3H2CA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
257
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNGSYNEVDAAVRHAKEMRDEGAHIIDIGESTRSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 257
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2cA00
4NL1A 2OGYA 4PZVA 4DJDA 2VP8A 3H24A 4MWAD 4O0QA 4C1NA 4S39A 3NOYA 3TYBA 1AJ0A 4DAFA 3MCNA 3H2NA 4MWAB 4S38A 2VEFA 3H23A 3H26A 1TWWA 3H21A 4MWAE 3TYUA 3TR9A 4DJED 4S3FA 3TYZA 5JQ9A 4S3BA 3H22A 4DJFD 4S3AA 4MWAA 4O1FA 4DJFC 3H2AA 3V5OA 1Q7MA 4NIRA 1Q8AA 2E7FA 2YCIX 4G9PA 4DAIA 2Y0FA 4MWAC 2YCLB 1F6YA 2Y5SA 3TYAA 3K13A 4DJFA 1TX0A 1Q7QA 4D8AA 2DZAA 2YCLA 2Y5JA 3H2EA 4DJEC 1TWZA 4NHVA 4D8ZA 3H2FA 4S3EA 3BOFA 2DQWA 4NILA 1EYEA 2DZBA 1TX2A 3TYCA 3TZNA 4O1EA 2H9AB 4DJEA 1AJ2A 2YCKX 2VEGA 1AD1A 4S3DA 3H2CA 4DB7A 2H9AA 3BOLA 4DJDD 3TYEA 4HB7A 1TWSA 4S3CA 4D9PA 1AD4A 2YCJA 4DJDC 3MCMA 2BMBA 3MCOA 3TYDA 3H2MA 1Q8JA 3TZFA 4C1NB 4S23A 1Q7ZA 4CCZA 1Q85A 1AJZA 3H2OA
chains in the Genus database with same CATH superfamily
2OGYA 1BF6A 4ZXLA 3LV6A 1NAL1 3RLVA 3UCCA 1DJXA 3VIMA 4JYFA 1M41A 2FVMA 3CZ8A 1DWJM 1GVYA 3IV3A 3S0CA 2GJXA 1XD1A 3NDYA 3W83A 3V0TA 2A0NA 3H2AA 4BY3A 2ZX6A 3DGBA 3G1SA 4FX7A 5CXPA 3BJFA 2V6AA 2NXHA 2CESA 4Q8MA 2RAGA 1A47A 1R7OA 3PB0A 3AU6A 3TQKA 3UPMA 1VFTA 4G56A 4HK7A 1IXNA 2CLKA 1A5AA 2GUYA 5AHFA 4L4MA 1YYAA 1OYAA 5CC3A 1PCWA 1ZGDA 4HN8A 3HURA 3V4BA 1J0KA 3WQCA 3STCA 1MI3A 5K2ZA 1TX2A 2DORA 1V7AA 4L4PA 1X1ZA 4C90A 1V6YA 2ZVIA 4AWUA 2CYGA 2YBTA 5M3WA 3LNMA 9XIAA 4DB7A 2QQ6A 5BCAA 1FWAC 3UQNA 4L6HA 5DANA 1M9HA 1Q65A 4E4FA 1OJXA 1YDVA 4RDZA 1TPVA 1UKPA 4XO6A 4I7VA 2OCZA 1ME7A 2YFNA 3NQBA 2OQLA 1WNOA 1EWEA 1V03A 3SI9A 5AVHA 5CC7A 5IHRA 3QHOA 4JFWA 5AYYA 4B9ZA 3MMTA 4OWGA 2O55A 1B9BA 2HVNA 3NM3A 2J6VA 3NQDA 4YWSA 3S2JA 1L8NA 3VIKA 1V3JA 1F5ZA 1WZMA 1IF2A 4FMVA 1NOUA 1OFQA 3FA5A 1TTIA 1K9DA 5C9UA 5D9MA 4J35A 3CTTA 4HU0A 3BARA 3EEZA 3Q37A 3ONCA 3A4WA 2YZ5A 3CV7A 4Q6XA 1W91A 3N14A 2UZ9A 1JG9A 3DFOA 5HWJA 4KFPA 3GWQA 1ME9A 4GI8A 4FXRA 3N3TA 4J9JA 3I7RA 4LS0A 2F38A 4GQ0A 3LTSA 3W25A 5CAKA 4TX6A 1XDLA 2X1IA 5LHFA 2QJGA 3NR0A 1KCLA 2ICSA 1JULA 4XZNX 4PTMA 1RCOB 4AY1A 1M04A 3L0GA 4XZWA 1PZ2A 2H8XA 4M7SA 4E4PA 2NVAA 4LUSB 1N7KA 1JRBA 3RG6A 2TODA 3ZQ9A 4F48A 4UTJA 1JZ6A 2PP0A 3Q94A 3DG6A 2V5DA 2VVNA 3O6AA 2XTKA 3P84A 2Y8VA 4LF2A 2V3DA 4D6GA 3SGGA 1ZUAX 4LV9A 2POZA 3TXZA 3KBVA 3N2OA 2DH3A 3I6EA 3KRBA 1GONA 1OGGA 3STPA 1E6RA 3F5LA 4W87A 2CWNA 3W1TA 2C79A 1I8JA 4JIIX 4E3TA 4JX5A 2E9LA 3VKJA 2DW7A 5J5RA 3U2EA 1UWIA 1JQXA 3W1NA 2DSKA 3KXQA 4ICCX 3OPSA 3VDHA 3KP0A 1RJPA 3LBMA 3MUAA 4NAFA 2NX9A 3UA3A 5G4HC 4A8RA 3PFRA 1K9TA 4L9XA 1DJZA 1M3UA 4AIOA 4OKDA 3NXFA 1ZJBA 4JNMA 1HJWA 2BDQA 4JKKA 1O5RA 2JIEA 4LANA 1G4SA 3ZXWA 1IR1A 1QPKA 4OTKA 1J0YA 2OEJA 4BI6A 2A6NA 1VH7A 2ZYFA 2ZE0A 4UQEA 2DZUA 5AC6A 1EWDA 4UMAA 3GG7A 4Y9PA 2Y63A 5DF0A 1K9EA 2GWNA 1FCUA 3L4YA 1BAGA 3QLDA 4YCOA 3M43A 2Q3RA 1NWUA 4EXBA 2ZRZA 4CCZA 1K3UA 2QJIA 3T40A 5TAOA 1J2WA 3DFYA 5BOFA 5I06A 1V0KA 3RN6A 5F2IA 4LEQA 2WNNA 2XN1A 2XFFA 4NAEB 3S3GA 3VZXA 5D05A 3ZJ8A 4UTWA 1MUCA 5EPDA 3AIBA 1Z7AA 2I5QA 2VFFA 4DUWA 4UNLA 3QJAA 4QBXA 1PKNA 1KFEA 3WNPA 3T4CA 5GVJA 1SO5A 3GH5A 3T05A 2ZX5A 3DENA 4XKYA 4IM4A 3DFHA 4GUIA 2WANA 1ZP4A 4HK6A 2QPSA 5CSYA 2BY1A 2E6AA 3GAYA 4KFNA 3C2OA 3K1DA 5CPMA 4W84A 2VOTA 3HGJA 3EPOA 4JTLA 1FWFC 1HGWA 4Y9OA 4AIBA 3QY7A 4UOQA 1M68A 4A2RA 1LT7A 1YNPA 2PLCA 1OFEA 2ZZ3A 2CIPA 2VXNA 4CKQA 1R9YA 1XQKA 4ZVJA 4EWJA 1Q6CA 1BXCA 1KTBA 4FB7A 2VI0A 4AVNA 5KITA 4WEVX 1P0EA 3CK5A 2ABBA 4GO9A 1GZJA 3CYJA 4L6OA 1XS2A 2J88A 5REQA 3R4IA 4MADA 1ZJIA 2X7VA 3WJWA 3S6TA 3SCSA 4NX5A 4LB4A 4M1RA 4YVPA 4V1YA 4P8VA 3RGTA 3BW3A 2Y7FA 1RD6A 3WUGA 4UTKA 1CI1A 5I2UA 5CGMA 5FSDC 2ZUTA 1VFHA 1G94A 3WUBA 1SZNA 1KBJA 1WKEA 2Z1WA 1HJXA 1TVPA 1I75A 3VE9A 4NIRA 2E6FA 1GG1A 1CW2A 2F9RA 2CLHA 3MUZ1 1M6JA 3GFYA 2A3EA 2ESCA 3C8NA 4KIRA 4I5XA 4HU4A 1GKQA 3CH9A 4C6FA 2VFDA 1UWQA 3PB2A 1E1CA 5HATA 3BG9A 1TQJA 4PMRA 3PSVA 5CH9A 4DELA 1ESWA 5A5WA 3GG1A 3FYYA 4GKTA 4K6AA 1PZ3A 3UXKA 4QLKA 4EPKA 3ARSA 1FKWA 3EZ4A 2HK1A 5F1VA 4FF5A 3C3NA 3A47A 4GIRA 2W0UA 2Y7EA 3RCMA 5T91A 1CGWA 1VFFA 1Q8JA 1ZPTA 4WRHA 1NP0A 1F61A 3BGAA 3UU0A 3VUSA 2V3GA 2XINA 1UG6A 2A21A 2VVSA 5G4EA 2PDNA 5MHBA 5FEXA 3R89A 4DNHA 2GJXB 3EOOA 4IIHA 2NQLA 1TJRA 3W1XA 4P7LA 3WQWA 5LGZA 5JBEA 1KCXA 2NQJA 5CC6A 3GLCA 1FFRA 3AZRA 1WDDA 4S3FA 1UQZA 3WG6A 1EHAA 4DJFC 3WD4A 3WENA 4DBUA 1B1YA 2WJZA 4GQBA 1XYCA 1QDSA 3T2PA 3NA8A 5CZKA 1RXOB 1VBHA 2V81A 1LRTA 1JQVA 4MKNA 3OW1A 1JFHA 2JGQA 3PZUA 3QF0A 4DRSA 1WKDA 2MNRA 2XU2A 1E51A 2P0IA 3WD0A 2QEZA 4D8ZA 3B4YA 2DJXA 1E3ZA 1M7OA 2YXOA 2PDJA 4JD4A 5DN1A 4DY1A 1LOSA 4NYUA 1OZQA 1OG0A 4DUOA 3RR4A 5F4XA 6ALDA 4AWEA 4TTGA 3WLRA 3PJXA 1GUVA 4AZCB 4ZSUA 4W7WA 1BYBA 3W7RA 3UXAA 1R86A 4L4OA 2Q01A 2WMIA 1FXQA 3M0XA 2A4AA 3PM6A 2H3BA 1PTDA 1OT2A 2QDHA 3E0IA 1DYSA 2RDTA 3LMZA 5FKYA 3DDMA 5A2CA 4C6NA 4JL1A 3TJ4A 4FK9A 4YHGA 4GGHA 5EA9A 1CX9A 3QXBA 2NXGA 4K2SA 1EZWA 3EA2A 2IKHA 2PDBA 3CS2A 3PJTA 5AZ1A 3PWAA 1AW5A 3THDA 3EOSA 