 3LPGA 5A6SA 1K8YA 3WJYA 3W4RA 3KL0A 3UCCA 3UZZA 4Q6XA 2J9ZA 2XINA 5GJNA 3VGBA 4LYQA 1IWPA 2A6NA 3TH6A 3L4VA 2Y61A 4RJEA 4UZUA 3RO8A 1A4LA 3VD7A 4Q8QA 3UF9A 2DZXA 3LU2A 4E8DA 2JF6A 4QDWA 4DM1A 2V8ZA 3EWWA 5D2VA 5DX7A 4CD7A 3NXFA 4JEJA 3PBMA 1HGYA 1M5WA 2G96A 2VP8A 4F0SA 5EFFA 3T8LA 2CLIA 4AZ6A 3NAVA 2IQTA 1R87A 4M7TA 1NP0A 2DT0A 4Z1BA 3UNDA 3CQKA 5HMDA 1C9WA 1U1JA 2ZE3A 4JOMA 5CSRA 2TRSA 4PA8A 1J4EA 4PR4A 1GQIA 4JD4A 3D5HA 3ZR4A 2R1KA 1V3LA 1ODUA 1XIHA 1E55A 2D69A 1H7RA 3WDHA 1XGDA 3G22A 3PJUA 3OG2A 1T7LA 1ITXA 3MSYA 3WBEA 3C8FA 4GCXA 4RDZA 1NTHA 2BTMA 2Z28A 4HNLA 2W62A 3KE0A 3OB8A 1X8FA 3RITA 4GRSA 1CENA 2OFJA 3PANA 3T05A 1HUVA 4EX4A 5K9XA 1VENA 3PSVA 5KZ6A 3N1AA 3BLOA 3QQ1A 1NWRA 2WMKA 3MSDA 1XLMA 1HJWA 4MMWA 2IQ0A 4W8AA 1PJ9A 1W1B1 9CGTA 2UY2A 2FH6A 1NOWA 1H5VA 4RDYA 5D8WA 3ZSSA 3TTQA 2ZRYA 1E6PA 2ZUNA 1B54A 4PULA 3SGUA 3W72A 1I1XA 2WC7A 3VXGA 2XTKA 3UJEA 3QV8A 2C19A 4ADTA 1EP2A 1WZMA 1NFBA 3VD5A 2E3ZA 1CTNA 1TV5A 2GYIA 2V3DA 5CSYA 2D2JA 2DSWA 2EAWA 1PEZA 3FIGA 5G4HC 2FMNA 3LLFA 2YDSA 5BOOA 4YVXA 1KM6A 4Q6JA 3ZLGA 4PBGA 2HBXA 4LBSA 2NT0A 4X0VA 1VCVA 2WVSA 4ZXOA 3F4DA 4D2JA 4C90A 3PJTA 4JFVA 3WQOA 2Z24A 3OW1A 4KIRA 2ZRVA 2J8GA 5FF3A 3GVVA 3NPWA 1KXVA 1S1PA 4QDPA 3O8AA 4ZVJA 1YQ2A 4R53A 1THFD 1R6WA 4B90A 5CAHA 2J24A 1JRBA 2Z2AA 1XSJA 4FK9A 1YHTA 3M5ZA 4PMXA 1WPCA 4TO8A 4DM2A 3O06A 2G41A 3P80A 5D33A 3OLDA 3HPAA 3N9KA 5D03A 2H3DA 3VDBA 1FWRA 3A5FA 4J28A 2ZRZA 4KESA 2E4TA 3EPNA 4QEHA 5TNVA 2BODX 3OYXA 3KP0A 5FCZA 3NGJA 2J7FA 4MJ2A 2GVYA 1SW3A 2VGFA 3HG2A 3GFYA 4AX7A 4F9DA 3VD9A 1MMFA 1HXJA 3VZZA 4O10A 4MWAD 1IT8A 2GGJA 3STGA 3I10A 2Q6ZA 5C5YA 1LLZA 2VZTA 3BZJA 2WSKA 3H2OA 3R43A 3LZ5A 1Q6EA 4XVEA 3SURA 5KSWA 1YEYA 3NWRA 2DIJA 2V9DA 4B15A 1XLAA 4H8UA 1RH9A 1A5OC 3L4YA 1SR9A 4A3HA 1D2KA 3Q58A 5D2YA 1W1IE 1F7BA 5CJ5A 1GKPA 5LA2A 2BS9A 4P7RA 4AC1X 2Z6JA 3UR5A 1TA3A 4LOCA 2PDUA 2G3JA 3NQMA 5CC3A 1VZWA 3LPPA 1NWUA 3P93A 3GXNA 1AQ0A 1TPDA 2J47A 3LCLA 1EQPA 5JVLA 1O7AA 3EGJA 1JRCA 1KRAC 3KBNA 4JFSA 1H4PA 1WZLA 1CLVA 1QI2A 5CG0A 1JCMP 4TMCA 3KLKA 4BI7A 5HAOA 1N8WA 4F3HA 2CKSA 3E0LA 5G1TA 4QAIA 2ZXBA 1JR1A 1EA0A 4R7OA 2AGKA 1RBLA 4UZSA 4LVGA 1VC4A 3HFYA 2PGFA 2ON3A 5HWMA 2UBPC 1XKYA 1AH4A 1S2VA 4G2DA 4C7DA 1S46A 4Z2LA 2YB4A 4X3ZA 5GNXA 3AIQA 2DQWA 4N6EA 3W70A 3AHVA 4LQ1A 2EF9A 1RY0A 4D72A 1M65A 3GTFA 2Z6IA 1VIZA 2ZZ7A 4DPPA 4J3WA 3FAWA 1BVWA 1XGEA 4GFIA 1GJUA 4ZQNA 2WC4A 1EEPA 3N29A 4ES4A 4W93A 1V0KA 2IPFA 5HR6A 4K3ZA 2VRKA 1TWZA 2FIQA 3E0FA 2D2GA 4WVXA 5F4XA 4AZCA 2Z0IA 5I3DA 1PPIA 1KBIA 5CPMA 3N34A 1G69A 3LMYA 2NXGA 1DP0A 1Q7ZA 1TWSA 1OG0A 3MI6A 1KFJA 4DZHA 2BOEX 1EOMA 4OIFA 4XV0A 3F4CA 4D6EA 1GJWA 1EYEA 2VGIA 1W5PA 1V79A 1XIEA 3L23A 1GOXA 1JPIA 1QW8A 3GNRA 3M5XA 3HG5A 1SFTA 3G0XA 1WKEA 3HGOA 4GIEA 4DBUA 3BWWA 2C14A 1TJ2A 1ZSXA 7XIMA 4Q4OA 4AF0A 3GW0A 4UTTA 1OX4B 1E1FA 5M5DA 2OEMA 3QR3A 4G56A 2PRHA 1LOSA 1UBPC 2A7PA 4X60A 1H2JA 2OZTA 3LCFA 1KBLA 1E6SM 3L65A 3LSCA 5FI8A 3W7DA 1MW1A 2WLYA 3U2OA 1XWYA 4UFIA 1SMDA 1QWGA 1ZTVA 4BR1A 4CUCA 2DV0A 4IHCA 1J8VA 4A8NA 4PZVA 3UT0A 2NXIA 1SU5A 3UYCA 5DN1A 5D4YA 3TLLA 5K3VA 3FA4A 2NVDA 5CBIA 4FIRA 3W23A 2C0HA 3KVMA 1VRDA 2VOMA 4JTQA 3U5YA 4M19A 3RN6A 1HN1A 3F4NA 3OLIA 4NJGA 3KVKA 3SY8A 1ADDA 3W22A 1VJSA 2TMDA 5HQLA 4Q4PA 5AKQA 4XTIA 4H7ZA 4Y8EA 4ORMA 3BUVA 2CWXA 2DGAA 3KOWA 4JNMA 2P88A 4AZHA 4F0MA 2ZQ0A 2HS6A 5I02A 3GIQA 3GK0A 2BX7A 4H6QA 4KH2A 3G18A 4D6HA 1DIKA 2EJ1A 5B7YA 3CLWA 3DAQA 4GMEA 4G9PA 5LKYA 3PTKA 3AIVA 2X1UA 2H90A 1GVRA 3AFBA 1MXGA 3I7SA 2ZFAA 3HOJA 4CD8A 4PCSA 3KXQA 3ID7A 4C6CA 2V5DA 1XYZA 4C7FA 4PB4A 1F73A 2MUCA 2W63A 3KAOA 3W01A 4I6KA 3D47A 3E0VA 5CPNA 1LQAA 2I5IA 2CLFA 2J7DA 