3H2PA

Human sod1 d124v variant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
126
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPRHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKAVAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of Pathogenic SOD1 Mutants H80R and D124V: Disrupted Zinc-binding and Compromised Post-translational Modification by the Copper Chaperone CCS
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 31
structure length 126
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3h2pA00
3KH3A 1YAZA 3L9EA 1BA9A 1SDAB 4A7GA 1P1VA 4N3TA 1QUPA 1JK9B 3S0PA 2GBUA 3KBFA 2WZ5A 1SRDA 2AEOA 3GTVA 1E9QB 1U3NA 3F7LA 3GTTA 2AF2A 4BCYA 2AQSA 1TO4A 1OZTG 1Z9NA 1F1GA 1E9OA 2Z7ZA 2NNXA 3ECUA 1OZUA 4OJAA 4FF9A 4A7VA 1SOSA 3KBEA 2Q2LA 1SXNA 1YAIA 3CQQA 1Z9PA 1F18A 3RE0A 1PTZA 1S4IA 1N19A 2GBVA 3ECWA 3HW7A 1E9PB 3QQDA 1DSWA 2AQQA 2AQNA 3PU7A 5KBKA 4MCMA 2JCWA 1F1AA 2JLPA 2K4WA 3L9YA 5KBLA 4A7QA 3CQPA 2ZOWA 1YSOA 1SXZA 3H2PA 2XJLA 2LU5A 4A7UA 4MCNA 1IBHA 2WKOF 1HL5A 1HL4A 3MKGA 1OALA 2C9SA 3HFFA 1F1DA 3GZPA 4A7GF 1IBDA 2GBTA 4A7TA 3GZQA 1TO5A 2V0AA 2AQPA 3KH4A 1XTLA 1UXLA 1JK9A 3T5WA 1IBBA 1Q0EA 3CE1A 2C9VA 2XJKA 3HOGA 2VR8A 3SODB 2C9UA 1RK7A 1B4LA 1UXMA 3GQFA 1IBFA 2R27A 3MNDA 2ZKXA 1XSOA 2AQTA 2WWOA 4BCZA 2ZKYA 4N3UA 1CB4A 1COBA 1IB5A 2WWNA 1DO5A 2WZ0A 1EQWA 2APSA 2Z7UA 5CU9A 4OH2A 1E9OB 1OAJA 1FUNA 1E9PA 3ECVA 1SXCA 3KM2A 3KM1A 1OEZW 1SDYA 2WYTA 2SODB 4A7SA 2WYZA 3GZOA 2WZ6A 3QQDB 2ZKWA 2E46A 1XTMA 2VR7A 1E9QA 4U4IA 2E47A 4L05A 1L3NA 1ESOA 4BD4A 1SXAA 1N18A 2Z7YA 1BZOA 2AQRA 1CBJA 1MFMA 3F7KA 1PU0A 1SXSA 3K91A 1KMGA 4B3EA 1B4TA 3H2QA 5KBMA 3LTVA 1AZVA 2WKOA 1EJ8A 2VR6A 1SXBA 2Z7WA 1SPDA 1JCVA 1PZSA
chains in the Genus database with same CATH superfamily
2DI7A 3OMIB 1KCRH 3L1FA 1OM3L 4BFKA 1D5RA 5T3ZH 4NZFA 1IQDA 2YD3A 1PL3A 4ZPTA 1W8OA 5IB2A 5C0JA 1OD7A 2E7BA 3WXWL 4LEXL 2AZAA 3NA9L 1N6QL 4M48L 1WD9A 1WRFA 4KV5F 3PL6B 1DZBA 4BSVB 4F7TA 3OKKA 4UQCA 3SHSA 3FT1A 1UASA 4GKLA 1ZT7B 5IJVA 5I8KL 3SKUD 5IMOB 5KYNA 1BZDA 2X41A 5I8CB 2X4SA 2XWTB 1KCSH 4N2FA 3SKJL 2VB5A 3OXSA 5IGXL 1BLNB 4OD1L 4X6FB 1SBSL 5TDPB 4F7CB 1UTDA 3BJ91 3KVQA 3STLA 5EF2A 4XI5C 1A9VA 3D07A 4C56A 5J13C 5EUKB 5ACZA 2HRLA 2B1OA 3HUJA 4PCYA 2ORBH 3SYCA 1BFTA 1HE8A 5C0EA 3FQRB 3LIZA 1SYSA 2B4CH 3GNML 4UOW1 3VRIB 1G7QB 1QP1A 3OD3A 2Q8BH 4PI0A 4Y2DC 3WIHH 4YSCA 1YMME 2AZUA 1MJ8L 1P4LA 2W0LA 4Y0GA 1UCBH 1JTTA 4P5KB 3VRJA 2BNQB 3UTZA 5KVDE 1S9KC 5LBSH 3RVXC 1JG9A 2VQTA 3W57A 3HFFA 4Q6KA 2AERT 1PLGL 1WA1X 2YUVA 5JPNB 3NJGA 1QZNA 3QUMH 4BFRA 3ZJAA 3FL7A 1TJHL 2CR6A 5DUPH 4U3CA 2X4UA 4DKEL 3BPOC 3HI6H 5FYKD 1GZPB 1YUKB 3QQXA 3QHFH 2PCFA 1BXVA 1MJUL 3SN6N 5E9DB 4EE2A 3CE1A 3HOGA 1LGVA 2E6PA 3RPIA 5HYIA 4Q9RL 5DVOA 2EDNA 5IJKC 2ZKXA 3MJ8A 4HK0B 2GIMA 4POZD 1F4XH 3QEQA 4TUKL 4P5TB 4PRBB 1ECYA 3DTUB 3I74A 4MAYD 5FYKE 4HPYH 4ALAH 3EJYC 4Y4HD 4A2DA 2A73B 1X5ZA 1EHLL 4MDRA 4XNQA 4RAVB 3H9SB 5HHPB 2GSIA 1ZLWK 4BA0A 3V5DB 1JZ2A 2WXMA 4P46B 3K7UA 2VXUL 4A68A 3HZYA 4X4YB 1FFNB 3LV3A 4YLQT 4LQFH 5C0AA 3U6RA 2Y1ZA 3RWCB 2WINB 1GKEA 2ADJB 3NZHL 4OM0L 1M7XA 1BM7A 4OFIA 4PG2C 2J88L 2WXRA 3DJSA 4PBVC 4ETQA 4AVJA 1PZAA 1NINA 2BY1A 2J8UB 2XC8A 3RVTC 3KH3A 4XXCA 4FQXA 4RISH 4XHJC 3PGFH 3Q3GB 5MENB 2FJUB 1UWXK 4NQDA 3RZCD 2F19H 4N3TA 5H35A 2YA1A 1IJ9A 4OM1L 3QIUC 1U3NA 3PWVA 3ZHFA 5ICUA 5I82A 4H26A 3WJJA 3TIDA 2X2IA 2B3IA 2EABA 3HN3A 3F6LA 1X5YA 1UG9A 3N9GH 3ECUA 3SQBB 1AP2A 2BVQB 4ZD3H 1IKFH 3FDWA 5T3XH 4OCRL 3SIKA 3VSUA 3WD5H 2C3WA 1FORL 1MH5B 3A21A 4X6DA 1XBRA 3S3JA 3D2UD 4QRSA 3ZSSA 4AYBA 3RDJA 1ZIBA 4PP1D 1A6AB 3DX4A 4XAKD 4YDVA 4HCRL 2V3EA 1AD0A 1GYUA 1JFQL 3S5LB 1OGPA 4ERSH 3D6GA 3K46A 4YXLH 3P77B 3QUZA 2XNAA 4CC1A 2TAAA 5I19L 2W9EH 3KCWA 1NPJA 3VI3B 4O2EA 3SJVB 2ED6A 3BAWA 2IG2L 3LNFA 4HIQA 4OCMC 4ECNA 4UMGA 5F9JA 4QXTA 4X8CA 3I75B 3QUYB 4XGZB 2WXNA 1PAMA 1WAPA 4I18C 4YDLC 1Y07A 2WOBA 3MRFA 3D39D 5ESAB 3RPKA 3TF4A 1BF5A 4YSDA 4U7SA 3NPSC 3EAKA 1D6VL 4ZPVA 5M95B 2NY5H 4HIHA 2MOQA 5CCKH 4GXUM 1KCBA 4KUCF 5D5MB 4P9HH 1DL7L 5SWSA 4WSJA 1T3FB 2EVFA 4K9JA 1BDYA 5KJ7E 4NP4L 1HESA 3NSJA 12E8L 4XC3H 3SYPA 3VFRB 4MS8C 2YFOA 2DMKA 2H6OA 4GAGH 4OT1H 3D39E 1G9MC 3ROLA 3G3LA 2FD6L 4MA7L 1LK3L 5MEPB 1A7NH 5C8JA 2KZWA 4IDJH 2Q7AA 2DRUA 4FKHA 2IWFA 4MFHA 4MNHA 1VFAB 2Y7OA 4TNGA 5KUMA 4N87A 4Z7AA 5TH2B 4WO4C 1KGIA 3IDYC 4HZAA 4NAJA 3R4RA 3UO8B 3U7WL 2C3XA 5DD0L 4Q4EA 1YEDA 5JHDB 3X2QB 1Q0YL 4J27A 1ASPA 4PGJA 3ARBB 5BRZD 4YDJA 4HJIA 4GRWH 5F71A 3GSUB 4I13B 1OWRM 4CADA 1UWYA 2IWEA 5KANG 3Q1SL 2VXSH 1SHXA 4IBSA 1IC7L 4NC1E 4JL1A 1QFWI 3KPNB 4M03A 5BW7C 1A7RL 1O5PA 2CDFB 4YBQD 3HCVA 5C92A 4HS8L 5GGQL 1AXTH 1DLHA 1JPST 2HG5B 1A6VH 4JRXA 5CEYB 5A16A 3D3VA 1ZA6A 5ID0B 1MVUA 4G8AC 3FCSA 4DTGL 3V0VB 3VDAA 2DICA 3ABLB 2N1TE 4ACPA 1UB6A 4AEIH 3TEUA 4U05A 4CC0A 4HOZA 2EUVA 1QPPA 4W9FC 1FPTH 2VE6A 1FG9C 1F6AA 3HAEG 4DP5X 2HA1A 1ZD6A 2EO9A 4N2NA 1YCSA 2NW3A 5C0DA 3SGEI 5IUCA 3CN0A 2YQ3A 1USQA 3TNNA 3TZVA 2CWRA 1FE8H 1ROWA 3FSOA 3CH1A 3INUH 2ZKHH 4AQZA 1S7QA 3ASNB 4ONFH 1UUNA 1A6WL 2ZCZA 4HOWA 