3H2CA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
273
structure length
257
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNGSYNEVDAAVRHAKEMRDEGAHIIDIGESTRSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 257
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2cA00
1Q7QA 5JQ9A 3H23A 4S23A 3MCOA 4D8AA 3TYDA 1AD1A 4DAFA 3TYAA 3H2NA 4NILA 4DJEC 1AD4A 4MWAC 4D8ZA 4MWAA 4DJFC 2VEFA 4S38A 2YCIX 4DJFA 3TR9A 4DJDC 4CCZA 4DJDA 4C1NB 3H21A 1TWSA 2Y0FA 3H26A 2H9AB 2Y5SA 4S3AA 3NOYA 2BMBA 2OGYA 2YCLA 1Q8AA 1AJ2A 2Y5JA 1Q8JA 2YCKX 3H2EA 4O1FA 4D9PA 3H2AA 1TWZA 3BOLA 1Q7MA 4S3CA 2DQWA 3H2OA 4S3EA 2DZAA 3H2FA 4NHVA 3V5OA 4S3DA 3H22A 4NIRA 4MWAB 3MCNA 4S39A 1Q85A 2VP8A 3TYEA 3H2MA 4S3BA 3H24A 4DJED 2H9AA 4S3FA 3K13A 4HB7A 2YCLB 2VEGA 2E7FA 3TYCA 3BOFA 3TYZA 1TX0A 4DB7A 4DAIA 4NL1A 1F6YA 1AJZA 3TZNA 4PZVA 4C1NA 4DJEA 4MWAE 4O0QA 4O1EA 1TWWA 1TX2A 4MWAD 3TYBA 3H2CA 3TYUA 4DJFD 4DJDD 1EYEA 2YCJA 3TZFA 1AJ0A 4G9PA 3MCMA 1Q7ZA 2DZBA
chains in the Genus database with same CATH superfamily
2QNEA 2PDBA 2P5NA 8RUCA 4JIHA 3SFWA 2UY5A 3ITTA 6REQB 4XZIA 2QF8A 5LIXX 3ITLA 3B0XA 5LGZA 2NV9A 4JFVA 2OWCA 5FSEC 3U2OA 3N14A 5AZ0A 1TTQA 4QAWA 1GOIA 2TPSA 3EWXA 3REQA 3DKLA 4XBKA 1GKRA 1RPKA 1DIKA 4RV8A 5I3DA 2CC0A 3CQIA 2BXVA 2Y8KA 4WD0A 5U7SA 1OCNA 3LB0A 3PVFA 2CEQA 3MA8A 1T0OA 1BWKA 2G3FA 4S3CA 1GONA 1GKPA 1L6FA 3GLCA 3GVQA 4FALA 1P6WA 4H9TA 1C9DA 1J0IA 1HVQA 1EJUC 1FKWA 3KM8A 5HMSA 3G1VA 2D69A 1W3TA 1NIUA 3VTRA 2YYUA 1NDYA 2D1ZA 3HPZA 4Q4PA 2RDXA 1CLVA 3AISA 3G6LA 4ICMA 2FHFA 4L61A 3QW3A 2XH0A 1WB0A 1M01A 2HVOA 4N0RA 3VOIA 4Q8MA 3HV9A 3WMBA 2IMRA 2Y63A 1TPWA 4HBKA 3C2FA 4BF7A 1T41A 4ZOCA 4FNRA 3E6EA 5ENLA 2BOEX 2XM1A 4QP0A 4UMCA 4HNOA 2XPKA 1FFQA 2DV0A 1E4MM 4P7QA 1NP0A 4MDOA 1ZFJA 4LNCA 4YTRA 1RBLA 5D38A 1IWBA 1W1A1 3ARYA 4C6CA 1P1XA 1ZQ5A 4RNIA 2FTPA 4DF0A 4ZFMA 2PEVA 4GO8A 1H7OA 1EDQA 1TE6A 3N04A 1U33A 4C6KA 1UC5A 3ARVA 3IJLA 1TR9A 3FYYA 3W1TA 5ABGA 2HNEA 5J04A 3RGTA 2JGQA 3BG9A 3P14A 1BSLA 3DHUA 5M03A 2RDTA 2JIEA 3VOCA 1XLCA 3RU8X 4GJJA 3CLMA 1VPQA 1IV8A 3OIHA 1QT1A 2VP8A 4A3HA 2OOGA 3I7RA 3PNZA 3WQGA 5JU6A 2RKXA 3U0HA 3CIVA 1BKHA 1I0DA 1H50A 2FVKA 3R89A 1LORA 4H19A 4IIBA 3CO4A 4UB9A 1M41A 3H7VA 1WOBA 4K1WA 1GOWA 3NJ3A 1V6WA 4PUEA 1TKKA 4J7RA 3LPGA 2OQYA 3A22A 3DFSA 3CV1A 3N6JA 4PULA 4P8XA 3GNPA 4ZOEA 1TELA 3WLHA 1E3XA 3IPWA 4FNPA 1VIZA 3HPSA 1YDOA 2ODOA 3N15A 2VDIA 4ATDA 3WQEA 1TWIA 3QQ0A 2VX6A 2Z27A 3GRIA 4GC4A 1EJ7L 1LBLA 3TN3A 3CMGA 4JL1A 4ADSA 3CHDA 3L4WA 1OZQA 2DUZA 1BG4A 1FCQA 3A3HA 1P7TA 3OLDA 4IHCA 3RLGA 4BQ5A 4PGLA 5D8WA 1WQ5A 1AL7A 1EX1A 1H51A 3N9RA 3UGRA 1CXHA 1TTJA 4KCUA 4URIA 4UTMA 4JTLA 4FX6M 2V3EA 3HB9A 3I6EA 3SGGA 1X7FA 5A2CA 4WDWA 3CHFA 3ZJ6A 2ASHA 1D7KA 4LYQA 1JCTA 2C6QA 4M1BA 1RD5A 1DWAM 2POZA 1IXQA 3PY2A 1ODZA 2W79A 2VELA 4ACYA 1UZDA 3BTNA 3BQ5A 3M43A 1AH3A 4C6IA 1R5YA 4LAMA 3VYLA 1IEVA 2FDSA 1OYBA 4G1KA 1V6TA 1E4NA 3NG3A 1J2BA 4MVAA 2WVUA 1RA0A 4TVCA 1PTDA 1MDLA 1EWEA 3KBMA 5GNYA 1XF0A 1JYXA 3R0KA 1KTBA 1GHRA 2IQ0A 3BW2A 3SJNA 1V3IA 2VO5A 4BY3A 1FUYA 4DWSC 3TCEA 2QVHA 4PTVA 2WMIA 4O11A 1ISZA 1A0DA 3ABZA 3ZWSA 2VNCA 3SCWA 3MUIA 4O12A 4F66A 1XUUA 3ITVA 2P0OA 1W3NA 4ZXOA 4LY4A 1LWHA 3WF0A 5HWNA 3M47A 4OV9A 3L4TA 4MY8A 2DJXA 3QC3A 2YOCA 4HSNA 3U4AA 3HGJA 3CAWA 4QXIA 4I6KA 4UIOA 2QPUA 2YW3A 3R6IA 2CPUA 2R9RA 2WANA 3PBUA 4L80A 3EYPA 3QTPA 3HJEA 3BLDA 5C5YA 1ITQA 3VI2A 3VFLA 4B5XA 2XJ7A 1LOQA 2X0SA 3MWCA 2GGGA 5K9XA 4MYXA 1S2UA 3WY1A 4GISA 2WC7A 1OSEA 2VC5A 4JPGA 2G37A 4UTLA 4CNOA 4GJIA 1RXOB 1XD0A 1R3VA 3H4XA 5CC3A 2I1OA 3AXIA 3IUHA 3PR2A 3IIVA 4ZO9A 4MOZA 2E8ZA 1QNOA 3PFMA 4P8WA 1HKJA 4KW2A 3OVPA 1FBAA 2CKRA 1WDPA 2D73A 1O5RA 2FGBA 3WEMA 1QOPA 3WL0A 4KGJA 1YIXA 4RR4A 1F6KA 3PFRA 3CUZA 3W9ZA 2GWNA 3CAVA 1LBFA 1PV8A 5U4NA 4J3UA 1NELA 5I79A 2V2DA 1IT8A 1EA0A 3EWWA 3VZXA 3GUWA 4H41A 1PHWA 1UH2A 2O9OA 4RE0A 3N2OA 1W2PA 4I8DA 3LM3A 1OGGA 3AMGA 5F1VA 3WNPA 2QJMA 1SPQA 5A94A 2XZ9A 2DGAA 4RZBA 2HVMA 5KZEA 4FX7A 1LQ0A 3W02A 4Q8NA 4WOQA 3MUZ1 5EY5A 4AC7C 1DJIA 4ATWA 1K3UA 3W2MA 2AAAA 2ZWZA 3EX3A 5LA2A 4DYKA 2JFEX 3RMEA 1NQ6A 3WQ5A 4WY0A 2DORA 2QXWA 3VIPA 5FA5A 2GVEA 4AD2A 4HOZA 3AZSA 1WNOA 1J12A 1CWYA 2WXDM 4AAJA 1PHQA 4FIQA 1XLLA 1MRAA 3SRFA 1W5QA 3PM6A 4C6EA 1EH9A 2YSWA 1JYWA 2FGZA 1JI1A 4HCLA 3RFAA 4IF2A 3NXFA 1A5LC 3FA5A 3BCJA 2DZBA 1Q63A 1VJZA 3RM8A 4UNKA 5C2XA 3BPWA 3EDEA 2EJ1A 1UUOA 3TC3A 3NQFA 4IG2B 3W7CA 1FXPA 4JX6A 3NOYA 4QS5A 4EPBC 1YX1A 3BMXA 3URNA 4DYJA 1V8EA 5I03A 1POJA 4PN2A 1XLFA 4FEZA 4LRTA 3PAJA 1J4EA 4D9PA 3G1YA 4XX6A 1CDGA 3L2IA 4XBJA 3CT7A 3NOEA 5M3WA 1JRBA 2WMHA 1K6WA 4U3CA 5LA0A 5C2GA 2QGYA 1OQFA 9XIMA 3SSZA 1LF1A 1P0DA 1DV7A 2XINA 3CUIA 4Z1AA 4AX7A 3TYEA 1FWHC 1UP3A 5LIUX 3F7JA 1G4PA 4M3PA 1K8CA 1YDNA 1SZEA 2ESCA 4DZ5A 2DZVA 4LAZA 3AUOA 3BK0A 4L6DA 1XRSA 4LS2A 3VNJA 3O0KA 2EGZA 3G1XA 2J88A 1KM1A 1ALDA 1NDVA 5B7ZA 3PF3A 5FEWA 2BY2A 2VRQA 1ESWA 4QJ3B 2DT2A 5F7UA 3M6DA 4N9BA 2XGBA 1EYEA 4KFOA 5FCZA 3VOHA 2WLYA 4NNAA 1W5OA 1UPPA 1REQB 4PCPA 1K8YA 3WLJA 1UWTA 4HK6A 5C70A 1EL3A 