5FJJA 2DZUA 4UMCA 4AD0A 1MVYA 3UA4A 3TCEA 8A3HA 4CQAA 1L8NA 1JCJA 3M0ZA 4NNAA 4NU7A 4REQB 2O0TA 1EZ2A 1T5AA 3L7RA 4NXKA 1KFLA 4MDPA 4O53A 4YXGA 1EH9A 1MRAA 2OSXA 4P7OA 3SCOA 1YTEA 1CW2A 2F6XA 4B91A 3W1MA 1AQHA 1TSIA 4QCEA 4S3FA 1PHQA 1W3JA 4IMAA 3HN3A 4NNCA 5HPOA 1A4MA 3M43A 3QPZA 5CZKA 3UG3A 1I1WA 1QI4A 1RAKA 2Z1XA 3QF0A 3WDPP 3T4CA 4QG6A 3RDKA 3IIPA 3KL5A 3T9PA 3QYQA 3P6LA 1TPH1 5HNUA 3S1GA 3SDOA 3MV01 5BU9A 3NZRA 5EA9A 3SUUA 4CU6A 3DKJA 1NEYA 3NSXA 3AXXA 2ZKMX 1R3YA 3IRSA 3G3MA 3MYOA 4IIDA 4UR9A 3WJXA 1DIDA 3VKAA 4D6DA 2A1YA 3GWQA 1KQYA 1CECA 4GFSA 3ZO9A 3EOOA 3AO0A 3Q4DA 4DF0A 4A3QA 3STEA 1EZWA 5AC6A 1B5TA 1TTPA 3NPXA 1GKQA 2QCNA 1OHLA 4IIEA 1UUQA 3CB8A 4GA8A 4UQEA 4R7WA 4TX8A 4NAFB 1CX9A 3ZJ8A 3VIKA 1C7TA 4G8TA 4IFKB 4CQ8A 2OLSA 2VL4A 1V6VA 3WH8A 2QF7A 2SFPA 3QLLA 1JYXA 3S3GA 4ZB0A 5FF4A 2R91A 3MCOA 1UA3A 1JGIA 2QJJA 1MRQA 4IG2A 3S5OA 2HS8A 4IGMA 3TYUA 3PWAA 5LXXA 4KEVA 3C2RA 4V1YA 5I3GA 2ISSA 2OG9A 2GK1A 4L6DA 3VILA 4FMVA 2C18A 2A6LA 4KFPA 4WHBA 4PMYA 4M81A 3WH9A 3TQ0A 1KKRA 4I7WA 3TUUA 3C86A 3W83A 1JDFA 3BLKA 2P10A 5C7HA 5JQ9A 1M9HA 5AHMA 3TC3A 3ANUA 3RR1A 2FTWA 1JUBA 4PTVA 1KXHA 4EXBA 5BWFA 4B4HA 3VU2A 1C29A 5C7VA 4W7VA 2TPSA 2QJNA 5CJMA 3IS4A 4D6FA 1UD5A 4F2UA 4JIRA 5DY3A 3TAKA 3OBKA 4EXAA 5FJOA 4C7GA 1ONXA 4DPQA 4NZ5A 3KOXA 1EX5A 3CT7A 1CXHA 4XSLA 1I60A 1WAUA 2FLIA 1HKKA 1R46A 2BP1A 2CXGA 1W1ZA 2NV9A 2ONEA 4PL1A 4Z0JA 4XBKA 1N7KA 5AY7A 3OVQA 3LTSA 4Q8OA 4KKXA 1ZCOA 1RLDA 3W1RA 4MJMA 4JNZA 3ABOA 1M01A 4FIQA 5A3HA 2R6OA 4H2CA 3LTPA 3VX1A 2GSJA 4OTKA 1SUXA 3NL3A 4UFLA 3NZQA 1AODA 4J4KA 1W54A 1XHGA 2VXNA 4CEUC 3EX4A 3T09A 3CO8A 1OF6A 5AHNA 2HDJA 1DPMA 1HQTA 3I4EA 2CESA 3T6CA 3PP7A 1EEXA 3UY8A 1O5KA 2OTDA 1XXXA 2PAJA 2ZUVA 3S9YA 2JE8A 5FJPA 1YPIA 1UWAA 4AMCA 3DERA 5J8LA 4RZ4A 1K02A 1RCXB 2C15A 3GH5A 1K8XA 1MEWA 2CCRA 3DYMA 4PC8A 4PMUA 2Y24A 1G94A 2VQTA 5DELA 1K6AA 2JQXA 4B5SA 1PCKA 3LS9A 3KWXA 1XLJA 3E96A 1FUYA 1S5VA 4E5TA 5KZMA 1H60A 2F84A 3ECQA 1AQMA 4C1KA 1P0NA 2WM0A 4DZ5A 1DHPA 4LY8A 1SQ7A 3LCHA 3GDBA 4GNKB 1T96A 2VX4A 4AX6A 3AI0A 4UOJA 4O54A 4O13A 5LIKX 4QNEA 4H9XA 1A5LC 1E40A 1VGAA 1Q6DA 3UXKA 1FA2A 4QE4A 3I7QA 3QOMA 2OXNA 2TYSA 3N04A 4JBRA 1HJUA 5IDIA 4EK7A 3VABA 1QNRA 4JN6A 2GWGA 2PP3A 3KBVA 4C6JA 1LWHA 1Y7VA 2I57A 2QMKA 1TZZA 3ICJA 2QJHA 1VFSA 2QDHA 5DFAA 5XIAA 3CWHA 4I7UA 1XPGA 2VUYA 1QCWA 3N19B 2YW4A 3WJZA 1VLIA 1V02A 4AD2A 2Q02A 5KZEA 3TKFA 1PE1A 3BGGA 5F1VA 1JZ8A 4NI3A 3JR2A 5TBOA 3WDJA 5BOFA 5E93A 1KV5A 4KMQA 1RQBA 2XSAA 3ITOA 3UBPC 3QQWA 2OCZA 4ZSUA 3LHZA 1F9CA 1F8MA 4HNOA 3B04A 3M0YA 1OFDA 3GDTA 2YIHA 2IKGA 3EZ4A 1IR1A 2DSVA 2INZA 5L9FA 3SUWA 1J2BA 2PP0A 1H7WA 4EAYA 3V5OA 1B30A 4AZCB 2Z26A 4AZ5A 4UTMA 3WLTA 1CYGA 2OKTA 4E2DA 4IM4A 3W3OA 3OYZA 4RZBA 2ZX9A 3N15A 1BYBA 3GNPA 3LEPA 4ZE5A 3CAKA 4Q8UA 3B9OA 3E5BA 4BF7A 1F3EA 2RJGA 2UY3A 3IJQA 2QULA 3GZ3A 4GUIA 1DWFM 2R1LA 2FZDA 3QY8A 3GC4A 4HBKA 3LHVA 3FSTA 4GK8A 3UWUA 1DKWA 2WLZA 3DECA 1TO3A 4WJ8A 2QIWA 1W1TA 3N6HA 4MHBA 5J5RA 3LA4A 4QAWA 3IV3A 1LT8A 3STFA 5HQEA 3OPSA 1FX6A 1YPFA 2WOQA 1I75A 4BCEA 3PSWA 3HFTA 1FFQA 4HP5A 3L5MA 1SGJA 2FVKA 4GKLA 4CQDA 2GUUA 2JALA 2PE4A 3CV7A 2ISWA 3O0FA 5I00A 1K70A 4AUBA 2V69A 2BASA 1LDCA 1KBKA 3MBFA 5CPSA 4MJZA 3EWUA 1E6QM 3NZGA 4AU0A 1ECQA 1HO4A 3K4WA 4YHGA 3EWDA 4V33A 3S9IA 2D24A 1TQXA 5M1TA 1F05A 3VD4A 5FIPA 3DOPA 3LUTA 1TV7A 1GEQA 2ADAA 1KXTA 1QHPA 3TA9A 4CD6A 2PDMA 4TU1A 2VEIA 1KGWA 2QCDB 5A94A 2R9RA 1CB2A 3LI1A 1W9DM 3RLGA 4JGDA 4L80A 3NVDA 4I5RA 4QIUA 4JYFA 1PIGA 2FFIA 2CZFA 3ELFA 2F8QA 1EGMA 1EF2A 1EJRC 4HU0A 3BG9A 2UV8G 2YOCA 1YADA 1A0EA 4ZBCA 3H12A 1GWJA 5CQ1A 4H1ZA 2FJUB 1WYIA 2Z1WA 1HNYA 3G8EA 5EGRA 4PN2A 2ZZ3A 