3H2PA

Human sod1 d124v variant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
126
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPRHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKAVAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structures of Pathogenic SOD1 Mutants H80R and D124V: Disrupted Zinc-binding and Compromised Post-translational Modification by the Copper Chaperone CCS
rcsb
total genus 31
structure length 126
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3h2pA00
1SPDA 1E9PB 3GTTA 3KBFA 2Z7ZA 5KBLA 5KBMA 1B4LA 2C9UA 4A7SA 2K4WA 1OALA 1CBJA 1UXLA 4A7VA 4BCZA 3QQDB 2GBTA 1Z9NA 1E9OB 1SOSA 1FUNA 2ZKYA 1BZOA 3F7LA 3KM1A 1E9QA 4BD4A 1Z9PA 2AQTA 1SXBA 1IB5A 1SXZA 3GTVA 1HL5A 4BCYA 2VR7A 1TO5A 1MFMA 2JCWA 1YSOA 2ZKXA 2ZOWA 4FF9A 4A7GA 4A7GF 4U4IA 1L3NA 3K91A 4OH2A 1ESOA 1UXMA 2AQPA 3SODB 1PTZA 2JLPA 3HOGA 1SDAB 3KM2A 2LU5A 2WWNA 2V0AA 1BA9A 1PZSA 3GZPA 3GQFA 3H2PA 1EQWA 3QQDA 3KBEA 1SDYA 2APSA 3CE1A 1XTLA 1YAIA 1YAZA 1AZVA 2WYTA 1SRDA 2Q2LA 4N3TA 1XTMA 1B4TA 1S4IA 1IBBA 1EJ8A 1HL4A 1OZTG 2AQRA 3CQPA 2XJKA 3ECWA 1N18A 3L9YA 1IBDA 2AEOA 1E9PA 2NNXA 1OAJA 2WZ0A 3HFFA 3CQQA 3L9EA 1F1GA 3F7KA 2C9SA 2GBUA 3HW7A 1Q0EA 4A7QA 3H2QA 3S0PA 1SXNA 4MCNA 3T5WA 1RK7A 3MKGA 2WWOA 3KH4A 3GZQA 4A7UA 1COBA 3LTVA 1OEZW 3PU7A 5KBKA 1E9QB 1F1DA 1IBFA 2XJLA 1F1AA 1N19A 2E46A 2R27A 1KMGA 1SXAA 2AQNA 1PU0A 2AQSA 3GZOA 2WZ6A 2E47A 1P1VA 2VR8A 3ECUA 1OZUA 1QUPA 1XSOA 1JK9B 1TO4A 2WKOA 2WYZA 1SXCA 5CU9A 3RE0A 1JCVA 4A7TA 4B3EA 1DO5A 2VR6A 1E9OA 2C9VA 4N3UA 4L05A 1CB4A 2Z7WA 2Z7UA 3MNDA 2Z7YA 1DSWA 1F18A 2AQQA 2SODB 1JK9A 1IBHA 1U3NA 1SXSA 2ZKWA 2GBVA 2WZ5A 4OJAA 4MCMA 2WKOF 3KH3A 3ECVA 2AF2A
chains in the Genus database with same CATH superfamily
4LSUL 5GRUH 3US0A 1N4XL 2WY3B 3NIFB 2K6ZA 4RCAA 3ABZA 3QQ4B 3EYQD 1BFOA 3QXWA 3WENA 3SCMC 2YAPA 1WAAF 1G7LB 3K5RA 3OKLA 3NFPA 4AV4A 1ASQA 1HSBA 3SSGA 2X89A 2YRBA 4MXWH 2GCYB 3KPSB 1IC7H 5EZOH 4XPGH 3KBPA 3TYFB 2DYPD 4HC1A 1T04A 5EU6B 4JM4H 1VFUA 2ZAIA 4QDGA 4BRJA 1F4HA 3VFOB 3DVFA 4FQIH 1JVLA 3B9KA 2IDQA 5E7BA 4DGIL 2NY7L 5IHHA 3IRPX 2F54E 1EBAA 1BGXL 4NRYA 3O45B 4L1HA 2V5SA 5IOPA 2C4FU 4EI5A 2VRKA 4HMEA 3PDGA 3BUBA 1U8NB 3H9HA 2QVMA 4PJIE 4GMTL 1ANUA 5SX5K 1NBVH 2EZ0D 3K5SA 4W9LC 3KL5A 4JREC 2PXYA 2FAUA 5LCVL 1RZIB 3V6FB 2Z31A 3EO1A 3PWNA 4ONFL 5DVMA 3OHXA 4L29B 4KK9C 5FLUA 3QIUC 5D7KE 4ZX6A 3GSQA 5FGRA 3UBXB 4KVNL 4J3XA 4EZLA 4WUKL 4J2XA 3HUJE 5CZXC 3RHWK 1MLCA 3DX3A 3FNKA 1PAZA 1U8NA 3H9HB 4YDNA 4HC1L 4YGAB 1U30A 4XXWA 2CUIA 3IFPA 4G72B 1C12A 5HJ3A 3SO3C 5B7FA 5JHDA 1K4DA 3LZFL 3O6FC 1BLNB 4R4BA 1NDGB 1RZIA 2ZUQB 4M7LL 5IJKC 4WHDA 4XAWH 3ULSA 2BXZA 4PMEA 4MAZA 4I18A 1ERNA 4ZFZA 1JZ2A 3PWPD 3K81A 4HAKA 1AXTL 3BUQA 1FL3B 4XE0A 1L7IL 2V3FA 2IH9A 1MIML 3U2SA 4UIKH 3TPKA 2JLLA 1DSFH 1O6SA 5F7KC 3HS8A 1O0VA 4FZ8H 5E99H 4FFYA 3EG9A 1T0PB 3V4UL 1YMMB 2XA8H 3EJYD 2K9FB 1JOIA 5F88B 5F0MB 1D9KD 1T1ZA 2Y07H 3N41B 1RUAL 5DUBB 1IQWL 2ZICA 4JFHE 1LNUB 2ZJSL 3NJMA 1K3ZA 1E9OA 3NRFA 4JQIA 3U9UA 4Z7AA 4B5EA 5B3JF 1IKNA 2CG9X 1WS7A 1FE8L 1AXSA 3C8KA 5IGXL 1PLGH 3DMMA 3WJLC 4F7EA 2W07B 5E24E 3PDDA 2XN1A 5EEUA 4OLYH 1DEEA 3P0VH 4A04A 