1ME8A 2ZZ4A 3KCLA 1NEYA 1Z42A 3VD9A 1TPVA 4XZLX 4MWAC 3UG4A 3QR0A 1RSCA 2VEFA 4AZHA 3L67A 4C1NB 1W32A 1OB0A 3WNOA 1FWJC 5IRPA 3EDKA 4IPJA 4IQDA 1TUFA 2BB0A 3T8LA 3CLWA 1Q6DA 4Q4RA 1Q8JA 4IQJA 1QNSA 4I9MA 3E5PA 4GHRA 3MV11 3L23A 2DZSA 4US6A 2RFGA 4JIPA 4GPNA 3F2BA 5EYWA 4UXDA 3O05A 1QAPA 3O7UA 3SB0A 1FFRA 1QJWA 1X38A 1OFPA 1XIMA 4Q4SA 3WDIA 2V0TA 3UBPC 1YPXA 4ZODA 1IXNA 2GJPA 4RK8A 3VNDA 3O3RA 5D02A 3REQB 2WVSA 3K13A 4LB4A 1K9TA 3ZJKA 1R3WA 3WBEA 4IPIA 4HZ6A 4N9DA 5CGTA 1HP4A 2OTDA 1KV5A 2UY3A 4OIFA 1PO9A 1IYXA 2XWEA 3B04A 1A0EA 4FAMA 1TMHA 4GIYA 2P10A 1XR2A 4PA8A 1IZCA 1K9FA 1V3HA 5LYRA 3T6CA 1YADA 4KEVA 1RHCA 3PG9A 4FA3A 1ZTVA 5G2HA 4MB3A 4RL3A 2Z4GA 3NWRA 3L2MA 3KTSA 4Y96A 1H3GA 3BH4A 4JN7A 1E4IA 1FH7A 2VEIA 1JJKA 4QRNA 4UBPC 3MSYA 2DDXA 4HJFA 4MF4A 1FWRA 4GI6A 4Z2LA 4JQ4A 1UKOA 3OB8A 4DO4A 3KOZA 2AQWA 4DRSA 4JNMA 2OT1A 4HHHA 2WSYA 3FKRA 5M5DA 4M81A 4ECLA 4KQNA 2ZZ6A 4ZO7A 2F2HA 2ALRA 4MPQA 4S3EA 3C0QA 5EPDA 2NQ9A 1JL8A 1QUMA 5KINA 1KBBA 2A7NA 1XUZA 2ZUMA 3WN6A 4XIMA 4ZTYA 2WZEA 1PS9A 3VIJA 3G1AA 3DI0A 3PS7A 4XZBA 2X41A 1UUMA 3RJXA 1S38A 1HG3A 1NTHA 1MEHA 2CETA 4GY7A 2G3IA 4Z42C 5C6MA 3V0UA 1PTAA 1B5TA 4FNSA 1XBZA 2SFPA 4AY1A 3R7MA 4KETA 2Z25A 1D2KA 3EWUA 4IGNA 1OIFA 4GVHA 1CT5A 3P61A 1GCYA 2QJHA 3VKBA 4OT7A 5EMYA 4HHLA 4AD4A 1V02A 1J6OA 2BV9A 2WCGA 3BJSA 3LRMA 3EX6A 3ARTA 3ZXWA 2E9LA 1HNYA 3K4DA 3T44A 4PB4A 3FN9A 4DBEA 3QOKA 5EB8A 4AC1X 1W31A 2CBJA 3AWNA 1PJ9A 2ZUVA 1HT6A 4QS6A 3W2KA 4ADUA 1TV4A 5I3IA 4LW7A 5AFDA 5HPOA 1OX4A 4UOJA 4PRWA 3A21A 3LCIA 2Y5SA 3H7UA 4PCNA 1VCFA 1K4GA 1PCWA 2YCLA 2FTWA 4E4FA 2V30A 4IIHA 2H3BA 3RLVA 4XK2A 1SFJA 1EB3A 1KB3A 4NJJA 3FYOA 1VS1A 2BHYA 1TMQA 1J8VA 3HV8A 2ZCGA 4WF7A 3MMUA 4Q4KA 1X8FA 2XH4A 4HPHA 1UD4A 2WKGA 4ZE4A 2BY0A 2V2HA 2XM2A 4LVBA 4UR8A 3OVRA 1EFZA 1P7TB 1KKOA 2XU2A 3GYEA 5A8QA 1LQAA 4KGLA 1M9HA 1SR9A 2QR6A 1S5WA 2CU0A 4C1LA 1YNQA 1EQPA 1I2OA 4ZZ9A 4Z0JA 1WXZA 4GACA 2WNWA 3P0XA 4GYKA 5I06A 1H61A 5EGRA 1VPYA 2DUXA 1FA2A 1XLAA 4QBXA 3WQ4A 4DWDA 4ORIA 4WIWA 1KNWA 3W1RA 1RV8A 3TAOA 3MZNA 4LYRA 2VKZG 1W9DM 4XUYA 3CHEA 2JF6A 3ITYA 3VGFA 1AD1A 3OTRA 3VA8A 1KWGA 3N13A 1M5WA 4EXQA 3EDFA 1XIBA 4ROQA 4A35A 1DJWA 1LUCA 1LLWA 3VUPA 1BSIA 4GYFA 3DHFA 1B2YA 5L6UA 1IWPA 1MEWA 5BXPA 4R7JA 3H8AA 2EJAA 2ZZ1A 1XLMA 3TA9A 2E5DA 4BWLC 2P3EA 1T7LA 3M4HA 1WZKA 1NARA 1JG9A 1E55A 1KGUA 3OLIA 3HFTA 5KZMA 1BF2A 3PTQA 3BO9A 1HL9A 1K7FA 3WDHA 5CC6A 3WQ6A 3OQ8A 3VNLA 2Y2WA 3RG6A 2J78A 2DT1A 1EPVA 5M2FX 3W87A 4NNBA 3BLKA 1XYMA 4A8LA 4DM1A 1MO0A 1OGBA 3T40A 2FLIA 4RCXA 3U4FA 1A80A 3EOUA 1HJUA 6TAAA 3EOSA 3NZRA 2RAGA 5JBFA 2VGGA 1WKFA 5K7JA 5C71A 1XGDA 1DTUA 1J0JA 1R38A 3HA1A 2FKPA 1UH3A 1TPUA 3E0WA 1UR3M 1LDCA 3O6DA 1QO2A 3A13A 4F0RA 1VYPX 2JBMA 4YMZA 1GQJA 2O9PA 2CZ5A 1RJQA 2DIJA 4REQA 4XVEA 3G0SA 5D2WA 2FIQA 1KCXA 2OX1A 4B3ZA 4AEEA 1E0TA 4DAFA 3TSBA 4GZIA 3O8AA 1CW2A 4ZB5A 3QC0A 4WKFA 2WMGA 3ZR6A 3DEQA 3DC8A 1BWVA 3UZWA 3ICJA 2VC9A 4GVGA 1R2SA 3LMZA 2NVDA 1B0IA 1S5MA 3CUGA 3G1RA 3KHDA 5I09A 3VC5A 2UV8G 1PCKA 3W71A 3SGZA 1LG2A 1JCXA 1FWTA 1KFKA 3R8HA 2WBKA 3CO8A 3WBYA 2CLMA 1DHPA 4F3HA 1O12A 5K2ZA 4UTWC 3GHRA 3GTXA 3M0VA 1MEIA 4HNVA 5C54A 1UUQA 3OHIA 4NAEA 2X1RA 1FKXA 1L0PA 2V67A 3A4WA 1UP0A 2NT1A 3SI9A 1TPFA 1V02E 3OLEA 4W93A 3CWNA 1KV8A 1B31A 2E67A 2E1DA 3STCA 1ISXA 1EZWA 1SU5A 1L6SA 3T0DA 3W07A 3EWDA 1FWIC 3OG2A 4G2DA 3LENA 1JAKA 2AMGA 4DXKA 5FKYA 4FR6A 3TEVA 5AHMA 4QJ4B 1PWMA 3VFCA 1CLXA 1DIOA 2WBGA 3T08A 2GSHA 3KRUA 1EYWA 2V6AA 3G18A 4D6JA 2Z1SA 4XO6A 1BPLB 1LQ2A 4PL1A 2NWRA 5LZLA 3GXIA 1IGWA 3UXKA 3JVAA 4FLOA 4ZB0A 4A8NA 3VK5A 1UBSA 4WY0B 1VFLA 1WDRA 4V1YA 3GHSA 3VMOA 1ZBVA 3V1HA 1KTCA 3RMJA 4K7VA 2IKJA 2PDCA 2QEZA 4EIVA 1EDGA 1S3HA 5BNKA 4NAFA 2DSKA 1Z44A 5ECVA 1L9WA 3MKCA 3WD4A 3LI1A 2DZPA 5BXSA 2NSXA 1HZYA 3GG7A 1W6TA 1TJ2A 1V03A 3DG7A 2IQTA 5FJOA 2QCDA 1H1ZA 2O9RA 3W0KA 5DCBA 5G4EA 2V5KA 1EGMA 3GHTA 5I7GA 2OG9A 4DLMA 4PSRA 4HMNA 4GINA 4JL2A 1ZUAX 2YA0A 4Z2HA 2C71A 2DUAA 4K36A 3XIMA 2I57A 5EBAA 2VQTA 4MNLA 3VNYA 3ARXA 4H9VA 2XFYA 3ORWA 4AIOA 2YDQA 1ZZMA 3R0DA 3RJYA 1HJWA 1OF8A 3L12A 4IM4A 4NZFA 4H04A 1UWAA 3QHNA 3COTA 3I4EA 3WF1A 5JBDA 2BHUA 4XQ6A 3UG8A 1WPCA 1F3TA 3EMZA 4N6FA 1QWKA 1P0KA 2ON3A 4ERAA 3GXMA 1IF2A 5DMLA 4OV4A 3LS9A 3BZGA 1M3UA 1RBAA 1B9ZA 4HSOA 1E6ZA 1X1OA 3WLMA 1JF6A 1BLIA 4X61A 1H0IA 4DO6A 3W7IA 5CJ5A 3W6YA 3FAXA 3OBKA 2OGJA 4AEOA 1SW0A 2PDPA 1WDWA 4P61A 3UXLA 1T6MA 5D2TA 3KFTA 4DJDA 4MB4A 1OVDA 5HNTA 1H5YA 1W1IE 3AIRA 4I7UA 4JD4A 2HE5A 2YDAA 2A0NA 1Q6RA 5CZ0A 5D2XA 4HOXA 1FWFC 3BJFA 4JEJA 1T99A 3BW4A 4R3UA 1VZWA 3W7OA 3OGVA 1CENA 2QUVA 4D8LA 4EE9A 4E2BA 1NFGA 5BOOA 5CJMA 3G3DA 3AXMA 2W5FA 2ZWYA 1CXEA 3FDGA 3QZAA 2ZYFA 2A7RA 2QPSA 5JUVA 1RCOB 3H2MA 1XIGA 1WAUA 1VGAA 3WDPP 4J3VA 4ZQMA 2BXZA 2V3GA 3DFHA 3QY7A 4H7CA 4XO7A 4B5VA 3WH8A 1AQMA 4P7LA 1FWWA 3AYTA 3WF3A 3KZSA 1M68A 4B5NA 1XCWA 1QPNA 3SN1A 4ONVA 3UY7A 2GDQA 3QGAC 1V0NA 4AHQA 5C0QA 3K4WA 2EQDA 2DSWA 3GIQA 1BFNA 2XZ7A 1ZLPA 1UPMB 3G24A 4JDYA 4LSBA 3CYJA 3WFLA 5A2AA 1JUBA 1EXPA 2FTYA 1Z9AA 3CASA 2WSQA 1H09A 