1J0YA 4WIWA 5CZ0A 4JXCA 1EGZA 3LNMA 2YYUA 2WK2A 2TODA 4XZMX 5ENLA 1J18A 5DMLA 2DVUA 4GI9A 4NJIA 4PMRA 3ABQA 3KUMA 4O1AA 1DJYA 2XH0A 3GBDA 3SM0A 2PRMA 3BAIA 3SSJA 1XIGA 2XDFA 1O66A 2ZC1A 1A5UA 1DXIA 3XIMA 3VDGA 1XG4A 1H7XA 3PZQA 3ITXA 4QG9A 5GNYA 3TQVA 1CNVA 4FX7A 3NM3A 2BSLA 7REQA 4OZOA 3HV9A 4XQ6A 3IUIA 4PUKA 3R8GA 3U0HA 3WO8A 4O52A 1IEIA 2GVEA 1KCXA 3FYYA 2V63A 2NT1A 2HVOA 2OSWA 1XM3A 1JDDA 2DJLA 3WH7A 3W7MA 3WN6A 5A6AA 4JFUA 3FKKA 1ZB5A 2QHAA 3V1HA 2D3NA 1X97A 1IV8A 3WLHA 3W74A 2FB2A 4JHMA 1CXEA 5DT7A 2EHHA 2ZZ1A 4ICMA 1JJKA 4MAVA 1QK2A 1YLVA 1Q4NX 1JCNA 4A8LA 2DZTA 1JZ7A 1SZNA 1OZQA 3NCOA 2PU1A 1DE5A 1IEWA 2DSUA 2O7SA 4UQDA 1EDQA 1MUCA 3LV6A 3TN4A 2Y8VA 3SUVA 1UR1A 3PZNA 2BY0A 1CGVA 2VFDA 2W79A 1YE4A 3N2OA 1R9ZA 2A85A 3V5FA 2WZEA 1P0BA 2XN2A 3TYZA 4OT7A 4RKAA 2O92A 4LW7A 4JPGA 1U2YA 1MDRA 4KCUA 1SSDA 3WLMA 4B3ZA 2CXEA 4Z2KA 4C65A 4A6GA 1DQXA 1RD6A 2I9UA 3VZXA 1IWAA 1XW8A 3ITLA 4OUIA 1HJVA 1XBYA 2UY5A 4QXIA 4S38A 1K9TA 1S3TC 4FS9A 3M0HA 3ARSA 3FJNA 3S42A 3VI2A 1KC7A 4JDBA 4WY0F 1R0MA 3AUJA 4Q22A 3M44A 3UZ5A 4S3EA 5BXSA 3TNOA 2L5HA 2XIJA 4I3GA 1LCOA 3CV6A 4D6IA 3LM7A 1OX5A 5FESA 3OODA 1TTQA 4NG3A 1G7VA 1LF1A 2NSOA 4ZSTA 3R79A 2W3ZA 1HF6A 3E12A 2DUAA 1H1NA 4XK2A 5AC5A 3N14A 2E1DA 4KWOA 5ECUA 2QJMA 2ODOA 2YDRA 4AZBA 4ML4A 2QCCA 2WAGA 2E9MA 3CZJA 3L67A 4V27A 4F2BA 3UR7A 1DXFA 2GVLA 3AHYA 4M24A 3N2CA 3GHTA 5D2WA 1OFRA 4K2SA 2YA0A 3EYPA 3V36A 3PS7A 2YKKA 3V0SA 3E2RA 1L6YA 4C6PA 4MDOA 1VFOA 2A3BA 3PAOA 2ACQA 4E3TA 3THCA 4AWSA 3G1HA 3ISIX 3PUOA 1ZRQA 4AAJA 3TROA 2YXOA 4BY3A 3H26A 2AKMA 1L2UA 1TREA 1TMLA 2WM1A 2DP3A 1LORA 4C6DA 4GQ0A 1TVLA 1P5BA 3GXPA 3WD1A 1VF8A 2ZWZA 3MUZ1 3NOEA 1F4AA 1ICQA 4JHOA 4UTIA 1UWSA 1RPKA 3CAQA 3LERA 3I7RA 1KGXA 2VENA 3GFZA 1Q6OA 1JAEA 3WZ0E 1UW9A 4A2SA 4YPJA 3PG9A 1IXOA 3SFWA 2CBJA 3CUFA 3EMZA 2ZXDA 1UZDA 2CITA 3APGA 1R9YA 2H8XA 3HA1A 3P60A 4JN8A 3OJGA 4DJFD 4WUIA 3S2NA 1W9VA 3RCMA 4JCLA 3TWAA 1XISA 3VK5A 5FF7A 1VLWA 1IR2A 2OWWA 4MB1A 4JQAA 5HR7A 1ZY9A 2AL2B 1TPFA 3CUJA 4MNMA 5EY5A 4Q4KA 4BS0A 4ZQPA 3M47A 1XLGA 4M1RA 4AIUA 4ZQOA 2IS7A 5REQA 2FVMA 5HNNA 2OZ0A 4A3UA 3QSRA 2GZXA 1W3LA 2WSRA 4XZBA 5FL0A 3CH9A 1XIBA 3M7WA 4BQ3A 1Z9AA 3FYOA 3WMSA 3HPSA 1KM2A 4NIRA 5CXPA 3RO6A 2WMFA 1M7XA 2ZUTA 4UXDA 3SCWA 4HPJA 4L7ZA 3VYLA 1GQLA 4WF7A 4LTSA 1DYSA 2EEXA 2D2HA 1EF3A 1R2TA 2V5CA 5FL1A 4FNTA 3WQ5A 4PGLA 3N3MA 2DT1A 3QV6A 4QDMA 1UWUA 3VGFA 4JTLA 1O94A 1G4EA 2ZTKA 4AVFA 3SY5A 4B2DD 1NH6A 3HQ1A 1N8IA 3W00A 1N55A 3PB0A 2YCKX 2Y1HA 5G4WA 3RU8X 1O5QA 3WYZA 3TJLA 1TB3A 4U3CA 3WLOA 3N4AA 1FH7A 4MVAA 1VPQA 4GLEA 3SRFA 1PL9A 2BHZA 1J9YA 4AB4A 4GY0A 5F2MA 3BLEA 3L0GA 1IZCA 5BU6A 3OA3A 4X9SA 1GOKA 2AQOA 4TV6A 1AJZA 2PDQA 1EJUC 4BA0A 3PPFA 4WEVX 3VD3A 4B16A 3CIVA 3W29A 1DWGM 3M5VA 4RE4A 3AJ7A 1GG1A 4GX9A 1KR1A 3H22A 2VEPA 3C6CA 4O0KA 1FXQA 1CLXA 2XIMA 3WL0A 5HMEA 2GPTA 3ABSA 2X0SA 1JF5A 4PBEA 2D23A 1P1XA 3S5YA 4M3PA 5DXYA 4DJEA 3IIVA 1VR6A 2HXUA 1ME7A 2PI6A 1J79A 3TXZA 4S3KA 4XD3A 1W8GA 2HROA 4H41A 3V7PA 3UP8A 3PFMA 3ARQA 4JR5A 3WQ4A 4LJ3A 3U7BA 3OBAA 1UPPA 3OVPA 1JCTA 4KEMA 3RG6A 3BOFA 2G3IA 4FI4A 3VFCA 4GXWA 2QVNA 1GVSA 1HT6A 4FX8A 3BW3A 4TIMA 1XP3A 1A0DA 3EWCA 4EAMA 4DAFA 4N0RA 1S2TA 1VEPA 1QU4A 4WGXA 1BLIA 1NDZA 2HZGA 2BHYA 5I23A 2PTZA 3BLDA 4HU8A 1P6WA 3KOYA 3M16A 3W27A 3F5LA 4O8RA 3F2DA 1U30A 3UCQA 3H2EA 3S5ZA 4GVGA 3G1RA 3O0KA 4NUWA 2VO5A 2ZA3A 4JIIX 3VM5A 4L1WA 1BYAA 3A3WA 1LUCA 4D1JA 4WDXA 1K03A 3TW6A 2FFCA 2E77A 5HWNA 3CAWA 1SJCA 3VAVA 3H23A 1WB0A 2RUSA 1CGXA 4FLQA 3KWSA 1TZ9A 4AY8A 5IOBA 4AIOA 3FFSA 4YWSA 3REQA 4IWWA 2GVGA 3VFLA 4IUOA 3H24A 4W86A 2YLLA 3N9RA 1TV3A 6TIMA 1OADA 5A2CA 3EX6A 1H7PA 1GEHA 2OLAA 