4P9ML 3N42F 1TLKA 2E5EA 2VKXA 3GSVB 4ZPVA 4BWTA 3ULVL 1OPGH 1AE6L 5EUOE 3SKOA 1RUQL 2LR4A 2VERN 4L0YA 5I8OH 4RZCB 1YN7A 1KNOA 4E9VA 1SOSA 5AOMA 2IC2A 4FFZH 5J57B 4BZ2H 5HYEA 1F90L 1UVQA 3ARGC 1JZHA 4UB0L 1MHEB 3FU5A 2AQTA 1WT5C 2WIMA 3MRFA 2AK4B 2R0LH 4UOW0 3TNMA 1RUPH 4CC4A 1YNTF 2BWQA 1PZDA 4FQIL 4WI0B 3HG1E 5DMJB 2FEEL 2GUOA 3DXAA 3H42H 4N4YB 4FF9A 3AY4C 5DA4A 3KNBB 4M8QA 1U3HD 3G6AB 3IFNL 2P8LB 4IBYA 3GSNA 1EHAA 2CUMA 3MLRL 2E4FA 3AU1B 1MI5D 2AK1H 4ZFQA 2ZYRA 3W1ZA 1VKXB 3LKRA 1Q4NX 4DJMA 4MMXC 3AQZA 1Z2KA 3DETD 4U0QB 3MRKA 1I1FA 1KIRA 4RLDA 1MVUB 5EOCH 1CGVA 3OR6A 2HUEA 4FNSA 1K4CB 3A47A 1Y18A 4B50A 3KLHD 5H4ZA 5J5EA 3FQ2A 2YK1L 1EWHA 4OF5A 4PJXA 1I9EA 4JM2F 3MUGA 1OZTG 4LLDA 2FJHA 3FRPG 1EO8H 4XVUD 1SF5A 3L5XL 3GLDA 4MD0A 3QCTH 4AT6B 3A4EA 4QIRA 4I13B 3U7AA 4I2XE 5C0FA 3QUYC 4KY1L 3JTTB 1NC4B 3GSQB 3ELQA 1TSHA 2IOIA 4XVOA 1N4XH 1DJGA 4GT0A 3RTQB 3VA2C 1G7PA 2D4DA 3CFDA 1TZHA 1C5BL 3WN5C 3S5YA 3NN8A 1SJHA 5IBLC 1PL3A 4UOW1 5L2KB 2BFVL 4FQQA 1NGQL 1GKEA 2DJUA 1FVCB 4M7KL 4C8XA 1WICA 2QZ5A 5IMOB 4LCIL 1JGEB 2DQHH 1BAFL 4GKOA 4YIQB 4IDJL 4WHTA 3SDDB 3T2PA 2VR8A 2HKAA 3BWUC 2VRQA 2NQCA 5DR5L 3MREA 5FOBB 1R3HA 2JMRA 4EDWL 1NFIA 2PPCA 5FV1L 1XH3A 2XPGA 1AXTH 4R7NB 4UQEA 1PLGL 3TCLB 4IGBB 4AV0A 4HT1L 4QRBA 2R8SL 3QSKB 3VXPB 3EFOB 5DZPA 1FNSL 1EAOA 2CGRH 5I66B 2RFXB 1YQ2A 3FSAA 1KEGL 4NSKB 3TO4B 3OBAA 1J8HB 4JHUA 1HILA 2P3YA 4NQSA 5I0ZA 1CJYA 2KYIA 2YUXA 4IOFC 5FKPB 1JPEA 2BY3A 2G2PA 4X6DB 1NSNH 1F0LA 2CGZA 2OSXA 4JDEA 5DA0B 4HCGA 4NBXB 2JKTM 3VO0A 1H8LA 1QPKA 4UINH 1K6QL 3MRNB 1FL5A 5H2BB 1Q9LB 3A4AA 3QI9C 2XTJE 1PX4A 1G9NC 3B1UA 4LCWA 5KYNA 3JVGC 5B38A 2VITA 4Z1PA 1PLBA 5CBAB 3TA3B 4M5ZL 1RZJC 5JZ7D 4LZKA 3EIFA 1FNEB 3WEBA 3ZE0B 3Q13A 4CGTA 5CJBA 3OMNB 2XV2A 3TZVC 1CGTA 1MY7A 5EU7E 1QKZH 2R1YA 3N1GC 5C9KA 3QQNA 2Q7YA 2YEZB 2F54B 4IMKA 2EDTA 3NJFA 4IMLB 4W4OA 2AEPL 3RVUC 5DHVB 5E8EA 3HNTH 1Z3GH 5ITFB 4NRXA 3QFJE 1PY4A 1ZT7B 2IANE 4HWBA 3O4LA 4M5TA 1BEXA 1VENA 1B3IA 4XR8C 2UZYB 3ET9F 5CEZD 1QFPA 1L5GA 1C08A 2ADJA 3S5LG 3EOTL 5D7JA 3ARPA 3MRPA 3QDJA 3B9DA 3FTZA 5DO2D 4MAYC 1NGYA 1BBJA 3ORJA 1M2VA 4MYPA 5IQ9A 5F1NA 1WTGT 2HJFA 4Y1AD 4MDRA 1RP8A 4XZUA 4JS7A 4TUJA 4P46C 4XMKL 3N1FC 4PRBA 3LY6A 1PD1A 1R5WA 3ILPA 4RQQB 4F37F 3KPMB 4KUZH 4KK6D 1HHJA 3CBRA 3SDCA 4G7QB 5A7BA 2IADB 1KCUL 2XC8A 3D25A 3FPXA 3RNQB 1T1WB 3UZEA 4X9HA 1HWWA 1CC3A 2BVTA 1FHNA 1LQSR 2DLTA 3X13A 4XNMA 2YSSA 5EWIL 4HWNA 3U30B 4Q9QL 4DN3L 4KNUA 5E56A 1CLOH 3GKZA 2CRZA 4G59C 4OCXH 1KCSL 5I5JA 4QOKA 5E1AB 1XZ0A 4R2GD 1HWGB 1JN6B 4ZQTA 3DO7A 4YQXH 5HHXH 1NFKA 1SEBA 1NAMH 4PLKD 5AG9A 1EHNA 3AMKA 1T4KB 1O6VA 1WD8A 2BNQA 1JHKH 5AW5B 1RUMH 1G5AA 4JW3A 5FO9A 1TJXA 3CFQA 1EK3A 5DSCB 3QWOA 2JKWA 5HYFA 5T1MB 5I76B 2VR4A 2YFNA 1P69B 3PQYE 2BOCB 2EEXA 3V8CA 4I0CC 5C0DA 2MCMA 4AW7A 1V7NH 3FK3A 3P73A 4RMTA 5T1KB 2AEWA 4L4TD 2EVIA 5FM5M 4NN6B 1D2OA 3FRPA 2O6DA 1TO5A 2NY4C 3FB5A 3WKQA 3WO4C 3QJSB 3LNIA 1JXJA 4FQCL 1ACYL 5GS2D 1CICC 3D0LB 4LHUB 3DX6B 4RRPM 2IFGA 1K5WA 3T9WA 2AZAA 5FC9A 4BGLA 4FA7B 3MUUA 1REIA 3FFOA 2YPVA 2N1KA 2XRAH 5AOKA 1MF2H 2WYIA 4BK4A 1ZE3H 4I9XA 5L7XH 3MLSH 5BV7L 4IOSD 4M02A 2NRDA 3SKNB 3ZKND 