3E2RA 4PEKA 3CHCA 2QCHA 2I9UA 5I0DA 2GUYA 2V68A 3V35A 3EGJA 3DH7A 2G3JA 5G1YA 4LAKA 3ZQ9A 4U10A 1ISWA 3ZVHB 3GNDA 4H2CA 3RILA 4ZMGA 1H2JA 1ZBCA 5CZSA 4CCEA 4UQAA 4ZQPA 2YJQA 1R3SA 3TXZA 4DJFA 4DELA 4M8UA 4ZB2A 1JPDX 3L66A 5LIKX 5F2IA 5CKSA 4PMYA 1Q8AA 3QY8A 4K6AA 3GNRA 3QZ6A 2PDNA 3P80A 3SN4A 4CEUC 1TWZA 4JQ1A 4BFAA 3S8HA 4JCMA 3LLFA 3NR0A 4IMAA 5HXMA 3C2EA 3QH2A 1IR2A 3IEBA 3LG3A 1GVSA 2V5JA 3GB6A 1F74A 1ZJHA 4YHGA 4JTFA 1ICQA 2VEMA 2PU0A 5JVLA 2YB1A 2DPEA 4ZO6A 3NTYA 3R58A 2GZXA 3GG8A 3U7VA 3DKJA 1RPXA 4JXCA 2PP1A 4BR1A 1U5HA 4YYFA 5CLTA 1I6NA 4MJZA 3UY8A 2DU2A 3QLLA 3NEVA 1CCWB 3AYRA 4YTQA 4LU0A 1DORA 3UWQA 1J2WA 5T8GA 3MCMA 4W7UA 3JW7A 3IGXA 5MHBA 2V3FA 3WKZA 3WH5A 1VBRA 5BU6A 3G1FA 4RLIA 3B4UA 1ZL1A 2VVNA 4E4UA 2HV5A 4G56A 2JQXA 4HCDA 4J3ZA 8XIAA 1KA9F 4IXXA 4UC5A 4XAFA 2GGIA 1RK6A 1EO5A 4L6OA 1KXTA 2E9BA 1C92A 4I8YA 3TQPA 3SAZA 3JRKA 4O52A 1UOZA 2PGFA 1XWYA 1M04A 3W84A 4UTTA 1IT0A 1W3LA 1M7PA 2B7OA 1GVYA 4LANA 1LL6A 1A4LA 3THQA 4MSSA 4PTNA 1IXOA 4LX4A 2AQVA 3VIIA 2NZLA 3APYA 2W63A 1OX4B 4FIRA 2CERA 3GX9A 4WUIA 3LZ5A 5KITA 4MGGA 3VKJA 4MJ2A 4F4RA 5G5IA 2GSEA 1XD1A 2YCLB 4GIAA 3B0VC 2L5HA 1YKWA 5AC7A 3LU2A 5E09A 4B16A 4GNJA 3R94A 1LZOA 3QKEA 4B5SA 5JH2A 1CB7B 2Y7GA 2NUXA 3C56A 4LGXA 4LV9A 2ISVA 4F9JA 2Y70A 3HG5A 1R2TA 2NUYA 3IIXA 2HROA 3MMDA 1P0BA 5AHLA 5FEXA 2HCVA 5I3JA 1MXDA 4P7NA 5DRCA 2ZDRA 4A3RA 4JBRA 1AMYA 2O9TA 4E2VA 5EMUA 4A29A 1NFBA 5TNVA 1PKYA 1JZ6A 4PH6A 4ERIA 5I24A 1EJWC 4UUIA 1US2A 5BZAA 2Y7EA 1E9LA 4RV3A 1E15A 3GVWA 3ANUA 2QJJA 5AN7A 2XFWA 3IJ9A 3USBA 1A5BA 5BCAA 4J28A 3AICA 3CL6A 1DPMA 1A4MA 3I10A 3LV5A 3DERA 3PZOA 4DQWA 2Y5JA 1B4EA 4K68A 1XQKA 1D9EA 3G1DA 3NL2A 1IZJA 4JTRA 2NVAA 4AZ5A 1VBUA 3RLHA 3EBVA 5D37A 4LXFA 3QEZA 1R3TA 2PDQA 2XVKA 4EP8C 4NVTA 2XG9A 3B8SA 5HMDA 1A5OC 4S3GA 5A6LA 3I6TA 2FZDA 5FESA 4O1CA 2E3ZA 3OYXA 3NCOA 4ZQCA 4C65A 3CIWA 2JGYA 1S2WA 4S2CA 1OT1A 3VZZA 5A8MA 2EBNA 2BGNE 3FSUA 1E6QM 4M80A 3TLLA 3NQMA 3ES8A 1Y5VA 2CZFA 2Q8LA 2MANA 1O1ZA 4NJIA 2V3DA 3P0WA 4CQCA 3BLLA 2VUYA 2B31A 1PZ2A 1Q4NX 3CZLA 3C5QA 1AZ1A 4M6PA 3W73A 1Q6OA 5E0FA 5CZJA 2E0PA 1E5JA 4O53A 1QI0A 2ZX9A 2EPMX 3AMLA 1J5TA 3AS0A 5FOOA 4JR5A 1H1YA 5CPTA 2NQ5A 3MI6A 4NJKA 2NUWA 4EPKA 1DJHA 1I75A 2WC4A 4IMCA 4QSFA 3UERA 3OZYA 5LNUA 2XSAA 5A6JA 2PB1A 1KC7A 1XI3A 3VGEA 4D6CA 2VGIA 5DQPA 3PB2A 1V0LA 3STGA 3F03K 6ALDA 3S6DA 2O7QA 3IAPA 2FZ8A 3QKZA 3LCWA 2Q02A 2B7QA 4Y9MA 3U5YA 4PMOA 3GDBA 4HVXA 1OC5A 1W2VA 2W66A 3W7KA 5TF0A 3QVQA 2UY2A 4B2DA 3NZ1A 1VFSA 4IT1A 1FHUA 1XBYA 4KCTA 2X1SA 2BHZA 3GH7A 3V3WA 3AOFA 3N4EA 1X7IA 5I77A 4CD8A 3QQWA 2YDSA 5KSWA 3B9DA 4TU1A 1UMLA 2XISA 3NQ2A 4NAEB 4MY9A 2Y4SA 3MV01 1I60A 4X2PA 4E2OA 3AQUA 1KGXA 4C6BA 1B90A 3CMFA 1C8QA 2OT0A 3LX9A 1M53A 4KWWA 3WK2A 3P67A 1ZALA 1V3JA 2QIWA 3AYVA 4HD5A 4U2ZA 3BCDA 4HJWA 5CZKA 3QLDA 1S2AA 2YR1A 3T0BA 2ISWA 4S23A 2Z1WA 4L4LA 4GXMA 3H2NA 2VC6A 2QAPA 1J10A 5BMWA 3SCNA 4ORMA 4ATLA 3N2MA 5CC7A 8CGTA 4M56A 1MI3A 3BLOA 3IJ7A 1U2YA 1UBPC 4C60A 2QUNA 3NUKA 3VOJA 2CLEA 1HL2A 3H54A 2BY1A 1E9ZB 2OB3A 3IK2A 3PZQA 3ZLHA 2ZX8A 3I7SA 5J5DA 4B90A 3WMLA 4CNUA 2REQA 4KWOA 4J27A 1I2PA 4S3DA 2I14A 4FI4A 4IXHA 3URBA 4K8GA 3KUMA 3MB9A 1BYCA 3KP1A 4O8AA 4NAFB 3HZ3A 1I1XA 2J7BA 3RHGA 3WLPA 1HGWA 1ME7A 1V08A 1GG0A 4HN8A 2BDQA 5DMNA 3KVMA 1TIWA 3EOEA 2QCDB 4M6VA 3ANVA 3O15A 2HK1A 4AHOA 4O10A 1VFMA 1RZMA 2HNHA 2XYLA 1JQVA 4Y7EA 3BGGA 1W5MA 1YXYA 3IIZA 1PDZA 3S5OA 3II1A 2WHLA 1PL9A 3SBFA 4JYDA 3IACA 1EA9C 4AVNA 1WXJA 4MDPA 4DX3A 1NY1A 2RDUA 4JZ5A 2OODA 2ZE0A 3GTFA 5B80A 3HG2A 1KGWA 1ZENA 1KRBC 4GQQA 2J7HA 2YB4A 5LNSA 2PWEA 5K3VA 3HPAA 3QXBA 3N11A 4FXSA 3GQYA 1R0MA 2F38A 1PPIA 5BRQA 4GZJA 1GT8A 1UIPA 1GOXA 5CGQA 4F40A 3BGAA 2WW5A 3P60A 1UIOA 4ZQRA 2V9DA 6XIAA 1OADA 3CZJA 1F76A 2NWSA 3FNDA 1JZ7A 4GQBA 4HN4A 1RD6A 2Z24A 2D3LA 3G3MA 4AU0A 4UZSA 4GNVA 1OGSA 2A3AA 1K70A 2ZUTA 2WVVB 3GDMA 3VKDA 4Z17A 1TA3A 3DG3A 1XH0A 5CEWA 4CN6A 2VRKA 1BAGA 2VM8A 1VB9A 1CZ1A 7ENLA 4R5EA 3EX2A 4KEUA 4GH1A 3CGTA 3BC9A 2OYLA 4CVWA 4B3KA 3GDTA 3AHZA 4OVXA 1G01A 4LH8A 2FH8A 4G5DA 1N2VA 4JCLA 3IVTA 1EOMA 1WZAA 4NZ1A 1E72M 3FDKA 1DXIA 3WLRA 1NOUA 3TK7A 2OKTA 1CGTA 1EUNA 4GUGA 1WBHA 3SCOA 2W3ZA 3CJPA 4OUEA 3W86A 4DWSA 4PUWA 4WXZA 3MUCA 4A05A 6PTDA 1JCMP 4NZ3A 5FF3A 1UYQA 4C7FA 1OK4A 2YZRA 1AA1B 3I4KA 1S39A 4DNHA 1QOXA 3BAXA 3R8GA 1OC6A 4HYVA 1R46A 3BURA 3CZ8A 2E8YA 1CNVA 4HGXA 2GWGA 3OW1A 3PWIA 1K8ZA 1HO1A 4BQ2A 3EMQA 2DH2A 5M17A 2FZNA 1FH9A 3URQA 1EP1A 3CQJA 4P8VA 4PUDA 4K7YA 1U1HA 3H22A 4D72A 3DBPA 1XXXA 1UZ1A 1MFVA 1FH8A 2WHKA 3FVDA 3I3EA 3ITCA 4Y6GA 1J9YA 3VZYA 5KETA 2C0HA 3GXDA 3HGRA 2OSXA 1YW1A 3QR3A 1HP5A 3BVJA 2JE8A 3ITGA 1OFBA 4MLRA 3KS5A 4PZVA 3NZQA 4RJEA 1UR2A 4TX8A 3ZWTA 4A8IA 1WKEA 2VX7A 3QRHA 1CI1A 2B7PA 2XVLA 1JI2A 5DANA 4P7OA 2EG8A 3IUIA 1FP9A 2XTKA 1TSIA 2CCRA 1BWLA 2D3NA 2PODA 2J4GA 2KAUC 4TTUA 1MDRA 3HO8A 4PMDA 3GAYA 1XCFA 2I17A 4YWIA 2X1IA 3A3XA 4R88A 3IS4A 4Y90A 4MB1A 1YRRA 4PFHA 1WV2A 1NOFA 1OABA 3PJXA 4LVFA 4GA8A 3SY8A 4Q8PA 3GIYA 4IX0A 4KRUA 2JIWA 1MYRA 2YL6A 5AYIA 5HMFA 