3MV01 1KBGH 4XPHL 4A7QA 5JXEA 1CICC 3B2UC 3VNZA 5KSBB 2ZXGA 1A9EB 35C8H 3AROA 4WUKH 2NR6C 3FMGL 3IGAB 1I8KA 4LDLB 3G08A 4R2GD 4UQDA 4MCNA 1EANA 4DP0X 4DUXA 1OM9A 1I8LA 3HRPA 1JV2B 1EUUA 4OD2B 1HL5A 1YZZA 3NFPA 4ZAKA 4DPAX 1MRCL 1JNHA 1Z0MA 4L18A 1RL1A 1UWFA 5T3ZE 4CSSA 2X70B 5HI5C 1LEIA 2A74C 3K2IA 3K4AA 1FAKT 2I5YL 3T6WA 2BVYA 4PUBL 1D9KA 2NDGA 1VZIA 2WTRB 4XVJH 4LQ1A 4OLXH 1WZKA 3GK8H 5IHBA 2LOEA 4HKBB 5F3HB 5E7BA 4BCXA 4JFZH 4W9IC 1VGEH 2FYYA 1ETZB 4PJAE 4W9KC 3QZWA 4Z5RA 1I1AC 3NJKA 1QACA 4PWEA 5FAAA 5FUOL 4TN9A 5KVEH 4PJEA 1ZY9A 1WA2X 2JKRM 3KD4A 4Y89A 2B3RA 3BQUB 2AC0A 1DJWA 4FQJL 2FEJA 2C9PA 3DJRA 3UEZA 4D9QD 1BD2D 3KLAB 1MCSA 1NDGA 1ORSA 4U1GB 5D1XC 5CJ8A 2PTTA 5AEAA 1KCVL 2PW1A 3MJGX 1GAFL 1FZOA 4QXUL 1RQ5A 3DYMA 2QGDA 5TE6L 3L3OA 1T20B 1CLYH 2QSCL 1BZ9A 3L5JA 4GMSH 4KK6C 3QUKB 4M7ZB 4E5XG 1FCGA 4BKTC 3O6FA 3VFGL 2FT6A 1ESOA 2X4QB 3IJEB 2FHCA 1MKFA 2JELL 1O9VA 2IAND 3QG6B 4P2RE 3AU1B 3RIFK 1KACB 1UZ8B 5TPWL 1NC2D 1IC4L 3DPBA 1IGFH 3W82A 1GOGA 4KVPA 3DSFH 5DVPA 3RGVD 2WKOA 1YEHL 3DXAA 2O5XL 3MGOB 1ZLVK 4GRWB 4I0KA 5CZVH 5AD0A 4H1LA 3LD8B 7CGTA 1R47A 1QLRA 1OAXL 2EIKB 2ATKB 3QCTL 1RZKH 2IOMA 4U3SA 5B4MD 2IANE 1M53A 4IW4C 4Z0BH 5EOTB 1BFVH 3ESOA 5IW1B 4QRUB 2AF2A 4K5PA 4UINH 5C07B 2MJWA 1U21A 1CIDA 4N9GB 5EZPA 4HH9A 4PJ9C 4YDKH 1X5GA 3RB5A 1Z9MA 1X5IA 2H0JA 2DQCH 2W9LA 5AKTA 5MEQB 2K3TA 1QX1A 2YAMA 5T1KA 3S3DB 1XXFC 3FSAA 3O45B 5KG9A 1R5WB 5FUCC 4HKJB 4DW2H 3FT3A 1L0QA 3S37L 5GGVY 2YC1B 2IAMA 1FV1A 4PTUB 4DT2A 1JGVH 1DHKA 2FR4B 5FGBA 1ILSA 7FABH 4AYGA 3TPUA 3G6JE 3MRBB 4FQHB 3ULUC 2BDNH 1MHEA 4HBCL 4KH9A 4QXWA 4TUJB 4LCCB 2XG4A 3SGEH 3VXMD 5DJDB 3L5XH 3DVGB 3ZT7A 1OPOA 1R3JB 2ZG2A 3LEVL 5GGSY 1MW3A 5JPMB 2R1WB 3I6SA 5JUEL 2XTJD 2B77A 1Z5LB 3LY6A 4HC1H 4N2KA 1OP5K 1IM3A 5AVVB 4NQSB 4R4FH 3AQXA 2V5YA 4HWEL 4X99B 1OCWH 3NCMA 2B16A 2LV4A 5FPIA 3M45A 2XVBA 4MNQA 2EYRA 1XH0A 2I60L 3UJJH 4F7PB 4F1SA 3D18B 2XTJE 4Y5XC 3GIVB 1YEKL 2Y7SA 4G9FD 4N22A 1NLBH 3HAEH 3HNTL 3QYCA 3F12A 5FDWA 1F4HA 4PJXF 4D0BB 2G5UA 3NCBB 1I1CA 3DI3B 1LDSA 4AVHA 1XXDC 1Z5HA 1EFXB 5FB8B 4ZX4A 3QDJD 1DBAL 3O11A 3OLIA 1U92A 4TLKA 5D7LD 5C08B 4X0KA 4HWUA 4N2MA 4XTRC 4DSYA 1RULH 1T0NB 4FZ8H 4M7LT 1H3UA 1E4JA 2FO1A 3FT4A 3IRZA 1AR2A 4JPVL 1M9WA 1ZVNA 3C6LA 3O6MH 4ZG1A 4LRIC 5CJ5A 3EOTL 3C09C 3IJYA 1AHWA 4Y9CA 1LMKA 4PGCA 5BMFL 3QAQA 2ZX7A 1LDPL 2VTFA 2H41A 1XF2B 1GGIH 1WF5A 2Z8WC 3DGGA 3FUHA 2VAJA 3IFOA 5D7LE 3T3MF 1A66A 2LR4A 4AUJA 1EK3A 1AXIB 3WO4B 4UUJB 1I1YB 4Y16D 3VSTA 3QIWB 2MOGA 5D9SA 2DTSA 3ZU8A 3BFOA 2QZQA 3E8UH 4WUUE 4F8PA 2AEPL 1IRAY 4WU5B 4TLUA 4I9WD 5AW6B 3EYFB 3BD3A 4N0YH 1WUZA 2O5ZH 3H3PH 3GM8A 5CLYA 4PBDA 5BZDB 4HEPA 4JFFB 1GYCA 4H7VA 4XCNA 1I9EA 3FHAA 4Z7NF 1IQDB 2M83A 4N0CC 4ZPTB 3FCTA 4OB5H 2A7BA 1T83C 1Y7VA 3L4XA 4MCYA 4TS6A 4WNJA 5C0JB 3QC5X 5DHVH 2ZX9A 2A9BA 1G43A 4Q6IA 4CJ0A 3UTPD 4Y9GA 3OKKB 4L48A 2P9RA 5KYUB 1FVDA 3MBXL 1HC1A 3TIEA 1K72A 2X4SB 5CSZB 1Y18B 2J71A 2WBJC 3PWPD 4FLRA 3STLB 1BMWA 1MCWM 3OZKA 3O4LE 3GMOA 4G2AA 1PCXA 2BVPA 3HUJB 4POUB 4RESB 1E6OL 2QGEA 1BVKA 3SCMB 3ZGHA 1FIGL 3F7VA 3ZL1A 1F2XK 4UQIM 5DC4B 3HG3A 5E2VH 4MXVE 1P4LB 2VIRB 2HSIA 3CSPA 5KEZA 2IFFH 3VRJB 3O0RH 2VSKB 1DTUA 1SJHB 3GMNB 1G1KA 1T2QL 3UTZB 2VC2L 2WYIA 5JIDA 2AJUL 4JPKL 3WSQH 5L6YH 3SDCA 1UJ3C 2UZYA 3MLRH 1CFQB 3NGBC 2NY6C 4IHBA 5F9OH 3WEXA 3EFDL 4PJHA 5CWSB 2IBZY 3QJHB 4YXHL 5I73B 3NABL 4S0TD 2WNKA 4EN3B 1M1XA 1UURA 1H15A 5LXGH 1EBPA 4KO5A 4B3VA 1GJIA 3VGAC 1FLRL 2IVFC 1CXIA 1UOLA 2ILLA 2PCFB 4MAUL 2VR7A 1S9VA 2Q3ZA 3SB3A 2VMFA 1KBPA 3FU9A 3TCLA 5F6IB 4IBYA 2KYIA 2XA8H 4W81A 1NCBL 4UBDC 5FM4A 1Y0LA 1WWBX 3WN5A 4R84A 4EI5C 3WMSA 3GMQA 2I9LA 3AITA 3UAJA 2H6UA 3KLSA 3LKRA 3UIYA 3LTVA 3RHWF 1TLKA 2IDTA 2DLEA 4AMWA 3U4BL 4WQOA 1JCVA 1FCCA 2JCCF 4IBTA 4OJFH 3VX0A 3PDOA 2E4FA 3QXVA 1F4YL 1UYWL 2FE0A 3D05A 3EXJA 2O61A 5KVEE 4UWQB 1CYGA 3U25A 4F57H 1CL7I 2OI9B 3A67H 3NAAH 3UPAA 4XP5L 1HHGA 3DPDA 1JWSA 4MAZA 2GBUA 3H4FA 5JHLH 5EZJA 1M3IA 2AV7A 5L4FA 2DYPD 2F2HA 3LV3B 4MCZA 3REWB 3ZHKA 4NKIH 4HAGA 4LPYA 2ZWNA 3C5ZB 4AJWA 4MMXA 2GITB 43CAA 2MIZA 1LO4L 2JI1A 2CM5A 4ETQB 4UNTA 1QEWA 4K71B 5IP4A 2K8QA 1NC4D 3PUCA 2QQQA 3LKQA 4FQXB 2X1OA 2EDTA 2R56H 4X9IA 4DGIH 1KOAA 1DVXA 1F6FB 1RMFH 3WDIA 4IQHA 3UABA 3NIDB 5LNGA 1CICD 4FQLH 4HIXL 4PW9A 4OFDA 3FTGA 4ES9A 4RRPG 3PWVB 4QRQA 1EGJL 4P4KB 1KG0A 2ZSVB 4PJCE 4NN6B 5ICXA 3SOBL 4QPEA 4FULA 1VERA 3KPOA 2GBTA 1Q72L 4LLQA 3MNWA 2F58L 4I3RL 5HI5D 4X6DB 3TC9A 2YMXL 3CDGA 4KKCD 4QRSB 3P11H 4MXWH 3GSNA 4PRIB 3CVIH 3MLVL 2VN4A 3ZO0A 4YDVB 5C7XL 3JTSA 1KEGH 1AQ8A 2QKSA 4XPBH 4RETB 5FFOA 4GKZB 4HHGA 2ZWKA 3PWUB 4AJ0A 4ZDHA 2XNAB 1RSYA 3MAWA 1KENH 4O2EB 5DDHB 1D5XB 4XB3A 3ZKXC 2WZ0A 4BQCA 2VAAB 5F9JB 2WNWA 3HG0A 1XGZA 3SDXA 1Y6NR 2PYFA 4M5ZL 1J1PH 4GAFB 4E9RA 3MRFB 2N0KA 2DQJL 4QUOA 4F8NA 3ESMA 4N5UA 1HI6A 4P59H 4HU8A 5I75C 2R29L 2D03L 1OGTA 2VSMB 3RWGA 1AS8A 4OVUA 3CUPB 4JDTH 5SWSB 2J6EA 1MJ7H 1BZOA 3UBFA 3AJ7A 5ES4B 3CHPA 2J55A 1KMGA 4N2HA 3CHSA 3ZE1E 1QUNB 4OZFA 3ZKMD 3RB7A 1NEUA 4X7TA 4MNGA 2EVHA 4TPRH 5MP6H 1NAML 3ROLB 3S36L 2DQEH 4OZIA 