2Y0FA 3LV5A 1QASA 4UFLA 3WLKX 4QCFA 3WELA 5AC7A 5CLWA 1MW3A 3LTYA 3W1MA 3B06A 3B4UA 3GXIA 3UY8A 3W87A 3GW3A 1E5NA 4O1BA 2QUMA 3PANA 4QX4A 1EQPA 3A4AA 1F3WA 3DESA 4P2VA 5I09A 2HVMA 3M9YA 1KM0A 3UZXA 3AXXA 3SIMA 3LOTA 2OZ3A 3KTSA 3RU8X 5H8PA 2ISDA 2WJEA 4U31A 2CLPA 4DJDC 3MMDA 2GUUA 4QSHA 4AY7A 2OYKA 4X60A 1CPUA 2GQ9A 3RR1A 1K9FA 2VKZG 3UR2A 4Y90A 1JD9A 4G7EA 3OZYA 5FOOA 4ZTXA 3LX9A 2J7EA 3NOYA 2PLMA 4E8DA 4IP4A 4FLRA 3TFCA 4IQEA 1CB7B 4KEMA 4DO6A 1H7PA 2IS7A 1OX5A 2PDWA 3VYLA 5I79A 3IJ9A 3KBJA 5FSEC 3D5HA 4GXPA 4ERAA 4PB3A 1US3A 4MF4A 4NXKA 3V5CA 4A29A 1QI3A 5D30A 1U33A 3PTMA 2YXXA 3FHAA 1R46A 3MHUA 1PWMA 1QI5A 1BGGA 2X1SA 1T40A 2R8WA 2ZX8A 4XD4A 1W1IE 4B9YA 4HA0A 5A6KA 3AICA 1A3XA 2PP3A 1V0MA 3H2FA 1HX0A 3AROA 3FN9A 1ME8A 1Q66A 1NFPA 1EJ7L 1IEWA 2YX0A 1KGUA 3GVQA 5HR6A 1BSIA 3AS2A 4PL1A 2OX1A 1KM2A 5C9ZA 4K7YA 2WKLA 4LVAA 1LDCA 3AZTA 3VGDA 2NV2A 5I77A 1CLXA 4X0VA 4HSNA 4J2MA 4PCTA 1C8XA 2HS8A 3C2EA 1EJVC 1XIHA 4ZTYA 1Q4WA 4O57A 4PMXA 4IZGA 4B92A 4UFMA 3SIZA 2J66A 1X7FA 3NOEA 4IT1A 3F2BA 3UJSA 3GTFA 3Q45A 2Y8UA 4QAWA 3UJFA 4F4RA 5BXTA 4JTTA 4NZ5A 5HR7A 4UNKA 2ZZ5A 4IF2A 2YW4A 1ICQA 3PVFA 1ZY9A 3WFLA 3S5NA 1AH4A 5A6LA 1QBBA 2HQAA 4G2DA 3RYSA 3VILA 1LROA 4DBEA 3OLEA 5DBUA 2YDSA 4UQDA 4XKYB 2XVGA 4DJED 3VGBA 3LHWA 3W28A 5TIMA 4IFRA 1Q2SA 3TTEA 3DCPA 2JKEA 1XRTA 2WHLA 3MQTA 4DI9A 4H8UA 1R7AA 2FH8A 4JZ5A 3A6OA 4O28A 1S5NA 3W86A 1EJRC 4XZ9A 3QQ1A 3QHMA 1R2SA 5J8LA 3TSMA 4M6VA 4KW2A 2R1KA 5EFDA 3N4AA 2NT1A 4LGXA 3EYPA 1KR0A 1LQAA 4D6IA 2PDCA 2XFRA 1O68A 3VOFA 2Q8XA 2VZVA 1XL9A 3DFPA 5REQB 3L0KA 2CKSA 2RUSA 4MUZA 1H50A 1HG3A 3NM1A 4EF9A 5DEZA 3A12A 4DN1A 3BLDA 1FXPA 3T2QA 1GZGA 2V5BA 2DH2A 2CWXA 3LXBA 4JGDA 1JGIA 3PY2A 3G0XA 1D8WA 5A8GA 2WO5A 3E1F1 4Y7EA 1X6UA 1E0WA 2GYIA 2QV5A 2OXNA 3L2IA 4B5XA 2OYLA 4DWSA 5TQLA 2B0MA 1UR8A 3BWWA 4ASTA 1XGDA 1NIUA 3MY9A 4ZQPA 4DYKA 3NURA 3VINA 4TU1A 1TWIA 5D02A 4UZUA 1E1CB 2HV5A 1W3HA 2ZUWA 2HE8A 1GYNA 3ARPA 1UHVA 1GCYA 4C1LA 3QC0A 4U10A 4M8UA 4Z2IA 1QMLA 3TOPA 4DNMA 2R91A 4JTDA 1OFPA 4V2XA 1QI0A 4N2YA 4AG0A 3DHPA 1LQ2A 3AMLA 2CXGA 2J8FA 1KXHA 1E9ZB 1H2JA 1KFJA 4MB3A 3TNOA 3LPPA 3N2MA 3V1PA 2WVTA 5F1UA 1OK4A 3JRKA 4P8UA 2FZBA 2JKAA 4IIGA 4OFCA 5KINA 3E2QA 2Y7GA 1Q6GA 1PVNA 2CPUA 4WOQA 3WQGA 3EXRA 3BSHA 2DUAA 3BCFA 4Z17A 4XTIA 4FNRA 4MVAA 3WH5A 4L1WA 1XG3A 3QYQA 5FF2A 3KCLA 3VX1A 1VBJA 2NWRA 3CU2A 3M0JA 4PUKA 1EUAA 4DEFA 4JQ1A 2H3DA 3DU0A 4C1NA 2WNQA 4FXJA 3AHZA 1GVIA 1DOSA 5T9BG 4PMQA 1XICA 1YXCA 5LNUA 3AMDA 3W7JA 1IWPA 1RA5A 3DEQA 3P8JA 1E0TA 1DJIA 1GYLA 1X7IA 3QZAA 3MTWA 1S2TA 1W5NA 1E9LA 2HROA 1UR4A 1XXXA 3MDWA 5AZ0A 2BV9A 2GGHA 1RA0A 3O1NA 2EJAA 2CZDA 3ARTA 3WLQA 4B16A 3E38A 4PBFA 2V3FA 4WZHA 3M7SA 5LHEA 2VUYA 2J7HA 3OZMA 3K8KA 4CNTA 5BMXA 2YCLA 1JDCA 3PZVA 1L9WA 2VC6A 3EWDA 1XFBA 4CNPA 4K8EA 4AD2A 3OTRA 3W9ZA 3WNMA 2DUZA 2V3EA 3TQ0A 1EYEA 1NDVA 1E6ZA 3PG9A 4A22A 4OV9A 4LT9A 2JGYA 1KFWA 3CHEA 3ZT7A 3SAZA 1EDGA 5ABGA 4LALA 2PU1A 2VC9A 2WMIB 3E0WA 1FA2A 4HU3A 1FY6A 3ANVA 3R0UA 3FNDA 1DQWA 3O9NA 1E15A 1H63A 4WOZA 4S23A 3TKFA 4DF2A 4PB4A 1MEIA 3GDBA 1V6XA 3CUIA 1TPC1 3V3WA 4IFOA 3TAKA 3P82A 3GTHA 4JNYA 1I45A 1JD7A 4WCJA 2Y62A 2JFEX 3U2ZA 3C2VA 5ECVA 3TSBA 1B3VA 3U8GA 1TCDA 3W53A 1YEYA 2E9MA 3ORWA 2TMDA 3CUGA 3CL7A 4G9PA 1EEPA 1THFD 1K8CA 2YZRA 1TR9A 4C6DA 1U2YA 1UZHA 3H6OA 2C15A 3PBWA 3RX3A 3TN4A 2QIWA 1VQTA 4KWSA 5FF0A 1H0IA 1EB3A 1CXHA 4NZFA 3WEZA 4B2DA 3RU6A 2J4GA 3VPLA 1QNQA 1RD5A 1YNQA 1TG7A 1TV8A 3KL3A 3MWAA 4OIFA 1PX3A 1BG9A 1GTHA 3N18A 4PBEA 1FDZA 4GINA 3U6WA 1WO2A 3VI2A 1DPMA 1JDEA 1OSEA 2X1RA 1OADA 3SJNA 4U2ZA 3K8MA 3WDPP 4LUJA 3S9YA 1O66A 1VEOA 5FL1A 4N9EA 3PAOA 1UH3A 4G7EB 1QI4A 1T7LA 2J27A 3PUEA 1IT7A 3OLDA 2WBGA 2FZ9A 5EKYA 9CGTA 1U83A 1K6WA 5A8PA 1WP6A 4UCFA 1ZLPA 3KHDA 4AD3A 2D0HA 1MZRA 2PF0A 2PWFA 5E0CA 4UR8A 1C91A 4H7ZA 2QCFA 4GYKA 5DLCA 1E1FA 2D69A 4U33A 3TJIA 5JU6A 4CQ8A 1US2A 2J74A 5LA1A 3LPFA 4LX4A 3SEPA 4V15A 4POCA 1W1VA 2GJRA 4PMUA 2WNZA 1PDYA 2OU4A 1NQ6A 2J7DA 1X6NA 2HEJA 4Q8QA 3QH2A 2ZKMX 4HNCA 1MFUA 3GKFA 3W07A 1UBSA 1WB0A 4Z1DA 4A8NA 2NUXA 2WMKA 2B81A 5D2YA 4ROQA 5JH1A 4CU6A 3U7VA 1VLWA 4O1EA 4LAOA 4E2OA 1UOKA 4DYEA 3LGGA 2O0TA 3D0CA 4C60A 1B3WA 1VYSX 1J8VA 4E4UA 2E09A 4JDYA 2HK0A 1ADOA 1FH9A 1UIOA 4NU7A 3EPNA 2PDPA 4CQDA 4O54A 2I7GA 4J5NA 4DX3A 4YTUA 3VNYA 4F9DA 2Q71A 2FH6A 5LGXA 2W67A 4K8GA 4YNGA 1R85A 4NL1A 3NDZA 3WLOA 1Q6LA 1FWJC 4Z2KA 4K8HA 3C86A 2OODA 1HIZA 1NFGA 3MB9A 4AY8A 3ARUA 4QIUA 3ENLA 3MZ2A 4O1CA 1ZP3A 2R14A 3W7LA 4JQ3A 3R25A 4FAMA 4J27A 3EOUA 1XFCA 2XH2A 5I3HA 1C90A 2YB4A 3W85A 3FA4A 2QCNA 4LXFA 2CZEA 3SRDA 1VRDA 2ANUA 3EMQA 3MHFA 3FSTA 3ICJA 2W61A 3V5FA 3D47A 2C0HA 2Z1VA 1MRQA 4XD6A 4MUPA 3DOPA 3NL5A 3MSGA 4A3HA 1LLOA 3W72A 2WSKA 4LFYA 1O94A 1UUOA 5CSUA 4GUJA 3STFA 4JTKA 3PBYA 4C5ZA 3W6YA 3P67A 1ICPA 1FHUA 1W9VA 4IPIA 4JFSA 4F0SA 3KCOA 1UQYA 2GZXA 3Q2DA 3SUSA 1FWNA 3TC7A 3WSUA 4Y8FA 4HKPA 5HPOA 4QROA 2BWGA 3VD9A 4LS1A 3NL2A 3V1HA 3P8IA 1U1UA 3GVRA 5HNTA 3SGUA 3AWNA 4F2TA 2V9DA 4DWSB 4M51A 2VCCA 3W24A 3SDOA 3SCUA 4GWEA 2ZRVA 