5T9CE 1RUSA 5CAKA 1CXLA 3L4UA 3ALFA 3PWGA 3EXTA 1DWHM 3B9EA 1EUAA 3B0YA 1I2QA 4ZFCA 4H6QA 3T0CA 8A3HA 3GR7A 2BOGX 2OOFA 3ZR5A 1SM9A 3UWZA 4MPKA 2BWGA 1JYNA 3IWPA 2RH9A 4LUIA 3N1AA 4O50A 1PKNA 3UW6A 1TX0A 4E38A 2UZ9A 1MQPA 4O0QA 5HULA 1JIBA 3DU0A 1BVZA 2WCSA 3B05A 5G4WA 1UR0A 5FSDC 2GQ9A 4D1IA 1ODUA 3SUUA 2FHCA 3MQTA 1AZ2A 4NILA 4DJEC 3QYQA 5IFTA 4O1AA 3LSCA 2Z7GA 3MBDA 2R6OA 3TCSA 3OGRA 3GFYA 4HMDA 4UOQA 4GGBA 4JNYA 3TR2A 5CZTA 1AK5A 2HTMA 3W26A 3MP5A 2ZE3A 4GQ0A 3LV6A 4LALA 3VIFA 1EKOA 1LWIA 3W1PA 1MW2A 3M44A 5D30A 1IXPA 1V6YA 3AIUA 1T40A 2QCMA 3ARSA 3LN3A 1W56A 4GQGA 3VOGA 5A6BA 2VX4A 1W1ZA 2WJEA 4TMBA 1KD0A 4XAGA 4Y9NA 3HU7A 4OWGA 4FSAA 1TV8A 3QGVA 3CTTA 1JDDA 4KWSA 3VE9A 2NX9A 4AF0A 2IUZA 1FWDC 4NL1A 1FCVA 3LSBA 3C52A 2PWDA 4CD5A 3E5BA 3MKVA 1TRIA 3UQNA 3AS2A 5D4YA 3UR2A 1Q4WA 3ABSA 3EEZA 3WQWA 5LNRA 2J7GA 3PSVA 3TYAA 3N9SA 4A6GA 1UKTA 2Z6IA 4NYUA 1UWQA 4HA0A 4FLSA 4MWAA 5HJLA 1BTMA 3K46A 2J9XA 2WPGA 1ZJBA 3H21A 3OEXA 2XFFA 1F9CA 3RM4A 1UD3A 2C16A 4HPGA 2VURA 5CPSA 3EX1A 4H6KA 3VCCA 1KM4A 2FVLA 3WLNA 3WUBA 1UH4A 3OG3A 1SGJA 2R14A 2WPBA 1TO3A 3NL6A 3UNDA 3ARQA 3STPA 4HOWA 1XRVA 4P8UA 4B9ZA 5A6KA 1RJRA 1V4YA 4ROPA 4CQAA 1R86A 3EPNA 3VGBA 1JDFA 1EIXA 1TJ1A 2IPJA 4UNLA 3UZXA 1E1CB 4EK7A 5HJXA 2OXNA 3KEHA 1HUVA 2QT3A 3ALGA 1O5XA 5IOBA 1FRBA 1R3YA 5FF0A 1I8JA 3SRDA 4K38A 4YLWA 2Z2AA 3VD4A 3HMJG 1Q7QA 3C3NA 3AS3A 2J75A 1H7NA 3MCOA 3UP8A 3E02A 4Q8VA 3ARPA 3IIOA 2X0YA 3GW3A 3S1GA 5B7YA 3SCSA 2ACRA 1XYZA 3UJEA 3F1QA 2VGBA 1XICA 3AO0A 4OECA 5A8GA 1ICSA 2PTZA 3THDA 1I4NA 1DBTA 3N29A 1PXGA 1WKDA 1XIFA 4GH3A 2E6AA 1ZCCA 4LF2A 4V15A 3D3AA 1TTPA 1YHTA 2NSOA 5BWFA 2GQ3A 2WJFA 3AIWA 1BXNA 4LUYA 3GXTA 4GCAA 4C5ZA 2WMFA 2X16A 1Q85A 4M82A 2ZVIA 5AVHA 2EPOA 2OZ0A 2GGEA 4HB7A 1Z89A 2PDKA 3PWAA 1XLBA 2A3BA 2E25A 1UMYA 4JTTA 3NZPA 3NO5A 2C14A 2VFGA 1IWAA 1I2RA 1U30A 2OVLA 3UESA 1XRFA 4ZVJA 3H7RA 5T26A 1BQCA 3PTMA 3K5XA 4A4AA 1QW7A 4XSMA 3H2CA 3DBNA 2D2HA 3O0FA 5I00A 1PVNA 3MDWA 2VZTA 4J35A 3S1XA 1FDJA 3KRBA 1JPMA 3EZ4A 4MKVA 3TNBA 1LROA 1JZ4A 4BEQA 5K9CA 1I1WA 1JXJA 5AY7A 3OA5A 1DWIM 4WR3A 1UD6A 3NGJA 1FCUA 2J62A 5KMYA 5XINA 2GVYA 3KBNA 3AZTA 1GQIA 3DFPA 3LK6A 3AU2A 2Z1KA 1RCQA 2ZUNA 1O7AA 2OKOA 4J9JA 4GY1A 2INZA 4GOAA 4TTGA 4GI9A 2EPKX 5BXTA 2NT0A 1KTNA 1Z32X 2CZDA 3S2LA 4F9DA 1L6WA 1RCXB 3M5VA 1KW1A 4S3BA 5BROA 1A5SA 4DJED 5IDZA 3KOWA 2G95A 2H3DA 1V7YA 3KBJA 4NRSA 4PSPA 3IGHX 3UPMA 4CD6A 1ZAHA 1H63A 3W83A 3E9AA 3KVLA 4LFYA 4H2HA 4W7WA 3V0TA 4NKCA 2GJLA 4N6EA 2AGKA 1MZHA 3FHQA 3T2PA 4X22A 4MWAE 3ITXA 3AHYA 2BX7A 2XN0A 3HURA 3TMLA 3OODA 3W25A 4GYJA 4I7WA 3LTSA 2AQOA 1TA3B 4B91A 3LA4A 4HHMA 4ZXLA 1X39A 3CUXA 1EF2A 4ICCX 4BI6A 2YKKA 1JYVA 1W3HA 2DP3A 1UWIA 3HQOA 1E0WA 2G8ZA 1C93A 3B3DA 9RUBA 2DY3A 2WMKA 2PTWA 1RP9A 1DJNA 2IPWA 2QCGA 1AQFA 1IQ8A 2ZADA 1GJUA 1RLCL 3TNOA 3TWAA 1X97A 5E6ZA 3LHZA 3LPPA 3UXIA 3MPGA 2XVPA 2XH7A 3R12A 4JY9A 1A50A 3H2AA 4GKTA 4HA1A 3GU2A 4Z2GA 5CLWA 3WFZA 4UTIA 2F84A 3OO2A 4DWSB 1KCKA 4QQ3A 3S5NA 3BV7A 4Z0SA 2R1MA 1SW3A 3OBEA 3B4YA 4NXKA 5F1UA 4UCGA 1T8QA 3CPRA 3H24A 3UR8A 4IG2A 2I56A 3G77A 4KESA 1YXDA 2OJPA 3LXCA 4LCQA 3O6YX 1A5UA 3SCUA 3OP2A 2I7GA 3NIYA 3BAIA 4QG6A 4L65A 4QIUA 3VNMA 4DB7A 2GGJA 5CSSA 4JQAA 3GC5A 4DUWA 1KKRA 5TBOA 3VABA 3L4VA 1JDEA 4KERA 3CWHA 4HPJA 1ZB5A 4IL0A 1C8VA 4Q6JA 4FS9A 5BRBA 4RPQA 1KXVA 1N82A 4CNSA 3GDLA 3I68A 5DY2A 4MFEA 4H9MA 7REQB 3VIMA 3GE7A 4LUSB 5AKQA 2AGTA 5D2YA 4CNPA 2PI6A 2YL5A 3TW7A 2FPYA 3FKKA 1ZHAA 4HA3A 4K37A 3CXOA 3LCHA 2NQHA 4F0SA 1ITXA 2ZQ0A 1TJ0A 4GZEA 4N4PA 1OG6A 3V5FA 1R6WA 1SJBA 5TQLA 2X40A 2PE4A 1ML1A 2Z1VA 1MXSA 3OQEA 1W5NA 4UTKA 3KCJA 2R94A 2C91A 1KM0A 4R7OA 4WJXA 4N7QA 4JQ2A 2BVDA 2WYSA 5DFAA 1N8IA 4Y8FA 3NM1A 4CQ8A 1REQA 4UR7A 3EB3A 1ZBWA 2A85A 3L0NA 2DZUA 5AYBA 4F48A 3MI3A 2F9RA 3IGSA 3N9KA 2NX1A 3FXYA 3SECA 3LRKA 1W1B1 3SM0A 3EA1A 4E3VA 1X6LA 3D47A 3KBWA 4GGHA 2PLMA 3WF4A 1LBMA 3OBAA 5D2VA 2D0GA 4JYEA 1G5AA 3U3HA 1EC8A 2WM0A 1W1VA 1KRCC 1WA3A 2WNQA 4CNTA 3KVJA 4H8HA 4K39A 3T42A 3A3WA 3IV8A 2X30A 4JN8A 5AOUA 1VHNA 3TJ4A 5JIPA 9CGTA 3T55A 1GWJA 4J3TA 1MFUA 2J8GA 1S46A 4QNEA 1J79A 3N17A 4UNIA 3VILA 3SZ8A 2ZZ2A 2OWXA 1H41A 1DJZA 2ZZ3A 3TR9A 1TIMA 3EOLA 2Y0FA 4Q4MA 3UVIA 4UQCA 3GTHA 1AJ2A 4KPLA 2YBUA 4A3YA 3CMJA 5IDIA 1F4HA 4LYPA 4HP5A 2YCEA 4NZ4A 3M0JA 4QDWA 1QK0A 2DQWA 4WCJA 2QJIA 1R9ZA 3EB2A 2FGLA 1ICPA 2OO0A 1K1DA 2G0WA 3AS1A 1I9CB 3BAWA 3L9CA 3A9BA 4N42A 1MSSA 1ZAJA 3CQ0A 3OZMA 3GC4A 1F7BA 4JKLA 4WZHA 4GZ7A 3BSHA 3AI0A 2BFGA 3N6QA 1QHPA 4U4MA 4C7GA 1SSGA 4WDXA 2DEPA 1S1RA 2HPIA 1DJGA 3IJ6A 4KRTA 4EF9A 2Y7DA 1ENUA 2CLIA 3KDOA 3WF2A 3DUGA 3W7NA 5DXYA 4KRZA 4IFKA 3NO1A 2XH2A 4MTVA 3DYPA 4D6EA 2E40A 1HJSA 2I5GA 1TJRA 1AVAA 2J13A 3MANA 1G4EA 1KM5A 4WDUA 3R8RA 3KRSA 5REQB 3IARA 4D6DA 4X60A 4AF0B 1C7SA 3W7QA 1AD4A 4IUGA 4ZTXA 2OQLA 3N25A 4CCZA 3GAKA 1JAEA 4DI9A 4YJ5A 1DVJA 1MW3A 3WH6A 1EC9A 2PGEA 1X6NA 5H8UA 3N3TA 2X0HA 1VJSA 3V1PA 4GQRA 4C5YA 4QCEA 2PDLA 4QITA 1SZGA 4A22A 4H9XA 1V3KA 4Q33A 4PUUA 4PRRA 4F0HA 2B4GA 1HQTA 1SMAA 2FH6A 1GOKA 2CNCA 