1UJ3B 1UZ6F 4YC2C 3NCYS 1JZGA 3ZGHA 3N85L 1HINL 1TEGA 3EZ8A 3FN0L 3QUMA 2VRAA 4BM7A 2QADD 1O5DT 5DD3L 5CJXA 1N8ZA 4KZDH 2W0KA 1NMAH 3EJRA 4LU5H 2HJLB 4N20A 3S5LA 1JWSA 5BOJA 2ZCKH 5GS0D 1SBSH 3LPPA 4JDZA 4S1QH 4ZMPA 1ETZA 2W9DL 4PRPB 2Z8WC 4IIQA 3IGLA 3V6OE 2ZXBA 4NT6B 4NAJA 4H1LA 1T0NA 4U1HB 5CSZB 4PH8A 4YHKH 4HDIB 3UXFA 2CK0L 3VXMA 2O72A 1N2RB 1LXMA 3FFCA 3FT9A 3MJ7B 4ZFFB 4G6FD 1EX0A 3AQDA 3MV8E 3PPSA 5LG1A 1WEJL 3FBKA 3ZTNH 3VXSE 2F5BH 1A3ZA 3SDYH 1OKEA 3KYNA 4LSUH 4Y9CA 3MYJB 3P3SA 3RUGF 4PLOB 5LGKA 5F0PB 1NUDA 4FGMA 4KI5F 4ZUUB 2NXYD 2ADGB 3BP6B 4QRAA 5D6CA 5GZOD 4PJ5D 2C7UA 1D5BB 2VXQA 3H3BC 3DTDA 4PJFB 1Q72H 3UZQB 4G9FD 3WXWH 5I9QC 4KI5E 1VACA 3E38A 1KFAL 4NQTA 2XG4B 4F8TA 2XWTA 2WQUA 4XPGL 1IUZA 3ETBJ 3D9AH 1R34A 4AQ1A 1YNLL 4M3JA 2JVUA 4LSVL 3A21A 2DDQH 5IFAL 2ZQKA 2ICES 5K9JL 2OL3L 4U31A 5JHMA 2IV9A 1CFSA 1FP5A 3I2CL 3LVTA 5JYMA 2Y24A 1E8WA 2K3HA 4ODXA 3FB8B 2LU4A 2G2RA 5CJOL 3MUZ1 4NZFA 2XQYK 1AFVH 4YZFE 3VMPA 4ZNEE 4BH7B 1JPFA 2IH3A 4PFEA 3SKMA 3QQ3A 4NNXA 1BM7A 1ONQB 5KEZA 3HKFA 3TLRA 4O2CA 5PCYA 1ZHLA 1BZOA 4HXBH 5KTEH 1JNLH 2GG1A 2EIEA 1ID2A 3VGDA 3KPQB 1AD9B 2DQUH 4OFYA 4NBYB 2G60L 4CJ1A 2CJSA 1CDHA 3EGSA 4FZ8L 1VESA 3RRQA 2XWXA 4BFNA 4L4TE 1S8DB 3C6LB 2Y6SC 1YYLL 4PRNB 1OHQA 3RAJH 2EEBA 4K3DL 1C08B 4OLXL 2EABA 2L4OA 5JOPD 5MHSD 4YR6B 2NR6C 4L4VD 4XNXH 5ENWB 4ZMXA 5IQMA 5DMIH 2BS9A 3K2MC 2D3NA 2IH1B 3KGTA 4HBCL 5TFSL 1I8IB 3IJYA 2QR0B 3BDXA 3FTWA 3OAZH 4MMZA 4KNTA 2CBOA 4TQIA 4WCYH 3R4RA 4YAQB 2M8XA 3ETSA 4P5KB 1J0IA 5ERWA 4OF7A 5IHZB 2KPWA 5K5YA 4UIKL 3G08A 2FJUB 4JFZH 1PG7X 3T3PF 3Q2WA 4WVRA 1CBVL 1QA9A 1ND0B 3FZUC 1Z0MA 4ANUA 3IF1B 3V0VA 3OB8A 4IBTA 4YDLC 3VVVA 4AX3A 4EAEA 5BJTB 4G8IB 1J10A 1NCBL 2KS0A 2FO1A 1MF2L 2BDNH 2R1WB 3WKNA 1DUZB 1EZVX 3QUYD 4FNUA 2XHNA 3KG5A 2QQKL 5FO7A 3UZEC 3O2WH 3C5XA 2J1XA 3QZPA 4XXCA 3PGCA 3SBPA 1CURA 1MAJA 4RAUA 2V33A 2WXGA 2N1TE 2ATPB 6FABH 4XNZB 5C0BB 1MIEL 1KWGA 1X5YA 1UM5L 5ALBL 1UFUA 3WKML 3VQMA 1A9VA 2Z64C 4P59L 1JPSL 4LOUD 4KH2A 3FU9A 2XIBA 5EIIA 1J87A 3U2JA 3C60A 3E8UH 1P1VA 2IV8A 2FGWL 1ODAA 3BH8A 3QO0A 2VZUA 1A4JA 1R3KA 1E50A 5D1XB 3SY0B 3PRZA 4FJZA 2C8NA 2BWIA 4NEHB 4O00A 5DK0A 4AYEC 1M7IA 2DQ6A 5FA4B 5KZCD 3NIDE 1JTTA 2P8MA 3QZWG 2DW5A 3RIFK 1QSFE 1OIOA 5EC1A 1A6TB 2EDXA 1NGPH 3I6LE 4R5TA 4L0ZA 1FH5H 3MJ9L 3FPYA 5F9DC 3SQRA 2DY2A 3STZB 2PO6D 3ZL4L 4I3SH 4J3BA 1I1YB 4IRSC 3LV3B 1DANU 2A6DB 2EIZB 2MQ0A 2HAZA 3D39B 1CQYA 3K6NA 3RDTD 3UYRH 5E8PB 5I76A 4QTIH 1AE6H 2BSEA 1V3JA 3KPRB 3T4YA 4UDUA 2UY6B 4TULH 3DOSA 3GUFA 4FFZL 3WTTA 3DROA 4IK7A 3ATBA 5F44A 1TITA 4LXFA 4ZT1A 2NY5L 4WK0B 1QRND 4U0RB 4AQOA 1Z7JA 3CZLA 4HIHA 4BSWB 4QOKB 1MZYA 1OTUC 4FCHA 1Y07A 5D72L 3C8DA 4NQCD 3KLSA 1WRFA 3OX8B 4ES9A 5EORH 3NJXA 1LVEA 1PLAA 1RZ8B 5F7UA 5I1CH 2FATL 3SY0A 3GZPA 4JRXB 4Z3JA 2XQYA 4NHUA 2GT9B 5AENA 4PBVC 5KN5A 1USQA 2YZ1A 2OJZH 4OCRL 2Z93B 2R15A 5E9DA 4XVTH 5F1IA 3STBA 3V5HA 1D5IH 3ULUF 2CXKA 3SGJC 1S4IA 2XYCA 4TRPH 3ESNA 3QNZA 1KLGB 2W38A 4FG0A 1AR1C 2PW2B 4NFDA 2R4RL 3VXUA 1QO3B 1E4WH 1ZEAL 3RBGA 3HJ0A 5DFTA 4EQ3A 1EBPA 1M2VB 2WCSA 4N0FA 1NGYB 3DBSA 4HBCH 5JIIA 4W6WB 4Y8AA 3OMZA 1CT8B 4NUJB 1F1GA 2Y4SA 3WDIA 1YY8B 