4KCTA 3TSDA 4RW3A 4C91A 3LRLA 4NJJA 3CUZA 4TXEA 1WXZA 2WSYA 3P2VA 4C6MA 2OOGA 3FVMA 5BNKA 2PTYA 1S2CA 1K8ZA 2RDUA 3OGSA 4LUSA 1GW1A 4TVUA 4XUYA 4RPQA 1KNWA 2BY2A 1B90A 1UKQA 3TX9A 1LBMA 2OO0A 3CU2A 4U4MA 2XU2A 3EPMA 4LGXA 3BJTA 1FHLA 4LT9A 1K8CA 2VD8A 1QR7A 3TTEA 2GOUA 2QPUA 2DPEA 4CU7A 2A79A 4HPGA 3VGGA 2FZBA 3IVUA 4LUIA 4O4WA 4DO4A 3PWGA 5CPLA 3A3XA 3LOTA 1MYRA 2CBIA 3VO0A 1E6ZA 4L5ZA 2CLMA 1B3OA 2HTMA 4WQ6A 3LGGA 4DF1A 4UFKA 4OU1A 3B3DA 2XUCA 3QHNA 2BNJA 3ARWA 2QMJA 4MUZA 5U4NA 3U4AA 1SW7A 1NDYA 3NIYA 3IUHA 4FEZA 3N2MA 5D2XA 1KD0A 3PK7A 5K9DA 3A6OA 1IE7C 1Q63A 4NRRA 3TP4A 2DZPA 3GDMA 4MPKA 1J0JA 4Z17A 4GZ7A 3M46A 4G6CA 2V2DA 4EWJA 2XVPA 1F2JA 3U7VA 4LS0A 1V77A 2PSNA 5XINA 3GH4A 1JCLA 4JKLA 5F2IA 1LTDA 4C6KA 3RIKA 2H8ZA 2WVTA 2YCLA 1AW2A 3KHJA 4ZOAA 3S5NA 4KRUA 4XZHA 3UWWA 3GDKA 4F0HA 3T0CA 3TJIA 4K8GA 5AC4A 4CD4A 3T1GA 2A4AA 3B03A 2NX9A 3GFXA 3VINA 1J0KA 1NOFA 1ZUAX 5IDZA 1VYPX 5HANA 3UYIA 3PJWA 1GPWA 2BMBA 2ALDA 4Y8FA 2Z4GA 3WUBA 4I6VA 4DY1A 1WO2A 3BLPX 4O17A 4GQQA 4YTQA 1WOBA 3K8MA 1GVIA 3GNXA 4QR6A 5C55A 1K6WA 3C8NA 1L6WA 4BJHA 3LTYA 3RXZA 3NG3A 4AWEA 5KITA 4YHEA 3W87A 3RR4A 1VEOA 9XIAA 3B0UX 3WQPA 1V8EA 4MWAB 2ZCGA 1RP9A 3OTRA 4R33A 3GTNA 4ZGYA 4HT3A 4V15A 2QQ6A 3G3DA 4P2VA 4ZQMA 1E5JA 2PWDA 1C92A 3IIOA 2Y7EA 2J6XA 1V3JA 5GJMA 3PPGA 4XZ9A 1BF6A 1UR3M 1PKMA 1JCYA 4XX6A 1OCQA 3QGKC 4IICA 4LAKA 2I14A 1IXPA 5JH1A 2Y8KA 3UJFA 1HL8A 4AG0A 3QY6A 3HZ3A 2QLYA 3GR8A 3S2LA 4N9EA 2G50A 5G5IA 5JXQA 1OYCA 2WBGA 1LOQA 3PHAA 2O55A 1CT5A 4IG2B 3VKKA 1RD5A 1DHKA 3ZQ9A 3GRIA 3COTA 4ZO7A 3LLXA 1EYWA 1JNEA 4PCFA 3ZJKA 2WZTA 8XIMA 1XV8A 1JQXA 3KVJA 1VBRA 3OZPA 1MDLA 1A49A 4I90A 4PUUA 4YLWA 1ME8A 1QNPA 4HYVA 2P8CA 3AAMA 4B5WA 2OVLA 3TJ4A 1OFEA 5F1UA 1QTWA 2VHLA 1ISVA 1LL6A 1ZU8A 3UWYA 4PTDA 1GT8A 3VNYA 3GNNA 4XD6A 1XYBA 1C93A 1YBQB 4Q4RA 1H09A 4RE3A 5F2LA 3SCUA 1UQZA 2XVKA 3BGJA 4ZB5A 4DJEC 5ABFA 2PC8A 5FOOA 1LOLA 3W53A 3G77A 3G1AA 3TFCA 1A5BA 3C2OA 3IJ7A 1P4CA 1EXBA 3PUGA 3DH7A 1OM0A 3B8TA 3CHEA 3L66A 2IQDA 2WKLA 2CEQA 1Q7MA 3NEHA 3H21A 2FZMA 1KR0A 1ENUA 4B5XA 2PZ0A 4UQCA 3BSMA 5A1AA 1OD0A 3ALGA 3BCDA 3R0UA 1Q6FA 4OFCA 1SZFA 4O0QA 4PTMA 3RJYA 5CPOA 3AJXA 3FGCA 1XRFA 2PTWA 1DJIA 5CGTA 3WNOA 1HVQA 1K7EA 4MNJA 1ZJAA 3FNDA 1F6KA 4DI8A 3BAKA 1UWTA 5BROA 4L4OA 4W84A 2PDYA 4GZIA 4PB5A 1X98A 3MMUA 3E6EA 3WD3A 5T8GA 3TVAA 4KEZA 4GJIA 3IAQA 3GG0A 4RV3A 2V2HA 4MUPA 1FWWA 3UERA 2WJZA 1W37A 3W75A 2CLOA 5C9ZA 2P8BA 1ZCCA 1CDGA 3SIZA 2XH2A 2E8ZA 3BLFA 1BFNA 4IMFA 1R86A 3NFUA 4Z1AA 3WMCA 3CH0A 3RLUA 1O95A 2QAFA 3VMPA 3A47A 3O6CA 2ZUSA 3BO9A 4EE9A 2C71A 5LNUA 4A3YA 3H2CA 2JEPA 3QTPA 2PCQA 1E4NA 2VT0A 1G7UA 3ARTA 1EL3A 1BQGA 4MGGA 3VNIA 1KM1A 2V67A 1UJQA 4LAUA 3ALFA 1KFKA 4HNVA 4HNUA 4NT0A 3VE7A 4PRWA 2CHRA 4Z1YA 1EDTA 1UYQA 4DO7A 4FXRA 4RZ5A 1EJTC 3MWAA 4JQ2A 2WMIB 3CUXA 5D8ZA 2F38A 2ACUA 5CSSA 5AHEA 4R5EA 4BI6A 2IPWA 1SFJA 4IZGA 4RPPA 2YW3A 4ASTA 4DNMA 2W0UA 1LWIA 3PPCA 5A6BA 4LPCA 3F4WA 4Q8TA 3WQEA 3OQEA 1QMLA 1RV8A 1R3RA 1E3ZA 4LEFA 1D3GA 2YL6A 3ABRA 1XYLA 4OECA 3VNMA 4GXPA 4HOZA 5A2AA 4AISA 2X2YA 4LAMA 4JTIA 4H9YA 4GUFA 5C54A 4J3ZA 2INEA 4NZJA 2YGYA 4N42A 1FXPA 4R34A 4E2BA 4CGTA 3VCCA 1K3UA 2VZUA 4DYEA 1REQB 1SW0A 4US5A 4US5D 1KXQA 2CU0A 3JZEA 4DXVA 4S3JA 5HNRA 3HM7A 4UTFA 5HJYA 3SGGA 3QHMA 2UWFA 1GW9A 7A3HA 4LANA 4A8IA 2CZEA 3KS5A 1DQUA 5D9PA 3WJWA 5EU9A 2VQUA 3LD5A 4JY8A 2W5FA 5AN7A 2VOTA 4LS2A 3KTCA 3WSUA 1OFBA 1CXKA 3GDLA 1POKA 1KFCA 4KWVA 3WEOA 2V3GA 3IVSA 5I3KA 1OGSA 1H49A 3JRKA 5EBUA 2OELA 3WNKA 4F0KA 2Y6ZA 1S3HA 1SJBA 1Z6KA 1EXPA 1M41A 2ATSA 4CNTA 4FAMA 4AXKA 1OG6A 1B31A 1HKIA 1DWJM 1NQ6A 2BV9A 4CN4A 1WXYA 5KINA 1SSGA 5IFPA 2AMGA 3GU9A 