5GPRA 3ZO9A 4MWAB 2J7FA 1V0KA 4IFRA 3AHXA 3DHDA 4LOCA 4JTCA 4P2VA 3QZEA 1DL3A 2PCQA 1VKFA 1GJPA 4HKPA 3RPTA 1DHKA 1DQUA 3WLIA 4QNWA 3SCQA 2HVNA 4H9YA 3CB8A 3PB0A 3CL7A 5H1WA 2PDGA 3BANA 1JD7A 1FHVA 3Q37A 2VR4A 3DGBA 1MQRA 3RITA 3S1UA 2W67A 1DJXA 3NQDA 4LVDA 2IXVA 4PC8A 2WM1A 5E70A 2FZBA 4IIGA 2GLKA 4WVXA 3PPFA 1H0GA 4ZOAA 5H8MA 1M7XA 3R1ZA 3CS2A 3ZJ8A 4JNZA 1Q6CA 4US5A 3M0KA 3N4AA 1TV5A 2NVCA 2CFFA 4WEVX 4QG8A 4I6VA 2X1UA 2ZXAA 4I5XA 2YPIA 4C6NA 2D20A 3HPXA 1VH7A 3DFYA 5F2LA 1QPKA 1J0HA 3L0KA 1EP3A 1E6RA 1L8PA 2PAJA 4CLMA 4WJEA 1RLDA 4XTIA 5E1QA 3XINA 4NZ5A 1VIWA 1M65A 3PSWA 4WHBA 3STEA 2ISFA 3HOJA 1CGVA 4MNMA 4WXYA 3GXFA 3KW3A 5DMMA 3UJ2A 4ACZB 1J11A 2GK1A 2P50A 1F3XA 2AL2A 4IMEA 3L4ZA 1ZY9A 1F07A 5CBBA 3GXNA 1XBVA 3FJLA 3GK0A 2F2KA 3URAA 2C7FA 1WUEA 3E2SA 4OQVA 1TPEA 3WDRA 3RNDA 4D2JA 3IUDA 4H8UA 4FO4A 2VDGA 3QPZA 1GVRA 1Y5WA 2PRLA 3VKAA 4AIEA 1J18A 1JEZA 3VNKA 2R1NA 2QUTA 5LXEA 3K8KA 2MNRA 4ZOBA 2VD9A 1GYMA 3N3MA 4NNCA 1UW9A 1BXBA 2Y6ZA 2CLOA 1GW1A 4FXFA 1K77A 1M6JA 4BF5A 3B97A 1ADSA 4PMXA 4RDYA 1WDDA 4RE2A 3E0IA 4OOZA 4LUJA 4GJ1A 3A12A 4MNJA 1W91A 3S3GA 1A5MC 4O18A 3GNXA 3NO3A 3IJQA 2QMKA 4KWUA 2OZTA 1SFTA 5KEZA 1P43A 3PUOA 3G2GA 2V81A 3QSTA 4X0NA 3W1AA 1HIZA 4UR9A 4M0XA 5CAHA 3B0PA 1JVNA 4FMVA 3KBSA 4PL2A 3HGSA 6ENLA 2WSRA 1L8NA 3GKAA 4CN1A 1EEXA 4DXXA 4QAIA 1R7OA 4ZCWA 1HJXA 1HFBA 4U5IA 2ZUWA 3NQBA 1Z7AA 3JU2A 1B3OA 1TVLA 3C2OA 4IGHA 2BTMA 3V7PA 3PP7A 3WUGA 2IQDA 3MZ2A 2R1PA 1LRNA 5JIWA 4W89A 4YVXA 2P76A 1E0XA 2VEGA 3ABOA 4FK9A 3C0JA 2E7FA 3TYCA 4LAUA 1H7RA 1YQ2A 3EPOA 5GJPA 2P88A 3BG5A 3VM7A 1QNPA 5IFPA 3MS8A 4V33A 1UWRA 2ZA3A 4N4QA 4GY0A 5G1TA 3SSJA 1RVGA 1JZ8A 3ID7A 4DBWA 4JTSA 3W7GA 2A3CA 2BVWA 3SQSA 2YCJA 1MQQA 4V27A 3KWSA 5JQ9A 3CEPA 2BY3A 2VR5A 5FI8A 2D2JA 4D8AA 2PP0A 3Q2DA 2VJXA 3QMTA 1SJCA 5A5WA 1JZ5A 3B8UA 4S3AA 2BMBA 3LDVA 1PKLA 1E43A 4NRRA 3GO2A 2HEJA 4S1FA 1BQGA 1RK5A 2F61A 1XFBA 3I3BA 1RVKA 4ENLA 5A95A 4QGCA 4GXWA 4PBEA 3VKKA 4YL2A 3W76A 3QSRA 3RCMA 3G5EA 4JEQA 1OFAA 3NVDA 2WNNA 5CBJA 3UVAA 4WGXA 4X9SA 3TQKA 3TC7A 2YDRA 2RGMA 2XSBA 4MUPA 3K1GA 4UFMA 4LF1A 1KFLA 4N02A 4GKLA 1QFEA 1B4KA 1SUXA 4XAZA 3USZA 1UWSA 1VFTA 3EWCA 3LYEA 3ARWA 1W0MA 2VFIA 2BZNA 2ZRVA 3KZPA 3N2BA 3IRSA 4AY8A 3NQCA 4HQVA 3M7SA 1ISYA 4GVIA 1IHIA 1VFFA 4NASA 4NF7A 4GYPA 1ZCOA 2IPGA 4PMVA 2GVJA 1JZ3A 4PMJA 4W9TA 4XV0A 4Z1BA 1TV3A 1SFSA 3CB3A 3F4CA 2PWUA 4FLQA 5E0CA 2FDMA 1XH2A 2Q8ZA 3GUGA 3WJZA 3WLKX 3BXWA 1IEWA 4HSHA 4J2PA 3BV4A 1H7PA 4XD5A 3KL0A 4LBSA 4NX5A 1YEYA 5A8NA 1N8WA 3NDOA 5C9WA 2PSNA 1XG4A 2XHYA 1E70M 4LT9A 3HIJA 3WH7A 5HWJA 3HF3A 3LHYA 1GPFA 4F2BA 3P5ZA 3KLKA 3Q45A 3MVTA 4AB4A 1EJTC 1G7UA 4W5UA 5HQMA 3AJXA 1JRCA 3RRXA 1VFUA 3BJTA 1P0NA 2YLLA 3CIXA 4QISA 3MI2A 4YVPA 3LNPA 2XGZA 3FGCB 3M0IA 5AC4A 1EGVA 1E4LA 4LYKA 1ZRQA 3AHVA 2YIHA 2Z7KA 3B03A 3MSGA 1C90A 4RDWA 2PLCA 3CYVA 1ZGDA 2DZXA 3LLXA 4UTHA 1OD8A 1NF0A 3P74A 2YXOA 1YMYA 4J3WA 1XISA 2DT3A 4K3ZA 3PHAA 1PBGA 1ADOA 3N4FA 1Q7ZA 4F2TA 3GFZA 4LY8A 1VYSX 4Z2KA 2J6VA 1SO4A 3BSGA 4AG0A 4U28A 1B3XA 3LCFA 4YCOA 4FNTA 1A0CA 4RW5A 4XD4A 1P1MA 1WX0A 4IPPA 2PGRA 5C9UA 4KEZA 3MBFA 7A3HA 3C2VA 4MG4A 4GMEA 3S5YA 1QMLA 3QV7A 3ZIZA 4Q4OA 2P0IA 2CHRA 3BLIA 1PE1A 1UR9A 3NPUA 2GGHA 3N73A 1L2UA 4A2RA 2O55A 3QHMA 5I3KA 3RAOA 1UD2A 3RCNA 2HJPA 1SMDA 3GR8A 2YFOA 3UJSA 1PWLA 2PLKA 4FOJA 4RPPA 3ZVHA 3WQCA 3UA3A 4LQ1A 3SN0A 4Q22A 4M5PA 5XIMA 2ZIDA 4IQLA 1ME9A 4CD7A 4XBSA 2X7VA 3MYPA 4B92A 2XN1A 2D2OA 1U1UA 1A49A 4F2UA 4UMBA 1MZRA 3L5LA 1UJPA 1V6UA 3H4GA 1GEHA 4A2SA 3N34A 1OFQA 3S2MA 1TV7A 3BMWA 3LGGA 2J9YA 4QR6A 4TV6A 4LWWA 1DWFM 3PBVA 3TYBA 3WNKA 1DQWA 2Y5EA 1KM6A 3TC6A 4YHEA 1I45A 1U22A 3NL5A 1X6UA 4RZ6A 5EBUA 3VMNA 4PE8A 2FFIA 3UWEA 3MUXA 1JFHA 2W9MA 4MZ1A 4HU0A 2VTFA 2NV1A 4UQEA 3AIVA 5T9BG 4AY7A 4BCEA 3WD1A 5F4SA 4MADA 4IFKB 3LTPA 2VQUA 2CKSA 5E5CA 1XHGA 4LTSA 1AL8A 5RUBA 3W22A 2VFFA 1JQXA 2ZZ7A 4KKXA 1XS2A 3C6CA 3A24A 1XLKA 4PMNA 3C86A 2AKMA 4LUTA 4ZR8A 1BEUA 5CPLA 3OJGA 4UFKA 3LCGA 5HK4A 1B57A 1E3ZA 2QF7A 2PS2A 2VFDA 1O5QA 4LC8A 3GTNA 3SCRA 2OYKA 2W92A 3POHA 3U6WA 2C1GA 3KL3A 3V5CA 4TXEA 3W4RA 4D1JA 3DN5A 1QR7A 2X8RA 2HPMA 5FEPA 5JMUA 4L5ZA 4J2MA 2QCNA 5GJNA 4YPJA 1UHVA 5DCDA 2NQLA 3GKFA 3EDDA 3SUVA 2ZXQA 5IHRA 4NYYA 2C15A 1E5NA 3WLTA 1AMKA 2WQPA 3MKKA 3FW6A 4CUCA 3QPYA 4TVUA 2A3LA 2E28A 2WCAA 3FY1A 1Z8AA 3EEGA 1QNQA 3ECQA 3P8JA 2PCEA 4XKYB 2J47A 3W72A 1CYGA 2DSZA 3LBMA 5MKGA 3AAMA 1XRTA 4LBUA 2C18A 1ZP4A 1KRAC 2J9ZA 1KBJA 1XH1A 3W7MA 4Q7NA 2H9AB 3WL1A 1LT8A 4HNCA 3DYMA 5LNVA 4XUGA 4IICA 3WQFA 1XQLA 4PCTA 1U5JA 3EWBX 1KXHA 5C7VA 1XKYA 3AWOA 2RHGA 3FJ4A 3M0HA 3N2XA 1XINA 5DBTA 3E12A 1KR1A 5J8LA 3U7BA 5IBXC 1K8XA 4UTTC 3NURA 1WOAA 4W7VA 2P1FA 3VE7A 4R34A 4QJ1A 3NXLA 1UQZA 2INEA 4X63A 2A3EA 5HJYA 1EC7A 4PBFA 4RNFA 4DUOA 2QV5A 4DAIA 3U57A 3J7HA 3OIXA 1UASA 2GK1B 4JFTA 2AL2B 3MWAA 1A53A 1OYCA 1H1NA 4K8HA 3QYSA 4JTUA 1GZ1A 4I5UA 3FK4A 1UROA 4QDPA 4R7WA 2A6LA 3G8EA 4KIRA 1CGUA 1J5SA 3UF9A 2FB2A 5A1AA 1LM1A 2XIIA 4L56A 3K4AA 4E8GA 2Q01A 3SCTA 2E68A 2FHBA 3L5MA 3CBWA 1W8GA 5LKYA 