3DYPA 2AAMA 3PBUA 3OOQA 4ZEPA 4JIEA 1KXTA 3PPGA 4JXCA 3DZ1A 3IUDA 4JTRA 4LU0A 2VQUA 4TVUA 1QW7A 2INFA 2V38A 3G1YA 1JDDA 3KRZA 3ZOAA 3ZVIA 3FOKA 1W3TA 4DLMA 5SWUA 2WCGA 2DZVA 1G1YA 3R6IA 3JW7A 3N11A 4IMFA 1W32A 1QNVA 4Q7NA 5ABHA 3NO1A 3LQGA 3T2OA 5G5IA 4Z1YA 4ADSA 5BWFA 4OUIA 7XIMA 3CQ0A 1NTHA 3RX4A 1SMDA 3KM8A 3W1UA 4PUWA 4KS0A 3R13A 2ZVRA 1I9CB 3BQ5A 2WSYA 4Q8UA 5CGTA 4S3EA 4HA4A 4AQLA 2GVLA 3VOGA 4NP7A 1FX6A 2PDLA 2MUCA 2ZADA 3U3HA 3DX5A 4AZ7A 2CHOA 1XSKA 5J04A 4WK9A 4GYFA 1C29A 1E0VA 1RBLA 2A3CA 5A6JA 1AW2A 1BVWA 4U2YA 1MQPA 1XP3A 4GX8A 5EGRA 3E9AA 3B8WA 3KL5A 4ZZ9A 4C1NB 5F2LA 6XIMA 1YBQA 3CH0A 3V0SA 2BHUA 1DIEA 1LBLA 4C6JA 3COTA 2BFGA 5IBXC 2Q6ZA 1ITUA 4O12A 1FWDC 4QE1A 3F4NA 1YE6A 4RE0A 5MF5A 5HMEA 1P6CA 1CGXA 2G41A 3CUFA 3GS6A 4L65A 3MO4A 3NZGA 1W0MA 2L5HA 4EP8C 4QTGA 4BEUA 3ABRA 4F2BA 2FDMA 3GDMA 3RPDA 1K7XA 2E6YA 1Z69A 4TX9A 1IGWA 3T09A 2YCLB 4L61A 3IPWA 1I2NA 2Y8KA 4CNUA 4IMCA 1CXKA 2XSBA 3BDKA 4LC6A 2QDGA 1LL4A 4HMEA 3ABOA 3QGAC 1F3XA 6TIMA 3O6CA 3PAJA 3TAOA 1AZ1A 1S39A 3FGCA 1P0DA 4HYWA 2Y1HA 2DSZA 2IKIA 3NWRA 3MUCA 3PTQA 3L4TA 5ABFA 2W79A 1TE6A 2XFYA 3LEPA 4EKJA 4E6MA 3CZKA 4W85A 3F4CA 1Y5XA 3VD3A 5HULA 3W29A 1Z8AA 8CGTA 2F2KA 1VYRA 3W2NA 1IZKA 1N55A 1DJYA 2EO7A 3T0AA 5KETA 3TFXA 2J47A 4US5A 4GQGA 4MY8A 1PKYA 1TYGA 3BVJA 4B91A 1A4LA 2QAPA 3ZWSA 4M19A 3HPZA 4O4VA 5HJLA 1A5BA 3LLFA 3WN6A 5HK4A 3NQGA 1XHGA 2G50A 4IOTA 5TD4A 1TVNA 3LHVA 4WLCA 2VZUA 3W23A 5C5YA 3H8AA 3N15A 3T07A 5IXEA 1KBBA 3PUOA 5TNVA 4ZCWA 3VX0A 3KS6A 3PWGA 4FXSA 1ADDA 2OMAA 2R1NA 2D3NA 1TTPA 2IKJA 3R0KA 5I5RA 2QCCA 1FWCC 3ZSSA 3L0NA 1UZ4A 3NZQA 4W5UA 3KW3A 5DELA 3GVVA 2DPEA 5KZMA 4C1KA 2OR2A 2JEPA 3I3DA 4FLOA 3QM3A 3C0LA 1VP5A 4BKNA 1IV8A 7TAAA 1QBAA 2DIJA 2IPJA 4N02A 4S3GA 3GRIA 1HJUA 4L7ZA 2VEGA 3AJ7A 4OVXA 2VZSA 1MDRA 4B3KA 1W54A 4A3RA 1XLKA 3WUEA 3PWIA 4QG9A 4WY0A 1GKPA 1CECA 5D9OA 3N6QA 4KRZA 4GZIA 3IJLA 3HF3A 3N4FA 3CB3A 3IGHX 4DPPA 4GUGA 5KZDA 4HTBA 4Q7IA 3W1AA 4HNNA 4M6UA 2VZTA 3ZT5A 1AL7A 1ODZA 1FWWA 3BUVA 2NXIA 2EPNA 2XM2A 4FNQA 1S2WA 1WBJA 4BS0A 3KX6A 1TJ1A 4IWWA 4QRNA 3LTPA 1IEIA 4XAGA 3E12A 1X8CA 3NQEA 1ITXA 1XIGA 2AKZA 2ZDRA 4GABA 3N1AA 5C0QA 2Z29A 3MYOA 3NFUA 3TQPA 4Z1AA 4C6KA 4DJFA 3R79A 1BHGA 7TIMA 1KBIA 1FH7A 4YYFA 1TV4A 3DN5A 4HCHA 4U3AA 3P0XA 1EA0A 1KCKA 2JF6A 2ALRA 2JIWA 3HV8A 4UTIA 3U2OA 1BVNP 1E4IA 4ZE5A 2PEVA 1UA3A 5BRPA 4WVXA 4ATWA 2UY5A 5C2GA 4CN1A 1V4YA 5CLTA 4I9AA 5AY7A 3TW6A 1W37A 3VDAA 3C6CA 4ZBCA 3IVSA 1WYIA 4F0RA 2CHNA 3BAWA 3ITGA 4Q4OA 2QMKA 5CPLA 2ZWZA 5T8GA 4EE9A 5EMYA 4FA3A 2Z1SA 1OZMA 3HA1A 1W5OA 1POKA 1PYFA 3TN5A 3QKZA 1HJQA 1I6NA 6ENLA 2R24A 4F9JA 1R3YA 3VIOA 4OECA 2E5CA 4B3ZA 1JCNA 3T08A 1XPGA 4JTUA 3GNDA 1I2QA 5KSWA 2I9EA 2V68A 3G1RA 4H9ZA 4ZFMA 4V27A 3O2LA 3CC1A 3EGJA 3RLGA 4DUXA 3WNLA 3CPGA 2VJXA 2E7FA 3TA9A 1LJYA 2LLEA 4JTIA 4HPXA 4O8AA 4YVXA 2NSOA 3TYAA 3W7GA 1BPLB 3SCWA 1A3WA 1V79A 4HHLA 1TB3A 2Y5JA 2GSEA 2WB5A 2YB1A 5DFAA 5H91A 4RK8A 3M5XA 3SUUA 1G4TA 1ZTVA 2CW6A 3CB8A 4PRTA 3LXAA 2BP1A 1DXFA 1I0DA 4CD8A 5D9NA 3N2XA 2PTWA 1VAHA 3MP5A 3BL3A 4O16A 4E5TA 1UP3A 4HB7A 4F0MA 2G3JA 4QEHA 3B8DA 1JDFA 3VGGA 1DXEA 6CGTA 1NJJA 3NQMA 3W6LA 4D6HA 2PSNA 4DJDA 4QNWA 5A95A 1WXZA 2OX4A 1F9CA 1UD8A 3KHJA 1R2TA 3QMSA 4GVIA 3TA6A 2XIBA 1LL7A 4CN6A 4JIPA 2YDAA 3PC0A 3CLWA 3QPYA 4DZIA 3BAXA 3QQWA 4LYQA 2VR4A 1NOWA 4IX2A 4FLQA 2H90A 3B3DA 2BTMA 1NSJA 2FZDA 3QBUA 2FYMA 4HZ8A 3ZIZA 4XZIA 3DI0A 2IMRA 3TIMA 1LOLA 4TTUA 1PS9A 1QT1A 3GUWA 3N19B 1GOWA 3ES8A 4Z1BA 4NHVA 3ZJ6A 2OO0A 3UZ5A 2GVGA 3KZPA 3UGVA 1WAUA 2DQWA 4HPHA 3BMXA 4J3WA 1ZJHA 3T78A 1UR0A 1NP2A 3AZSA 3DYMA 1S1PA 1R47A 3OZOA 5BRBA 3NZRA 3VIHA 2WV8A 3L12A 1VCFA 4F0LA 3W82A 4I5UA 2PLKA 4JY9A 4JYDA 2O9OA 1W2VA 2D0FA 5BU9A 4DWSD 4NJKA 2XUCA 1G7UA 2PB1A 3OO2A 1AJZA 1J5SA 3SUVA 4H9TA 1T8XA 2DUXA 3ZR6A 3LBOA 3BICA 4W7VA 1ML1A 1L6GA 1OB0A 1OIMA 5D03A 4MZ8A 1UWTA 1O6IA 4M3PA 2D20A 4FPSA 3P7YA 3TTSA 3C3UA 3BGGA 5I3DA 4TV5A 5M1TA 1B2YA 3KFTA 3ARYA 4H9UA 2VENA 1F8MA 2Q8LA 3HPXA 1KRMA 2PDMA 1YTEA 3PZOA 3ALFA 4QJ4B 5C71A 4IGNA 1EO5A 4UTTC 3A21A 2ON3A 3V75A 3FGCB 1Y5VA 3XIMA 4DI8A 2XZ7A 3BCJA 4RW3A 1TWZA 3W22A 5ABFB 2YW3A 4NNBA 2WHMA 3OGVA 1O5XA 4D72A 3FDGA 3GR7A 1IQ8A 4YTSA 1ISZA 3GC5A 2G8ZA 1PSCA 3R10A 5ABTA 1TRDA 1UKSA 3VOHA 2BG5A 2W4XA 5HXMA 3WLMA 3N9KA 3EEGA 3TONA 5BOOA 1EP2A 1EC8A 4DXXA 3QMRA 5I3GA 4ZO8A 2QUTA 3WFZA 4ADTA 1G67A 1F4HA 3RPMA 1YKWA 5IHSA 1J18A 1DWGM 4IMGA 4BF9A 5C2XA 3UVAA 4CU7A 5D09A 3UR8A 1OYCA 4CD6A 1OQFA 4QFUA 2BGQA 4XZHA 3ARRA 1WQ5A 2G3NA 3AHTA 3O07A 3UGRA 2WZHA 4DAFA 5FA5A 2C7FA 2OO6A 1VBUA 3NQ2A 2QVHA 1S2UA 4MNMA 5LIUX 1AZ2A 2PC4A 2Z7KA 1SSDA 4BK9A 1W2PA 2QXWA 5JQ9A 1AQ0A 4W93A 3VGFA 5EMUA 2FMNA 3W6MA 4Q4SA 1ZRQA 1R9XA 4J2PA 4O15A 4UFIA 1CEOA 2XIIA 3EWCA 5BZAA 1QI2A 1A5LC 5GJPA 2W92A 1K1DA 2GGEA 4KWUA 2HMCA 2WM0A 3WJXA 2YLLA 1JAEA 1MZHA 4XO7A 4PUUA 3EX3A 3BCDA 3OGSA 1E9YB 4V1XA 1OFRA 3TYCA 2FPVA 3QY8A 5AYZA 5AFDA 2ACQA 5JVLA 3L5LA 3G0UA 4MM1A 4DBSA 4WY0B 1R8LA 3WF4A 1JVNA 2AQVA 2VUNA 1L6WA 3M0LA 4HPGA 1H61A 1J5TA 1W17A 3PZMA 