3W7PA 5DMNA 1P6BA 5CCZA 1ELSA 3M9YA 3TN3A 2ANUA 1GONA 2BB0A 3VTRA 2G3NA 5H8MA 4LUJA 1RPXA 5DF0A 5F7UA 1XUUA 1GOWA 3ABXA 4BQ2A 1YNQA 3SCTA 1SPQA 1W5NA 3RLVA 1IXQA 3FJ6A 3DYOA 3H8AA 3BJFA 3A13A 4DX3A 1K4GA 2XH4A 4UMBA 3LCXA 3QW3A 1DE6A 4HZMA 4CNOA 4MKNA 2QJGA 3IARA 5EB8A 2BZNA 4O50A 3GR4A 3GHRA 3QSTA 4HCLA 1T6MA 1GGOA 3W9ZA 1B9BA 1J96A 1S5TA 1XQKA 4AEEA 1ZNNA 4HZ6A 1KA9F 3ES8A 2Q8XA 1GYMA 2DW7A 1R85A 3N2TA 3O6DA 4QNWA 3W6MA 4MY1A 1BXCA 3GTIA 2DY3A 2PLJA 3B9EA 3FA3A 3UGVA 4HVXA 2O9OA 2V0TA 1VPXA 1TPWA 4G1KA 4GXMA 3O15A 5BWAA 4GH3A 1HKWA 3B8IA 1DWAM 4QJ3B 1XRTA 5BMXA 4G7EB 4O19A 2R14A 1GG0A 3V4BA 3MYPA 3BQ5A 4JHZA 2WNQA 1XI3A 1BXBA 1UROA 3FJ4A 3S5SA 3C3UA 1MNSA 3FGCB 4O0ZA 4L65A 3AWNA 1E0XA 4BK9A 1XPYA 3B8VA 2EG7A 1X7FA 4KGJA 2PD9A 4YWIA 3UJ2A 2D0HA 1D3HA 1QHOA 3N11A 5C2CA 4M82A 4N2YA 4MTVA 4P8UA 1RQEA 1OWQA 1W9UA 4IIGA 1RY8A 4U28A 1QBAA 1DBTA 2NUWA 1A3WA 1ECEA 3AZRA 1L9WA 3FKRA 5A6MA 1T8XA 3ARYA 1AL8A 1D7KA 2FYMA 5KETA 2B81A 2PDKA 3KRSA 2FGLA 3IVTA 4FNSA 5DRIA 4ZOBA 3DBPA 3W25A 2X30A 3LHYA 3P8IA 5DO8A 1Z3NA 2X1TA 1WDPA 1VB9A 1YTDA 1GHSA 1VJZA 3RGTA 3N4EA 4HK7A 2W91A 2PUZA 4DWSD 2J66A 4JTTA 3BV4A 3H55A 2VX6A 1Q6CA 3TAOA 4B5VA 2NSXA 5HWJA 1JDCA 4GABA 3UU0A 3FV9A 4AZIA 2QGYA 1KM4A 3CUHA 2A7NA 4MJ4A 2CIPA 4Y2WA 4JYEA 3MO4A 2ZUWA 1GUVA 4Z1CA 1R9XA 1U1UA 3SCVA 3TMQA 4Z1DA 1REQA 2PDWA 1LP6A 1XS2A 2CZDA 4DJFC 5I6SA 1UP2A 4O14A 3NO1A 3KBWA 1H50A 1OBAA 4IGHA 4AZGA 4HIBA 2FGZA 3KHDA 4Y6GA 1XLFA 2DUZA 5MF5A 3C5QA 3DBNA 3NQBA 3QN3A 1XD1A 1KTBA 3MSRA 3RCNA 4HA0A 4IX0A 1US3A 3ITYA 4C6EA 5JIWA 5K2ZA 3NPVA 1W32A 2YBVA 3H4XA 5D9MA 3P67A 3PG8A 3VDCA 3WBYA 5CBBA 4WY0A 3OGRA 2DT3A 4A8RA 4UOZA 2HPMA 3WLSA 2V5JA 2BDQA 4IJBA 3P81A 4PUWA 3EDKA 3CUGA 4QG8A 3KVLA 3GNOA 2EO7A 5HQMA 5HATA 5H6HA 2GLKA 3UGRA 3CQ0A 3WK1A 4PTXA 4MLJA 1CXIA 4R3UA 4UQ9A 1DJNA 3T78A 2AAAA 4UB9A 3W2JA 2DORA 1JZ5A 1TX0A 1TIWA 4ORIA 1E70M 4RNIA 4J3XA 2BFGA 4WSJA 6XIAA 1AZ1A 5C9WA 3NGFA 5AVNA 3H53A 4KCWA 3AMCA 3WH6A 1TV2A 2Z2BA 1QO5A 2WHKA 5LZLA 1BRLB 1EJWC 1FWFC 1X8CA 1YYAA 4F4RA 5F4WA 5G2IA 1W2VA 3EEZA 4OVXA 1CLKA 5E5CA 3U48A 3T0AA 3EAUA 5GJPA 2D3LA 1H1YA 1E0WA 1SZGA 1BWVA 1QW9A 1S1RA 1LQ2A 4ZQCA 2VX7A 2ZADA 3T07A 4QE5A 1E9ZB 3A24A 3T2QA 1POJA 3TYCA 3CL6A 4D1IA 3BGAA 3TYBA 2ZBTA 2X41A 1PX3A 1YMYA 4KRZA 3GH7A 3C3NA 2AOSA 3A64A 4GACA 4GYPA 3AHXA 4X0NA 4MZ8A 4PBFA 2BXVA 4GJJA 2VKZG 4INFA 3FDKA 1Z8AA 4W8LA 1UD3A 4OBSA 4HPXA 5E0FA 3P0XA 1J5SA 1ZZMA 4NX0A 1ZJIA 3TC6A 3WDIA 1J2WA 1Y5VA 3TDFA 4PUMA 4A2RA 1GTHA 4W5UA 1RUSA 3F2CA 4K1GA 1G01A 2OMAA 4OUEA 3R12A 4V28A 1EHAA 2YCJA 1JNDA 3EX2A 3LGEA 3WLIA 1I45A 3B9DA 3VIOA 4NAEA 2ZE0A 5T9CE 3DC8A 5J04A 2E6FA 1UIPA 3MMDA 4E2VA 1JDAA 3SFKA 2WJDA 3G6MA 1E3XA 3RM8A 3GHUA 1VFTA 3AZTA 2I7GA 3ERPA 3QLDA 4LYKA 2VD9A 3SZ8A 5C0QA 2G97A 3UG8A 2ZDSA 4GGHA 3MUY1 3IPWA 2HNHA 2WMIA 1HP4A 1VS1A 1N2VA 3ZFHA 4RCXA 3EDEA 4K37A 2DH3A 2XHYA 3C2YA 3W24A 4BF9A 3KM8A 1KRBC 1OINA 2XM2A 3M41A 2VFIA 4R9OA 5LGXA 2GL5A 3H2NA 3AXKA 3SO7A 1CGUA 4Z2HA 5FEPA 3ZIZA 3KBSA 2CLEA 2REQB 2Z1SA 3FA5A 4WOQA 1TPUA 1MI3A 4FNRA 2WB5A 3QMTA 2VEFA 2P53A 1XD0A 2Y4SA 4ECLA 1OYAA 3NOYA 4AC7C 5H8PA 1V6YA 3S47A 4PUJA 4PCTA 4MOZA 4AH7A 3S8HA 4HZ7A 3GXDA 3WD2A 1C91A 1CB7B 4JN7A 4H6RA 3UJRA 2OT0A 4LH8A 2NXHA 2ZZ2A 2Y5JA 3B0PA 1C9DA 3UETA 5F2GA 2YFNA 2PDPA 3LNPA 3WLNA 5I09A 3PZMA 3MCMA 4H04A 4XKYA 5CLWA 1LROA 1SO3A 3FXGA 2XVLA 1B4EA 4Q7NA 3DHFA 3W88A 3TYDA 3NXLA 2ATMA 3A4WA 3G1DA 2RGLA 1X1ZA 4NZFA 1NWTA 3A4JA 3LQLA 1O5RA 1XLHA 4MIMA 6REQA 3BW2A 3GY1A 1PTAA 1K1DA 4ONVA 1XDMA 3SN0A 1FKXA 2AKZA 4IGNA 2Z2UA 4E8GA 4GYJA 3URNA 2FGBA 5DCEA 5CC6A 4WOZA 3WQVA 2GGGA 4UTWC 1UP3A 4PMQA 3T7VA 3ZM8A 1EOKA 1GQJA 