1UA6L 2WMPB 2EYRA 3OZ9L 4Y4HD 2NT1A 4MMZC 2BSED 1HHKB 2CIKB 2BLFA 2D7OA 5D5MF 1AQMA 2WWOA 4ORGB 3MUGB 1PJ9A 2PO6A 5B1CA 3NIFF 1J12A 5C08B 4AYID 4F7PB 5B8CB 5M7QA 1MPAL 5IVXF 3NP3A 3U4AA 1FNFA 1KCWA 1CLCA 5J4MA 5GS0H 4Y9FA 2BFVH 1Z5YD 2X70A 4GG8B 4P49A 1J1PL 2VITB 3HN8A 2HH0H 4XVJL 2PPEA 1NBZA 3UZVB 2WMPA 4K3DH 3MDJA 4LCWB 3DX9B 1OZUA 4H2CA 4N2FA 5F97E 2R56H 1WPCA 3QUXD 1N3NB 1CDJA 4LPVA 5KN5B 1ORSB 1YYML 3UCQA 4HLJA 2CE6A 1VFBB 2MTAA 1R5VA 1Q38A 1O7SA 3FQUB 1AYRA 4CKVX 3IB4A 4JY4A 4PRHB 5IW1B 5C2BH 4ZUSB 2ZXQA 3HLAB 1LNUA 3LSOB 5EEYA 4A2GA 3GWJA 2ICWB 2XYBA 3ASOB 1DVUA 3LHAA 5FDWA 5CZXD 5ICYA 4HAGA 4X80L 5ESVA 3S36L 3TEWA 4HUCA 4E9TA 4H25A 4A6YH 3V5DB 4AGLA 5CSGA 4UAOC 3QQDB 1UTDA 1ZDSA 2XWZA 4G8GB 4R7NA 1ZHLB 4TSBL 4P4KC 1O6SB 4ZPVB 4TUOA 2WGXA 1PBYA 5ICXA 4BD4A 5DZOA 2Q6WA 1R3LB 3LKQB 4MBRA 2DWTA 4NP9A 1SDDB 3GMLA 4LCUA 1KCVH 4F58L 1LDSA 1ADQA 2WV3A 1E5UI 3EUUA 5TE4H 2RCSH 2V2WA 3BSZA 1CWVA 5HGDA 4MGXA 1RULH 2Z31D 3TFKD 3HOGA 3IN0A 5H94A 3FCSB 4AQZA 5GZNC 3MLPA 4LOUC 1I7RB 1QSZA 1SJXA 1QTYT 4KPHL 3N04A 4Z7QB 3MNWB 3I6KB 4NAMA 4RFOH 1ZVNA 5CMAA 2EP6A 2ITCB 2XXMB 5F3HA 3WNKA 1WFTA 1JYWA 1T7WA 3P0GB 5IJCC 7PCYA 3BZEA 4JAMB 2E7HA 4H8PA 4Q6IB 4AJVA 1CXEA 1PY0A 3L5WB 2GEQA 5FB8B 4P3CH 4PGZA 4LLQB 2X38A 1H3GA 4IRZH 4UWQB 4HPYL 1CS6A 3QQXA 4Y2DD 3KXFA 5BZZA 3OAUH 1S7RA 5HYSG 2GYSA 1N2RA 3HUJA 5KVMC 3ZE1E 4NRYB 4UQCA 1GMEA 4I3SL 4D0CA 4IHOA 1OE1A 3BN3B 1MNUL 1A6VH 2AK4D 4M7JH 3GSOA 4JE0A 1BECA 3QJTB 3VXRB 1HK6A 4HCFA 5GGVY 2J8UF 3IYLW 4HZAA 3AU1A 1H5BA 15C8H 3T2OA 2DYPB 2R4RH 2Z31B 1NKGA 3O0RH 2HH0L 4XVJH 3KDMB 1D7BA 2R27A 3CVHB 2HXAA 1JHKL 2RGSA 3KPNA 5T33H 3CZUB 3QRLA 5K39B 2ITCA 4HJGB 1YUKB 3OWEA 1CGWA 2JB6B 3ZKMC 3T0EB 4YEEA 2NYKA 4DEWA 1JERA 2VW6A 3AGVA 4LASH 4JHBA 1WBZB 4JKMA 3QDGE 5I1CL 5L2JB 4YWGH 4A7TA 1X44A 5HHVL 4CN1A 2MEJB 5GZOA 3MX0B 4JFDD 2IH1A 1U8JA 4IBVA 4FG6D 1L9MA 1JK9A 5AVRB 4DK5A 2OK0L 4N2NA 2YN5A 3CPUA 3FU3A 3NCBB 5FR3A 1V05A 2ESVE 4IYKA 1TDQA 5KVEL 5TE6H 3MHZA 4U6VH 5HP5A 2VLJA 1RUKL 5I1EH 1CDCA 1YN7B 2PXYD 1KJ3L 3MRJB 1Z9NA 1QABA 2XZQH 4RZCA 1YEJH 4FFYL 4S11A 4DGYH 2EC8A 2ZKHH 2WKGA 5FDWB 2ZUSA 4MKMA 3TA3C 1P1ZA 2FBOJ 4AW4A 1SEQH 4MCYB 1LEIA 3QZWA 2WZPA 2Y6SD 4YNYB 4PJCE 4Y2NA 1WIPA 4ZTEA 4YL9A 3AT0A 2PPDA 2Y2TA 3CX5J 3G5YB 4PI2A 4PJ9D 1NGZB 5GRJH 5SWQA 1ORSA 4PJIF 5JR1H 1Q72L 3P40A 2X7LB 2BMKA 1QLEL 3AG2B 4IOSA 3NACH 1KYDA 3ARDD 3PIQB 3QUZD 2XQYG 4LGPB 2XT1B 3S7GA 2XWTB 4L8CB 2P80A 4F80A 1CE1H 3VAEA 2VDLL 3OZLA 3A23A 1E90A 4KH9A 4Y4FB 4Z9KB 5ILTL 5JHDB 5DQJB 4B9PA 4OTXL 2IGTA 3H7BB 5T1DH 3DSNB 1NGWB 4AQ1B 4YE4H 5A7EA 2WO2B 1OE3A 1ADWA 2CLZB 2AK1L 3JTSB 3TBTB 1TVHA 1S3KL 2QPSA 4S2SA 2FX9L 3PGDB 2ADGA 3EGXA 4JFFA 4X0KB 1WCBA 3UDWA 1NMCC 3M6DA 2WLJA 3BGFC 3KHOA 3EKCA 4OFIA 2EIBA 4X83A 1PVHA 2GABA 3CLEH 4W68A 1I9RL 4PS3A 5D8JH 5INCB 4MA1C 3MRDA 1Z32X 1KB5B 3A6BL 3S5LB 1CVRA 3VCLB 1MRDL 1UH2A 2V17H 3DRTB 3EH1A 4LPCA 4IIQC 2LE9A 3MAWA 2Y7MA 3AMLA 3RWCA 1YEWA 5CM1A 3ZVVA 4MA7H 5J9PB 1QQDA 4WCYL 1EVUA 4JGJA 3SKNA 4MNGA 4XZ4A 5IJVA 1JD9A 2P8PA 5KAQG 4UDTB 3MGAA 4PJ7E 3LB6D 1KUMA 4MJ5B 3LQZA 1DQLH 4OCSL 3J27A 2QMJA 5CBAA 1YYLH 2VSKB 2ORBL 4OSUH 2P7TB 3N1QC 