1UKTA 3F7JA 3THCA 4NJJA 3GVGA 2DT1A 4QAIA 1KTNA 1CWYA 2IXUA 2ALDA 2C14A 3N13A 2C13A 3FA3A 2XIQA 1ONRA 3W2LA 3OA3A 3GG8A 4NJHA 3AC0A 4XQ6A 3D3AA 2PAJA 3S1VA 5D38A 4HNOA 1LLZA 2OWXA 3L4UA 3U57A 5BU6A 2VO5A 4XZMX 3S2MA 4S3JA 5HBFA 1TPFA 1E71M 3LG3A 3NDOA 3OBEA 3M47A 1R3VA 1TIWA 1EJWC 5BRQA 3W75A 1JI2A 2DFAA 4O0KA 4OU1A 4B2DD 3RPTA 3A23A 3IVUA 4WHBA 3C2RA 3W2UA 4JICA 5D04C 1G0CA 3FIGA 4NZ3A 3GXTA 3ALGA 3N25A 4FNSA 3FCPA 2NQ5A 4MFDA 1A0DA 3TX9A 1UW9A 1JPMA 4XSLA 1XLCA 4DJEC 1OCNA 4IQDA 2CKRA 2CLIA 1QXLA 4V28A 3CV1A 3TNBA 4KH2A 4AYGA 2WC7A 5EMLA 2FZMA 4HQVA 3MT1A 1XLHA 2ZRUA 3CUZA 4S3DA 1XLEA 3IRDA 2VCAA 1RALA 3G3DA 3H7RA 1PAMA 4X61A 3N17A 3UP8A 3WNNA 2YJQA 1LTDA 5CSSA 5D33A 4D9PA 2O9PA 1MRAA 1OCQA 1FWRA 2B31A 2HNEA 3SN1A 4CNNA 3BQ6A 3ONBA 4D6CA 2XVKA 5CG0A 1B3XA 2ZZ1A 4C6MA 2NQZA 3BW4A 3HN3A 2G95A 4ZR8A 5C2CA 2PC8A 5LYRA 4CCCA 2WK2A 2PMQA 3W37A 3B9DA 3CAQA 3QOMA 5I02A 2DSUA 4F0HA 3URQA 5FF3A 1RH9A 4O0ZA 2VR2A 5I3FA 1MNSA 4GBUA 3W7NA 4O52A 3DAQA 1NWRA 2PRLA 2A3BA 3B9AA 3UXLA 1GVOA 4H2CA 3PNZA 1P7TA 2QIIA 3AS1A 3WBWA 1RVKA 3P61A 1W3JA 1NOFA 5GNZA 2OSYA 4X22A 4DAIA 1QW9A 1W9UA 1H49A 1ZL1A 4UFJA 5AHIA 3CNYA 2V2DA 3S5YA 9RUBA 3K13A 4NXSA 1R5YA 1RBAA 4DBWA 2D22A 1Q63A 2J7GA 4EVZA 1KFBA 3GNPA 2PWHA 5HNNA 2ZXBA 4ICNA 2ATSA 4NF7A 1UUQA 4NZJA 7ENLA 3BG3A 3BANA 4AVOA 3AUJA 4FR1A 3ZWTA 2PGEA 3VU2A 4HSHA 1QNPA 1XLIA 1ZBKA 3RHGA 2EPLX 3CV2A 1QPRA 3TYEA 2J24A 4PRRA 3PJUA 2J7FA 1AG1O 1S38A 4ZODA 3S2NA 4LWWA 1OEPA 4MSSA 3ARZA 3AUOA 3TOYA 1SFLA 4CU8A 2VL4A 2G0WA 3H4WA 1TV3A 1H7WA 1ZAIA 1JUKA 3L66A 4QQUA 4IJBA 2BOEX 4QSFA 3F2CA 2QHAA 3HV9A 1HN1A 4IIBA 4S3BA 4YWIA 2CC0A 1A5NC 3GB6A 3CHVA 1G7VA 1BD0A 1M53A 1RQBA 4OOZA 3LPGA 2PBOA 2XIMA 3W7KA 5K9DA 2F6UA 2O9RA 3UNDA 4L6DA 8TIMA 3L68A 5DQPA 2NZLA 1GORA 4G5DA 3LSBA 5FAGA 2A7NA 1SR0A 4AF0A 2QW5A 3QR0A 4GYJA 4O11A 1GQIA 3IGUA 5JBDA 1IZJA 1TPDA 5FEZA 4J7RA 4QNEA 4FOUA 3ITTA 1RLCL 4AIEA 3VIJA 2JEQA 4O8RA 1X6LA 4YYCA 3VD7A 1JDAA 2FZNA 2C1GA 4MMWA 4MHBA 3JU2A 1XIFA 5HMDA 5DRCA 2PRMA 5K9XA 4HU8A 3N6JA 1MEWA 3TC6A 1RPXA 4AU0A 4ORMA 4RZ4A 1F3EA 1L8PA 4GH3A 3W1LA 1DVJA 4JN6A 2OT1A 4RL3A 4B4HA 1TCMA 4FR6A 4A6GA 1AMKA 1L6FA 3NQCA 2ASHA 3VTRA 1V0LA 1VJZA 3WBXA 1QU4A 1HL2A 2WWCA 1WKYA 3GFXA 1CB2A 3CPUA 4BZYA 1HXJA 2HCVA 4KEVA 5FCZA 2V0TA 2YL5A 4RZ5A 1CGTA 3KDNA 3RAOA 2B7QA 1EH9A 3SCNA 1JUBA 3OLGA 2Q3OA 1QFEA 4HT3A 1VBRA 3LENA 1N82A 5AC5A 2PFHA 4GQQA 3HG5A 2EPMX 1H5VA 1XYZA 4H41A 4ZA0A 1FKXA 8A3HA 3MHGA 3HOJA 3PJWA 3KRUA 2QCDA 4YLWA 3MYPA 2XZ9A 3E6EA 4BI5A 3TH6A 4QEEA 4RCXA 1XIMA 1PBGA 3FK4A 4PGLA 3MI2A 2I5GA 1JR1A 1SZFA 2J9YA 3PR2A 5IRPA 4NILA 2W63A 2VEIA 3WBAA 4HOWA 4DLFA 2Y89A 4JHZA 3B03A 1E1EA 3WIJA 1WOAA 3TC3A 2X0YA 3GYEA 3LHZA 3DYOA 1DORA 4RXGA 5EMKA 4AFYA 1ONWA 5D9PA 1MSSA 1RZMA 1C7TA 3EKGA 3NO5A 4LSBA 2POTA 4OV4A 5EMMA 5PTDA 1ICSA 1ZENA 3L65A 1CYGA 2WC4A 1RQHA 2PI6A 3AMGA 2HS6A 3KL0A 3L4XA 2ZX9A 3P14A 3TJLA 3UWWA 2VDIA 4IPLA 1S3TC 2Q02A 2QR6A 1REQA 3U2CA 2YL8A 2W9MA 2OTDA 3IJ7A 2X2GA 3AFBA 3PG8A 3S1GA 5AHMA 1XLDA 1EJTC 1LZOA 4ZB0A 3V5OA 1F07A 2WZTA 2YCIX 1XLGA 3UWVA 3NYDA 4HCDA 5A2AA 3DGRA 3S5SA 1LCOA 2O92A 1IXPA 1V93A 7REQA 1IWBA 1VB9A 3UERA 1VEPA 5B7ZA 1H5YA 2EJ1A 2O4MA 3WQDA 4KGJA 1UJQA 4BEQA 4HNVA 3UVIA 1GQJA 4F2UA 4AZGA 4JIHA 1H3GA 1A50A 4TVDA 1QPNA 3BZGA 3NTYA 4GD0A 5D37A 4MG4A 1PKLA 3MSYA 1P0NA 4LY8A 5I00A 3LK6A 3S5OA 2VEMA 5EBAA 2DEPA 4MIMA 5EMJA 2VHLA 3W81A 4DO5A 3E02A 1PB0A 3PF3A 3GHRA 3QLLA 5KZ6A 4EOUA 3N2BA 1O7AA 4US5D 3AHXA 1GJUA 3C0JA 2BOGX 1XSJA 4MLJA 3KAOA 4JOMA 1JCYA 3A9IA 4YVVA 4MPQA 4RNHA 2WPGA 2OELA 5CPQA 4MYAA 4ZB5A 1IIHA 1QWKA 4W8LA 3U4FA 3BAYA 4UIOA 4ERGA 3EDJA 1FQ0A 4N7QA 4QR6A 1XBZA 1UWRA 1X1NA 4I90A 3HMJG 1IWAA 3UCDA 2QZRA 3KVKA 4PCSA 4ZFCA 1XH1A 5CPSA 3B8SA 1YDNA 1TPUA 3JUGA 5IDIA 2VDHA 5TBOA 8RUCA 2WQDA 2YYTA 2ZDSA 1A0CA 5IBXA 1QOXA 1DTUA 1VC4A 4FO4A 1J79A 3TK7A 1QNOA 3G2GA 1F2JA 3HPAA 3I3EA 1D3HA 4D1IA 1ISYA 1IT0A 4K7VA 4NYYA 1RJQA 1F6YA 3EXSA 1UASA 4P8XA 4PSRA 4KGLA 3AIVA 3TE9A 1TZ7A 5BOEA 3WD2A 1R87A 2PDIA 4LW7A 3UW6A 1TMHA 1FH8A 4XBKA 2Z2BA 4NSBA 4Q8NA 4GI9A 3UJEA 1EGZA 4JYEA 3THAA 1GQLA 1HF6A 3PULA 3L23A 4XD5A 1M7XA 3UYIA 4JNZA 2W5FA 1ZNNA 4A21A 1V3KA 2PTYA 3H2CA 3QVQA 3NQVA 1GWJA 1PKMA 1A5MC 3T0BA 2PDFA 3I7SA 5DRIA 2ZA2A 6XIAA 1IT8A 3CZJA 3M0IA 5CZ0A 1O12A 2C16A 3M5ZA 2XG9A 1F4AA 3GD6A 3ABSA 3IAPA 1TRIA 3TYDA 3REQB 4PFHA 3PK7A 3GSMA 3PHAA 3NEVA 5CBJA 1W5QA 3A5FA 4CCEA 3RUBL 2XJ7A 1BWLA 4ADUA 2CLLA 3DHUA 1OFBA 2Y70A 5I3IA 1P7TB 1QOQA 1UOZA 4D6FA 3QW3A 2FGZA 3AJXA 1KFKA 5DX7A 4HIBA 2QGHA 5FD0A 4DJFD 1H41A 4LYPA 5FJTA 2KX9A 4XBJA 2FTPA 1GW1A 5FJRA 1D8CA 3QR3A 1OYBA 1DE6A 1MW1A 1UD3A 4WJ8A 2A2IA 2ZX7A 1KM1A 4LH8A 2XWEA 1S5VA 1K7EA 4CUCA 4H6EA 3HQNA 2E68A 2VGFA 1B90A 7CGTA 4ERIA 3GNOA 3QSRA 3M6YA 4ROPA 2BVYA 4Q4MA 1XJBA 3A3WA 4US6A 3FXGA 2YDRA 1EJXC 4KETA 2VOMA 3OG2A 1W1ZA 4XUGA 1UKOA 2F7FA 1D7KA 2DT0A 1W3KA 3KLKA 2IXVA 2NSXA 3DBNA 5H2ZA 5DMLA 1Z6KA 1NDYA 3R5EA 1EF3A 2QF8A 4Z2LA 3W2JA 1EGVA 3FY1A 1UD6A 2BOFX 3LY0A 2AGTA 4R33A 3KOYA 4LF1A 1WBHA 3IARA 