3BDKA 3WNPA 4EF9A 4JNYA 1MUMA 1TQJA 4L4LA 3MY9A 2VMFA 3VIHA 3A5VA 1Q13A 3DFPA 4RK8A 5J5DA 4FNUA 3QZEA 4DI9A 4MPQA 3GS6A 1E6XM 1TVPA 4NF7A 1US2A 1JXKA 4GYFA 4J3SA 5M17A 4K68A 8XIAA 3CV1A 4IMCA 1NJJA 3W07A 4NZCA 1S5WA 4KEUA 4NI8A 2OYMA 1LYXA 3THUA 3MQTA 1BF2A 1VRXA 2D20A 1UIOA 4RXFA 4LRSA 3MTWA 2MANA 1C90A 2CHOA 4IP4A 2JGQA 5E6YA 4H3DA 1DIOA 5KTLA 1UZ4A 2HNEA 3GQYA 3HF3A 1TWDA 3PULA 4J9JA 1O1HA 1X39A 3RNDA 4CCZA 3SIMA 1T40A 2XSBA 3GW3A 1E43A 4PTNA 3PY2A 3DN5A 2PTXA 3II1A 5AB3A 3THQA 4EXQA 4C6OA 5H8UA 1C7SA 1RBAA 1UD6A 1BG4A 2I17A 2YA2A 4GI6A 1XLDA 1ZHAA 3FSUA 4DLMA 3OVGA 4IGSA 1EKOA 1OSEA 5BOEA 1HFBA 2E5CA 3QR0A 2REQA 5T26A 4C1NB 1IYXA 2XZ7A 3EOSA 1FTXA 7ODCA 3BXWA 1DWIM 1KFEA 1XINA 4N02A 2QV4A 1KWGA 2VNCA 1SYTA 2D0FA 3HMJG 4PEKA 1LQ0A 2CWNA 3LHUA 3AS3A 1E51A 1K77A 3CS2A 2E1WA 1H62A 4NJHA 4AW7A 3KX6A 3OVRA 1IF2A 3KCLA 3ZT7A 3BCFA 4NY2A 5LSMA 3N17A 4HK6A 4JEQA 4NZ3A 2NX1A 1BSLA 3K30A 4XKMA 2V3EA 1FRBA 1E9IA 1TWIA 1K7FA 1YX1A 3WFAA 1IQ8A 4X2PA 1Y0EA 4QS5A 1KGUA 4PMOA 1BKSA 2YXXA 3S9ZA 4GUJA 4HU4A 4LVFA 4JS3A 2VEGA 3CZ8A 2CZ5A 3WBAA 3A12A 2LLEA 4IQJA 1EBHA 1Z32X 4WR3A 2IPJA 2ABBA 4YVVA 1IT7A 4IP5A 5LIXX 3MZNA 2ZICA 1WDDA 4WDUA 5DBUA 1JIBA 2PD5A 4XO7A 4AXNA 5G2WA 2CNCA 1H63A 3CQIA 3CUIA 3A4XA 2G37A 1HP5A 1X38A 4XUGA 3FS2A 3HIJA 1TUXA 2DSZA 4DBDA 2GDVA 4EF8A 3F1QA 4UOQA 3WF2A 1IIHA 5G1MA 2B4GA 3TW9A 1V6TA 3WELA 3E0WA 3PAJA 3VE9A 1UWQA 4DWDA 3VIMA 3Q45A 1XIMA 1XRSA 5EYWA 4S3DA 4QLKA 3WD4A 4S39A 1BAGA 4IF2A 5CPTA 3PZVA 2Z27A 2PLMA 4LCSA 1I0BA 1XL9A 3ZWTA 4FXSA 2QEZA 1UR8A 3HURA 4REQA 3G1VA 1KBJA 5BCAA 2OB3A 4L56A 3DGRA 1NDWA 1VAHA 4KFOA 4GG9A 1OFQA 2E5BA 3Q94A 4HQVA 3L4ZA 3AXIA 4ZO6A 4XWUA 1HG3A 2VFEA 4Z08A 1EJXC 4H9ZA 4HN8A 1M7OA 3KTSA 2ICSA 2INFA 3AUOA 1FWJC 2CZVA 1TE6A 3RMEA 1V6WA 2BXYA 4MNLA 1A5SA 4CCCA 3CYJA 2EKGA 2FQIA 1DQWA 1VHCA 1B3WA 4IXXA 2WHMA 2ZX7A 2YFOA 2RKXA 1TJRA 5A8GA 1M04A 3GG7A 1AG1O 3IK4A 3RCYA 5EMJA 1AFSA 3HMCA 3QY7A 1WP6A 4QROA 4GBUA 3TOYA 4AHQA 1PZ3A 4MWAA 2IKIA 5ECVA 1TG7A 3BSGA 3G5EA 3ZXWA 1WBHA 2I16A 1KWKA 3W26A 1E9LA 3LK6A 2B7OA 2YL9A 3DFYA 3CHDA 3CQJA 3RPDA 4DQWA 1TVNA 2CLHA 3G1SA 4F40A 5GPRA 4MNKA 1TA3B 2ZYFA 1YDVA 5CZJA 5K9CA 3WQ6A 1GPFA 1UUMA 2VVNA 9XIMA 1OIMA 2Y7FA 1MXSA 3ZJ7A 2VTFA 1GZJA 3L0KA 4QISA 3GUWA 4DZIA 3MI2A 2J88A 1K9EA 3L2LA 5AZ1A 4X9YA 1GVYA 4JFWA 2TAAA 4LAZA 1PYFA 1FP8A 1ONRA 4FHAA 2RH9A 2HV5A 3T42A 1VBJA 1I2OA 3DHUA 4J2MA 4B5NA 4IPNB 4AYSA 1Q6QA 3V1PA 4GC3A 3BLLA 2QCDA 3TOPA 3OZMA 2HE8A 3BL3A 4HPNA 2PFHA 3TLQA 3PTQA 1KM3A 1BRLA 3UPWA 2DH2A 4GYPC 1Q5MA 1QHZA 5LA0A 3DG6A 1SR0A 3FEQA 2XWEA 3T8QA 1LLOA 1GOOA 4DEFA 1LL7A 4KETA 4M7SA 3DFNA 3GVRA 1EO7A 1U5HA 3W6LA 1TRIA 4DWSA 1ZFJA 3BMVA 1S38A 2HK1A 3RHGA 3VIIA 3FX4A 3S46A 1V08A 1PIIA 1GVQA 1TR1A 3TMLA 3TN5A 4ACZA 4JTRA 4JTJA 1MZRA 3EBVA 1F07A 3ABZA 4GIYA 3AMKA 3R25A 3K46A 1W1YA 2CBUA 3SSZA 2PA6A 2WZMA 4ROQA 2QCLA 2QNEA 1C8YA 3W85A 5A5WA 4GGBA 4I5UA 1KBBA 1OEPA 3QW4B 4XAYA 4FALA 2HISA 2G95A 3VMOA 2PDFA 2ZIDA 2BOFX 2HEJA 2AGTA 1LZOA 3ARZA 4HHLA 3MHUA 2Z1BA 3QR1A 4ATDA 5CGMA 2ABAA 2V30A 4GX8A 1OABA 3MP3A 1W3IA 4IFKA 1RJPA 4I9TA 4GKTA 4OJYA 1GOMA 4L64A 3GC2A 3HV8A 2X09A 4JTCA 3TNBA 1SVDA 2R1NA 5DMMA 3VNLA 2YB1A 3V3WA 4TMBA 2P76A 1OFOA 2F6UA 1EUNA 3MJMA 3VOHA 1JI1A 3NYDA 3IRDA 3N2XA 2A3LA 3G1YA 4D6JA 2IMRA 1FH9A 4XTDA 2YDAA 4AD5A 2WYSA 4XIMA 4CKQA 2E5DA 4IPLA 4TTGA 8RUCA 1E4LA 3LI0A 1HL9A 1BYDA 4E2OA 2OQLA 2QAPA 4WK9A 2JKEA 1ZQ5A 4JTGA 1A5KC 3SRHA 5JBEA 1X6UA 1X7IA 3M0XA 5EKYA 4Y9AA 2WZHA 3W7RA 1YDOA 1ISXA 1QNVA 3BVJA 5JUVA 1P0EA 3DX5A 4FLRA 1ZBKA 2RHGA 3ENLA 2Z7GA 2VDGA 4HCHA 1OK4A 2E0PA 4UTJA 3H54A 2DU2A 1QNQA 4YTTA 4HJFA 1O1ZA 4MZ1A 5E70A 