5JHBA 3I50H 5F7AA 2UY6A 3I3BA 1AQHA 1TKWA 1D9KC 3EXJA 2K9UA 4YHYB 3PWLA 4ZW6A 3TU6A 3TVMA 3A0OA 4XNYL 2F58H 4XCYB 3DYOA 3DV4B 3LNEA 4LPYA 5EDXA 3WUWG 5BZWA 2QL1A 2OMTA 1WQVT 4JPVH 5D1ZC 5MENB 2GAZB 2VXTL 3FQYA 4GO6B 2VH5H 2BK8A 2C9XA 3SE3C 5HHMD 1O9WA 4NC0B 1N6QH 3A4DA 4PVBA 5CKAA 1XCTA 5I9QB 4A7GF 2NYYD 4NKMB 1LTXA 5T1KA 5CFHA 3MMEA 2YLHA 3SODB 4HWEH 1CD1B 3QZMA 5FM5O 3LX9A 2NX5D 4WI2A 2KL6A 4U33A 4UZSA 3FQWA 3QXVA 3DX8B 5A2JH 1CL7H 4KC3B 3QHZH 4W9IC 1GY1A 4J7RA 2DMBA 5ACMA 2CR6A 1S9XA 3HNSL 3H2PA 3SPVA 25C8L 3HS0C 4GFXA 2WLHA 1SJEB 3KAAA 4LASL 1A9BB 1E6OL 4UYQA 3SDDA 1CGUA 1SN0A 2Q2LA 2YA0A 3B2PA 5EF2A 3RGVA 1MWAB 3L3GA 4DEUA 2YC1A 3T09A 5F8RC 5BS0D 3DVGB 4MMYA 4OQTA 4WWPA 3IDJA 4ELMF 2PCFA 1I7ZB 1ZCRA 3RILA 3M46A 3QXUA 3IFOB 3UPAA 3V0WL 1KCUH 2P49B 4KV5F 1BQKA 5DJZB 3ZDZB 4XN2A 4BYHA 3FOMB 5I2IA 3O4LE 3BEVA 4BXVA 5IVZB 4DFIA 2VDQL 2XZZA 5HVHC 1CLYL 1ETJA 4PRAB 2AJ3A 4DN3H 2O26U 2H9GA 5E95B 3H6JA 1QWNA 4TV3A 3ZMEA 1DFBL 4CMMA 4NUGL 3S8GB 1J0KA 1A3RH 3EOAA 3QBTB 4K8RL 4KMQA 3SPHA 1X7QB 3TNNB 1MFDL 5D7SL 2J88L 1UM5H 3GFUA 2R83A 3WKMH 2F7IA 4W9FC 2J43A 3WUWA 2UVFA 4HUXB 5DD1L 2ZSWB 3QIBB 2R4SH 3FT3A 5MEOA 3KLDA 2EC9T 3HPJA 4N9GB 1M7UA 4QJ3B 3HBQA 4QRPD 4XCFL 5CEXB 4XPHH 2IO5A 4TNFA 3OJDA 3SQOH 2P45B 1W0WA 3X14B 2AABH 1JFHA 2IQAB 1F3DJ 3WFBL 2GJ6E 1GTNA 5JW4R 4XMKH 4BQ8A 3DPBB 3L3GB 1UOWA 2PTUA 1U0QA 1YJDH 1GJUA 3JVFC 4J3OC 2DQGH 4H4NA 5KYWA 1A4CA 3ERXA 1FJ1B 1D5XA 3VU1A 4TNVF 2J5LC 1KBPA 3IRCA 2NXZC 1AIZA 2HN7A 3D87B 2FK9A 2VDPL 5J0BA 1T6BX 2CDEA 3OZ9H 2VABB 3QHTC 1DVYA 3LRKA 4Y4HA 1G7QB 5FF6B 5EOTB 3KS0J 2ZXDA 3L08A 5CZVH 1RZJH 2EDWA 2X4RA 2DQJH 5AVXB 5E6ID 2J4WH 1TQBC 4APQA 3B3BA 2UWEA 3TA3D 4PI0A 4XPAH 4MCYA 4XTRD 3P77A 2OCJA 3AJ7A 2MNJB 3G6JA 3TC9A 5MEPB 1CXLA 1TYRA 1UURA 5EZJA 1UZGA 1AGDB 3BJLA 4JKKA 6PCYA 5AZ2H 1MFUA 4P9MH 4HIXL 2DL9A 4GUPA 3COOA 3PHOB 1EVTC 5L88L 3IJEB 1IC4H 4GOSA 2EH8L 3HPLB 1SGKA 5KANI 1KZYA 1V7NL 2QFRA 2NY6C 1G9HA 2XNAB 2LLNA 2H5UA 4FXKC 4N3TA 4GRMA 3L3OC 5ISZE 4X6BB 4Y2DC 1E3FA 4HKBA 5IVXA 1ZK9A 2F0CA 5BQ7B 4K23H 2VQ1B 2HRGA 4G7SB 4ANXA 3K8KA 1MH5A 3HR5B 3VDCA 1FC2D 1SHSA 3F83A 3PUCA 4FERA 1ADQH 1CG9B 4NKIL 1ETZB 3VXRA 3TJPA 5EU4A 3WIIL 4NZTH 2QFPA 3VSVA 4OLWL 1IGML 1U2HA 2O6FA 4AE0A 4CJ0A 3CVHA 2WTRB 1ETA1 4HPOH 3SJVA 1UKQA 1UWXH 1V5JA 1WAEA 1X4ZA 5HPMB 2UZIH 2E9JA 3I9AA 4DK6A 2QKIC 2VXQL 5E2VL 1WT5A 3L54A 5IY5B 2HVJA 3BC9A 3ABKB 1FFPA 1ORQA 3VG0H 1AS8A 1PF3A 4YFEA 3MTXA 1L9NA 1UM4H 2V7NB 1PU0A 3UJJL 3W56A 1G7PB 3WKYA 1G4MA 4RGND 2HLFC 3EYOB 3G6DL 4JANB 5F7YC 1SLXA 1YY9C 3T3MB 3BVTA 3APDA 1FORH 1KPRB 4GQPH 1QFWM 3RVTD 4HJJH 4PN6A 4F8NA 4ODTH 1TNMA 1E2WA 3B56A 1JNHA 2I07A 4QRUB 2GY7B 1KCVL 1URZA 1RZ7L 4F58H 4Q6IA 2NY3C 4XOBA 1S6NA 2V8LA 2WKOF 4NC1C 3OLEA 1KN2H 2VDNB 2R2HB 3IPEA 4KAQH 1FYTE 1HKFA 3N5AA 4XBGB 2P5WB 4U6HB 4NCC1 4PD4K 2D7TL 4TQHA 5KBMA 1WZMA 4XAKD 2N0MA 3QFJA 5E9DD 4XN7A 3FCSA 4G7YH 3ZDZE 4M1GH 2VN3A 3HI6H 2XTSA 1HSBB 3ROOA 3T0AA 5BV7B 4OCNC 5EFIA 3NFSH 3OPZH 5DQ9B 4YSAA 2V2XA 2CM6A 2R7EA 4Z7WA 3STLA 5D7LE 4E68A 3DVNA 4PREA 3W39B 4QTHA 2R2CA 3US9A 4M5YL 4ENZA 2ZKXA 4A55A 5GJSH 3UTSB 1CBVH 1NA8A 4RWYH 1F6LL 5C0IB 1RIUL 3QJQB 