4FOKA 1P6BA 1XRVA 2UWFA 3MW7A 2FJUB 4GACA 2P10A 2ACSA 3MJYA 3ES7A 4W8BA 3LHTA 4GCAA 3O3RA 4MYXA 1OCJA 4G6CA 3WQPA 1E4MM 1UD2A 2P76A 2A3HA 3H70A 4W86A 3W00A 3LD5A 1F74A 4I5RA 3UG5A 2GJNA 3UG8A 3JR2A 4IIFA 4CEUC 3GZ3A 1UBPC 3HQPA 1RHCA 4HOXA 4MTVA 4AF0B 4A8LA 3KOWA 2DZSA 3UWZA 3N73A 4Y6GA 2QCLA 4Q4KA 2PWVA 3BMVA 3WKZA 3PBGA 1FTXA 2V82A 5CZJA 2HRWA 2Y24A 3L2MA 3W26A 2BNJA 1TJ0A 4AD0A 1F6KA 3Q65A 5HINA 3QY6A 1DIOA 1I2OA 2Y7DA 4RNJA 3WH7A 3R8RA 3O05A 3EX2A 3KBWA 4J3XA 3BLKA 3TZNA 3FSUA 3Q4DA 4TMCA 1UH4A 4Y8EA 1TE1A 3R12A 2XYLA 3IV8A 2PURA 3IGSA 2WVVA 2BLEA 4MDPA 4A2SA 4DJDD 2OT0A 4LBSA 3BPWA 4D6DA 4UUIA 4RV3A 4H6RA 2X0HA 4EPBC 4Z0JA 4OBTA 2WW5A 3VOIA 1DWFM 4A3UA 2FZ8A 1P6WA 5E5CA 1NY1A 3UG4A 4JKMA 3TXVA 1ELSA 3M44A 4O17A 1BVZA 1TSIA 6A3HA 2ZOXA 3ARWA 3A9BA 3S2CA 2ZTJA 2DSVA 1XH2A 4X9YA 5CAHA 1H60A 1WDWA 4LCQA 2XIOA 5BXPA 1BLIA 5KZEA 2GL5A 3VKBA 3OVPA 2PCEA 1AVAA 1I4NA 4FX6M 2G97A 4FHAA 5A6AA 2AAAA 3CPRA 1EF2A 2Z27A 3F5JA 2ZZ7A 5E0KA 2QAFA 1ZALA 1P5BA 4EAYA 2E9BA 1K4GA 1OGBA 4C6OA 2WZMA 1UR9A 1C7SA 2XN2A 5IFTA 4HZ6A 3ZJ7A 3NQ7A 4FEZA 2GK1A 2DZAA 2C19A 4A35A 5CBBA 1GTEA 3OBAA 4RE4A 3QHNA 4Q32A 4D6JA 1YE4A 4D71A 1H11A 3SQSA 5D4YA 2IW0A 3BC9A 1JZ5A 5FL0A 4QE5A 2X42A 4YTRA 4X63A 5EB8A 8XIMA 1GPWA 4AHOA 2DW6A 4NY2A 3EKLA 1TZ9A 4DZ5A 1UZDA 4IIEA 3BXWA 4JBRA 3SRHA 4HP5A 1AD4A 1G69A 1KD0A 2OSWA 1UMYA 3CYVA 1DJNA 3TR2A 3CZLA 4GC3A 1TA3A 2A7RA 3OQ8A 4PA8A 4CLMA 2YA2A 2B7PA 3FJ4A 1TZZA 4ZOCA 2IQTA 2HZGA 2P50A 1WCGA 1HKJA 4QS5A 1REQB 3FW6A 3VGHA 4C6BA 5CPOA 3R11A 3S8HA 2W6RA 2QF7A 2PGRA 3LBCA 3WF0A 3CAKA 3VUPA 3P80A 3I6RA 4ZXOA 2NV9A 4S3AA 5D32A 3BO9A 3DKJA 1B3YA 2ACRA 1EUNA 1S5MA 2W3ZA 3KBMA 4NI8A 7REQB 2IUZA 3SN4A 2QUUA 2CZVA 3OVQA 3SY1A 1JYWA 3MU7A 4KCVA 1S5TA 3DH7A 4H6QA 3M6DA 3NPVA 3CT7A 1BYAA 3BLOA 1WDPA 3TSDA 1EZ2A 1PXGA 2BXVA 3ITCA 1Z48A 4QISA 3HZ3A 1RP9A 3BOFA 3WD1A 4WKFA 5A6MA 5HNRA 1EYWA 1DKWA 4CNOA 4Q3MA 1R3QA 4WJXA 4EPEC 4I8DA 3TN6A 1A5UA 2XN0A 3H12A 1H7RA 3WK1A 3TDFA 3DI1A 4F3HA 1FWBC 1BWVA 2CNCA 4TUFA 2YR1A 3ZSTA 3L7RA 4WX2A 3HPSA 1P1MA 4U5IA 4DXVA 4G7FA 2Z1BA 1RAKA 3TJXA 4X3ZA 3VD5A 4H9VA 3WF3A 4IMAA 3WNKA 4QHRA 4PCPA 4NJIA 5A8OA 3M0KA 1P0KA 3UWQA 1MXSA 1Y0EA 1ZCOA 3G1AA 4NUWA 4R88A 1S2CA 4JTEA 7PTDA 3UEQA 4I6VA 4PTWA 4N9CA 2I56A 2BVWA 4S2BA 2VFEA 2WMGA 2QKFA 2I14A 1XISA 4ZENA 4D6EA 3KOXA 3FFSA 1DTNA 4M56A 4J1OA 1RY0A 2XM1A 1H09A 3L5MA 4UCGA 3AHYA 1YMYA 1NF0A 4ZQMA 3DFSA 3F4WA 3IJDA 5IOBA 2JK2A 1SO4A 1WZKA 2NLIA 2PD5A 3LERA 1FWGC 5HA7A 1E72M 2WZEA 2IPFA 3FDKA 2E0PA 4GI6A 4QDPA 3SB0A 2I9UA 1FHVA 2V5CA 1F76A 3FLUA 3G1DA 1OWQA 3GDLA 3PUGA 4GZ7A 4CN4A 1HKMA 2YKKA 1C8VA 3MKVA 2E25A 4GXWA 1XIEA 2DDXA 2ZA1A 3O15A 2FTWA 4O10A 2OZ0A 3ITLA 4S2CA 1Q6DA 5C70A 5CKSA 4KRUA 1TTJA 2CERA 1YRRA 2NLYA 5A6SA 3UG3A 3R8GA 5ENLA 3ZYZA 1FVPA 5AHNA 1EIXA 3ABQA 4NRSA 2Z28A 3UD6A 2ZXQA 1XINA 3WJYA 2AOSA 5I0DA 1EBGA 3P62A 4BF5A 1AJ0A 2F2HA 1XWYA 5JBFA 3KZSA 4LYKA 5K9CA 3HFYA 4Z0SA 5FJPA 1UPPA 1O1HA 4FZIA 4ML4A 3DHFA 2VX7A 4IP7A 1E6QM 1VF8A 4F0KA 3U5YA 1M65A 2WJDA 4XSMA 5FEWA 4GE8A 4W5ZA 3MZNA 2BHZA 3O6DA 1BQCA 2X40A 4K37A 3GU9A 3E5BA 1OF8A 4H9XA 4L80A 4CGTA 3B40A 1TELA 4AZ6A 1X38A 4H4IA 5E1QA 1V6WA 1WAWA 3PN8A 1XPYA 5AVNA 3ZO9A 1Z44A 2R9RA 3TEVA 2UV8G 1L6SA 3BAKA 2ZZ2A 2F8QA 1TPEA 1HZYA 4O13A 4EAMA 3WH6A 4HTYA 1IEQA 1HVQA 4LV4A 4RLIA 1XKYA 1GJPA 3MV01 4JTFA 1PIIA 4IGHA 1ZAHA 3S2LA 3B8VA 2BGSA 1A49A 2CCRA 3TU9A 2YDQA 2KZHA 1BWKA 1U1JA 3PUDA 2VP8A 3O6YX 4K1GA 2R1MA 1XDJA 2R6OA 1TFVA 4ATDA 3VCCA 4NAFB 2Y85A 4IL0A 1YDYA 3VKCA 1M7PA 1OC7A 2D2GA 4FXFA 1MQQA 2HWGA 1W9DM 2XISA 3WQFA 1K4HA 3AXIA 1TUXA 4DWSC 1UC4A 1ZU8A 3B9EA 3M5YA 3RITA 2RJGA 1SFSA 3NJ3A 4GNKB 1SSGA 4HMCA 3AQUA 1B4EA 1YPIA 4C6LA 5A6BA 4JFUA 1M01A 2Y2WA 4WDWA 3MANA 2FHCA 3DG3A 3NSNA 3CQIA 1UROA 2OGJA 2J62A 4PN2A 3W4RA 3W1RA 3BOXA 1HT6A 3ARQA 2WKGA 4AEEA 3C8FA 4GY1A 2HPMA 3OP2A 1VRXA 2WVVB 3R0DA 2CEQA 1POJA 3MUY1 3VOCA 3GVWA 3GQYA 2WC3A 3GNRA 1CXFA 3ZFHA 1B0IA 4LS2A 3G5EA 3OIHA 1AW1A 4DJEA 3DXIA 3HGOA 2PRHA 4RPPA 3PZIA 2FGLA 3NNTA 4JKLA 4MB4A 4PUDA 4JS3A 3CMJA 2ZC8A 5HAOA 1KBKA 3G1FA 4D8LA 2PTDA 4Q4PA 5AYBA 5C6MA 3GDRA 4N4PA 1ZFJA 5CSRA 1ZAJA 5CQ1A 4TXEA 2WHJA 5H8MA 1PPIA 2CLOA 1H1NA 1K8XA 1G01A 1KLZA 4QJ1A 3VNKA 3W7QA 1RQEA 1A5SA 2Z00A 2FB3A 4A8IA 4E2VA 1FRBA 9XIMA 3T44A 1OFAA 2PCQA 3U5UA 4R3UA 1ENUA 2Y4SA 3S5ZA 5CCZA 3IJIA 2D3LA 2OB3A 1D3CA 2F84A 2FFCA 1GVQA 1HUVA 4X9SA 4MWAE 3R58A 1QHZA 1G9HA 1XIBA 1W9XA 3QW4B 3ZVHA 3CUXA 3CZEA 5DCDA 1KXVA 2EPHA 1W1TA 2XDFA 4MWAA 3IAQA 1MEHA 3RMEA 4LBUA 3T42A 1X1OA 4HK5A 3UPWA 1JI1A 4JFVA 1Q6EA 3GHSA 1BRLA 3MBFA 3S9IA 1L2QA 4KESA 3QMTA 1XIJA 3BAJA 3T55A 3BSMA 1H1ZA 2BASA 2UBPC 2VMFA 4KRTA 3CO8A 1OK6A 5FJIA 3WX7A 3P2VA 3NPXA 1NWTA 4W88A 4JIRA 3U0HA 3B8UA 1VHNA 4UQ9A 1K6AA 1IEXA 1ZBVA 1UKQA 1V3MA 3CJPA 4Z42C 4HGXA 2RKXA 3BGJA 1AQFA 1KM4A 3JZEA 3EDFA 2PTXA 1K02A 3CIWA 5A3HA 1TA3B 3G18A 1WOBA 3W01A 4J28A 1QOPA 3NVDA 4ZQCA 3ABXA 3AYSA 2Q8ZA 3A4XA 1H62A 1VLIA 4MNLA 1LWHA 1D2KA 2WMFA 4M5PA 4R7JA 3VNIA 4H3DA 2Y88A 1AL8A 1PDZA 3KVJA 3WZ0E 