4OAWB 3HB3B 3US9A 5C8JB 4P3WA 4JUSA 2V3DA 4OGZA 4AEFA 2OR9H 4ETYA 4AL8H 4Y4KC 5FKAA 1CYWA 1CLZH 2WM0A 3B6SA 1OAKL 4FNLL 2BIQA 2J1WA 4P57B 3M1BA 4HX1B 3CZKA 5FEBA 3QDGE 1V8HA 4PJ5D 4DZBB 2A5UA 3KWXA 4KRNA 3BFWA 3BH8A 3RFZC 2DQMA 2Z7ZA 4BM7A 4XMWA 5HYSA 1O9WA 3ARDC 5DC9B 4FMFA 1RHFA 2CRMA 2IV9A 1T5KA 4CADB 1LO0H 1NGPL 1DE4B 3OPZH 1AO7A 1QPKA 5FK9A 4YEFA 3QNZA 2IADA 1DLHB 2QV2A 4JRXB 3KJ6L 5D7IA 1IFRA 1YN6A 4M29A 2Y9RT 3D3VB 5HHOA 4K7PH 4A63A 1ZA6B 3RNQA 4FXGB 1MVUB 5E4EB 1U2YA 1CL7H 4QHPA 2FUTA 1I85A 2E7LA 1V55B 2HKFH 2A38A 5TGBA 1PCSA 2Y22A 2EC9T 1SEQL 4HMCA 2VE6B 2RMNA 5FYJH 2GSMB 3VYPA 1UWEL 2N59A 5ILTL 1Q9OA 3CH8A 2GHZA 2NW3B 2YPVH 3DRQA 5I6NA 3X1FA 3AS1A 3BW9B 3DKHA 4EBQH 1VACA 3CH1B 4B95C 1ZV2A 2VDNB 1YNLH 1S7QB 5EG6C 2QVIA 3QJOA 4JDZA 3T5WA 5KZCD 5BV7B 4WEBL 3FS9A 4JQIH 5DMGD 2VZ1A 3QO1B 4TQHA 1P6FA 3RWEA 1I8KB 2PPFA 1A3LH 3G08B 4XP6H 4GH7B 5KJRH 4FZEH 2LTQC 3NFPB 4ZAKB 1YDPB 4ODWA 3B2DC 2HFGH 1P6WA 1FUNA 3RPBA 4DVBB 2XRAH 5F97E 2H2PC 2V7NA 3B2XA 3OPUA 2RGSA 2BSRA 4NCDA 4KJWC 3LN4A 4ZYKA 1RUKH 1U3HD 2BP0B 4ZMVA 4KDTA 5CU5A 2JE8A 1W15A 4HS3A 2YS4A 2YD7A 4NUQA 2FYYB 3HPLA 4JFXA 5IM7B 5C0CD 3QZWB 1WE5A 3U9UB 3WMPA 3O6KL 4PJEB 1NAKH 1P9MA 3C08L 3SBQA 1O7DC 2ZZUT 2RAMA 5TK4A 2EE9A 2YSSA 5AAPA 4QHMA 3OAZH 4QHUA 2Z7WA 1XL6A 3RIAK 3QZBA 4TOYH 5IMMA 3CZEA 2CLVA 3IDIA 1HE7A 1MF2H 4M7JL 1QFPA 2EDKA 2PTTB 3A47A 5C0CE 3IXAB 3U9PH 3L3OB 2VITA 3ARUA 2BP3A 1BZ9B 4NQCE 1HHJA 2IPKA 2JJSA 2ZICA 2UXTA 1OSEA 3HIZA 1TO4A 3VUAA 4G6JH 3DO7A 4HU2A 4TQIA 2IBBA 1IIKA 4QXGL 4PS7A 1NJ9A 2YO3A 4U1IB 5DO8A 5I28A 3DPBB 4GO6B 4D94A 1GRWA 4XP4L 4PJDF 5LXVA 2XQ0A 1J9TA 3DXAB 1N64L 4E9SA 5DJ8A 1E90A 5EOCH 1JGLH 5IF0A 2WLHA 1I9RL 4ODXA 5AD0B 3L3KB 4OZ4A 5HDBF 4JO3H 1QLRB 1JPGA 3ZRSA 3FAXA 5DI8B 4RFOH 4U3SB 3TEYA 1CVRA 3I3EA 2LU5A 4PJBE 1HKFA 2VABA 5C09B 5M7QA 1RU9H 1N70A 2C4FU 2P8MB 5HI4C 2BFGA 5HHVL 3WNIA 1PY4A 2HTLC 1U36A 5IMLA 1DEDA 2CO3A 4IOFD 4FTVA 1UM5H 1UEYA 1E27B 5H37A 5K1NA 1SYVB 3LVTA 3LRLA 4GQRA 4JPSA 4QCIA 1YQVH 1C08A 1EIBA 4WIQA 4JY5L 3I9PA 3NJMA 4X7SL 5T1KB 2X05A 2Y2TA 1U8MA 2G4EA 3V9FA 5J8OA 3NJXA 4J8RA 4KKBC 3KYNA 5D8JH 2HFFA 4N2BA 2LAAA 1CJYA 4N3UA 4UT7H 3CLWA 3KXFB 1FV1B 8PAZA 4R8WL 4YHNA 2ZSWA 1PKQA 3PNRB 1E0OB 3TPUB 2QVMA 2Z1PA 4WW1B 3UPRA 4X83A 4XX5A 5DA4A 5IROA 4FABH 1R9FA 5AOIA 1MHEB 2VW7A 3QI9D 3HE6C 4UANA 3TA3C 4Q9CA 2XG4B 3CIAA 1GGCH 4MX7A 1A21A 1C8PA 4ZTPH 5JIQA 2OW6A 1B0WA 2EQDA 1ZLDA 5F7MC 1JHTA 1GCYA 3EH1A 2ZCLL 1IM3B 2Y5QA 4N1CA 1LJMA 1CBVL 4G5AA 3GJFB 2FLBT 4M93C 4MMYB 5SWZB 4U6VL 1C1EL 4LAQL 2XI9A 4LCIH 4TQEH 2JIXA 2CBOA 4MNQB 2DQ6A 5H2BB 3V6OC 2CKNA 5EEUA 4DP1X 5A1AA 2BNRA 3N85H 5JO5A 3EYOB 1IBYA 3T1FA 4WI0B 5DFWH 1JK8B 1OM3H 3UG5A 3OKNA 3F12B 2AEIT 5IVXF 2XT1B 5F93C 1L0XA 4RA3A 1NOLA 2NCEA 2VDRL 3WXWH 3KNBA 3NA9H 4YZWA 1N6QH 1IAOA 2VLJE 5D2LE 3IXTA 5FOBA 1QI3A 5I8KH 4UTCA 1YVLA 2BSTB 3FT4B 5I18L 4RSYA 5IKCA 4ZW3A 3MXWH 5C0BE 3C6LB 4P23B 1ZLUK 3SKJH 1TYEB 5IGXH 3KPRD 5EOCJ 4OD1H 1SBSH 4ZW8A 5LGHL 4WHDA 3IJYB 5L9DL 5I26A 5GXBB 4KRPD 5SV3A 3HG1B 2Z31A 4W9CC 1FZKB 3EGDA 3IFOB 3GNMH 3MLYL 3RWFA 4PB9L 2DAVA 1OT1A 1O7SA 1JZEA 4K94L 4WGWB 3N5AA 5IREA 2Q3XA 3S3CB 2GTZB 2WWKT 2B9BA 2EEAA 5I1DB 1TIUA 2DIAA 4ES8A 4M9PA 4AYID 1KIQA 1MQ8A 2YZ8A 3BH9A 3CVHL 3UEQA 1PLGH 5I6PA 2PPAA 4KO6A 3TBYA 2VSDA 1TJHH 3X11A 5C0NC 5I9QC 4L29A 3JBG7 3KDMA 1ERNA 4HUWA 4DKEH 1MCPL 1FHGA 1GYAA 4X5RA 3ARGA 4XCNB 3FFCB 5JTWA 2HZHA 1OP3H 4K7PX 1MJUH 4B9CA 2QHRL 4Z7UA 4MCYB 2ZE0A 1BMGA 3MRRA 1NSNL 1TQBC 2E7HA 4Q9RH 3DTDA 5F1OB 5GZOC 3U2IA 1BQSA 1JF5A 1KB9J 4FQQB 4PJ7E 4J3OD 1TOXA 1EEUA 4MJIA 1NM9A 3N41F 4NUMA 3AZUA 4TUKH 3QUXA 1WISA 3KM2A 3QO0B 4G1EA 2FDBP 1NANI 3MUY1 3POHA 2CZNA 4GKNA 4HJSA 3S3BB 3NIFE 4AKOA 1EHLH 1QFWM 1D6EB 3MGTA 1ZV9A 2RFXB 3LN5B 4DK5A 3GMOB 1A6UL 5J1SC 2VJ8A 4Z76A 1NGYA 1BVKB 2XETA 4LLDA 4AH2A 2XG5A 2VXUH 3MCLL 4GIOA 2NT1A 4MZ2A 2O6CA 2YAEA 4FFTA 4W9JC 3VWKD 3L4CA 4MD0A 2NY2D 4DK6A 5DUBA 3NZHH 4OM0H 4PJXB 4LVNC 3TP4A 3TBSA 2FZ3A 1ADQL 2J88H 5GRJL 4ZOAA 3SDCB 1IBZA 3SPVA 4LLMB 4DNLA 4R7DA 1C5CL 2DW5A 4PJHB 1MDAA 2NY4D 2OTWA 4WNQB 1EHXA 1TYJA 3AMKA 1L9TA 1LEGA 1H15B 5IFJA 4PVMA 1XZWA 1AKPA 4WEMB 3FN3A 3RY6A 1S9VB 1Z3GL 1MXGA 1QRNB 4JDEA 3S5LG 4EZKA 4ZNEA 3TCLB 1AKJA 5LG6A 4KKNA 2H7WA 4WK4B 1BWWA 4OM1H 3MLSH 1Y0LB 3KBEA 3MLWL 4C54A 1TU2A 1ZKAA 3QUHA 3WN5B 2XQBL 3GBLA 2I9LB 3A6BL 3BUQA 3IU3A 1GY2A 3LKRB 4PFEA 4Q8BA 4X5WA 2OM5A 4NC1C 1RIUL 4OCRH 3BAKA 4FQ2H 1E9PB 1DVFA 3REVB 3WHE0 3PDOB 1YY8A 4PLNC 2DOCA 2V33A 2O61B 2QFRA 3O4OC 4WTZG 1T6VN 5LN8A 4QNPF 5HHNA 4ZQTA 4PSRA 2VLKA 2QZ5A 2ZUQC 5EBMA 5T1DL 3GHEL 4AYEC 1JWSB 4HCRH 2ERJB 3EHBC 3RJOA 5CKGA 3T2OA 1JFQH 5GS1C 2AV7B 5TF0A 3CFTA 3ZE2F 1T5XA 4MCZB 3CMOL 3QIBD 1J9RA 2GVYA 5DWUL 4ONHA 5I19H 4LASL 1SMDA 1MIEL 2DJSA 2TSBA 4Z7NB 1VEOA 4MMXB 1JGEA 2MQ0A 4ZFOA 1KY7A 1QBML 2XICA 3GS7A 3PPEA 3H9ZA 1GGYA 2CO2A 3LKQB 4KXDA 3KWWB 4YPJA 2P1YA 3EDDA 4UZUA 1MPAL 5ISZA 2DM7A 2L4OA 2EDFA 1VEPA 1HOCA 1D6VH 2IWKA 4I3SH 4L3ED 1OT4A 3NTCH 3NFNA 1DL7H 4UZGA 4QRQB 5AQ0A 3DOIA 3PNWA 5F7DA 2AP2A 3HR5A 3S6CA 2OA9A 3TYFA 