3MODH 4AJYV 4ZS7H 4R26H 4BZ1L 2G3XA 1OCZB 2N3JA 3LNDA 4E36A 3QS3A 4U6YB 4UBDD 1GC1C 3FO9B 1N3NA 4DO5A 3JWNG 3VFMB 4E5XB 2J71A 3BHBB 2EILB 1SDYA 5IFHH 3DUHA 4XO4A 1AZVA 1MN4A 1U8QA 1K3IA 3UTTD 1B4TA 1UWGL 3ARBD 3P30L 3VW3H 1GGIH 2DMKA 1TSRA 4GW5A 4X99A 3MX0A 5AZ2L 1ADQL 2AJYH 1WAPA 3HTLX 3MCYA 3AT9A 1OHZA 4P59H 4A67A 2DYPA 4MB1A 1U91A 1OE2A 3Q6FA 4AC4A 2DQDL 3CK0L 4ATWA 4BQ6A 2OL3A 2A73A 4N2EA 3K0YA 1MI5A 4PGBB 1M3JA 5HHVH 1RSFA 3UG4A 3HAEB 4ZO9A 1A7QH 2DWEA 1IMHC 4PJGB 1LK2A 1CT8A 3ZBMA 4OLZL 3VE0A 5CZVL 4NRXB 1WBZA 3B9AA 3C9NB 4HUVA 3VRIB 4V1DB 4DH2A 3U2SB 4N28A 3DUUA 1IAII 2AV1A 4NJ9L 1PNDA 2MTPA 2XZCL 2C1OB 5SWSE 5J13C 1CLZH 3FSWA 3IXTA 3JVGA 4NO0B 1KJVA 1O9VA 1UXSB 5DEJA 3X3GL 5GS1B 5D70L 3LKOA 1RV6X 1C12B 3F58H 1SY6H 1CF8H 1ECYA 2D3VA 5HJDA 4G6AC 4UT9L 2O30A 4RGOL 4EE2A 4QRSA 1NCDL 1BQ5A 3TYGH 4BUGA 1FHGA 3BAXA 4H5SA 4N68A 4NPYA 2NXZB 2A38A 1HU8A 3B43A 4HH9A 1IE5A 5KANG 5FDYA 5EN3A 1FAIH 3KPPA 3HUJB 1IC5H 5BRZB 3D85B 4FNLL 5IQ7H 4H40A 2K3TA 7PAZA 1YY9D 2BNRB 3RYMA 1E3ZA 1UB6A 4M1GL 5F6IC 6CGTA 3WLBB 4PW9A 2IBZY 2ZONA 1T22B 1S2EA 2VXVL 4XPFH 4TN9A 4MRCA 4V1DA 3MRBB 2D7PA 4TSAH 1LK2B 2M1KA 2DBJA 4GRLA 3AWGA 3LRGA 4H8QA 1Q9WA 4HKBB 4DIXA 3U4BH 2MIZA 3ALPA 3QORB 2WINB 3C5ZA 1GGBH 3KR3H 5DK2A 3T1FB 1R3LA 3N40F 4OJFL 5MEPA 2KQNA 2B39A 1ZJBA 1S3RA 1ZK5A 2JLPA 4X7TA 5EO1B 2PO6C 1DQTA 4HWUA 1W9XA 1TTBA 3U0TA 1E40A 2A74A 2FJFA 3ULUH 1DVSA 5IHUH 2VZ3A 4Q9RL 2XCMC 2BX5A 3ARDA 1W2KT 4AGPA 1LK3L 2JJTC 1TJMA 4P9HL 1FORL 3TURA 3QO1A 4WQOA 5FUCC 1Z5LB 2E7LA 5KUMA 3FO9A 4J3OF 3RX7A 3RZCC 5L8JB 3V79C 4HF5L 5DK0B 4P4KB 3CQPA 4D0BA 3L4WA 4ONGH 1Q90A 3QUYB 2X4NB 5T1LA 3DPBA 1KBGH 4H26B 4KZEL 4Q7DA 1P2CB 3I9IA 3UO8B 1JZ3A 4YSSA 2WOYA 4RFNC 4GSUA 4X5WA 3BD4A 1IAOB 1KG0B 1ROCA 2BM3A 2HLAA 1RUPL 1YRKA 3V6BR 2G9HB 4UM8A 1BP3B 3IGFA 3P4OB 5SWZE 4U3CA 4LNRB 3WUWB 1UXWB 1K4CA 1K5NB 3HAEA 3ZDYE 3IMRA 5HYSA 4P8QA 3M1OA 2CA3A 3B34A 1AZBA 1LO2H 1OV8A 1H3UA 4QHKI 2WPGA 4CDHA 4FQHB 2E9GA 3AZUA 3BGMB 3HZMA 3HE7C 3I9PA 3EJZC 2Y07L 3UERA 4JO2L 3GIVB 1PZUB 5IKCA 3S3JA 2XACC 2OQJA 3HG2A 1O9ZA 4FG4A 4L3ED 5E08L 4ZMYA 4L9LC 2XZCH 4H26A 4YAQA 2Y23A 1IKNC 2IJ0C 4UBDC 4TUUA 3V5HB 2GSGB 5GGSA 3HUJF 3KPRD 3GSRB 2D7MA 4HUKB 4U6YA 3OXSB 1A1MA 2YAOA 2WXIA 1BXVA 1DQDL 1UXLA 1KLGA 12E8H 3SJVE 2ATAA 5GISH 1UC6A 1TTAA 2JKJA 1OCRB 1YMME 3B9EA 3I84A 3MBEA 2UUDH 2WCGA 4JY6B 3K1DA 4F27A 3J8F7 4U4BA 3ZTCC 4ZJ9A 3FOLA 3ZYZA 1HAUA 4DQAA 4QTHB 2DPKA 2DDQL 3GMNB 3U7WH 4PWKA 3THML 1T21A 1THCA 5KVGE 4X6CB 7FABL 5DD1H 1U8PB 1HEZA 4PR5B 4FI7A 3KM2A 1WA0X 5F9JA 2FTAA 4KTGA 3P11H 1U93A 4D3CL 1A7PH 1TQSA 2BERA 1P9MA 3LHPL 5I1IH 1PX3A 2NLJA 2UX7A 4HIJA 4AG4L 1QP1A 1XZWA 3FO0H 2BOBA 2K78A 3QO0B 1OTTD 4NGHL 5C07E 3ZGIA 1DN0B 3GO1L 4N8PA 3RVTC 4ZNEA 1NH6A 3KWUA 2WO3B 5FA4A 1UHVA 1IGTB 2EDRA 4TUKL 3EFFA 4IBWA 4POUB 1H3XA 1FAIL 4PG9A 3STZA 5JW3H 3NCWA 1KJ2L 1IEAA 1DDHB 1QTSA 1X5HA 3CUPA 4ORZC 4KPHH 3K6FA 3DVIA 4KK8D 2V5MA 1XGQB 1X5FA 5L8KB 3V0WH 3QIUB 1WZLA 2ARWA 4PGDB 5D5MB 5DVOA 4NPYB 2H1PL 4YVNA 4QXUL 1KTBA 2R29H 4XN5A 4NI6A 3LPOA 4A7UA 1YC8A 2DQTH 3O3AA 3ZHNA 1G7QA 2OTWB 3DTUB 5KYYB 4KUCF 3FQ4A 5IQNA 4HT1H 4TNWK 5L2KE 4HDIA 1TFHA 