3G22A 4UTMA 4H01A 4H9YA 3DECA 5E6YA 3UR5A 4PMJA 5C8BB 1OC5A 3TUUA 3LCFA 3SW6A 1LG1A 4NNAA 1DE5A 3CQKA 4HA1A 5AYXA 3MMUA 4O1FA 2OPJA 1HFBA 2Q09A 3P74A 1EPVA 4PCNA 1E4LA 3EB3A 4AYSA 4AAJA 1N8FA 1ZS2A 4PB5A 4B3LA 1W56A 4G1NA 2ZICA 4J40A 1XLMA 3O63A 3NQ6A 2OG9A 1PZ0A 5MKGA 3WJSA 4DUVA 1FHDA 3PS7A 3RM4A 3C52A 4GUHA 2PA6A 2Z26A 3UZZA 3UXIA 3S1XA 4IP5A 4IICA 2E3ZA 1TJ2A 5JMUA 4JX6A 2ISVA 4ZO9A 4CQAA 4EX4A 3TMQA 1J11A 3NZPA 3HMCA 3ZJKA 1SJAA 1X97A 4J3TA 5FF4A 1S3HA 1J93A 2ZFAA 3LXCA 1SYTA 2GVYA 3OG3A 3ZMRA 3L5AA 3ITXA 4ZB2A 4JHMA 3RIKA 5GPRA 1WE5A 5D2TA 2X41A 3WL1A 4URIA 4BJHA 4OBRA 1EXBA 2V30A 3T7VA 3EWUA 4P7OA 4BR1A 3RM9A 4JTAA 1KM3A 2P3ZA 1EGMA 1C8YA 1GVRA 1JL8A 3WQ6A 3H7UA 1Q8AA 4RE3A 3QZEA 4E2DA 4HSOA 4R7WA 1YTDA 3W3OA 1TV7A 2FHFA 1TPWA 1ALDA 3S42A 5IFPA 4C6EA 1TX0A 2C1IA 1XIDA 3WYZA 3T0DA 4KERA 3B97A 1W3IA 5HQEA 3GIPA 3A13A 3FEQA 4EK7A 3VKAA 4TOQA 1PX8A 2NW0A 3GBDA 1EKOA 5K4XA 5H6HA 2OOGA 3RMJA 4HVXA 1IXQA 3IS4A 1LF1A 3RO8A 3ME3A 3V0UA 3SCPA 1XCXA 2I1OA 4JQ4A 1PEZA 1E43A 3GFZA 3LQLA 1CXIA 4QXIA 1FWSA 3LCIA 3B0YA 4CVWA 4YN5A 4WQ6A 4H04A 4BFAA 2XGIA 1T8QA 3BJSA 4HYVA 1E40A 4UTHA 4GVFA 3WUFA 4HPJA 4C6IA 1VIWA 4AISA 4RJEA 1CNVA 3I4EA 1VFUA 4RXFA 4GVHA 1DIDA 1A53A 5LA0A 2DT3A 4MFEA 4AZCA 1QO5A 1M1BA 3NVTA 3HB9A 3N9SA 3R43A 4IUGA 4JN7A 4DWDA 3W7DA 3NZ1A 5I07A 3LHYA 2VRKA 5LKYA 4RZ6A 1PHWA 3NAVA 4UTLA 4LNYA 3H54A 1EIBA 1AH3A 1TV5A 1KQYA 4NI3A 1RVGA 4GYPC 1OM0A 3HG2A 1KWGA 3I10A 1XM3A 4YXGA 4LCSA 1RJRA 3FKRA 4GNJA 2IPWA 5K7JA 1ZZMA 4CCDA 4HNLA 4DBDA 1DP0A 1GEQA 4HBKA 3CM4A 5G4WA 2P0OA 3ECQA 4GNVA 2ISSA 2VRJA 4IJCA 3URAA 3E0FA 3UCQA 1S5WA 1XBYA 4KT2A 2YXGA 2VR5A 3IIXA 3N2CA 4H7VA 5AB3A 5G1YA 1QATA 1WA3A 3LPOA 3ELFA 1CT5A 2QJNA 3UESA 4CNSA 2RDUA 1ZB5A 4UXDA 2VC5A 3TLQA 4GBDA 3FVMA 1SUXA 2UY2A 1XGZA 3DUGA 3CBWA 3B0UX 3IVTA 3W1PA 4W9TA 1MW0A 3OIXA 4WF7A 2ZE3A 3G24A 5CJNA 1PZ1A 4C6CA 3TYBA 4AVFA 3G8RA 3RCYA 3QPZA 1XLJA 2VEPA 4EIVA 1NF7A 1SW7A 1O4UA 3MJMA 3BW2A 4DO4A 5C7VA 4MNKA 2WLYA 1OIFA 2DZWA 1BTCA 2J8GA 2F6KA 1OX6A 4HHPA 4IPJA 3LYEA 2R1PA 5HMSA 2A6LA 1X98A 3AYVA 1CTNA 3F4DA 4JFTA 2GFTA 3W73A 3E0LA 3B0XA 3DERA 4QQ3A 2X1TA 5CG7A 4PSPA 4MJMA 1S1RA 3DFQA 2YCEA 2P53A 1R6WA 3IJQA 3T8QA 2GQ8A 3RNDA 2QUNA 4JTSA 3M46A 1RR2A 3HQOA 3GTNA 4XIMA 2FJKA 1TO3A 2TPSA 1VCVA 4IPNB 3VM7A 3G3MA 1PTAA 3B0PA 1Q13A 3VKKA 4JHOA 3NQ8A 3PPFA 3SZ8A 3CUHA 3M0ZA 3NL3A 4BQ3A 3LCHA 4C91A 3I7QA 3PPCA 4HNUA 1VR6A 5BW6A 3VNMA 1E9IA 1TREA 1WX0A 4QDMA 3P6LA 1OF6A 3QV8A 1TVLA 4X2PA 1KKOA 1DXIA 3H2OA 4ZOBA 2FPTA 2PDKA 4Y9AA 4ONVA 3RILA 1XX1A 2RDWA 1GOMA 2Z25A 2FMOA 3ZVHB 2ZZ6A 3NL6A 5XIAA 3R2GA 4MWAB 1ISVA 2OYMA 2ZC1A 1P1XA 3E5PA 4MKSA 2E77A 3SUWA 2YA0A 1GNXA 5HJYA 5M5DA 1BRLB 4O53A 5A6TC 2XH7A 3NXLA 4JX4A 1F3TA 1E6SM 4B5VA 4JR5A 1Y7VA 1XLBA 5C9XA 1W8SA 2PUZA 1OG6A 4AXKA 2DVUA 4KKXA 5HMFA 4GI4A 1VFSA 3GY1A 2Y5SA 4C7FA 1V8EA 3BLEA 4ZOAA 3RJXA 4AH7A 3D3FA 4PMOA 1JEZA 1VD6A 5C9RA 1QHPA 1MFVA 1UPMB 3LHUA 4EACA 2XSAA 3TP4A 5AYIA 3OU8A 4AHQA 1H7NA 4F8XA 2NVCA 1Y5WA 4FLSA 1QR7A 4JTHA 2Z6JA 3QOKA 3PTKA 3G6MA 4FF7A 5CJMA 4DF1A 5M17A 1RV8A 1LP6A 4LVBA 4DF0A 1UIPA 3WBEA 5F2GA 1TR1A 3L21A 3SCQA 3MCMA 4Q8TA 1VGAA 3SQLA 2E28A 2ONEA 3S46A 4D2JA 1A80A 3TROA 1DWIM 3VD4A 2EEXA 1Z9AA 4WY0F 4EXQA 4Z08A 1DBTA 4PL2A 4QS6A 3OYXA 3GH4A 3UNTA 1E3XA 1JNEA 3DIPA 4AIUA 2FLIA 4B5TA 3AMCA 1E0UA 4L5ZA 3SY5A 3VE7A 1V08A 4QDWA 4ZL1A 2G4FA 5AOUA 2GOUA 5AHLA 1HNYA 1YPXA 5MKGB 2ZA3A 3VC6A 3VNJA 3C0QA 2OKTA 3W7IA 3UF9A 1SW0A 1QUMA 1EXPA 1LRNA 3EB4A 3AYTA 3IEBA 3APYA 2CZFA 2OKOA 1XCFA 1XGEA 1ZHAA 1A0EA 1WUEA 1LBMA 2G37A 2PGWA 4JIQA 4XTDA 4XAPA 1X39A 4IMDA 1E73M 4OQVA 3M7WA 5KMYA 2AMGA 4Q8VA 4PC8A 1BXNA 5C9WA 2P8BA 2WSPA 1VFLA 5A94A 3CMGA 4QITA 1NVMA 2OZTA 4H9MA 4CQ9A 1O60A 1PV8A 1KM5A 4XVEA 1W1YA 3IJ8A 2P3EA 1E70M 1KQZA 1ITQA 4AMCA 3AIWA 4UWMA 5HQLA 3KCJA 3WQOA 1OINA 3U7BA 3WDHA 4JEJA 1ITCA 4S39A 3K5XA 4IXHA 3P60A 5GNYA 1QVBA 4FIRA 3SCTA 3BZJA 2VCBA 3VNLA 5LZLA 4HCLA 2XPKA 3TYZA 2QCEA 1T5AA 1GW9A 4DVOA 3QGKC 3WH9A 1WXJA 2OWCA 5BNKA 2CBIA 3N9RA 4P5UA 5B80A 1B4KA 3UWUA 1HO4A 2H6RA 3AIRA 3VDCA 1SJDA 1Q7QA 5I6SA 3M41A 1V3IA 3LNPA 3CWOX 4JQ2A 2EAWA 5CPNA 2WM1A 6REQA 3BG5A 4Q33A 4R53A 5DMYA 2AL2A 3W27A 1NEYA 4A05A 1YPFA 3CLMA 1FP9A 1JPKA 4GLEA 1XLLA 2AKMA 1R9ZA 5M03A 1KFCA 1XYAA 2PS2A 3N34A 5ECUA 5T26A 3STGA 4H00A 3CAVA 5I78A 5LXXA 2VTFA 1CCWB 4TX8A 4LNCA 4ATLA 1EP1A 1Q4NX 1LBFA 3UETA 3UZYA 2FVKA 2ABAA 2CBUA 3RF9A 2FIQA 3LUTA 3W7CA 1MVYA 2WSQA 4MJ2A 2YBVA 3CASA 3H23A 1FFQA 3PPHA 5G1TA 2J78A 5GJNA 3LB0A 2FPYA 3FX4A 4HA3A 4Z1CA 4UNIA 3GAKA 1ZCCA 2DSWA 2VWSA 1BKSA 2DT2A 2OSXA 4UOJA 2KAUC 4ZO6A 4F40A 2CXEA 3KOFA 1UYQA 3AWOA 1VFOA 3RM8A 1OC6A 3WLNA 2V2HA 5LIWX 1K03A 1Z32X 4Q4QA 1QPQA 2WXDM 4HPNA 3GXDA 1Z42A 3SFWA 4MJZA 1JZ7A 4M7TA 5A8NA 1SZGA 4H8VA 2BX7A 3CGTA 3WDQA 4GRSA 4KWWA 3EBVA 5JIPA 4L1GA 2DIEA 3ZR5A 1GQKA 5G2WA 4I9MA 4NZ1A 1TIMA 4V33A 2HVOA 3LZ5A 1HTIA 1LORA 1AJ2A 2C3ZA 5DY3A 5HANA 3AI0A 4YMZA 1BF2A 4KEZA 1GVSA 3WEOA 4XWUA 1XYLA 1GGOA 1F6PA 3PZ9A 4GQRA 3LDVA 4GJ1A 4I7UA 1SQ7A 1OVDA 