4NP4H 12E8H 3SDYL 2W0FA 4TULH 1SXCA 1U8IB 3AACA 5ICXB 4W93A 4WV1A 4OQTA 5FECA 3F58L 4LLQB 3MNWB 2H2PD 2FD6H 4MA7H 1LK3H 2OCJA 3SE9L 3NCFB 3GI9L 4L3EE 3CDGB 4MBOA 3GSNB 4UTAA 5A2BA 3O41A 3OTTA 1HILA 4IBWA 3JTSB 1X9UA 5EO1A 3GMMB 4HUCA 3OSVA 1N18A 4ICWA 4F2MA 2YBGA 3A0OA 3PE9A 3U7WH 4BUQA 1RY7B 3VCLB 1FZJA 2XKUA 4OTXH 1Q0YH 3ET9F 5HYJB 1UFGA 4NPJA 4U6HB 4YUEL 5KS9E 2HRPL 4NUJA 4Y1AD 3SDXB 3Q1SH 2PYFB 1IC7H 1SF5A 3QNXA 2B4CC 1KCLA 4NB7A 4HS6A 2YPLA 1A7RH 4QRRD 4TUOB 4HS8H 4W68A 1M7UA 3L1OL 4LDOB 5GGQH 4FYTA 1IGCL 1ACYL 4GQQA 1A5FL 1NANH 3FB6B 2F8XC 1HI6B 3ZTNL 3CC1A 1PJWA 3FQWA 4LHUA 1OGTB 1MSPA 1LVEA 4BGLA 4DTGH 5I23A 3AS0A 4L4TD 1IU1A 2VR3A 1XF1A 1NFDF 2A6DA 2BY0A 3IDGA 4Y1AE 4HALA 3D52A 1TTBA 4YHIB 1TG8A 1D5ZB 4ODVL 4QRRE 2F0CA 3LN9A 4OZFB 5C6TL 3U6XS 5IEKA 5KUKA 5L2KA 1P4BL 2ADIB 4MNGB 3C9NB 4XN5A 1EERB 3WNLA 4OZIB 2UWEF 2EDDA 4KQ3L 3VMNA 2XQYG 1B4JH 4I1PA 2I26N 4I48A 1YEGL 3DVNA 3LQAH 1A6WH 1DQQA 4TV3A 3NACL 4JFWA 5FFLA 4XPHH 4ZMYA 2R39A 4I9XA 2NRDA 1PX8A 4OF8A 3FMGH 2YAQA 1ZGLP 3M1BB 3KAAA 3ALXA 3L9BA 1P53A 3BH8B 4J3BA 1IX2A 3IGFA 5HYSB 5I6KA 1ZV5A 3SGJA 1SOKA 3ARBC 4WCYL 3T3ME 4F9LC 4PJIF 5FK9B 2OMUA 2I5YH 5E6ZA 1CK0L 3QNZB 3DX6A 3HRZA 5IQOA 3V4VA 4JPQA 4KKRA 4G8IA 2Y3AA 1YN6B 3NJHA 3UP1A 4F24A 3T8XB 3PHAA 1UACL 1IILE 4U1MA 3ROOB 5FCSH 2FL5A 3RNQB 1QSFA 5DHXB 2OCCB 3QXWA 1ED3A 3SYOA 3BN9C 3T0DA 4MJJA 5TGBB 2JF1A 5FUOH 1O7VA 4L8CB 4R83A 1EXHA 3GRGA 4WVRA 1Z5YD 1QSVA 1TQSA 1Q9OB 2DTML 5K59F 2YJQA 4I85A 3DRQB 4R4NC 3W37A 4FQJH 2YGOA 4ZUUA 3CIQA 4K3DL 3T2QA 2CO6B 1UWGL 1A4KA 1VACB 2NQDA 1LEKA 5EIIA 3KZ8A 4P3DA 1RFDL 1KCVH 5F88A 1GAFH 4QXUH 4IK7A 5TE6H 4AIZB 4OJYA 3RWEB 2QSCH 1TNNA 3LH2L 5D1ZD 4XWOD 3FZUC 3VFGH 5IEHB 2JELH 1RERA 1OOWA 2F5BL 1JMXA 3VFNA 1MI5D 1HHKB 4ODWB 4PI2A 1SM3L 2VXQH 4PJFF 5TPWH 4UM9D 1IC4H 3KLHD 1X7SA 5F6HI 5L8KB 1S7TA 1KB5H 4QRPB 4QF1A 4X9HA 2BSRB 3VFWB 4ZYKB 5FW8A 4XAWL 4GOSA 4YR6A 3ENEA 1OAXH 3CXDL 3QCTH 2UWEA 2FH8A 4XBGA 2WJ7A 3E3QE 3HPLB 1MI5E 4JFXB 3MV9A 2YAOA 4UV7L 3F00A 4NKOB 4XVTH 2V17H 1NCAL 2EYTB 3LZOA 3QZLA 3UP6A 1WCBA 2A6JA 5DJ0A 2NY5C 2UXFA 1ADWA 3FB5A 5IMMB 2Y1VA 4OFYA 3MPCA 4P9HC 2CLVB 3IDIB 5KBLA 4JM2A 2JQMA 3F84A 1AYOA 1FO0A 5DJ2A 4QHKI 2UUDK 3CDZB 3DMMB 1NMAL 4FFVC 4U1GC 2QQKL 2VITB 3QZOA 4PJIA 4XXWA 4FP8H 4NNPL 1P1ZA 3S37H 3DO7B 5JNYB 4HKZA 5IBLD 1WD8A 3ZE0E 5D2NB 1AQHA 3BD5A 1NJ9B 4ZO7A 5IB4A 3PDGA 4A7TA 3JTTA 4QHLA 2CG9X 2GI7A 3K80A 2J4WL 3ZKNC 2UZXA 1VPOH 4FTDA 4HBCH 1NKOA 4PV9A 2LLLA 5IF0B 3L3IA 1MJJA 3PHOA 2QADC 4NZUL 4ODXB 1JXGA 2LU3A 1R3KA 2DMHA 3LEVH 2AI0L 4JM0A 4KROB 5DO2D 5AB2A 5JUEH 3IJSA 4L1TA 1OCCB 2F8IA 2VABB 4TVPD 4Q9QL 1KTJA 4JRYA 4GPVA 2OMVA 4IGBB 2OJZL 4HH8A 4C4KT 1VEMA 2ICWA 4AGNA 1NCJA 9CGTA 3Q1EA 1IGML 2IPUG 3D06A 3OC5A 3H6JA 3DA0A 4M8QA 3TGXA 4OU3A 5L2JA 1XO8A 3PL6D 4FTVB 5G5DA 4YJZL 5K9JL 4QCIB 2DLFL 4J7RA 2I60H 2WZ6A 4HK3N 5LN4A 2Q2EB 4Y4FA 5DHEA 5E6IA 5CINL 1AZZC 1YEKH 2Y25A 3MTRA 3RZCA 3HNTH 5GQBA 4HIJA 2HFFB 1TETH 1XCQA 2W80C 3VVVA 1B0RB 3VTAA 1DBAH 3UXFA 4DEWA 5LDUA 5I1GL 4M61A 1BQKA 3V7AE 3N3EA 2NY0C 4U3XA 2ZSWB 1AG0A 2VZUA 5ANMA 4JPVH 2JVUA 3KGRA 3CMGA 3EJZD 3QULB 3UPRB 3WI9A 1IVLA 2FO8A 2BNQD 2WPGA 5CIPA 4MX7B 4PRPA 1G5GA 1N8OE 4JFOB 2HKHL 3PGDA 3PGCA 3F04A 15C8H 5EDSA 1K5NB 1K4CA 1LDPH 3UTQB 1JHTB 2OTUA 5AB9A 5E5RB 1HEZB 1NCDL 1ASQA 3PAVA 4MVBD 1HYSC 4NLAA 3GIZL 5BQ7A 1HEJC 5CEZD 4LHJB 4GUCA 4TXVB 2WD0A 5E9DD 3RL2A 5CM1A 2V9UA 5I24A 2MQCA 2VDOL 4NNYB 2R1XB 2GBVA 2AEPH 1KT2A 5C2UB 3TEXA 2BNRB 2NY1C 3D0LB 2XN0A 3ULAB 1RUAL 4OD3L 5JO5B 2YHGA 2JKNA 4BELD 5H94A 3L16A 1F97A 3T1FB 2B20A 4P5TD 4ZMTA 4E0RB 2COVD 3OKLA 2XXMB 2HX7A 5B39G 1PIGA 3OKNB 3ZK0A 4F8OA 3K8MA 5E9DE 2Q6WA 4DKTA 4YHOL 3H9SD 1RJCA 3RVUC 3O9WC 4L8SB 3KNBB 5HDBB 3M17A 4P46D 3IXTB 3A4DA 1QABA 4JO2L 3MBXH 3SGDH 4O2CB 4UV4L 5IKCB 3P4LA 3MRGA 4JFDA 5FCUL 2V9QA 2FJHA 3ARFC 4KHXL 4XN7A 3CFDB 3LCYA 4B9KC 1G6RL 4NAQA 3CZSA 3BLPX 2AGJL 3AXIA 1X5HA 4J4PC 1D5IL 3KJ4B 1TNMA 1E6OH 2Z31B 3QARA 1Z2KA 3D50A 2CHWA 2BVOB 3EGDB 3V10A 1WAAF 4RMQA 1FIGH 4ZX5A 3ARZA 2Y06L 1IC5L 3UJTH 4P49A 5BS0E 4G82A 2X6UA 3Q6GL 5MEND 4IMKA 5BRZA 3TN0A 5KWYC 4Y19E 3BYYA 1AG6A 1T2QH 1UOKA 3O3DB 4HUKB 2VC2H 1GR7A 2AJUH 1XSJA 3QIWC 4PVBA 4CGTA 1RZKC 3M6DA 1AE6L 3GLEA 2WYZA 3EFDH 3D30A 4IU3B 3TBYB 2VDKB 2VT0A 4YXHH 5HGBA 5DRZA 3NABH 4L29B 3KDMB 3MRKA 4HUWB 3RZWA 4ZMPA 4IRZA 5MI0C 4AQ1C 2N7SA 4MAUH 3EG9A 4KMTL 5MENE 4Z7UB 3GI8L 1THAA 3KPLB 2YQ2A 2BZDA 3P0VL 4LGSB 1BBDL 4XCEB 3QQ3A 3HBPA 3R7QA 2OYKA 4S2SB 1IAIL 2R4RL 1AC6A 3QUXB 3CSYB 3U4BH 1T1XA 5DQ9B 3SJVD 1SDAB 1LK2A 3GMLA 1KEML 1P5VA 4GKNB 4CNIA 2GI0A 1X6NA 3MGTB 1TZAA 4LRNL 1UZ6F 1NCTA 2XACC 4HF5L 3WENA 4KKLC 3QUYD 4Z7VE 5J6GB 4NO0A 3JQOB 4XP5H 1WPCA 2D4FA 3ELAT 5D4HA 4Z76B 2VL4A 4LLDB 4TLSA 4AH2B 2XG5B 2KQMA 4BE6A 4JK0D 5EC1A 4D8PA 2JXMB 4FA7B 3QXUA 1ETB1 1VGKA 4ZRGA 1U8PB 3LRSA 4L9LB 1F02I 1T21A 5E8OB 3RJDA 3SCMC 3PWLB 3SO3B 2FSEA 2R2EA 4LARL 2GBAA 5DUBB 4PD4K 4LCWA 4IMLB 1LO4H 1QTPA 4XB8A 5DT1H 3SPVB 2VDLB 1AS7A 1B3JA 2P24A 1A3RH 5B3SB 1NFIB 4H25B 3MJ9L 4KX8A 1LEGB 4KWUA 1MFAL 5IFJB 