1ADSA 1FWEC 3BAXA 3REQB 1R3VA 1DWHM 1TPVA 1JULA 4NASA 1SO4A 2E6YA 3ONBA 3CZKA 4QQUA 1WZAA 4NL1A 5GNZA 3M0VA 1V6UA 4HGXA 1FH8A 2ZVIA 1XIJA 1CI1A 2J6VA 3EWBX 3GG1A 2MNRA 3EWZA 2VC5A 1I8JA 4ACZB 3OG3A 4GWEA 3C0JA 3C2EA 4FXJA 1D7FA 3MDWA 1EO5A 1QNSA 4JL1A 3ZVHB 3O6AA 3BANA 4DUXA 4UNIA 2H6RA 2PBOA 3U2EA 3OHMB 5CSUA 2JGYA 2YCIX 1QUMA 2BBFA 3CMFA 1SM9A 3LG3A 1JZ2A 2C16A 4UFHA 3PVFA 3UFYA 4GBDA 3SUTA 1ZENA 2B31A 4ADUA 3WDRA 1TV4A 4Z2GA 4X22A 4NP7A 3MA8A 1PTDA 2PB1A 3R4IA 2PS2A 1WA3A 3OZOA 4E6MA 3V35A 3V0TA 4UNLA 2DFAA 3C0QA 1UH3A 4O28A 1SJAA 5LIWX 2ISFA 1OT1A 4U31A 4L4MA 1GYNA 1LG2A 1OIFA 4O1CA 1RVKA 4MYXA 2ZZ4A 2PGRA 3MUIA 1J0ZA 6A3HA 5A8PA 3VIJA 2F2KA 3NQ7A 3GAKA 1O60A 1UOKA 2W61A 2OGJA 4DUOA 2WSPA 4DRSA 3TV8A 4XZWA 4ZTXA 1PZ1A 1I2QA 3VVGA 4ZXLA 3VA8A 1MFVA 1FDZA 6ALDA 5K7JA 1M7JA 2R82A 3NA8A 3QQ0A 1MW0A 4JTEA 1OCBA 1E0VA 3KZSA 2WZIA 1OFAA 4GIAA 4DN1A 2X1SA 4TX9A 2CC0A 3NL2A 4JFTA 3W7GA 2O7QA 2QGHA 4I9AA 1PKYA 3LCWA 1RZMA 7ENLA 4O1FA 5IBXC 4WD0A 2NX3A 4QLLA 2BGNE 2I56A 5FSDC 1WDSA 4U2ZA 1AMYA 1GTEA 4P8WA 3L0NA 3VIPA 1D9EA 1CWYA 1M7PA 4QITA 5KMYA 3U6WA 1MQRA 1UWIA 5L6UA 2HPIA 5D32A 3BARA 4IFOA 2Z1VA 3MKVA 2XFWA 4AWTA 1JCXA 2XG9A 4LAOA 5ABEA 3EWXA 4HNTA 5IHSA 2XFRA 1WUEA 2TSYA 3B40A 3MMWA 2VYOA 1HIZA 2Z29A 2PP1A 1IEVA 3DUGA 1H7NA 1OCNA 2XM1A 1VFHA 1Y8BA 2GQAA 3CJPA 4WDWA 2O4QA 3QTGA 4ZMGA 1FCQA 1GNXA 3PM6A 5JBFA 2V2CA 3UWVA 2Y62A 3WUGA 3WLLA 4WSHA 5DANA 4LB4A 4F0LA 4H7VA 4IX2A 4UCFA 3SI9A 3WNMA 2E67A 2GSHA 1YKWA 2V82A 4HJWA 1BPLB 5A2BA 2HK0A 4XZLX 4NZ4A 4O1BA 4GI4A 4KF1A 4HTYA 1PS9A 4CQCA 3TEVA 3B8DA 2ACSA 1TX2A 3M64A 3QXBA 3CZEA 1W3KA 4AIBA 2PDXA 4YU1A 1W3NA 3C0LA 3NQDA 5I0DA 4FX6M 4RDWA 5HPCA 3W28A 7REQB 4FSAA 5LIUX 3HTWA 3W2NA 2E28A 1VP5A 3WLPA 3RX4A 1FWTA 5FF2A 4Y96A 1Q6GA 2QPXA 7CGTA 2OSYA 3PZGA 2HMCA 1TUFA 2P5NA 3DI1A 1C8XA 5D9NA 1D8CA 1ONEA 3GE7A 4PL2A 1PKLA 2CW6A 2ACRA 3M0JA 4RDVA 3P61A 3VCNA 1ODZA 3LRMA 2XPKA 4H83A 3SJNA 1JPMA 2DVXA 3ZVHA 4IXHA 3ZR6A 2Z00A 3H6OA 5H91A 3EKZA 1IEQA 3UR8A 1EBGA 2C13A 3CK5A 3V18A 4M6PA 3GZAA 1GORA 1XH0A 3C61A 4XVDA 4IUGA 2CETA 2G3FA 3NO5A 4XKYB 2P0IA 1LBLA 2XGZA 3HJZA 4S23A 5I77A 3NJ3A 5AECA 3CNYA 4MKVA 4HYWA 5D02A 4B4FA 2PWFA 4HN4A 3VDHA 4JQ1A 4AWUA 3BTNA 4WKHA 1UC5A 1EWDA 3CL7A 3UEQA 3KFTA 4OE7A 4HB7A 4DJDD 2HBVA 2GUYA 2J78A 4ZO8A 4LU0A 4D6CA 1TR9A 2KX9A 2WANA 2KZHA 2X8RA 1QI5A 2A7RA 3EB2A 3WQDA 1NFPA 1YRRA 4J1OA 4V1XA 2YA1A 5EMUA 4K39A 3KL3A 4C6BA 1QBBA 1HTIA 2VFGA 4PMJA 4CNPA 1XC6A 3W7NA 4S1FA 2BY3A 4LV9A 1JYNA 3AHZA 2PU0A 3SCPA 3FW6A 4CVUA 1H5YA 4LC8A 3LCGA 3TA6A 4FNPA 4ILSA 1KM5A 4MY8A 1ZAJA 3PTDA 2YBTA 3LBMA 1OCJA 4LNCA 4W8BA 1ICPA 3P84A 1PIFA 1G1YA 4GH1A 1B3YA 3TR9A 3GXFA 3AQUA 3S1UA 1FWGC 3CWOX 1GZ1A 4DJED 2NWRA 1M6JA 2O9PA 3E2SA 3QPYA 1BGGA 2J75A 2WCSA 2JIEA 2X1IA 3LXAA 2WVVA 5AVHA 1CCWB 2W92A 2QXWA 1TCDA 3E02A 4HNCA 3IGSA 3NNTA 4H7CA 3FY1A 1H0IA 3FCPA 3SADA 3W86A 1KCKA 3TTSA 2GWNA 3KS6A 4R85A 3G1FA 1ZAHA 2OWCA 5FEZA 1HZYA 3QM3A 2R1PA 1PKNA 4DUVA 2QUTA 4LBRA 1JUEA 3PUEA 4DIAA 3O1NA 4HU3A 3CYVA 1UKOA 4PFHA 4V2XA 3CV2A 5C71A 1I2NA 5I2UA 3AYSA 3N13A 3EOLA 4UQBA 1XX1A 1JI2A 2XIBA 5DCBA 3WNNA 3TSBA 1WNOA 3IIZA 2EKCA 3A9IA 2EPKX 4O1DA 3T0TA 1P0KA 4YYCA 3RPMA 1ISZA 4PMVA 1GVOA 4YCPA 2VZSA 4NVTA 4UR7A 4AMAA 1OK6A 2PWVA 2GQ9A 1FWHC 4TV5A 1F3TA 1PYMA 4BFAA 1S5NA 4N9DA 4I7VA 2YSWA 3GM8A 3QKZA 2D2OA 2F7FA 4B5UA 3U9IA 2BGSA 1TELA 4CCDA 4IL2A 3S0CA 1RJQA 3L4UA 3AOFA 3UVIA 1AVAA 1J10A 2X40A 4JQ3A 5B80A 2QYGA 3R94A 1B57A 4RNHA 4PUNA 4P8XA 2NV2A 1E1CA 3KRUA 5IM51 1LG1A 3WEMA 1TWWA 1P7TA 2ISVA 4EPEC 4IMDA 4MWAE 3QBUA 3UJSA 2OLHA 1RCOB 1FWNA 1VEMA 1DJHA 4Z42C 3VC5A 3CBWA 3AXHA 1XLEA 2R8WA 1E6NA 