5BXSA 4NJGA 3B8IA 3P3BA 1P48A 2DZTA 4M80A 1H51A 2E5BA 4TV6A 1P43A 3K2GA 2G3MA 3EA1A 4AWSA 2G3IA 3RX2A 4UOZA 4K36A 3M5VA 1M03A 2OVLA 3EX4A 4L9YA 2DIKA 5E09A 2HNHA 3FJNA 3GYCA 1IEVA 1IZCA 1DIKA 3MMWA 1JCMP 3F03K 3VVGA 4GIEA 3BTNA 2OLHA 2Y6ZA 1OT1A 1Y8BA 3AMKA 3W1QA 3WK3A 1GOQA 4ORIA 5DY2A 5HPCA 3UZWA 4IGSA 4WXZA 1SPQA 2ZBTA 3ERPA 1CDGA 1JGMA 1W1PA 3PZNA 5DXXA 1E0XA 1GOKA 1F73A 1EFZA 3MSDA 4KCTA 3S6DA 3SCRA 4XAZA 4KCUA 2EGZA 2QPXA 3IUIA 3JVAA 2X1UA 1WXYA 2BS9A 2XVNA 3W7OA 3W76A 1U5VA 1XLAA 2OOFA 2DVTA 3SGZA 4PRWA 1U5HA 4PE8A 3BH4A 2OEKA 2JQXA 1EDQA 2DZBA 2WKJA 3EWBX 1FWIC 3L67A 1W5MA 2X16A 4FP1A 4ZQNA 1R3SA 5DT5A 4IISA 5F4SA 4KBXA 1E6XM 3AU2A 4QM1A 2GJLA 4IFKA 2BMBA 1AA1B 1ISXA 1B3ZA 3WD3A 4K1WA 2G96A 2RDXA 2D73A 4UMBA 3T0CA 3CWHA 2VFHA 1HL8A 3VFCA 2IPGA 3L4WA 4WDUA 2J6XA 5HUPA 5IDZA 3W2MA 1XBXA 4O0QA 3RRAA 2NX3A 2YPIA 3VA8A 5A6BD 2X09A 2H8ZA 3ANUA 3QFWA 1JF5A 1LT8A 4M29A 3RO6A 5ABEA 2GDQA 2B7NA 1HJVA 3MI3A 1MQRA 3WY1A 3POCA 1U1HA 3ATYA 4G1KA 3LMYA 2GVJA 2DGAA 2E1DA 2JKPA 2O7QA 3MKCA 1KC7A 4HZ7A 2XH4A 4XIAA 3BK0A 1FDJA 4FNPA 4QE4A 1QPOA 4YS1A 3AISA 4OJYA 2DV0A 2J79A 1OD8A 1J96A 1JXKA 1HGYA 5D8WA 4JCMA 1WDSA 2V5KA 4M82A 3AS3A 1J2BA 4GXMA 5FACA 5JXQA 4OBSA 4YL2A 5FJOA 3FYOA 2GGGA 2HPIA 1HO1A 2HSAA 3M64A 4R7OA 3FS2A 4WKAA 2RHGA 4R9OA 3GXNA 3W88A 1LUCA 3VDGA 4AB4A 4MKVA 2INZA 2A7PA 4BHYA 4HNTA 1GVEA 4AEFA 1I2PA 3CIXA 2XGZA 5LSMA 4PUMA 1NFBA 4S3CA 4DXKA 2Z0IA 4RNIA 1XW8A 3CHCA 4UB9A 3PTDA 5A8MA 2ADAA 4J4KA 2WOQA 1UR2A 3AXKA 4F79A 5E0FA 3E74A 1FDYA 1I0BA 1DJQA 4RZBA 4MWAD 4EPDC 1XR2A 4H19A 3R94A 4Y9NA 4YCPA 3NUKA 1TMLA 2C18A 1N8WA 2A85A 3TWBA 4U5KA 3GO2A 4C7GA 3SFKA 4NASA 3KBSA 4IXXA 4O19A 4HN4A 4MOZA 2NT0A 3NYZA 2FTYA 2HBXA 3GE7A 1K77A 2O9TA 4C7DA 2VGIA 2J13A 2EPOA 3GR8A 4Z2JA 3HFTA 4PUNA 2CLEA 1KB3A 2YYUA 1XYMA 3DBPA 1VHCA 3NQFA 2Y5EA 2PWEA 1B31A 3LRMA 4EWND 3UR7A 1KLYA 4H8HA 2E6DA 1ZQ5A 5E70A 1XIIA 2QT3A 2EBNA 2J25A 3O06A 4IPPA 1N8IA 3BMWA 1YBQB 3I6TA 3W74A 3B9OA 3STEA 2D2HA 4ZSTA 4E8CA 1PWLA 4GVGA 1XLFA 4B15A 2C0AA 3A24A 1KGWA 4ECLA 2QVNA 3M0VA 3OEXA 4XUYA 4LVGA 4UTFA 1E56A 3UY7A 3WFAA 1FCQA 3LLXA 4R9XA 4ACZA 1J0JA 3WMSA 4PMYA 1XC6A 2BHYA 4LOCA 1VJSA 1ADSA 5U7SA 2ISWA 2MANA 4RDWA 2GWGA 2C91A 1EL3A 1FCVA 1SFJA 3CV6A 3KTCA 1QO2A 1JZ3A 3RK8A 1O5KA 1PX4A 3SR7A 3AYRA 1K7FA 1SO3A 5HWMA 4S38A 3USZA 2VEFA 4LAKA 4KEUA 5FJUA 4I6KA 4MZYA 1ZSXA 3E2RA 3IIZA 1TV2A 3GNNA 4B90A 4Q8PA 6TAAA 3C0SA 3TWAA 3O8AA 1PCKA 4XAYA 5F7UA 2WVSA 4JAWA 2JBMA 2VRQA 3QYSA 3DFTA 1FWHC 3QZ6A 3RXZA 2Z6IA 2AQWA 4MLRA 1MUMA 3K30A 2VX6A 6REQB 3EDDA 2RJHA 5EL1A 5AC8A 3AALA 5AECA 2AL2B 1HKIA 4ILSA 1ONEA 3WDIA 3BV4A 1QK2A 1I1WA 2WSRA 2D23A 5C7HA 4AZBA 4MY9A 3TW9A 4PTDA 3M16A 4OHQA 3TW7A 3GXPA 3HJZA 3QR1A 1V6UA 2V63A 4W7UA 2G5WA 3DC0A 4H2HA 2VELA 3MP3A 1JFXA 3N2TA 4GJIA 2H9AA 1MUWA 1GZ1A 2XWDA 2C1HA 3XINA 2G3FA 3T9PA 3TMLA 4XG1A 2J9XA 4NZ4A 4LUIA 3I65A 2Y61A 3BLIA 1U22A 2BZNA 2Z7GA 1HQTA 3LA4A 4K3ZA 3EDKA 3KRSA 2X30A 1ZBWA 3ARVA 3P0WA 3QRHA 4OE7A 4AMAA 1JYVA 4HHHA 4PTVA 1Q45A 1S2AA 4X0NA 1JCXA 1JPIA 1VPQA 1UWAA 3K46A 1G4EA 1I2RA 3HBLA 1DJWA 1YIXA 2Z1XA 3VZYA 1XYBA 2ZUMA 1NELA 1OX4A 3QGVA 3SUTA 5HQMA 1CGYA 1W3LA 2PE4A 3PSWA 5E9AA 1GOIA 3PZGA 3N4EA 1XF0A 3UWYA 1WZLA 2QCGA 4O4WA 1R3TA 2QULA 2WVUA 1E6PA 4QP0A 3VABA 3VIIA 1XYFA 3GC2A 4L56A 2VEKA 2PP1A 1A4MA 4R85A 1RBOB 2QPUA 1C8QA 3OHIA 2C8NA 2E8ZA 3IIVA 4GY0A 3R8HA 3GTXA 4O1AA 4ZQRA 4Y96A 1CENA 4JTQA 4DPQA 3GDKA 1YADA 2ZIDA 3ZT6A 1UMLA 4TO8A 2J75A 4H83A 1XV8A 4IJRA 4FS9A 3IJ6A 4PZVA 3B8TA 4LUTA 1YXYA 3E2SA 3SECA 1TUFA 1UUMA 3V16A 3ANYA 2QJHA 1A5KC 1DQXA 1MXGA 3BURA 4QLLA 2VD9A 4AC1X 5IM51 4NNCA 3UWEA 3E0VA 4XK2A 2FFIA 1PYMA 3OVGA 1W1A1 1SFTA 4B5UA 4B5SA 4UZSA 3D6NA 1NH6A 4QG8A 1Q7MA 2BB0A 2INEA 1SZRA 1TJPA 2UY3A 3RFAA 1X96A 4PMDA 5GJMA 4F66A 4GX9A 2V2CA 1EP3A 1J9YA 1I1XA 3WF2A 3MO7A 5DBTA 3O7UA 4Y2WA 3MKKA 3IGXA 3EOLA 1KRCC 1RCQA 3RJYA 2GSHA 1RP8A 4WR3A 3ZLFA 2G4JA 5G2IA 3F4VA 3QV7A 3WDJA 3FAWA 3WK2A 4LYRA 2CZ5A 3Q58A 1QJWA 4O1DA 2I5IA 1GEHA 4IFKB 3LGEA 4REQA 4AHPA 3M0YA 2GDUA 1V3HA 3EMCA 2EKCA 3SSJA 3WMCA 4MY1A 2VURA 1V5XA 5EY5A 4E0CA 1C92A 4JQAA 3NO3A 5TF0A 2SFPA 3NGJA 2EG7A 3DFNA 1WPCA 1GOOA 3LU2A 1RK6A 3SO7A 4GISA 4IUOA 3MV11 3POHA 5CBIA 1OD0A 2CU0A 3C5QA 2CLFA 3DG7A 1W9PA 3VAVA 4MB1A 2ZRYA 2BXYA 1LRQA 5XIMA 4I9JA 5D2XA 5DT7A 4PEKA 3HG3A 3K4AA 5EU9A 4GGBA 3W70A 4BWLC 4Q4RA 3A4JA 4UFHA 3AXMA 4Y9MA 3VFLA 3THQA 3WQVA 2WPBA 4N6EA 1S2VA 3UJRA 5KEZA 3QTGA 1XG4A 2A3LA 2DU2A 5EFFA 3CL8A 3FJ6A 1XRSA 1RSCA 3FKKA 4H6KA 4JN8A 2D0GA 3W7HA 4M81A 2X8RA 4PTXA 3VIPA 3AIQA 1UH2A 1EPXA 3HIJA 1LUCB 1MDLA 3QKEA 4GYPA 1FCBA 3LCWA 3TLLA 4LAMA 4BF7A 4LBRA 2PU0A 1J0IA 4RPQA 4HMDA 3ATZA 2NQ9A 4KQNA 4J3VA 1B5TA 2X2YA 4NRRA 4QJ3B 4AC7C 2A1YA 3G0SA 4QLJA 4IQLA 1XCWA 4KMQA 2X05A 1SU5A 3ARXA 3E3HA 3LRKA 2QDEA 1KGXA 1ONXA 1GYMA 2Z24A 3P5YA 1LL6A 3IIOA 2GLKA 3PZQA 1VEMA 3KWSA 3J7HA 2ZUSA 5B7YA 3UXDA 1GPFA 1BXBA 4XBSA 2D1ZA 1VJIA 2VFGA 3Q67A 5CGQA 5L9FA 3V18A 4HZMA 2Z2AA 4ACYA 5K3VA 1JCTA 4U4MA 1TPB1 1C9WA 1NQKA 4PFMA 1H7OA 