4NSKA 1EX0A 1Q1PA 3UMTA 1JWUA 3K74B 5I73C 3QQ9D 2CBMA 2JJUA 2Y6TE 5BXFA 5IQ9A 4IIQA 4HIXH 1AKJB 3WUWA 5D5ME 3RY4A 1I7TB 1OARL 2F61A 4KZCA 2LW3A 4RGNB 1TU2B 1EMTH 4H20L 1O9ZA 3IU3B 1CURA 5JHDD 2BP5M 3SOBH 2RQEA 2KQNA 5B38G 7PAZA 3ILDA 1Q72H 3Q8AA 1DVFB 4DEPC 1YY8B 1ZVSB 2F58H 4I3RH 4WWID 3L81A 3QFDB 3UO1L 5EBLA 2OAAA 2EIMB 5HHNB 3MLVH 5EBMB 1YC8A 5AB0A 2Y7MA 5C7XH 4JKPL 1U2CA 4TTDD 3P2DA 3WOVA 1KN2L 5DXWA 3VYNA 1WGOA 5JHDE 3AREA 5JIHA 3S37X 5DZVA 4LF3A 4UTBA 4AUUA 4K07A 2XDHA 1A6ZB 5E8NA 3IJ8A 1JGEB 5EU6A 1OV8A 4JGJA 4ZFOB 3TWCL 1H8NA 4DAGL 4J2QA 1AAJA 4ZUVB 3VFMB 4M5ZH 2A6KA 4NQXB 4JHUA 4JFPB 3GKZA 4KJYA 1W0YT 2WCGA 2AQ2A 1E42A 2DQJH 3OSKA 4XNZC 4X9GA 1I7ZA 1KJ2A 2OQJA 5ISZB 3WE1A 3O2DL 3BPLB 5CUSL 2FBJL 2D03H 4LPCA 3NFNB 4O51A 4O02A 4KRLB 3TLRA 4X5XA 3IMUA 5K9OA 4ZS6D 4QWWC 5F7DB 3AAZA 1BXXA 1XEDA 3BP6B 3FW6A 3PQYA 1ETJA 4ZO9A 2FTAA 3ES6A 5CCHE 4PB0L 5AOZA 1RPUA 5J1AB 2VQ1A 2BOLA 2V37A 4WV1B 4P4KC 1NAMH 5FECB 2WCPA 2IV8A 2WXFA 3EFOA 5FLUA 1ICTA 3Q2LA 3VE0A 1DBML 4PIBA 2BPBA 1NPNA 1A64A 2KLTA 2O26U 1AFVH 3O41B 1KTDA 4YIQA 5LO7A 5GJSL 3E9TA 5KSBE 1OAKH 5HVHC 2P8LB 2VDQL 2OSLA 1RJYB 3VI4F 2OL3A 1SXNA 3B7YA 1FZJB 3ZYJA 3FUDA 2IH3A 4ELMA 3I3DA 5F89B 4FNQA 3WUZA 2F1AA 4G8GA 3BVTA 3RA7L 3VXRA 3TONA 3TO4B 3EZ8A 1NGPH 4PJ8B 3KS0J 3QZPA 4MD4A 3QNXB 1C5BL 3VXMA 1JF6A 4HD9A 1AGCA 1G1CA 3BQUD 3KJ6H 4XNAA 5SWQA 4Q4IA 4FRWA 1J9CT 3FU0A 2W60A 4FKKA 4IBLT 4XPAL 3FQWB 2VQ4A 2X12A 3I9IA 3P4MB 5F1SA 4N1EA 2Q76A 2YOAA 5DK0A 2A6DB 2CUMA 2EO7A 3IDGB 5IJKA 5CSBA 1SEQH 1I7UA 1PFOA 2PW2A 4Z7QB 3MRCA 1UWEH 5IEKB 4HT1L 2OSWA 5ILTH 1SNRA 1OTUD 3ZE2B 1K5WA 4J3VA 4NKMB 1IFHL 1YPZE 5IVXE 5I1LB 4AIOA 3TO2B 2MHAA 2ZT9C 3ATBA 3WTWA 2P43B 3B56A 4G9FA 4JKNA 4WEBH 1A0QL 3DVNB 3JWDH 5DA0B 3W39A 2WQRA 3QJXA 5LKNA 4OGXL 5I6XB 3ABMB 3PXJA 4J3WA 1K6QL 3LKOA 4BFNA 2RIKA 5JOEA 5KSAC 1Q94B 3QDJA 1NCCH 1ZLEA 1NBVL 4K9EL 3HKFA 1EHKB 4PG2A 1AGEA 1JVOA 3OKDA 1S7WA 5C07D 3EGXA 4MMZA 3HA0A 2GC7C 3WFHB 2OMUB 3DX6B 5D96B 3HRZB 4G8IB 3LZQA 3EH5B 4U1MB 2E47A 3JV4B 1QNZH 2FL5B 3F85A 1U9KA 4TUUA 1JOIA 5C0IA 4OGYL 5ADOL 4X4ME 1EHAA 1BQHA 3F7KA 4Z6AT 3B7RL 3WY1A 5E4EC 1OB1A 2ZIDA 5AVXB 3IN2A 3O6KH 3QIUA 1NUNB 4U4BA 3C08H 5C07E 3N40P 4ZJ9A 4E41E 2XWDA 4JG1L 5E94A 2X10A 4WWKB 1N2RA 1NA8A 4ISVA 4OFKA 5F9DC 3QUGA 1HIML 1ZTXL 4ZUUB 4UT6L 2YD2A 3ZMRA 1A4KB 1LEKB 1XH2A 5EIIB 3ILPA 1OAUL 4GUPA 4H1LG 2G75A 2F1EA 3M1OA 2KBGA 1MHCA 1YEEL 1CFMA 3NJIA 2Q7YA 4XVUD 1SHSA 4I2XE 4U1LA 3BIKA 2FVNA 1H5BC 4S0SD 4Z77A 4JFEA 4LVOB 8CGTA 2CHNA 4IRJD 3CN1A 4KVNL 5AZUA 4S1DD 1QFUL 3VFNB 4BH8A 1KTRL 3FU6A 4QXGH 1RIHL 2OZNA 2D7MA 3IRPX 4TSCL 1SFHA 4XP4H 5EIQA 3PWPA 1HAUA 2EIDA 1S7TB 4QF1B 3P3YA 1N64H 4WHTA 3T4AC 4I18A 3UPCA 43C9A 1W72A 1VKXA 4YR6B 1I9RH 1U8NA 3H55A 3L4VA 4X98B 3KPSE 2UWEB 2HRHA 3HFML 1R5IA 1E30A 1LP9F 2AABL 2WLIB 1HFUA 1BFOA 5C6WH 4LLAA 1EAJA 3M46A 4H4NA 4LBEB 2YXVA 1IT9L 1VFMA 1GJWA 1EFXD 5HHVH 3QYMA 1HL9A 1WCBB 2A6JB 5DJ0B 5C08D 3GDCA 5A2AA 4Y5YC 2WSKA 5DD5L 1P7QA 3W0WB 1S9XA 1ZS8A 4X7SH 4R7VA 3V6BR 4PJIB 4WO4A 3BE1H 3VXPB 2EIZA 3ZGIA 5AG8A 2G0LA 4OH2A 3BWUF 2HLFD 2MCG1 1VSCA 1XB6A 5C08E 1OEZW 4YAQA 5IB4B 4R8WH 4AL8C 3GJEA 5DZOA 3JTTB 1X7TA 1P6AB 3MZTA 1KLUA 4QY8A 4XVSL 5I71C 5BW7A 4PV9B 2EUXA 4BKSC 3U30B 3E1F1 4ABUA 3L3IB 4Z3IA 1MJJB 2CJSA 2VRAA 3PHOB 3K1KC 3U7YL 1R24B 3NJNA 1R3KB 1OTTC 3L3HA 5E99L 3IJSB 1FFOA 3VXQA 1ND0A 1IBGL 1DDHB 1T89C 4JFFD 2AV1A 1AGBB 1A47A 4B9FA 1HQRB 5DK3A 4JRYB 4MASA 4NENA 1CBVH 3QPKA 4G7VL 2QJDA 4U6VH 3WO3B 4FHBD 2JB6B 5I74C 2B59A 4C58B 4LAQH 5DK2B 4YFLI 4M8QB 5L2JB 4F80A 4A7GA 5IB1B 2OJEA 4KI5E 2VUYA 4DIXA 3C5SA 4XP9L 1AGDA 1BZQK 1RP8A 2VERA 3E9UA 5HPOA 1I9JL 5E6IB 4Y4FB 2J3SA 3KVDD 4JFFE 4KHTH 5I30L 1FHNA 1YMHB 1RZPA 2HH0L 5LCVL 4HQQH 1JV5A 4N24A 3MRMA 4HGWB 1CICA 1HH9A 4HIJB 4H8HA 3DIFA 5J56B 2NR6A 1XCQB 2VDRH 3DUSA 3FCBA 3QSKB 1SLWA 3HVNA 1TEFA 5FYKU 4M61B 5HGDA 2EO1A 3ZUCA 5I18H 3AS2A 5J06A 5JDSA 1FDLL 2A74A 4QYOA 4YL4A 2JKXA 2EKSA 5EEYA 4U1SA 5DRWB 5LGHH 4PRPB 1DBKL 1SY6A 2O93L 5L9DH 4C56E 1YG9A 1TVDA 5D7JB 5ENWA 5C2BL 1ID2A 2ODHA 2OTUB 1CTOA 4IS6B 4EPSA 4EN3D 4PB9H 4NFCA 3VH8A 5BQ7B 4K94H 4WI9A 2HWZL 4YZFF 2LGNA 3B2PA 3RL2B 1CIUA 1V3MA 1TQCB 2AEWA 5DS8A 2IALA 4UDTB 4RAUA 4LEEA 4XO3A 1KT2B 3HZ3A 5GS2H 4GG6F 1KBBA 3CVHH 3DYPA 5CLWA 1TVBA 2FSDA 5DZLA 3QEQD 2I07A 5D1XA 5EU5A 1NFDE 3D12B 4W6XB 2YRBA 3W56A 3FQUA 2GUYA 3OKLB 1MFDH 3BGFB 3E38A 1IV8A 1E7VA 2RQ8A 1KXQA 1T66C 5JZ7C 2QHRH 3MV8A 1USZA 1AC0A 2XBZA 1E43A 4QTIL 3MLZL 1S9WB 1NSNH 4FI7A 4YE0A 5JW4M 4LLUA 1VFBA 5A3ID 1NDTA 3OM3B 1ZANL 1UXWB 5EWIL 1DDTA 4H1LH 1CE1L 2K6YA 4A37A 4N26A 3G6DL 3QEQE 3P4OA 4BZ2A 5C0AD 1N10A 4JFDB 4CBZA 3QQDB 3C5ZD 2WP3O 5B1BB 4L0PB 3FUIA 4FG6C 1SLXA 4NBYB 3CFNA 4V2CB 4ELDA 2W07A 4LO9A 4P23C 2IMNA 2XIIA 1XD1A 4C4UA 1ULVA 2EECA 2ENPA 1A6UH 3BI9X 4NYLB 4ZXBC 5K39A 5CAYB 2D8KA 3MCLH 3MCG1 4PJ5A 4W4OC 3PIQB 4FQXD 4QRBA 1IO4C 5IMKA 5C0AE 2F15A 5FYKL 4NN5B 1Z66A 4NQDD 2VR5A 1IEHA 3ILQD 1ADQH 2IWGA 1M9SA 3TT1H 2LVCA 4PJ9A 2YSTA 1NGZB 1XX9C 3FT0A 1C5CH 1JK9B 2PWHA 2IPTH 3GPSA 1NCHA 3KBFA 5HGBB 