4HIBA 4PTXA 1KBKA 1SJAA 3E96A 3OHMB 5DEZA 3UWYA 3W2UA 4DO5A 2H6RA 1CGWA 1GOQA 1AUSL 4NJHA 2VI0A 3WEOA 4DUVA 3MW7A 4PODA 4UFHA 4RDVA 4OJYA 4MUZA 4Q8OA 3T09A 4LCSA 3UGVA 4XD6A 3CH9A 3WNMA 1PIGA 3NPWA 1Q2RA 1DE5A 5HOSA 4JKKA 4M19A 3K2GA 3UD6A 3F5LA 3U2ZA 2E6FA 1CLKA 3NZGA 4HU8A 4TMCA 4XWUA 1KFJA 3LUTA 4XISA 4BA0A 3BGJA 3EXRA 4XKMA 4GG9A 3VNIA 4ASTA 1BTCA 3WELA 1FTXA 3ATYA 3R43A 2DVTA 1LLOA 2XVNA 1B3VA 1QI5A 1P0EA 4GVFA 5AHIA 3NQ6A 1YTDA 4AD5A 1Q13A 3SRHA 1OCJA 3PUEA 2XIBA 5HR7A 3PPHA 3RXZA 4DLFA 4DJDD 5G2WA 5PTDA 3KCOA 4UTFA 3M1ZA 3W00A 1YTKA 1B3WA 4JTJA 3UU0A 4C6MA 4L64A 2GVGA 3UA4A 2V69A 2WO5A 3QFEA 2PDFA 1XC6A 4Z2IA 5CGMA 1XYFA 2QMJA 1DJQA 3GH5A 1OD0A 3PNUA 1G69A 2PZ0A 3IVSA 2VC7A 3QPEA 2CXEA 2OEKA 3WJWA 3VCNA 3THAA 3E2QA 1JUKA 4WQ6A 4DYEA 3O07A 3QN3A 4CQBA 5HATA 1AH4A 5CPNA 1OK6A 4JYFA 3POCA 3W1QA 1GQNA 2HSAA 4AD0A 1ECQA 3KE0A 3O63A 5AB3A 1ADDA 4P5UA 3I6RA 1H11A 3E0LA 2Y88A 1GYLA 3BAJA 2IKHA 4ZQNA 2WZMA 2FB3A 4AHPA 3TIMA 2R91A 5EKYA 3WK0A 3ARZA 1LG1A 2O56A 4HZ8A 6CGTA 5GQBA 3GBDA 4WLCA 3SW6A 5C7HA 1R9XA 3KAOA 3VOFA 4D6HA 2Z26A 2ZC1A 2E1WA 1D3HA 2YBTA 3PAOA 4ML9A 1EXBA 1W9BM 4FNUA 1US0A 3JUGA 2NX3A 2J25A 3BMVA 4M6QA 4YWSA 3SRKA 3FJ6A 5AC5A 4DJFD 5TD4A 1KWKA 4IL2A 1AJ0A 2PTDA 1S5VA 3PULA 4GD0A 3LPOA 2Y1HA 1A47A 3KP0A 2BP1A 2ZA1A 1Z48A 1FVPA 5CBIA 3PZNA 1XIHA 3UYCA 4MNKA 3OGSA 2EKCA 4S3KA 1KLYA 3N6HA 1H4PA 5DLCA 4CN4A 5C8BB 4Q8TA 2ZRYA 4CD4A 5K9DA 2ABBA 2GL5A 1Q6QA 3ZLFA 4B4HA 7XIMA 1S1PA 2Q8XA 5I3FA 1DWJM 3B0UX 3LD5A 1MVYA 3A5FA 1YYAA 4ZQOA 3DGRA 3IV3A 1EX5A 4L9YA 4ADTA 3TTSA 2PBOA 3M5XA 3WJYA 4DZAA 2HQAA 1EZ2A 1JULA 3BOLA 1XLIA 3GD6A 5AYXA 3SUTA 1XIDA 3AUJA 4F0LA 1G4SA 2WKJA 2DZAA 3H2FA 4PEEA 1DEDA 2AMXA 2OMAA 3GU9A 2JEQA 3WIJA 1PZ0A 3SIZA 3KBVA 3MUAA 5FJUA 4GLEA 5G2IA 3C0LA 4PMUA 5I6SA 3P82A 2FYMA 4R85A 3PZTA 2GJXA 1V6XA 1BGGA 3WYZA 3LCXA 2G50A 2W4XA 1G9HA 1NDZA 4JTAA 2W62A 1ZJIA 4MY1A 1CXKA 1XDJA 1LYXA 3BARA 4G1NA 4C6LA 3U48A 5I07A 4B5TA 1V0MA 3FEQA 5DT7A 4EWJA 1OEPA 2WVVA 1F8MA 2GPTA 1TPB1 3THUA 4YTTA 4H9UA 2PPGA 4EKJA 3VX1A 1FX6A 4GIRA 3JZEA 1XGZA 1TTIA 4FNQA 4Y8EA 1KR0A 3ZT7A 2ZTKA 2J74A 3G8RA 3VX0A 4NI8A 3PBGA 4LRSA 3B8VA 3NQGA 3TSMA 4ZSTA 3RCYA 4O15A 2YX0A 1F73A 2J79A 4W8LA 3Q65A 2DJLA 2C0AA 5HQLA 4PUJA 1AG1O 3MMTA 4IJRA 1F2JA 4U3AA 3CPGA 2Q71A 2YA1A 1W9VA 2H90A 1QHZA 1S5TA 5DCEA 1F5ZA 5CH9A 3GZ3A 1SFLA 4X9YA 2J7CA 1A3WA 2A6NA 3HPFA 2VD8A 3Q94A 4JX5A 3WSUA 1VENA 5BMXA 2A4AA 4RW3A 2PDMA 4TR9A 4HZ7A 2PMQA 3MTWA 3E38A 5CSUA 4PB5A 1YLVA 4R33A 3RO8A 5CC5A 3BOFA 4GUFA 4JOMA 1CGXA 4LJ3A 5AYYA 4BI5A 2ONEA 3W7EA 4G6CA 3DENA 1NOWA 3GDRA 3O2LA 1DJYA 1K4HA 1NFPA 2VZUA 7ODCA 1TJPA 3GDKA 1UZ4A 1WXYA 4O1DA 3QJAA 3A9IA 3APGA 4HT3A 2X09A 4GX9A 4NY2A 2QUUA 4JFSA 3P8IA 1R7AA 4W5ZA 3GNNA 1RQEA 3LHTA 3H12A 4G7EB 1EWDA 5D09A 4HMCA 3CQKA 2IKIA 3RPMA 3RR1A 4BEUA 1ZJAA 3O06A 3TTQA 3NQEA 5FD0A 3CZKA 3RM9A 5A2BA 3NSMA 2V8ZA 3PBMA 3DDMA 2V63A 3FOKA 2V38A 2VMFA 2CLLA 3WQDA 3P5YA 3LRLA 1PUDA 1YPIA 3GTIA 2A1YA 3P62A 1KXQA 2QCCA 2QJGA 4NU7A 3O6CA 2QZRA 3TV8A 3L4XA 1AW1A 4MAZA 3V5OA 5XIAA 3DFOA 3WLOA 4F0KA 2J77A 4MYAA 5EFDA 3TN4A 4B5WA 3M9YA 4Z08A 3V75A 3I65A 3S2JA 2DW7A 2ACQA 1PZ3A 2Z6JA 2BODX 3VD3A 4JY8A 1WP6A 1CXFA 3TYZA 3UZYA 3ZT5A 5DXXA 5GNZA 5KZDA 3LLDA 4DF2A 1K6AA 4IIDA 4LUTB 4BKNA 1OINA 1KBIA 3V0SA 2B7NA 4TX9A 5EFFA 3ZYZA 1HO4A 3AXXA 5I3GA 1CIUA 3VIHA 4XZHA 2ISSA 3SIMA 3BE7A 4PRTA 1A5AA 5C9XA 2DT0A 2YZ5A 1HJQA 3H23A 1QPOA 3A5VA 3EPMA 2BOFX 4ML4A 4HNLA 1W9UA 4JFWA 4WSKA 5H91A 4YU1A 3AHTA 3M07A 3PTDA 3UT0A 1RAKA 1UC4A 4IMFA 4C90A 2XIQA 2HRWA 2Z00A 5HA7A 2PDJA 4B2DD 1A5NC 3C61A 7TAAA 1QI2A 3C4UA 3H4WA 2UY4A 3GS6A 1O94A 1SZNA 4HHPA 3MC5A 3LGDA 4BF9A 5MKGB 5CPQA 4M24A 5C2CA 2VR2A 1E6SM 4YVVA 4AMCA 2J8TA 3LEPA 3R5EA 4FOUA 3TE9A 4X0VA 2F6UA 1ZPTA 1GQLA 5HAOA 5D33A 2OQHA 4D6IA 3LNMA 2H8ZA 3T81A 2G4FA 1PX8A 4C6PA 3WO8A 3S6TA 2ZC8A 4QLJA 4IQEA 1UP2A 3UCQA 3W3OA 3RDKA 1AW5A 2YFNA 3CEUA 1FP8A 5DELA 3AMCA 4MJMA 1S2TA 1OFDA 1XLEA 3TU9A 3GIPA 1UWUA 1YNYA 1CPUA 2FZ9A 1DWGM 5DO8A 2HBVA 4KT2A 4J5NA 2EG7A 3WD0A 1M1BA 3R10A 4GO9A 4IH3A 3KX6A 4NP7A 1VP5A 4AQLA 3FAWA 2VX5A 4RNJA 3ARUA 4INFA 1Y5XA 2Y8VA 5JXQA 1CEOA 3QV8A 1OFOA 4UWMA 4GWEA 2D2GA 1O60A 2ICSA 4H4IA 1V51A 2Y61A 1XP3A 3S83A 4H83A 2VCBA 4DNMA 2PWHA 5LIYX 4C6JA 2PWGA 2ZICA 4ALDA 1OWQA 1E56A 2IKGA 3LOTA 4O16A 4O4WA 4IP4A 4AWUA 2POTA 3IJ8A 2XIOA 3ATZA 3SADA 5LGXA 3WZ0E 5CG7A 1UD5A 1X1ZA 4DBUA 4NI3A 3T2QA 2OLAA 4JIQA 3FXGA 3DXIA 4JTKA 3ARRA 2OCZA 3L7RA 1OZMA 4NSBA 4OU1A 1W17A 3FS2A 1FOBA 2ZFAA 3T9PA 1N55A 4M29A 1FWEC 4EX4A 4IIFA 4DHGA 1ITUA 1JPHA 1IEQA 3W7JA 1P5BA 4QDMA 1E1CA 3L5AA 2UWFA 3WUFA 4FF5A 3SUWA 3AIQA 3UJRA 2BASA 3BLFA 1VBGA 1SO6A 3D6NA 2EAWA 1QI3A 4QE5A 4AD1A 3OPSA 2QVNA 4YCPA 1NJJA 2KX9A 1UKQA 1E0UA 2RUSA 5FL0A 1XPYA 1Z41A 4EPDC 3WFAA 2YBVA 4XAPA 3GVGA 3LI0A 4ZENA 4B15A 3SO7A 4IZGA 2LLEA 4L9XA 3S2NA 4NG3A 2XFRA 3C3UA 3QY6A 1VCVA 4O57A 4BHYA 3WK1A 3DFTA 3DZ1A 2XSXA 1TVNA 4IMGA 1O5KA 1WUFA 4A3QA 4AWTA 1F6YA 3ME3A 1WBJA 4U2YA 5D03A 1Q2SA 4DWSD 1UOKA 3L4YA 1V7AA 1PSCA 