3NQGA 1LRQA 4M0XA 3U2ZA 3NSNA 4PTWA 1XIIA 1CBGA 2QIIA 5DLCA 2NQJA 2QCHA 2WPGA 1PWLA 4ZEPA 3CGTA 4WJEA 3G6LA 3SN1A 1MXDA 3HPXA 3ZS4A 1ITUA 4XZNX 4UTUA 3AIRA 3DGBA 1Q6RA 3AYVA 3OP2A 2OEJA 4ZFMA 2CKRA 5A6BD 4HA4A 3UXAA 2ZDRA 3UQNA 3P3BA 5E9XA 3IAPA 3YPIA 3I6TA 3KDNA 3WMBA 4NHVA 3PN8A 2F9RA 3HJEA 3WLJA 4H6KA 5ABTA 2OX4A 3VNKA 3WF3A 3VOCA 3WENA 3MC5A 1O4UA 2PMQA 3MANA 3NR0A 2Y7DA 4MFDA 1Q7QA 3MJYA 4YVPA 1EIXA 1MWOA 2VJXA 4IQLA 3EA1A 4XBSA 1J6PA 3P8JA 5AZ0A 5IXEA 1U5JA 4DF2A 2YZRA 2E7FA 4XD4A 4W7UA 2Q09A 2CYGA 4D71A 5CJNA 1JVNA 3S2MA 2VGGA 3DFHA 1WUFA 2J77A 3MVIA 1GOQA 4H8HA 1X96A 6XIMA 5G2HA 3G8RA 1BEUA 2GQ3A 3RPTA 3RX3A 4CN6A 2FDSA 3VDAA 4O57A 1PO9A 3XINA 2ZC8A 2I5QA 1R3TA 5FACA 1F3XA 3KEHA 4YS1A 1W31A 1R38A 2QDEA 2WXDM 2NWSA 3V0UA 4RR4A 3C56A 1E5NA 1YIXA 3S1WA 4JTSA 1R2SA 4HHHA 1KRMA 2ZWYA 4LCQA 3QKEA 3DEQA 3GVQA 1T8QA 3SRDA 1YNPA 1WDQA 3KZPA 4Y7EA 3EPOA 1FBAA 1OFPA 2GSEA 4RNFA 3L21A 2IXUA 1SFLA 4FP1A 3IEBA 1W91A 3WCZA 4AY1A 2PWEA 4H8NA 2QCGA 3HQOA 3TZFA 3UNTA 4RLIA 4Q4SA 1J5TA 1WKDA 1KV8A 3CT2A 1K7XA 2GQ8A 3POHA 4DO6A 2QUMA 5FSEC 4L9ZA 4X61A 2G5WA 1E1CB 2OX1A 2WBKA 4NAFA 3MKKA 2VDHA 2XIIA 4B5TA 3W1XA 5A8OA 3R6IA 3HGSA 4H00A 4IMGA 1ZLPA 3JU2A 3VKDA 3UG4A 4HOWA 3HGRA 4ENLA 1AK5A 2Y88A 3QOKA 2NUYA 2POTA 4EPDC 3C2FA 3U3HA 1P0DA 1XYCA 2ZRUA 3PBUA 1QOQA 2PZNA 1JD9A 1OYBA 2UY4A 3LPOA 1IIGA 1B4KA 4J3TA 2VURA 3CEUA 3OQ8A 2PLCA 4OV9A 3MI3A 3NM1A 1E4MM 2C1HA 1Q65A 3GHSA 2BWGA 1QI3A 5T9BG 3WFZA 2QCFA 5CH9A 4QS6A 1SFSA 3BG5A 3QGVA 1V03A 2FZ8A 2HWGA 4ACYA 4AVOA 1V51A 5A8NA 3UZYA 3LRKA 4PYSA 3AIBA 3SQSA 4ZR8A 3CLMA 3PB2A 1PTGA 5G1YA 1OY0A 2FZNA 3P74A 1TJ1A 4A3RA 2XN1A 5JU6A 5C6MA 4W88A 4XAGA 3JVAA 4Q7IA 4UTWA 2H9AA 1HGWA 5AHLA 3WK2A 4R88A 5E0CA 2EPNA 2FDMA 4JTDA 4YYFA 2R94A 4ZENA 2VR5A 3N6JA 1WV2A 2X2GA 2DZAA 2A3HA 5TIMA 5HDRA 4A35A 3QV9A 1F5ZA 1A0CA 3TTOA 3VCRA 5C70A 4ML9A 5A8QA 2HVNA 2WCGA 4Z2JA 2YL5A 4Q8WA 4YTUA 5GQBA 1XYFA 4P8VA 1XF0A 4GZJA 5TAOA 3AIWA 3VGEA 4U10A 2F61A 2WNZA 2ZX5A 4MY9A 4F8XA 5FKYA 3WF0A 4GJ1A 2FPYA 3B9AA 1VKFA 3WK0A 1QOXA 3R0DA 4OOUA 1KO0A 4QJ1A 4RE2A 4A05A 1CZ1A 3QZAA 4A4AA 3N73A 3ATYA 3H7VA 3F5JA 2OZ3A 8TIMA 3TJXA 4ERAA 4GNJA 1H3GA 3RJXA 1F8IA 3NQ2A 1J11A 5DCDA 1FP9A 3THAA 3VKJA 3LB0A 3UPMA 1WBJA 3G2GA 4O8AA 1BQCA 4DELA 2IKHA 4WDTA 3UD6A 3IIXA 5FA5A 4LX4A 4WKAA 1MO0A 3EEGA 3RFAA 2I9EA 3WJSA 1FCUA 2AMXA 1A3XA 1O6IA 3INPA 1UHVA 5CGQA 5GVJA 1P7TB 1ML1A 1VBGA 4BWLA 3ANVA 3I6EA 1W9BM 2E25A 3BPWA 1G4PA 4XAPA 7PTDA 3L4XA 3USZA 1KQZA 3W7KA 1Q45A 3C52A 3B8WA 1FWIC 2AL2A 1XLKA 4R27A 3KRZA 3NUKA 1V0MA 2OO6A 3HG3A 3JW7A 1PB0A 3BC9A 1XH2A 3NDZA 4GCAA 4DB7A 4C1NA 4NYUA 4AD1A 1ZBVA 3MHFA 1VYRA 2GJPA 3DKLA 4JL2A 1V93A 3EKGA 1NSJA 3DHPA 3M6YA 4DBSA 2DZSA 1NOUA 3EWYA 3S2JA 4K7YA 5MKGB 3D46A 1SO6A 2XSXA 4GPNA 2J9YA 4J7RA 4EANA 1DJZA 3DG7A 4U2YA 3KLLA 5BMWA 3LBOA 1OGBA 1SO5A 2BY1A 2R1MA 1XDJA 1Z69A 3IGXA 3B05A 4F2TA 3MVTA 2A0NA 4IJRA 4NJKA 4DLFA 4YIWA 5EFDA 4JY9A 3NQFA 5EMKA 1UC4A 4Y9NA 2A5HA 5HXMA 1WXJA 4EKJA 4J5NA 4OV4A 3TQKA 4N4QA 2FVLA 2OR2A 1T0OA 4IL0A 3W7QA 4H9VA 2IUZA 1YPXA 1TTJA 3NQ6A 3AMGA 3BV7A 4LVAA 4W7WA 3BG3A 2XJ7A 4LY4A 3K2GA 5F4SA 2PF0A 2GGIA 2PGEA 1YBQA 4Q8MA 2E9LA 3OZYA 1XFBA 3T0BA 1XBVA 4C6QA 4M1BA 4W85A 1ZP4A 4BQ5A 3QHOA 1N82A 3ARPA 2NVAA 1CXFA 5CLTA 5CAKA 1DVJA 3UXDA 4K6AA 4GIRA 4K8EA 3WQCA 2ZA1A 1ZGDA 3HU7A 2X7VA 2EPHA 3W02A 1WDWA 2QR6A 3FXYA 4TVCA 2DZVA 2PWGA 1L0PA 4Z0SA 5JH2A 4GQBA 3NO3A 1EIBA 2Y70A 3D0CA 4C6LA 3AXMA 2DVTA 2BGQA 1UB3A 3GKFA 1A5NC 2OGYA 1M68A 3BAJA 1UA7A 4AD4A 3BQ6A 2XVNA 1QNOA 4LUYA 4IOTA 4H4IA 1IT0A 4PMNA 1PX8A 3UXIA 1IHIA 3L4TA 4L6HA 3M07A 3QC3A 1Q2RA 4XISA 3GO2A 1A47A 1H0GA 4FB7A 3NZ1A 3GNDA