5DRZB 1TJIL 3DSNA 4HUUA 5FDYA 3ZSTA 3FUJA 1KIUA 5DR5L 3WS3A 4WK2B 1AZUA 3EG9B 1Z3GH 5DJXB 4NQDE 1G5AA 2GCYB 3CLEL 4HJGB 3IKKA 4PRID 1KLGA 2AK4B 4KO7A 3P54A 1KGJA 4NM4H 5IW6A 3NZ8A 5AW5B 1OAYL 4XRCA 3MLWH 5C9JA 4DP8X 3KPQA 3A6BH 1L7TL 3EF4A 3HC2A 1I8IA 4MYPA 4OZGA 3V4PA 2P5EB 1RIUH 2JSFA 5GGUA 3WEOA 3ZR6A 1LK2B 1P5VB 1EO8L 1I3GL 5DHYA 1X7QB 4KGLA 4CNIB 5EZLB 1CXKA 1OANA 3UX9B 4K7FB 2Z4QA 5T1DH 3GHEH 2EVJA 1RZGA 1HL4A 4LOUC 3BUPA 1MG3C 1NFAA 3K81A 4MJ4A 5EC1B 4MHHI 3FTXA 1VGKB 1P7BA 2ZOTA 3CMOH 3GZPA 1BVZA 3O3EA 4OJEH 1T21B 2YD0A 4RDQF 4Y5VB 4LASH 5DWUH 3FQ4A 4XBMA 1MIEH 1XGPB 2CKBL 2R2EB 3GINA 5J5EA 3SKMA 3LRHA 3BPNC 4LCWB 5SWSD 2AANA 7TAAA 3QRBA 1QBMH 1S7RA 2P24B 3BKML 2R1YA 5C0FA 1HXMB 4AE1A 4U49A 3MRHB 4Y5XA 4H5SB 1A14L 4NSKB 3QDME 1V10A 2PO6B 1JWUB 3HB3D 4UAOC 4FKEA 1WDAA 3KW7A 3BRDA 4M1CD 4KDWA 3LSOA 5IQ9B 3BUIA 4IIQB 3WUWB 1WG3A 4M7LL 5SWSE 1F5WA 1G7LA 2MPVA 4N0RA 3VFSB 1HHHA 3PP4L 2NY3D 3SDYH 4AQAA 4LP5A 2D2CC 4F2FA 1B0GB 3F58H 2ZP8A 2RJMA 4IJTA 3SE9H 3KBHE 2YKLL 4RMSA 1T5WB 1S7UA 4L2LA 3I6KB 2OR7A 4B60A 2E27L 1EVTC 2PWDA 3EOYG 3QJSB 3QJQB 4CU7A 4JRXD 3WDJA 1T03H 2BHZA 3FC8A 4MSWB 4XMKH 2ERJC 3D3VD 3D4GA 3AREB 3I6LD 1Z9SB 1NBYA 5T1MA 4LF3B 1PNCA 4N6RB 2DEYX 5E8NB 3UTTB 4MGXA 5E6SB 3IAPA 5EU6B 2HRPH 4NO3A 4LVHC 4QKTA 1WSST 1ZJBA 1VZHA 2CRZA 1HXYA 3MN8A 3WFBH 2H4EA 1HZLA 1RZIA 2DQDL 2G5BA 3L1OH 4PY8I 1SBBA 3B1UA 1ACYH 3LB6D 1I7ZB 2RTTA 3D3VE 1KJ2B 2OQJB 4IOIA 1KELL 1ET5A 4N25A 3ZTNH 3I6LE 4HXBH 1QEXA 2WLLB 1P2CA 3FCGA 3FO2A 1A4AA 4O02B 4UYPA 4GRLB 4JKLA 4ENEC 1WAEA 4TQ8A 2WW8A 5K9OB 1TJGL 5CGTA 3AAZB 5KVFE 1J1XL 3PQYB 5JXED 1ZLSL 3ES6B 4TNWK 4A2FA 5C6TH 4PQXA 1E4XL 2VQ1B 1P4BH 2X6AA 1MFUA 1J1OH 2WBJA 3CQPA 4GT7A 3BZFA 3EFOB 1E2WA 4JFUA 4Q2ZB 4ZAKD 5TE7L 3VE0B 4CW1A 1J9QA 1RPQA 5LNEA 5FO9B 4F3FA 4AEHL 1TZGL 4OZHA 2GQHA 1YEGH 3QB7C 5FYLD 3N1QC 5J13B 3DARA 1P84K 4OIBA 3H85A 3NACH 4YIQB 1U8JB 4KJQD 4U6XB 3HMXL 3SYAA 1BJ8A 5DWPA 2OL3B 2YD6A 3TF7C 2DL2A 4Y2DB 2IH3B 4ELMB 4KTGA 1TO5A 2R0KL 4G8GB 3FOLB 3FQXA 2PABA 3VXRB 3G9AB 1S3KL 2P3YA 4KZDL 1M7IB 1UJ3A 2X0VA 4MD4B 4WCYH 4KAQL 2J1ZA 5AW2B 1CK0H 1BM3L 1WCQA 2Q20A 4GQZA 4PSPA 2HFEB 4I7ZC 1SDDB 2AITA 5SWQB 1XZ0A 2ZP0T 2NXZD 2VN6A 3RAJL 3N1PC 3QJRB 1J0ZA 1IB5A 1BHGA 3BMWA 4L3FA 1KDIA 2Q76B 5DK0B 5T3ZL 2Z9TA 2P28B 1O6SA 2JMRA 5DQJA 3WCYA 4PJEE 5GS2D 4MRCA 1PFCA 4EI5A 4Q52A 3I3BA 4DN3L 5KYXA 2DTMH 4OI9A 5GS0D 4IK6A 5I8OL 2OSYA 3KCPA 4Z7OB 5BUPA 5I16B 1T7XA 3PJSA 4K3DH 1UWGH 1ZLWH 1HS6A 4FG2A 3SPHA 1RFDH 2WXHA 2GIYA 4F8TA 1N6UA 3DXAD 2BO0A 1J11A 3PHSA 3LH2H 4IRSB 3TS8A 1QFOA 3T3PE 2HT4C 4QTHA 1U6AL 3T6VA 1ORQA 2F5BH 3P73A 2O30A 1SM3H 4HCIA 3OKDB 5GPRA 2VO8A 4Y2OA 1S7WB 5I1AA 3VD3A 3KPRA 1S7VA 3DXAE 5HVWA 1ZT4A 2Z65C 2HP4A 4XAWH 4V1DB 4J3SA 2DKUA 2X4NA 3OMAB 1BQ5A 3CXDH 1JXDA 1NZRA 3EADA 1KLFA 1N8ZB 3RUGF 5C0IB 3HI6L 1ILUA 1F3DH 1WS7A 1BQHB 5T1KD 4CBPA 4KXZI 4UV7H 4XCYB 2TRHA 2G5RA 1OB1B 4U7KA 3QIUB 4GI8A 5ADPL 5E2JA 1PZ3A 3STBA 5E94B 1NCAH 2ISDA 3UIZA 4PS4L 2FJGA 4FFWC 4GW1A 1N2RB 5LBVA 4ISVB 3BCDA 3CK0H 4N8VG 4PRHA 3U79A 3VI4B 3KXFD 4WLCA 1U58B 2XZAL 1HCVA 4NUPA 3CSBA 3SE8L 1KIRB 3ILPB 3OKOA 3JT0A 4GUPB 1IBHA 2F74A 4HJJL 1ZXKA 4UTBL 4ALAL 2GAZB 4IOSA 1QBAA 1NMAH 5AVZB 2BRQA 1MHCB 3DETD 4GY4A 1OALA 2IH1A 2QQKH 2EC9U 2Z1KA 2Q7YB 1F4WL 2GFBA 4URTB 3BIKB 2JWYA 4NNPH 3O3AB 4ICXA 2GJ6B 3IEAA 4J6RL 4JJ5A 4JFEB 1DQDL 1YEIL 3L5WA 4NDMA 4F37K 5CEXA 4BH8B 4NQEB 1IM3D 4I77L 4WDIA 4YHKL 2P5WA 2VDPL 4PAZA 2H47C 4GXFA 5CP7A 2FQGA 5H37G 5SWZD 4UB0H 5I1KL 2J4WH 3C75A 1YYLL 4ODHL 4WHTB 4GUOA 43C9B 4YDLB 4YDIL 1W72B 2XYCA 1JYXA 4MNQD 3R0MA 1U8NB 3NPSB 4NZUH 1E5ZA 4Z95L 2AI0H 4I4WA 5D93B 3VU2A 5BRPA 1BP3B 4Z7IA 2C7UA 2BERA 4JBSA 4Q9QH 4CN1A 4IKIA 2FQEA 1KTLB 3VWKA 2OJZH 5IZ7A 4LKXB 1IGTB 5KSUA 1SDYA 2DLIA 1U8LA 1IGMH 2H3NA 5JHAA 4MNQE 1JRHL 3AMLA 5K9JH 2DLFH 2YGNA 3NSXA 3ZTCC 5F44A 4ZUSA 3WFCL 4DKFH 5K69A 1P7QB 4PCKA 3UMNA 1S9XB 1ZS8B 2Q10A 3C6LD 4N2AA 3S2CA 4Y4KA 1Y1UA 3WLBA 1BECA 1NGXB 3RDTC 4UOZA 4WO4B 3B9EA 3DMMC 1FN4A 1AZBA 2DWTA 4EKXA 1I75A 3HG1D 3RFZA 2VERN 1ZVHA 1PMYA 3WNMA 5I1GH 4YAQB 3LKNB 3ARDA 4S11A 4ERSL 2NNFA 4YXLL 2V5TA 4LFHG 4CMMA 3ZQWA 1P0SE 3GJEB 5D2NC 1KLUB 5I8EA 1TZHA 4G5ZL 5A6IA 3QNYA 4AI7A 5EU7E 5AW7B 1FP5A 3NIGE 1WBYA 1ITCA 2HKHH 4PREB 3LXCA 3ZO9A 4UQ3A 2QTEA 3E6FB 4EZMA 5SX4I 5LQBL 3VXQB 2F9BT 1ND0B 1MFNA 2X6CA 4AE0A 1NCDH 4NRXA 4NENB 3X1GA 3GIZH 3FFCD 3FAWA 1JYVA 1G0XA 5CCKL 1DBBL 4P9HL 1OSYA 4N90E 3H7BA 2VDOH 4FLSA 4K15A 4OGQC 5DHDA 1KXHA 2IDSA 3BAYA 4DGUA 1EO7A 3BLKA 1JZHA 3TURA 2FJFA 5EEWA 4PW4A 2OJEB 5IJCC 3AU0A 1RUAH 4OD3H 4OT1L 3DOSA 3QJUB 4KJPC 3K6OA 5IQLA 1UA7A 4DUVA 3KBPA 1BPVA 3SD2A 3HNSL 2WUCH 3MRMB 4UILL 4IDJL 4TVUA 3DIFB 3GXNA 4JL2A 4YHOH 1UATA 1OLLA 4PG9A 3C60C 4Y2NA 4G6FB 1OE1A 5FA3B 4YPGB 2GT9B 2QVTA 3ULVD 2JJTC 1VFUA 4JO2H 1TF4A 2AAVA 2C9VA 3DV6B 3JV0A 4G6AC 2KPWA 4UV4H 3UZEA 5FCUH 4AEEA 1SJEA 3JWOL 4KHXH 3TU6A 4GJTB 5CCGE 5IB3B 4QYOB 4EVNB 4BFJA 4IKJA 5JDSB 3UTOA 1G6RH 4DUWA 5AWNH 2VLME 3F05A 2EKSB 5ALCL 4U1SB 2CAKA 4N0UA 5AYQA 4ZW6A 4R7XA 3SDCD 3DV4A 5CLXA 4YHZH 