3EWYA 1TG7A 1JCNA 3ZOAA 1KBLA 2C3ZA 2E4TA 3TW6A 3V36A 1IZKA 2VCCA 4TUFA 2RJHA 4KH2A 3YPIA 4B9YA 1H60A 4LC6A 2ACSA 1K03A 4UFJA 2QPXA 5E0KA 1TV2A 3ELFA 4O8RA 4PCSA 1X8CA 3RX3A 4ZBCA 4EAYA 2VOTA 3SCPA 4N9EA 2OX4A 2P53A 3Q67A 2DVUA 4L4PA 2CZVA 1E0VA 1M7JA 5HR6A 4X3ZA 4A3UA 3HQPA 4TV5A 2QIIA 1EEPA 4I3GA 5JH1A 3TVAA 3MO7A 3SURA 1GOMA 1VQTA 1ZU8A 3WBXA 1XIIA 1XSJA 3ABXA 5DF0A 1DQXA 3PZVA 3TOPA 3KHJA 3MHUA 2W61A 3QQ1A 2ZUSA 1QTWA 3M0MA 3BZJA 4NXSA 3DC0A 3TTOA 2WVTA 4IFOA 2BSLA 3ZLGA 1SQ7A 2ZRXA 3WLSA 1HKKA 4DXVA 2GVLA 3VM5A 3CUHA 3RLUA 2QCFA 4FF7A 1W54A 3D0CA 4I90A 3MP4A 2TMDA 2DH3A 1PB0A 3SR7A 1PZ1A 1ZBKA 3GC2A 1O4UA 1EBGA 3NDZA 1ECEA 3RRAA 2J8FA 2PTXA 2GJXB 3HGOA 3ITOA 4IGMA 3WDQA 2EO7A 4EXBA 3AXKA 3FLUA 4C1KA 1P6CA 1ONXA 3AC0A 1SZRA 2IW0A 3LHVA 3VO0A 1GW9A 1LTDA 3SEPA 1XFCA 5LA1A 1AH0A 5AC8A 4NQ1A 3CQHA 3VGHA 2WWCA 3WCZA 3G1HA 3CC1A 1BD0A 3AU6A 4UFIA 5LSMA 3PZGA 3QTGA 1RQBA 3EA3A 1GHSA 2Z28A 2XUCA 3EKGA 2ALDA 1OJXA 1XDMA 1OCBA 1QU4A 3R13A 1IR1A 3EOOA 4R27A 4B3LA 3ONCA 4RE3A 4Z1CA 2OU4A 5K4XA 3UZZA 2ZXDA 5F4XA 1J93A 3QM3A 3VDBA 2A3HA 1OT2A 1W9PA 2WZIA 3TAKA 4HPNA 3PJUA 4NIRA 3SCVA 4AWSA 4L1XA 4DI8A 3MSRA 3Q4DA 3VD5A 1UB3A 1HKIA 1EJVC 3DFQA 1JCYA 3EKZA 1J01A 1OG0A 4XZMX 1BF6A 3T0TA 3K8LA 3OZPA 4RE4A 5KZ6A 1OCQA 2CITA 2E6YA 4JIRA 1EJXC 5AZ1A 3TMQA 2YXGA 3G22A 3I3DA 3WUEA 4OBTA 2TRSA 4G7FA 1TPDA 3MHGA 1KFEA 1GOOA 2QV4A 1A5CA 4TO8A 3QOMA 1DE6A 3W1MA 4GNKB 3AMKA 2XWDA 3CK5A 2R82A 5FL1A 4RXFA 2VHLA 1FXQA 2F7FA 3UWVA 1BXCA 5A6BD 1ONWA 1PDYA 1VD6A 2OFJA 4JGDA 2HS8A 3TQVA 1Y7VA 3A6OA 7REQA 1U83A 3RUBL 3UCCA 4O1FA 4LUSA 3VGGA 3W88A 3W81A 4OUIA 3W70A 1B3YA 3KVKA 3S9IA 3FFSA 1K02A 4LAOA 4QLLA 2BG5A 4DZHA 2I5IA 4AD3A 3PBYA 3LXBA 4HCHA 2A79A 1R3RA 1QXLA 3PZIA 2Y8UA 4KF1A 4W8AA 1XGEA 1EJRC 4AXNA 4YTUA 4FLRA 3RN6A 4MJ4A 3GY1A 1NSJA 1RALA 3MMWA 4OBRA 3UZJA 1OIMA 5C55A 8XIMA 1NH6A 1QWGA 5A3HA 3W7LA 1LJYA 1QK2A 2WMIB 3CTLA 3GU1A 4DN1A 4QE4A 1XBXA 7PTDA 5BU9A 1W1PA 3V18A 3BICA 2YLAA 2J24A 5T91A 4JIIX 3VPLA 1LL7A 1DIDA 1TR1A 4MWAD 3S5SA 3S0CA 1WDSA 4HNNA 3NQ7A 4E8CA 1NM9A 3DAQA 1OHLA 5EMMA 2VEKA 3DFNA 2EKGA 4U5KA 3W2LA 1TMLA 1XLDA 1C8XA 3B06A 3S4TA 2EF9A 2HS6A 4PUKA 1ONRA 3PG8A 3LMYA 3W7DA 5L9FA 2YCIX 5I5RA 4OFCA 3FVMA 3NM3A 4I7VA 4FZIA 4QJ5B 1RJPA 3RYSA 4JQ3A 3GW0A 4D71A 3XISA 4MB5A 1DKWA 2P8BA 3RU6A 4W84A 3PK7A 1TE1A 3A64A 1E9YB 2ATMA 2I5QA 4FX8A 3AIBA 3WK3A 2FPVA 1RP8A 4HK5A 5D8ZA 4AUBA 4HYRA 1OYAA 4GRSA 5HMEA 3TKFA 4WKHA 2Q3OA 2J27A 5I78A 1R30A 5LXXA 5EMJA 2PC8A 1B3ZA 1R9YA 4UCFA 1NQKA 5AECA 1IEIA 2PU1A 2JKEA 2Y62A 3FA4A 2GQAA 3BDKA 4PYSA 4GK8A 1Y8BA 4JTQA 1KM2A 1VR6A 2OO6A 4UQDA 5FF7A 2GJNA 2QKFA 2VUNA 2BBFA 3O1NA 4AFYA 3IAQA 4CGTA 2WC3A 2C19A 4KCWA 2YXXA 1C7TA 1G1YA 4AXKA 5AC6A 8TIMA 5F2GA 3HFYA 2YGYA 5BYWA 3CPUA 1T5AA 1VFOA 1BRLA 1UG6A 3ZJ7A 1QVBA 4PUMA 4Z2JA 2D0HA 3W7HA 1K9EA 4IPNB 5FJIA 4EF8A 4RX0A 5E9AA 3P7YA 3R0UA 1CB2A 3O6AA 4JTGA 3N18A 1JFXA 2V5BA 3TN6A 3OYZA 5A6MA 4PMRA 1XV8A 4LS1A 1GQKA 3W1UA 2HWGA 4K8EA 2WOQA 3OU8A 1HVXA 2V5LA 2DIEA 3F5JA 3MT1A 1LL4A 3NSNA 1E40A 1R87A 1R2RA 4EVZA 3MO4A 1GVIA 5REQA 3U2EA 4EAMA 1S3TC 4Q7IA 4QM1A 2G5WA 3SY1A 3GZAA 3GG1A 4JS3A 1XIEA 3E49A 3UWWA 2X1TA 3KDNA 3LY0A 1A5KC 1UJQA 1ZP3A 1LOLA 2ZRUA 3TLQA 1WDQA 3EB4A 4A21A 3T07A 4C91A 2E9MA 2OELA 5CSRA 1E1EA 3QV6A 2J66A 2O0TA 1W3KA 3TTEA 4B5UA 2OLHA 3VU2A 3GBEA 4DY1A 1VFHA 4L4OA 1EGZA 2PD9A 4YTSA 1TWWA 1TX2A 4IISA 3L0GA 1U5VA 3TYUA 4W86A 5H6HA 3IVUA 1J0KA 4Q4QA 1ZNNA 4MAVA 3RX2A 3HN3A 4V28A 5BOEA 4MHBA 4OOUA 2E5CA 3DI1A 1EHNA 3AFBA 4O28A 4P7RA 2G4JA 1IIHA 4BQ3A 3G1SA 4DBSA 1E6NA 4F79A 1HF6A 2C1HA 1HW6A 2BGSA 2GUUA 5K4ZA 1GVOA 3RR4A 3ABQA 5H2ZA 5ABHA 3NQAA 4L1WA 3IJDA 1MUWA 3P6LA 1XKJA 3PTKA 1NWRA 3WQOA 4R9XA 2WLZA 3VUSA 1SJDA 2VEPA 3W2JA 5HWMA 4NHVA 1DXFA 4YS1A 5ECUA 1TUXA 2NLIA 3L21A 1N7KA 2W6RA 1NDWA 2DQXA 1KQYA 1MRQA 1SO3A 4Q8QA 4AVFA 3T78A 4MFDA 4WSJA 4E3TA 2WB5A 3M7WA 2VZVA 3O16A 3CZEA 4JIEA 3VXGA 2TODA 3CAQA 4NZCA 3SUSA 4H7ZA 4GX8A 2PBGA 3IGUA 4ACZA 4NUWA 4QEEA 3OZOA 1XW8A 1CTNA 3QW4B 3RF9A 1FHDA 4QEHA 3LHWA 4QG9A 1XC4A 1CGYA 3T8QA 3N2CA 4RXGA 3ZSSA 2ZUUA 1OX6A 3WJSA 3VMPA 2DFAA 3F2DA 1MUCA 3JZUA 1WO2A 2EPHA 1X98A 1QOQA 1JGIA 4PBGA 2O4MA 4EOUA 4JHMA 2ZDSA 3WD2A 3CWOX 3IJIA 3KTXA 1WCGA 2R24A 1LWJA 1QW8A 4HU3A 2NXIA 4XTDA 4FOKA 1JXKA 4IJBA 4L1GA 1YBQA 5HQEA 4BZYA 4DO7A 4CCCA 2WZHA 3LM7A 1B9BA 5AHNA 2GOKA 4GI8A 3PJTA 3W74A 3WQVA 2X2YA 2TYSA 3LPFA 5IXEA 4H6RA 3C2RA 4H3DA 4BQ4A 2ADAA 4HPXA 3T4WA 2X42A 4AEFA 2YL8A 4ZSUA 1G4TA 4Q3MA 3EA2A 3W6LA 1Q6LA 2OEMA 2R8WA 4OZOA 4CVUA 2ZA2A 3G0XA 3GNOA 4WRHA 3CUJA 2D0FA 3Q58A 3TA6A 3L2LA 4JHOA 4LS0A 4AZBA 2OZ3A 4AW7A 1TPH1 1THFD 5FAGA 1L6YA 3W38A 4JX4A 3H70A 4M7TA 3QF0A 4QTGA 5HANA 2Q3RA 3S46A 3B8WA 1E71M 3S1VA 1C3FA 1QBAA 1TQJA 2CESA 3PPGA 4RUBA 1QBBA 1M03A 1LOSA 4MKSA 3CAKA 2XVGA 4L4MA 1L2QA 1D7FA 3NAVA 1V5XA 1ONEA 4N9CA 3CU2A 3E0FA 1H5VA 2B81A 2FPTA 4O13A 2V5CA 2YW4A 3OVQA 4WKAA 1GVQA 1C9WA 3BSMA 2HXTA 3TYDA 2PWVA 3GM8A 4RDZA 1A3XA 4EPEC 2OSWA 4DZIA 3EWZA 4RKAA 4RZ4A 1RR2A 2WHMA 2X05A 4DF1A 