1TQWA 2AANA 2FB4H 1EXUB 3L1GA 3SD2A 4A2EA 4NUPA 5C7XH 1H3WM 2I24N 1IEBA 2WQSA 3BAJA 4PW3A 4NNYA 2Y9RT 4LLUB 5TDOB 1FPTL 5IQLA 1NCTA 4XO8A 2O61A 2IBZX 1QNZL 4FFYH 2J8UA 4PWGA 3KHQA 4DGYL 4QXTA 5LBGA 4ZOCA 1J11A 4MWFA 4P48A 2B1OA 1CFQA 1A6ZA 2RTTA 5F93C 1TENA 3FL7A 4Y9EA 5KYUA 3DRQB 5I6LA 1UADC 3CXDH 2ZF9A 3U1PA 4LNVA 2P24B 4YHZH 1I9JH 2ZSWA 2X4TB 4DP5X 4E9YA 2K8QA 3VM5A 3U83A 3W82A 2WJ7A 4O58H 4WAFA 43C9A 3HJEA 3EGDA 3IVKA 3D8MA 4CVUA 1E8YA 1QNIA 2YEQA 3MLXH 4HHWA 1EIBA 4YZFF 1Q9OA 2R23A 4F7MB 2VDLB 5C0DB 3RWJA 5CGBA 3D39E 4ETQB 5CN1A 4NO3B 3ULUC 5DZLA 4OQTH 4ZO6A 1YJDC 2A74C 3FRPB 5CLXA 1DJSA 5ECGA 1F56A 1CGSH 4TLUA 5IZ7A 4MDIA 3ES6A 5EUKA 2MNWA 1BGXH 4K23L 1MFCL 1PEZA 2VDNL 4LRNL 1BVZA 2V8MA 1MRFH 5HDOA 4JQXC 3G5VA 3TS8A 1EGJL 1J5IA 1BHGA 4TNVK 2MNUA 3N43F 1W6WA 2MKWA 4BELD 5KSUA 3HZ3A 3E1ZA 4WWID 5J11B 4O5LL 3SKUD 2CU9A 1BVKB 1WZKA 3PNRB 2OX5A 2EH8H 3WHXA 5KUKA 3BMVA 3R06B 2NUTA 3L13A 3ES6B 5EUKB 2CGYA 1I7TB 5L6YL 4J2QA 5JMOC 5CF3A 1ZTMA 4YO0B 1JNJA 2BNRE 1I9RH 2FE0A 3QQ3B 3E3QC 4NNXB 4G9DB 4F8QA 3AQXA 3UFIA 2YD1A 2JK5A 2BVOB 4IU3B 3Q0HA 3H1ZA 1S9YB 4HISA 4MQ7A 4F9PC 2W65B 3EW3B 4KTEL 4XC1H 5LBSL 4BZ1A 3IFLL 2ZUXA 4XMPH 4AOFA 3ROLA 4CN4A 4I2XA 4ENEC 1KWKA 2C26A 2R29L 4MLIA 4GKZA 2JJSC 1NEUA 5DVLA 5TF0A 2IDFA 4Y8DC 4DPRA 4AENA 4GG6E 5IJDC 2EE6A 5GJSL 5DJ2B 2B59A 2ESVB 1PYWB 5HJGA 1YDPA 4X4MA 4G80B 1GJIA 1M05B 5E23A 4PJXF 1XR8A 2YIHA 4IRJC 4I85A 3M86A 1ZT1B 2YPKA 2L0DA 5E2TL 4MX7B 3MYJA 3O3AB 4PJ9B 4QGTA 2GJJA 2CIIB 4TTDC 1AOHA 3IDIB 3LDBB 1R3JB 4NQED 1N0LB 4PJHB 3D06A 3RWGA 1L4IA 3N44F 1EXUA 1KFGA 2JIXA 2VCOA 2WCPA 3AFLA 3BP4A 3CN0A 3VFUA 3WMPA 5HPMA 3X11B 1DO5A 2AJZA 4KRLB 1LE5A 4GP8B 2OW6A 3GBNL 4YHMH 2PN5A 1IEAB 5DD3H 3MV9D 4K7PH 1DQMH 3FF8A 3FO0L 3U9WA 1MIMH 2GJZB 2MCPL 2HT4D 3MLYH 1EXGA 3Q5OA 5E00B 3NCXA 4N0UA 1HS6A 4I87A 1YCSA 2G5UA 2FUQA 3FSOA 2VM3A 3H6AA 1X5LA 3GJFB 3LDBC 2Y7OA 3MFFA 3MJGX 1N70A 1Q94B 5KSBF 3KXFB 4DP7X 3C60C 3F7LA 2IAND 2R56L 3HNSH 5MI0B 4AENB 1BG1A 1OK0A 3SYQA 2CRYA 3K4AA 1P6FA 1RJYB 3PABB 3GYRA 3N85H 1ZLVK 3PGDA 4AJWA 1AXIB 3N44B 4NSKA 4HQQL 4Z7VB 3ZL1A 4JBSA 1JGDA 5AW8B 3V4VB 4OKVA 1JV2A 4OLYL 3FQNB 3O6LL 1UQSA 2AMGA 4RMQA 1CZ8L 5KG9A 4FLRA 1L9TA 1CF8L 1FCGA 4OJYA 1ZLVH 4GKNB 4W93A 4QRPB 5C7XL 4KRPD 5ICXB 1MRCL 4L8SC 4DP8X 4OQTL 5B21A 5K9OB 3NVQA 1AQKL 4LF3A 1RUAH 4QRFA 1ILSA 3CFEA 1EA9C 4JM2B 1QSFD 5ESVB 1BQLH 1J1OL 3NH7H 1JN6A 3O2VL 3PYCA 4NJ9H 3BUDA 4YHOL 1MVYA 2CUHA 1C5DA 3BKJH 4NDMA 1FYTB 4PQXA 5DLML 3FTVA 5H4YA 3WMSA 2FEEI 1XSKA 4AQ8C 4FAAB 4QPEA 4YDMA 4PJCF 4QRRA 1J5HA 5BZDB 1CIUA 5GS3A 4ALAH 1LO4H 4BWUA 2C9SA 2CBMA 3S88L 2Y1AA 5EUOA 3CK0H 5FIEA 3JWDL 1YEGH 1YN6A 2JTDA 2G60H 4P23D 2WP3O 4I9WE 1KEMH 3KJ4C 3FMGH 1NGQH 1J0ZA 1QSVA 2X4SA 2DZEA 1U21A 3T2LA 3EDEA 1H8SA 5GS1C 5I8EA 3WFBH 2HRHA 5A2KH 5GS2H 1MKFA 2LVCA 4B3VA 4M93C 1MFEH 5IT2L 3DJZA 2WAQA 4M8VA 4BUQA 3HG1A 1M71A 3WNOA 1N7ML 5E5RB 1C16A 3QNFA 2F5BL 3SDYL 3O3BB 4KK9D 4C83A 3LQAH 2C3XA 2FH8A 1KIQB 4MAYD 3OR6B 4KY1H 5I15L 3CZFA 4JGMA 4ZS6C 3ZSSA 5FGCE 5I6MA 2WWKO 4L3FA 4RVBA 4WI3A 2JCCF 2E6JA 4X6FA 4MWFB 3KWWA 4N3UA 1EFXA 1KTJA 4UM9D 4AZ8B 2AXGA 5F3BA 4N0FB 3O9WD 4OZFG 3ULVE 