1D5IH 5ENWB 3QISA 4A1RA 2E9IA 4EKJA 1AANA 5KW9L 1E2VA 1IKOP 1QLEL 3ULVE 1IL1A 1I1AB 3VH8B 1IC5H 1F2QA 4F91B 3HZVB 4JFYA 3O3UN 3OJ2C 4JN2A 4AITA 3Q6GH 4HSQA 1PX4A 1QRND 1FNHA 4AEIL 1XR9A 5DS8B 2IALB 2YAHA 4JQXC 2VLRA 3QR0A 2PYEA 3D0VA 4RAUB 1XTMA 5TJWK 4L0YA 1AE6H 4FI8A 1RPKA 1KDJA 3RI5K 4PJHE 3R1GL 5AVSB 3UAJD 2I07B 3EUUA 5D1XB 4HHAA 4Z3GA 4KK9D 1WFNA 3AXHA 3HEIB 3FQUB 5EDXA 4ATWA 4GRMB 5F1NB 1NGQH 4KMTH 4ONFL 4L4TA 1S9YB 3MV8B 4HWZA 3GI8H 2DYRB 1Z3RA 3P0VH 1L9SA 4LLUB 1PSKL 1BBDH 2NYKA 2WKGA 4FJ6A 3PABA 1IAIH 1CT8A 1QO3A 2GHWB 3QORC 3MGAA 4GO8A 3V0EA 3QA3B 2E9JA 3VXSA 4L8SC 3P4OB 3B83A 1N68A 1J5DA 1ZHNA 1M2VB 1QPXA 4A6YA 4ZK8A 1K4DA 3UAAA 2W07B 4LRNH 2EE3A 4A39A 4HF5H 3VYOA 2SEBA 1PDKB 1UA3A 3NCJL 3X14B 1X6LA 2KH2B 4A2LA 5K39B 3VGBA 1J0YA 1C7TA 3EZJB 2DBJA 3AW5A 3QBTB 5IMKB 2A4EA 1VGEL 4P3CH 3PHQA 4LARH 3SKNA 5JOFB 1ZHBA 5KVEL 4J3TA 4MJHA 4PJ9B 4LKCA 2GJJA 4BXVA 2R7EA 4JM4L 2XJLA 1I31A 2EIJB 3MJ9H 4RH4A 4ZSOA 2VDOB 2ZOKA 4HUUB 5EOQL 1KIUB 4D0CA 3CZFA 1ZXQA 2CMRL 2VZVA 2JJVA 2ALAA 2Y7LA 4Z8FH 1F1DA 4KDVA 3WTSA 1KLGB 2XN9E 5EFIB 3SO5A 5IW6B 1OARH 1YMMA 4GMSL 4XRCB 3WHE1 3ARVA 1AR1C 5C9JB 4QR7A 2R8SL 1N7MH 3KPQB 4H20H 1Q0EA 2YGVA 3U46A 3V4PB 4LIQE 4FEIA 5GGUB 5DHYB 3UO1H 2AQTA 3HE6A 1MCLA 5B1CA 3VA6A 4U2YA 5E5MB 5F7BA 3QFGA 3CDYA 3LEYL 2WTOA 4JKPH 1ANUA 3G5VA 4GAYB 3ZDWA 3TCTA 4XT1C 1URLA 3QDHA 1KN2H 2IF7A 5E2UH 3L4UA 1D7FA 1RZKL 3O3EB 4X5LA 5L8LB 3DX8A 4FJZA 1J0KA 5GGRY 3HHSA 1C5DA 3UBXI 1FA4A 4UM9A 2YWZA 3SKMB 1G9HA 4XMTA 4UINL 1G7IA 3SO3C 3SPIA 3TWCH 5LNDA 3V6OA 3SDXE 5DJZA 4DAGH 1KPUA 5J11B 1JNJA 4FLQA 3WYRA 4JPIA 1X5AA 3MACL 3RP1A 4GINA 3VXOA 1P4IL 3C8HA 4AXWB 3BPCA 5CN3A 3ZYIA 4APQC 4Y5XB 5F7AA 2NYYC 4J23A 4MDJA 3CFUA 4J3UA 1ROCA 1LE9A 2P4AB 1IGYA 3Q5OA 1NKRA 4N6QA 5CUSH 2C9QA 1AQMA 1T7WA 2FBJH 3LSOB 2VM4A 5HD8C 3AXLA 3LMJL 1A2YA 1G7LB 5CP3A 5DJCA 1A1MA 2GJRA 1HHHB 2DD8L 1PY9A 4PB0H 1K8DA 1C8QA 4AQAB 1GYWA 4RGNC 4OZIE 1DFXA 2D9QB 1R3HA 1SRDA 4OLWL 2AFNA 2ZUXA 4CVZB 1J88A 7FABL 1DBMH 3SBRA 1GC1L 2NZ9D 3FNKA 4FQCH 1S7UB 3C09B 1Z9NA 2NQCA 4LSQH 2EH7L 3FHEA 3BC9A 1HDMA 2JB5L 1I3UA 4LCUA 4LHUG 2Q2LA 2QKIC 2FBRA 1MWAA 4YWGL 4HULB 5GRXG 2VDQH 5HHOD 5G2NA 2BX5A 5T1MB 3FRPA 2RH0A 3RA7H 2X4RA 4UT9A 1MCQA 3E6HA 3GMPB 1TYRA 1AO7E 1OCWL 3NOIA 4NO3B 3H2PA 4DOHB 1FF5A 3LDBC 4F15C 1HXYB 1C5BH 1RZIB 4G8FA 4LSRH 4ZO6A 4OIFA 1G7MA 4D2NA 5D7IE 3QS2A 3A6CL 5HHOE 5C71A 3J7HA 2MOVA 4KY2A 3S7GA 1Q9LA 4ZQKA 1JUFA 4HWNA 3TX4A 4F93B 5J9PB 6PAZA 1P2CB 3FO2B 4TNVF 3GXUB 3PF2A 5DEGA 1S46A 5GZOA 3LNIA 5JR1L 3OLGA 1GYVA 4RNRB 5A2IH 1J10A 5F7WC 2EXSA 4HT1H 2YQGA 3PL6A 1DZ0A 2WBJB 4N8UA 1QZ1A 3MV7B 3BZFB 4HK3J 4W1TA 4CW1B 3S88L 1TTFA 1JERA 3K71A 5IMOA 5EO0A 5L4IA 3U36B 1QA9A 5I8CA 4B9GA 2WQWA 4XMLL 1A0QH 3W3BA 5TDPA 2Z7UA 3D5OF 2NXYC 1II4E 2MPAL 2XWBA 2ZUYA 3TJHC 1K6QH 4BHUA 3MOQA 3TNMA 4KTDH 1MRFL 5E8EB 4IHOB 2WQUA 1NBVH 3VRIA 4K9EH 1YYML 2ADFL 2A83B 3FQXB 2BWIA 1JIBA 5EC2B 3JXAA 3L5IA 1UJ3B 4OBSA 4Z0XA 5BJTB 3NGBB 2NY6B 2OXHA 2BNQA 1CXFA 4WNSA 2NZIA 1G4RA 4NBXB 3TO4C 4XMVA 4PJ8C 2VN5A 5EIIG 1W0WA 4PJAF 4GNKB 3ZDZE 3GF8A 1XZ0B 2WBWB 3DRTB 4YZFE 4LZKA 3NBNA 3VGAB 3EO0A 3QQ4A 3X1EA 5CFHA 2C1OB 2PR9A 3N40F 4OGYH 4OBRA 5ADOH 3ABGA 4NP9A 3DMMD 1BWMA 3G5ZA 1AGFA 5B22A 5AVQB 3AWFA 4JG1H 1T0MB 4EI5B 5DFTA 3D1MC 4QMEA 5GGTA 4HK0A 5KYXB 5J12C 3DGDA 5JQ6L 1CDBA 2D7TL 1HIMH 1GKOA 3DECA 1KGCD 1GW6A 3VTTA 5B8CC 4PRBA 1FYTE 1OAUH 3MRLA 3MRPA 3L9RB 1K3ZA 2CALA 4I0PB 4KUZH 4G6KL 1YEEH 4CL7A 5LHDA 4RAVA 3H9SA 5HHPA 2HTKD 3BCFA 4MZIA 5J3HC 3V5DA 2XIDA 4NM8L 3J8F7 3LZPA 4O5LH 2JKIS 4KROD 4ODUA 4KVNH 3CFEB 4X4YA 4Q6YA 1ORQB 3FT9A 2ZYHA 4JGNA 1FFNA 1RIHH 1NEZB 1OD9A 1Z0NA 2XXFA 4TSCH 4E9TA 3GB7A 5T1LA 3QXAA 2ICES 4IGBD 4Y2OB 5LJYH 2WINA 3FRUA 2R9HD 4FHJA 1XH3B 3LRKA 1S7VB 2AXHA 1XIWC 1ZT4B 4HP5A 2WWMC 4PBWD 1J12A 3MLRL 3VXTB 5CD5D 1R19A 2J2ZB 2J8UA 2Q86A 4FTVD 1J5CA 2XTLA 5DMKA 4NRZA 1CMOA 5G55A 4L8DA 4UU9A 3HFMH 3ZT6A 4OQTH 2BIIA 1KJVB 4MXQC 4JFVA 3WDHA 2CK0L 1MCBA 1M7DB 1CDIA 5AAMC 1IT9H 3QJVB 5CNHA 3VXUA 2FJGB 4GW1B 4IKKA 1A25A 4K5OA 4NEHB 3VD0A 5FS5A 3VDBA 3VQ2C 4FTVE 4WWKC 3A23A 5DD5H 2WLMA 1GIGH 4XMXA 3V5HB 2M1KA 3QPQC 2F74B 3QQNA 2KUTA 4ZFFB 25C8H 1KPRA 5A2JH 5IROD 1MH5A 2IH1B 1FAIH 3FN9A 1OP4A 3SZ6A 2ZWSA 2AJVH 2EILB 4PVLA 3GHPA 4M5SA 4LOEA 3OLEA 2GG1A 2BSCA 3L5WB 3H53A 1IAKA 4WWPA 3ZKXB 2P5WB 4NKIL 4EIBA 1PKQE 4HIIB 2YRZA 4XVSH 3T71A 2XXGA 3B43A 4HMDA 4YSPA 3I75A 2JIXD 3AT8A 1QSEE 5L7XL 3U7YH 4G72B 1FFRA 2BNRD 1YNTA 3H7LA 4I4WB 5D72L 5I75B 1KCUL 5E99H 4AYMC 2MRYA 1QTYT 2C7UB 1IBGH 2E7CA 5L4JA 4DGIL 5F0LB 5BQDA 1MFBH 4JVWA 2QBWA 3QUMA 4X8JB 1FL6B 3GYRA 4G7VH 5KSUB 4G70B 5D1QC 1U8LB 4WW2F 3NDYE 3UERA 2WXKA 4ZFGL 4EXKA 2HT2D 4P4RB 3RVVD 2YXFA 4PWFA 2FX9H 4X9BA 4ZUSB 4XP9H 3SZKC 3HN8A 3SBWC 1I9JH 4MLIA 2CLZA 1TCMA 2HH0H 3UBXB 5MEPA 5ICZB 4Y4KB 5LCVH 4JJOA 4JCLA 1YY9C 3WLBB 3ME0B 3CQQA 2E76C 4CSZA 3NSDA 4PTTA 1FN4B 1VFAA 2EUWA 3FPXA 3EFFB 1AZCA 4XVOA 4XPBL 2Z31D 3V4VH 2MEJB 2JCWA 3OR7A 3FTWA 3RUGB 2VDML 3ARDB 3M07A 1NUGA 3WHXB 3JWDC 4CMMB 1ZOXA 4OIIH 1ODAA 4FLHA 1DJXA 3OHMB 