1Q3NA 1AQ0A 2EPNA 3PBWA 4XIAA 3KRZA 3OLGA 4V2XA 4O1BA 2IXUA 2HBXA 2WSPA 2GQ8A 4W88A 3T0AA 1MUMA 5F4WA 4UOZA 2TAAA 2WMJA 1MWOA 2Z29A 1DTNA 1K7XA 4NJGA 1WE5A 5JBEA 3IIPA 2DSUA 4U31A 3W28A 4LEFA 1TCDA 3UEQA 2Z0IA 3WMCA 3WJXA 3INPA 1XCXA 5IBXA 5HNNA 1JPKA 2VCAA 3NPXA 3DHPA 5J5RA 1TYGA 4E6MA 4WDTA 4AYGA 5HUOA 4AZGA 2C13A 5HNUA 2VFEA 1KM3A 2CYGA 3GVRA 2CBVA 3EX4A 5BWAA 3TFXA 4GBUA 1KCZA 2XIJA 3TX9A 1AJZA 4H6EA 4FHAA 2Y89A 3PZ9A 5EL1A 1VC4A 4K1GA 5E93A 2HZGA 1O68A 3SFKA 3F2CA 2PDUA 3P2VA 4IX2A 3UR5A 3F4VA 5C9RA 1TWDA 1QNRA 3T1GA 3W37A 3B9OA 4RNHA 3ABRA 4BWLA 5A6SA 1MNZA 1KFCA 1P6BA 1XL9A 3M5YA 3AMDA 2G41A 3ENLA 4H8VA 5ABFA 2PP3A 1FY6A 3MP3A 1VHCA 5I3HA 2OPJA 4CQDA 4Q7BA 2A2IA 4EACA 2INFA 4PR4A 3FA3A 3SGUA 3M0YA 4XAYA 1KCLA 3BQ6A 4CKQA 2PURA 3H6OA 5AHEA 5LNWA 2CZEA 5FF4A 2ZBTA 4LNYA 4HYWA 3W24A 5D04C 2ZRWA 2WNZA 1VEPA 4PTDA 3GYCA 4R9OA 3VKCA 1TZ9A 2AAMA 2WQDA 3TUUA 2YL9A 3TSDA 3CH0A 1EP2A 4XB3A 2QJNA 2ANUA 4DPPA 1PYFA 3TQ0A 4E5TA 1JR1A 5E9XA 2DW6A 3RK8A 2UBPC 3WD3A 2AOSA 3ZMRA 1O66A 3A4AA 1DP0A 1KO0A 1W3IA 2X7WA 3AYSA 3D46A 4JTEA 3CV2A 4QE1A 2NQZA 1IT7A 1GK8A 1E6XM 1TVPA 3F4NA 1LUCB 3AJ7A 4MIMA 2W27A 3LCLA 1Z3NA 1B1YA 3U9IA 1Z6KA 5CPOA 4WY0F 1PX4A 3M0XA 3EKLA 5AYZA 3WNNA 1TCMA 1XYBA 1G0CA 3TJIA 5ABTA 1W37A 4OGZA 4Y9OA 2FZMA 4GCXA 3RX4A 1K9DA 2OYMA 3VDHA 4KCVA 3VCRA 3FGCA 3TH6A 1OF6A 2EPLX 3KOXA 3P81A 5FF2A 3E1F1 5IHSA 4YYCA 3NDYA 4GYPC 4UTWA 4GUIA 1H7WA 5CQ1A 1QW9A 1VCGA 4I9TA 2CWNA 2CBUA 1A3HA 2C1IA 4V1XA 2BNJA 5DY3A 3KOYA 3H2EA 1MNSA 3KLLA 4J1OA 2QQ6A 1FDZA 2CHNA 1C8YA 4AIUA 3NQVA 3BL3A 3W6MA 3ZSTA 4Y2WA 1VAHA 5D05A 2ZX5A 1XLHA 3HTWA 4L7ZA 1WZLA 2ZXBA 1UR8A 1EOKA 3W27A 1OFEA 4REQB 4PMQA 4GXPA 1BYDA 3LZ3A 1FWNA 2YYTA 4AX6A 4TIMA 4S2BA 4KEMA 5H8PA 3CM4A 1XYLA 3PPCA 1EO7A 2NXGA 3WDJA 5A8PA 2VWTA 1AFSA 5D9PA 4US5D 1QHOA 2D22A 1XPGA 1QDSA 4XZWA 4H7VA 3TROA 4H1ZA 1TQXA 1QATA 4CEXC 4CNNA 4OE7A 1EPXA 2E5BA 3NQ8A 1VLWA 1R3QA 2WHJA 5AVNA 3NA8A 2Y24A 5EMKA 4M6UA 1B54A 3F4DA 1OM0A 2CLKA 3WENA 4LV4A 1HKWA 3D3FA 2VT0A 3DESA 2P3ZA 5GNXA 3AXHA 4NZJA 1PX3A 3O9NA 3PZMA 3S47A 4BJHA 1Q6FA 3NPVA 1Q45A 1R8LA 1FHLA 1JCLA 4F8XA 3E74A 2OR2A 1BRLB 3THCA 3K1DA 4IP7A 4Q6XA 5FEZA 3S1WA 1W5PA 4O54A 1H7XA 3VDAA 1JF5A 3PN8A 4E2DA 2XIMA 1PKMA 3VDCA 4OHQA 4HZMA 4Q32A 4Q8UA 4DVOA 3N19B 1HTIA 2PRMA 3NL3A 4PB3A 3VAVA 4DPQA 4IIEA 1EHAA 2J6XA 4RZ5A 4DBDA 3AIEA 1E9IA 5FJJA 1Q5MA 3SQMA 4AZIA 3EMCA 3R2GA 3U8GA 5FJPA 3B40A 2IS7A 3ZR4A 3FX4A 4HNTA 1F61A 1NWSA 2ZVRA 2R1LA 2ZX6A 4IWWA 5CSYA 1N8FA 3QGKC 2QAFA 1G7VA 1XDLA 1MW0A 2DIKA 1XYAA 2PDHA 3VVGA 4XG1A 2PDYA 2JK2A 3BUVA 4O1EA 3M6YA 4JICA 4UTUA 1GNXA 5HDRA 2CBIA 2O4QA 5I23A 4ICNA 1F3EA 3WLQA 1HKVA 1UD8A 3CNYA 1KQZA 4DIAA 2QDEA 3C0SA 3W1NA 2I16A 4C6FA 2VOMA 3FYPA 4W4QA 5LIWX 4TX6A 4Z1DA 3RIKA 4Z1YA 3UNTA 1BGAA 3HQNA 2CLFA 2Z2BA 3MY9A 2QCEA 4JAWA 4AZCA 2GSJA 1SZFA 2B0MA 4KWVA 2GDVA 1TFVA 3DG6A 3UWUA 3BW3A 1NP2A 2NW0A 1NWUA 1GGOA 4MZYA 3B9AA 1GTEA 1RY0A 4WK9A 4HMEA 3MSDA 4CU6A 1ITCA 3TWBA 3B9NA 4XKYA 3AROA 2EHHA 3IK4A 3MCNA 4HTBA 5G4HC 1BVWA 4AIBA 2X2GA 4ERGA 1LRQA 3FIGA 3CV7A 1J96A 1F3WA 2H9AA 3ZM8A 1E73M 3I7QA 1E1FA 4PMZA 3BLEA 4XD3A 5LHFA 3ONBA 3ERPA 3ZS4A 4D6GA 4Q8WA 2Z1XA 2GUBA 4ZGYA 3UCDA 1UA3A 3VGDA 3T7VA 1Z69A 4NT0A 3A4XA 5HPCA 3ZFHA 4GI4A 3IANA 2VRJA 3CHVA 3UPWA 2WZTA 4MMWA 2OLSA 1PIIA 3LTYA 4FPSA 1QPQA 2BVTA 3SY5A 1US3A 1Q65A 1BKSA 2OSYA 4HA4A 3OVGA 2G3NA 3C8FA 4ILSA 5FAJA 3JS3A 2BVYA 4FB7A 5CXPA 4PTMA 3EAUA 1HN1A 2WKLA 3M41A 1SYTA 4LBRA 3NFUA 3PJWA 1IIGA 4LVGA 2VDHA 3NSXA 1PTGA 3W01A 1TWSA 5GJMA 4BK9A 2QYGA 3DOPA 4O17A 5LHEA 3U2CA 1GPWA 1PEZA 1QO5A 2CIPA 1PIFA 3V16A 3TJXA 3WQPA 4QX4A 3ANYA 3BG3A 3UZ5A 4QCFA 4WSHA 4AZ7A 4BI7A 1V93A 4WGHA 4GUJA 5D9MA 3M0ZA 1Q7MA 1YPFA 3VIGA 2CXGA 3LXAA 4QSHA 1O1HA 1O95A 2PGWA 3G0UA 4FXRA 2DVXA 1X1NA 5A8OA 3E0VA 1JNEA 3C2YA 4LVAA 4IP5A 1XX1A 2HDJA 4M7SA 4UQBA 1YBQB 3P84A 3KS6A 1CXIA 4MLJA 5I02A 2FQIA 4ZE5A 3MUY1 4HTYA 1MW1A 1GUVA 3R4IA 1TREA 2PZNA 1IE7C 4GC3A 4O4VA 5DRIA 1V3LA 3S9YA 2BLEA 1WKYA 2BXYA 2NV2A 3W7RA 1JUEA 4DUXA 4LCRA 4S3JA 3TOYA 4J3SA 3TXVA 2PC4A 2R1KA 1FWAC 1IGSA 3B8TA 3L65A 2NXHA 3GHUA 3LERA 4POCA 1AQHA 5CPMA 1EDTA 5CCZA 2CLPA 3PUGA 3BAYA 5DT5A 4GFSA 2V5DA 5CG0A 3TW9A 3QR1A 2FFCA 3MVIA 4GE8A 3W82A 1GVFA 2EXOA 4ZL1A 4GABA 4FP1A 3PUDA 3BLPX 4L9ZA 2OZ8A 4YIWA 4C6OA 1RA5A 5M1TA 3CL8A 2C8NA 5TAOA 4AYSA 2OGYA 4TVDA 2ZOXA 1YTEA 4KMQA 1J0ZA 1VYRA 3W1LA 4W8BA 2VGFA 2PF8A 3HG3A 4JTIA 1AODA 5AHFA 3LQGA 2DSVA 4EWND 4M1RA 1IEXA 2ZRZA 1I0BA 1W1TA 4IGSA 3ZZ1A 1JDCA 1J0YA 2V82A 4H00A 4CU7A 4N2YA 3DX5A 4FR1A 1UA7A 1YE4A 2TSYA 1S5NA 2VYOA 1W8SA 3CUFA 3NNTA 2FJKA 3UR7A 1DYSA 2RJGA 4UTJA 5FACA 3W85A 3ZVIA 1O6IA 2OEJA 3BCFA 3KTCA 6REQA 1Q6GA 3V4BA 5HBFA 1JNDA 1OX5A 4NX0A 1XLGA 3TZNA 3QMRA 3R25A 1J6PA 5A69A 3E3HA 2VZSA 4IUOA 5FJRA 3TZFA 1RQHA 3QMSA 1SVDA 3M16A 2ZKMX 3NYDA 2F6KA 3W1XA 1T96A 1ZAIA 4KBXA 1CX9A 1WYIA 3S42A 1R47A 1UZHA 2ATSA 3QHOA 1XM3A 2W0UA 3LBOA 3CV6A 4PFMA 5D32A 4AH7A 3W75A 5EU9A 1NWTA 1SSDA 4EANA 2RGLA 1LCOA 3WG6A 2IPFA 1FWSA 1GEQA 1HKMA 3ES7A 4WJ8A