3OA5A 4LRTA 4LRSA 3SSZA 3RLUA 1CLKA 1PE1A 1OY0A 4NX0A 3SCOA 1DEDA 5CZTA 4DZAA 2WZIA 3GC4A 4J3UA 3WDRA 2PWDA 1Q6RA 3EB2A 3NSMA 1CGVA 2BBFA 3NG3A 3SURA 4AZHA 4C6PA 2ZXDA 1T6MA 2VFIA 2J7CA 1J4EA 3RDKA 1GQNA 5L6UA 3V35A 3KE0A 2QLYA 2YCKX 2V8ZA 2YLAA 1EC9A 1TQXA 4JPGA 4ACZB 3GW0A 4N9DA 3F5KA 3CT2A 3WQEA 3W7MA 1R38A 1AFSA 3LI1A 3W84A 4MJ4A 3ZZ1A 3R1ZA 3H2MA 1F05A 1AODA 3BLPX 1J6OA 2PODA 3LCGA 3HM7A 3FJLA 1V7YA 3U48A 4WKHA 4PMVA 4XAFA 5E6ZA 1XUUA 2PDQA 1OHLA 2BY2A 1SM9A 1VS1A 2ZZ4A 1DV7A 4UC5A 1FHLA 4RW5A 1E5JA 1JPHA 4R34A 2WYSA 3RCNA 3URNA 3TYUA 4EXAA 2F6XA 1UP0A 3W02A 3LN3A 3GUGA 4DZHA 5LXEA 3WQ4A 3QC3A 4ZGYA 1DL3A 4AW7A 5DXYA 3TV8A 4UTUA 4C6QA 3QTPA 3GR4A 3AIEA 3AS0A 2BSLA 5JIWA 1W1B1 1BYDA 1XDMA 4MPKA 1E55A 2PDGA 2E5DA 4C65A 3VDBA 2CBJA 3SJ3A 2ISFA 4GO8A 3VGEA 2IQDA 1J6PA 2WNWA 2H9AB 4FNTA 4K39A 1VZWA 1KW1A 2WMHA 4PMNA 1Z3NA 3MBDA 3NIYA 1GOXA 3CQHA 3INPA 3OLIA 2GVEA 2FQIA 4ZO7A 1CGUA 1UD5A 2CETA 2E4TA 1OGSA 1H1YA 2QCMA 2ZTKA 4CD4A 3GTIA 1GK8A 1UWUA 3MCOA 1L0PA 1VPXA 1V02E 3LSCA 3EWXA 4CD5A 1LLWA 2GJPA 3C56A 4K68A 4XKMA 1EDTA 1W9BM 2NVDA 3TCEA 2TSYA 1LG2A 1V02A 1Q85A 1KTCA 5FEPA 3G77A 2CITA 4JTJA 1T41A 2WAGA 4S3KA 2DY3A 1R0MA 1X8FA 4PYSA 1WUFA 1WZAA 4GMEA 2VYOA 4HJWA 1HKWA 1IE7C 4MAZA 3W2KA 3WQ5A 1SO6A 3KOZA 2WCAA 1QK0A 1OX4B 3VZZA 2OLSA 5I7GA 2PZ0A 4Q6JA 3PBVA 1T96A 3I68A 3WL0A 3PNUA 3P93A 3WLPA 5HWNA 4RKAA 4BCEA 2YGYA 1XBVA 1YHTA 1BGAA 1FP8A 5FESA 2BGNE 4AWTA 1IIGA 5CJ5A 1RY8A 2QUVA 3EMZA 4GFSA 3JZUA 1LOQA 2OWWA 1AH0A 3A64A 4YU1A 1MO0A 4E38A 2V5JA 3ABZA 2JF7A 1AD1A 5GNXA 4DM2A 3M1ZA 1Q6QA 1R3RA 4ML9A 5E93A 2VZOA 1JIBA 2C71A 4I8YA 1D7FA 4LB3A 4LTSA 2E8YA 4LUTB 1IXOA 5LNSA 1U5JA 2PBGA 2VNCA 3YPIA 1GHRA 3CZGA 3GK0A 4PEEA 4E2BA 1TKKA 4IMEA 5F4WA 1UB3A 1O95A 4QGCA 4JEQA 5BYWA 4MAVA 2GUBA 3OVRA 4N4QA 2OLAA 4W89A 5A8QA 1LYXA 2ODOA 3UZJA 1EX5A 3FAXA 5CC5A 1G6CA 3IWPA 1A3HA 1KV8A 3M07A 1RPKA 2YOCA 3BSGA 3KVMA 2OQHA 3I4KA 4O18A 3GIQA 3T1GA 3MVIA 1KBLA 2VT0A 1VYPX 3AO0A 1J10A 1NDWA 3CMFA 1F8IA 4A3YA 2HJPA 3O0KA 4WUIA 2R94A 3OZPA 4XB3A 2XVPA 2HE5A 3N3MA 2WBKA 2PPGA 3IANA 3ITVA 2P8CA 1MMFA 3AXHA 3P5ZA 2PDUA 1PL9A 1JXJA 4LPCA 3VXGA 4REQB 4YJ5A 2E67A 3O0FA 4E3VA 3V7PA 4N42A 3BAIA 1D3GA 1UP2A 4M1BA 1BTMA 1XKJA 1KNWA 2EG8A 4MNJA 1RLDA 1JF6A 4C5YA 4OOUA 4WSKA 3WMLA 1JYXA 1JCLA 1GT8A 4LAUA 4L4LA 2O56A 4GCXA 2WMJA 1W5PA 3FHQA 3SN0A 2FHBA 4YTTA 5XINA 4CVUA 2OZ8A 1IR2A 4R27A 4UTWC 3TN3A 1XUZA 2NV1A 2DJLA 4XVDA 2A5HA 1H7XA 3QEZA 2P88A 3B05A 3A22A 4N9BA 1IYXA 2O4QA 3KDOA 3KLLA 4BQ4A 3H2NA 1NARA 3E96A 1QWGA 5M2FX 5FJJA 1TWWA 1AUSL 2BXZA 4YIWA 4GH1A 2RH9A 3OJGA 4KWOA 3QPEA 1T99A 3TTQA 2E40A 3VMNA 2BODX 3C2FA 1MNZA 1KWKA 1ECEA 3LZ3A 3GDTA 2ZWYA 1CXLA 1EA9C 1UA7A 4B5WA 4TIMA 1GHSA 4UQCA 2ZUUA 4RV8A 3WO8A 1GJWA 4IIDA 3H2EA 1GVFA 2PDYA 1BFNA 2CLMA 5DMMA 3B0VC 4MZ1A 4IHCA 2NX1A 2PWGA 3S1UA 1LQ0A 3MWCA 3CO4A 1IHIA 1SZEA 3E2VA 4P7NA 1EQCA 3N04A 1PJ9A 4AD1A 5A69A 2JE8A 3K4DA 2XVLA 1RUSA 2I57A 4IGMA 3MSRA 3VOJA 3PZTA 1CXEA 3GHUA 4IL2A 5JH2A 3L4ZA 1US0A 4GKLA 4P61A 2FVLA 3TZFA 4WJEA 1AQHA 4W4QA 1TPH1 3BLFA 1VFMA 3WH8A 5G2HA 3WBYA 2IQ0A 1T0OA 3NCOA 2W62A 3SQMA 3VMOA 3JS3A 2X0SA 3LS9A 2FGBA 1DJGA 3VC5A 3WF1A 1BG4A 1OCBA 3G1HA 3H21A 4OGZA 5DCBA 4LAZA 3B9NA 2BVDA 3M0MA 3G6LA 3H53A 4UMCA 4Q8OA 2PF8A 3NPUA 5EYWA 1DWHM 1NWSA 4M24A 4PMZA 1VCGA 2D24A 4PR4A 2DP3A 4IX0A 1U30A 4ENLA 3NGFA 5CPTA 1JAKA 5H8UA 3HGSA 1MXDA 3GU2A 1DHKA 2QCHA 3S4TA 2ZQ0A 4GFIA 5I03A 2W66A 4KPLA 4KIEA 3UFYA 1H4PA 2QS8A 4JTGA 1AQMA 1MYRA 4DIAA 3TTOA 4GIYA 2Z2UA 4KFOA 4BQ2A 2VD8A 1EX1A 1KRAC 1V51A 4O14A 3BOLA 4JY8A 3S9ZA 2AMXA 1QAPA 1VBGA 2A79A 2GQ3A 3OGRA 3MP4A 4H1ZA 4LC8A 4KCWA 3T4WA 3KVLA 1W8GA 1Q7ZA 2PDXA 2QMJA 4UQAA 4IQJA 4LUYA 2QCDB 5LIXX 2WQPA 1KO0A 4GPNA 5FF7A 2EPKX 4AUBA 2HXUA 3GG0A 3ZM8A 3G1VA 1HW6A 3I3BA 3N6HA 4LCRA 3IK2A 3TR9A 4IG2A 4AEOA 2YSWA 3H22A 4X2RA 1QW8A 2PDHA 3CIVA 2REQA 3USBA 2YIHA 4CQCA 1CZ1A 1LWIA 1WKFA 4GG9A 2ATMA 1SR9A 2VC7A 3WLLA 5U4NA 5EBUA 3S83A 5BROA 3VM5A 4D8AA 1V6VA 3SY8A 4LVDA 3FEMA 2BVTA 3ISIX 1Q2RA 1J01A 3IRSA 3VNDA 3MDUA 4FI4A 1QHOA 3WJZA 5HOSA 4MGGA 4DQWA 4HHMA 1VKFA 4J3SA 3MC5A 5FIPA 2EKGA 3MS8A 3UBPC 4E8GA 1G4PA 2EF9A 3WLHA 3DC8A 1BYCA 2HISA 3OYZA 2VM8A 4ZOEA 3CXOA 2DZXA 3OB8A 2IKGA 2EQDA 3K1GA 1HKVA 3W71A 5A1AA 2VWTA 2I16A 3SM0A 3WK0A 2QGYA 4M6PA 1UR3M 4WDXA 4LY4A 2J77A 1N2VA 3O16A 1JRCA 4YPJA 3OODA 5FI8A 3GZAA 2V5LA 1NU5A 1YDOA 2F61A 5HJXA 8XIAA 1XD0A 3VIGA 3QV6A 5AC4A 4FALA 1YLVA 5F2MA 3CHFA 3WMBA 4A4AA 3EOEA 2RGMA 3CQJA 4LJ3A 3VIFA 3MCNA 3PBMA 4RR4A 4GHRA 1O5QA 3LGDA 3W7EA 4DHGA 3LI0A 2VQTA 4AZIA 2E1WA 3DHDA 3VCNA 1EJUC 2GQAA 3PFMA 2P1FA 1SMAA 4AD4A 1JNDA 1M5WA 4DM1A 2FKPA 2A3AA 3XISA 1Q3NA 3GHTA 4RE2A 1L6YA 2EHHA 2OQYA 2GGJA 3VKDA 1CLVA 2HXTA 2FB2A 4FSAA 2J8TA 2ZRWA 4QCEA 1VIZA 3WQ8A 1W6TA 4P8WA 2HDJA 3BV7A 3T6CA 3UT0A 3WCZA 4B4FA 1CBGA 1PO9A 1QNSA 5FAJA 4TQTA 4D1JA 5AKQA 4Z2HA 4K38A 3HJEA 3FYPA 4HJFA 1LWJA 1BEUA 4GK8A 2HTMA 1EO7A 3CUJA 5LIYX 2V69A 3FV9A 2XIJA 3UA4A 3VNZA 2CHRA 5A2BA 1LM1A 3H7VA 4NT0A 4RUBA 3OHMB 2YCJA 3W38A