5KVMC 3ARBA 2WLYA 2PPEA 1FDLH 1ET8A 1TZHB 4F9LA 3GS4A 3MU3A 3QNYB 3OG6B 3G7TA 4QOKB 4PLJD 4U0QB 2K6ZA 3WS6C 1DBKH 1N67A 3KPNA 5AW8B 5DRNA 3G5XA 3Q6FB 2OSXA 4PS8A 2FHBA 3UAFA 4RA0C 5CEYA 1IBDA 3IAGC 2VZOA 4LEOA 3Q44A 4R6UA 4ZFZB 2HWZH 2V9TA 1ES0A 5I5RA 5FHAL 2IH8A 3TV3L 2K45A 5I0DA 4AM0A 4H8PA 3G6JA 1W8EA 1PYWB 4QKXB 5D7KD 4QLRA 2PN5A 3GGWA 1X4ZA 3QUXD 1UH2A 5J6GA 4AVKA 1B3IA 4I1NB 3ESPA 1BSIA 4NIYE 1LD9A 3LPGA 1OAJA 1X4XA 3COOA 4Z7UE 4QTIH 3MLZH 4LMQE 1HSAB 3VGHA 5FM5M 1LWHA 1ZANH 3QUZC 4HETA 5EWIH 3FYIB 3MV11 1CE1H 2LTQB 3BAEL 4MJIE 2MCAA 3G6DH 5JQHC 4Z3JA 5IMLB 5AVYB 1R5VB 1JV2A 2F54A 3P02A 1SJEB 3CBRA 3B8SA 1JVLA 1BPLB 3FO9B 4N0UB 4PLKD 3OF6D 3WLWC 2VMDA 2DM2A 4MXVF 4DP9X 5EF3A 2WVVB 3ECBB 4RMWA 1E5YA 2OK0L 4EI6A 1FG2B 4HKBA 1JZ5A 4XNYL 1M1SA 4KNQA 1E4XI 1VDGA 4JN2B 4ZUTB 4J39A 5FYKH 2A2QT 1AKJD 1XR9B 1TJXA 5F21B 3LNDA 1INEL 2VLRB 4KOCA 1X44A 4J2XA 2X6MA 5CJOL 4BZ1L 3QR1A 2YMTA 5KBDA 4FG0A 3D4CA 2A0LD 4HHAB 1TMQA 3UGXA 1TJIH 5K9QG 2XN2A 4EBQL 1DVFD 2XVGA 1BGXL 5DR5H 2NPLX 1NOAA 3ABKB 4HWZB 4PJGA 4ZNEE 3CLEH 1OE2A 4YSRA 1GGBL 3BGFC 1NCUA 1GZHC 1T20A 2EDMA 2WO3B 5GRVL 1F1AA 1JNLL 1OAYH 3EO1A 5ECGA 3QUKA 1CT8B 1QO3B 3SGKC 1R4XA 4ZZFA 3LPPA 3NYKA 3T0EB 4WUUA 2H8PA 3QG6A 4A6YB 2IIJA 3AU1A 4U1KB 4N2EA 1UZ8A 3GKWH 1H8SA 3IDMA 1K4DB 3OR6B 5GGRB 4A2HA 2W65A 2YWYA 4D3CL 3MGOA 2VLKE 5D7HA 3AWGA 2X3AA 4WJ5A 1LYQA 4B9ZA 1RUKL 3BAJA 1N59A 2V0AA 4OJDH 2ATKA 4GKSA 5ISZD 3B2VL 4NZTL 4EUPG 5JW5A 2DI8A 3I6GA 3RKDC 5BVJB 3PHQB 3IM1A 2VZTA 5EOTA 3SKNB 5IW1A 4QRUA 3E7JA 3BWAA 1ZHBB 1NAKL 1CXEA 4GB9A 3ZIMA 4LKCB 4PGZA 4N9GA 3BKMH 2R7EB 5F7HA 3TZVC 4PP2A 1CB4A 1A14H 2Q1EA 3WELA 3O4LA 3AB0C 4HWBL 3QAZC 4AQEB 2BH0A 2NTFA 4BQ9A 4PJCF 2H1LM 3JZYA 1AI1L 4YLCA 4I5BB 1JVKA 2M8XA 3BEVB 2DIEA 1YMMB 3CFJB 4HKJA 1EXUB 5D6CA 3WNNA 4OF0A 3PP4H 2YC1A 3ASWA 3IPEA 1PEWA 1U8CB 2EDOA 3EYQD 2BSSA 4PTUA 1BJ1H 1M6OA 1B90A 1T4WA 2FR4A 5DURB 5J1TC 2YKLH 2OMBA 3I9GH 3MRBA 3TA3B 3TO4D 4FQ1L 5GRUL 1OTSC 1PU0A 4J12A 2DWSA 5BZDA 5EUOA 3ETTA 3S5ZA 1CGSL 1BAFL 1X5KA 4LCCA 3G5VB 4JFFA 3GJFK 5DJDA 4X4KA 4F2ME 2X3CA 1R3JA 4RMRA 1T2JA 1XMEB 4GMTL 5HBBA 3L9EA 4HJ1A 5JPMA 5DTFA 2R1WA 3DX8B 4LHUD 5DUJA 3HHSB 1C5DB 1S7SB 4PV8A 4NQSA 3AWEA 2NUTA 1G7IB 4Y5VC 4YNYB 1NLDL 4TQPA 5DJZB 4BUHA 1KPUB 3STZB 2IH9A 4JPIB 3TVMC 2YPLE 3VXOB 4X6BA 2C3GA 3BPCB 4FHKA 4K94C 3QPXL 3N0PB 4FFYA 4B5EA 4JJHA 1EZVY 1SOSA 4MWFA 4N2GA 5B7EA 4F7PA 1KELH 1LE9B 3D18A 4O9HL 4MQXC 5F7KC 1MW0A 3ZE1F 4LU5L 3CPUA 4EMZA 3KVPA 2AQQA 2AQNA 2EEXA 3T0WA 1CDUA 3O6FC 5D8JL 2PWEA 3O9WA 5E9NA 2Y1AA 1J1XH 2ZQKA 1ZLSH 5K5YA 1FRGL 3M86A 3V52L 1LE5A 1YSOA 3RKPA 1E4XH 2LFGA 5FB8A 1IQWL 5L2KE 3JVFC 4UT7L 3S35X 3FQ1A 1UOVA 4H8QA 1R3HB 4M62L 1WT5C 2BS8A 1L9OA 5JW3H 2EKJA 2ICWJ 3B9AA 5DVLA 2R69L 1KCKA 4J4PA 4AEHH 2LABA 1HDMB 4HCFA 5CKAA 4LCUB 4NQTA 2TSAA 4FCHA 3WFZA 1MWAB 1WP6A 2L7EA 4LPWA 3HMXH 1ONQA 1KULA 1XF2A 4YBHA 2R0KH 3UOAB 3VMOA 2DWDA 5DJYA 2YPKA 4UUJA 4B5ZA 8FABB 3QIWA 3E6HB 2CDEB 2AHIA 4KZDH 1F56A 1M6UA 3U0TA 5AZ2L 3GTNA 4KKQA 5D70L 1EJ6A 2CKBB 4KAQH 3WGUB 2DPKA 1BM3H 4WWKD 4G8FB 2E86A 1G7MB 2BHUA 5HGAB 1DO5A 3C5XA 3EYFA 3MO1A 3QPQD 3RAJH 1ZSDA 2FEDD 1QSFE 4AQ1A 2EE6A 3N42F 1CG9B 2J44A 2F8VA 2E8YA 3K6SA 2G3MA 2Z3FA 4HMEA 1TQBB 4KFMA 5DEGB 3GRWA 2IAMC 1JZ6A 4GRLC 2Y1YA 4JMNA 2ALWA 3C8KB 3TH4T 4AW4A 1CWVA 3U0PB 2AXGB 4P2QE 4DN3H 5I8OH 1BJ1J 3FF8A 5FFGA 2H3XC 5KYUA 1DJHA 3K71B 2HT3D 2WQ8A 5EO0B 2F7IA 1QA9B 5CSZA 1F0LA 1Y18A 3MXWL 4QD2E 4Z18A 1NGWA 1MCCA 2DMBA 5TFSL 2VXTL 4AZ8A 2XWBB 5IR1A 2CBTA 5CGYD 3H42H 3TNMB 4UI2A 3S4SB 3SCMA 1U6AH 1T6BX 2H32H 3MV9D 2V5RA 4LVNB 1F58L 1X9LA 2RR3A 3BRGC 1KF9B 2VIRA 4GSUA 4KK5C 4Z0XB 2OPCA 2DIBA 1SJHA 3GMNA 3MRJB 2OXHB 4HC1A 5DEFB 4WFFD 1F1GA 3VGDA 3ZL4L 2RALA 1W0WB 4HAKA 1CFQA 2EXYD 2XY1A 4WENB 4EUPH 3S2AA 5I6LA 3EO0B 1HH6B 2C4XA 3ATAA 3F65A 3QJHA 3QQ4B 4OFYD 5CWSA 1HZHL 1PQZA 2W9DL 5E95B 4EN3A 4JM2D 1UEMA 2IQ9L 1E5CA 1U41A 3MV9E 2IJ0C 4JO1L 3G5ZB 3QDGA 1AGFB 5ADPH 4S1SH 1O0VA 3THML 2DQGL 3WIFA 4WFFE 1CF8H 4PS4H 1DSYA 3HAEA 2DL9A 4ZMOA 3C2AL 1QW9A 4LPXA 2XZAH 4WFHD 1RUML 3ML8A 5FGCE 1RI8A 4P2OC 3SE8H 3VGFA 4UTBH 1KYAA 4HJJH 3O4OB 3MRLB 3MRPB 2ZUQB 2KDYA 4ILDA 3EHBB 5D6DC 5A7BA 4JDVA 1F4WH 4WTXA 5GS1B 5E8PB 2R0ZL 3T1WA 4J6RH 1KFAL 4ODUB 1DQDH 2C1PA 1AOHA 1YEIH 2ZJSH 4IRSC 3CCHA 2P80A 4I77H 4YHKH 3REWA 2YEZB 2VDPH 3GB7B 4JRYD 4M43L 5T1LB 3QXAB 3C5ZA 3ZIYA 3FRUB 5FO2A 2DLHA 5I1KH 5CLTA 2GITA 4ODHH 1YYLH 4BCZA 3ZR5A 4PJBF 2Y36L 4YDIH 4XN1A 1PF3A 2MMXA 2WO2B 1AMYA 1WHPA 2WVTA 3VSVA 3SPGA 2Q86B 2B2XL 4M6AA 5DMKB 3F2LA 4NRZB 4Z95H 4KK8C 3OXRB 3WKML 4L8DB 4UU9B 4HIEA 4EXPX 5E6ID 4Y4FD 1AQDA 2OZ4L 3BT0A 3GSQA 4FFZL 3KR3L 4ZS7H 1OP3K 2A9DA 1RP9A 4Q6IC 2WJ5A 1K8IA 4WI3A 5JA9A 4AGLA 2Z8VC 1F13A 3CX2A 3VXUB 3AG2B 2DWEA 3I02B 3MLSL 2KDGA 4PRAB 1JRHH 4P4KA 1P5UB 3AGVA 2ZSVA 1QYGL 2H2SC 3WFCH 5C86A 3NK3A 1SF3A 4FQ2L 2VISB 1R75A 4LGRB 4WHYH 2G9HA 1KPRB 3TM6A 3AUVA 4A7SA 4ANUA 4A2EA 2DJUA 1ASOA 1N0LA 3Q5TA 2GTQA 3FSVA 3P40A 4PRIA 1RK0A 5A2LH 1V54B 4PRPD 3ZYOA 4QAMB 3NVQA 3L17A 4JX0A 4PJAB 2EZ0C 1AIZA 2APVA 5D7JD