2UYLB 2VJ0A 1F6FB 1ZE3C 2OP4L 4JZNA 2KDGA 4KZCA 5D2LA 4LSVH 1SXSA 2Z8SA 1N64L 1RP9A 3NCMA 1GZHC 5C9JB 2GJ6A 4W6XB 2D0GA 5GGUA 4HJGA 3GXNA 3AAZB 1L6XA 3C09C 4LAJH 1VKXA 5FYKL 3L7FA 2ZOKB 1S9KC 1LP9B 3T0BA 3RPBA 1IGYA 2QKIB 5MERA 3DX7B 2AV7A 3QUHA 2NZ9D 4ZYKA 5HYQB 2KLSA 4QXGH 3X1GA 3VXRD 4K4KA 3NFNB 1J8HD 1TVDA 3CHXA 1WG3A 1I85C 3BPOB 1IKFL 1XV8A 2XKNA 1RI8A 1TZIB 1G7JA 2CDGA 4PW4A 4XBPB 3P9LA 4E42B 1UXWA 2FUTA 1KY7A 3DX8A 2XDHA 4M5SA 2R2BA 2ZAHA 2EDQA 1G0DA 2PF6A 1QZ1A 2Y36L 2CNZA 2XTJC 4PS4H 3K6SA 4JO1L 1K85A 7CGTA 1H8NA 3MRJA 1QHQA 3GEWB 4L3AA 4MD4B 4IQHA 3Q8FA 3VFTB 5IIEB 3TCLA 4NKIH 3RY6A 2QVKA 4YDKL 3IAQA 4W9ZA 4HK0B 4PU2A 4WW1A 3W2DH 4UM9B 4O51A 3CFJB 3OD3A 3I02B 3B2UD 4C56B 2X1PA 1LP9F 1MHHA 5F88A 5C07D 1ZLEA 3BKJL 1WD9A 2BWDA 3GSNL 1UCTA 2GHWB 2NY1B 2BNUA 2CKNA 1R9FA 1H8OA 2R29A 1MJJB 1QFUH 3D7PA 1X5GA 5E99L 4L3EB 3T3MF 5CFAA 5ISZA 3O6LH 3UTTB 1PG7L 2ROXA 1JPSH 4JVWA 4G7VH 3OMIB 3WAJA 3QZBA 4DKFH 1JRHH 3OSKA 4FTVB 4WEEA 4S1DD 2YRZA 2APFA 4AITA 3MLUL 1AGBB 3GSUB 2XN2A 1HL8A 2A6JA 1UWYA 4N8CL 2AJUH 5EC2A 4EN3A 1WBYA 1YEEH 1BAWA 4OD1L 4PJCA 4MNGB 1JYNA 1FA4A 4JRFA 3CCHB 3ZZLA 2XIDA 3ULAB 1FVCA 5EIIB 2H6PB 3NOIA 3N06B 4D9QE 3TA4D 2MQ3A 4BFFA 4FTDA 5HGAB 3GHEH 5CXPA 1I3RA 1JZ6A 1AMXA 4H25B 3TX4A 3O3EB 3IM1A 4NP4L 3K6SB 2ZNXA 4YIQA 3CNKA 3DIDA 2XTJD 2VDRB 4XHJC 3TV8A 2FATH 1WF5A 4PJDE 4X6CF 5BOZG 5FYKD 1G9EA 2CLRA 3II1A 3UJTL 4XVTL 5CIPH 4ELKB 3VD9A 3LPWA 4MA8L 1JWUA 1RZKC 2YD2A 1VFBA 3N6YA 5FA3A 5LKNA 4JN1H 2A9NH 1F6AB 4I0PC 4C58B 5DCCA 3MKKA 5DRZA 2YUWA 3PWNB 5CUSH 1R19A 5IT2H 1EJOH 1ZMYA 2NY5H 5EO0A 3TWCL 1XMEB 1BF5A 2IFFL 3NABL 1GGYA 2FEJA 1JWMB 4PGBA 3EYFA 2ZUUA 1FO0H 3QH3B 3MJ9H 2X70B 3LZNA 4GG8A 4WSJA 5D2LB 2IPTL 2GIXA 3VRIA 1N0XL 1WC7B 4LNRA 3O9WC 4ZPTA 4K7FB 4L37B 4JFYA 3U1SH 1TJIH 2DV6A 3G6AA 3ZZSA 5DURB 3DX2A 4N1CA 5FUOH 3WIHL 4DN4L 2Z8RA 1TQUA 1F4AA 4FYQA 1SDDA 3GMLB 4PJHF 4FJ6A 3GJFK 2YBRA 4QCIB 1UD3A 3ARRA 4JM4L 1TFPA 2FBRA 5F6HJ 3UAFA 5D4IA 1KJ2H 3E6FB 4FQ1L 3FFCD 5DFAA 3CGTA 4XO3A 1TCRB 2KZBA 2TRYA 3QG6B 3ZRFC 3PNWB 2WKLA 3O6KL 3RB7A 5GQBA 3ULUE 4H8UA 5T5NG 5I15H 1P7QA 4YX2L 2AXFA 3ZQ9A 4G9DA 4E5XA 4LOFA 3HAEH 4ZW8A 5D93B 4LIQE 4YSPA 2VXTH 5BVJB 5HVFB 5F9OH 2A9MH 5F21B 3VJ6B 5A6LA 4K3GA 2XV3A 3SGJA 4XNQA 5M95B 5DO8A 4AEHL 1ZANH 2VN6A 4RESB 4O2CB 2XI9A 4WI5A 5TF1H 2HX7A 2D9QB 2GSIA 4AH2A 4U1SA 1CLZL 4F7EB 3RY6C 4U1KB 4PV8A 4QF1A 4ZTPL 2ZWZA 3QUZA 4MJID 4G3YH 1M7DA 4MCNA 4DQOH 3D6GA 43CAA 2YKLH 2WYHA 3MZGB 5B38G 3VW3L 1FE8H 1QWHA 5D7KD 3KPRA 3T4YB 1CLVA 1RK1B 1WVZA 3X14A 3GXFA 4BCXA 1NLBL 1L7IH 5DYOA 2UWEE 2AFNA 5TPWH 3LRSB 4BK8A 5JIPA 1A6UH 4AIOA 5TDNA 5LWYL 5K39A 1NMAL 2EYSA 2WBKA 3TBSA 3RVWD 1UB5A 4GFTB 3T0EC 2WXKA 1QRNE 1SQMA 4C83B 3GUTA 3MLXL 1OD7A 2A3TA 4IRSB 5AVWB 4KHTL 1NKRA 4JEGB 3PAYA 5I30H 3OV6A 1PSKH 3PV7A 4P99A 5EBMB 5ANME 4QRSB 4Z8FH 2P5WA 3MLSL 4LARL 4U6HA 5BV7H 3ZDZF 5GHWL 3UJIH 5EOQL 1AZRA 1K72A 3U9PL 4NN7C 4X50A 3NSJA 4LFHD 1AOZA 2Z93A 2FCBA 5E9DB 3CX2A 5CD3B 2IOMA 5DC2A 1CDUA 2N01B 5TDOA 4FQLL 1G1YA 4JKLA 2XBDA 5DT1H 4BCZA 4KKCC 1ZHKA 3IETB 1UGKA 1UJ3A 4JG0L 2YQ3A 2QVIA 3DUSA 5EOCL 4BQCA 3REVA 3QFGA 1CK0H 1I4FA 1Z9PA 3LN9A 3PS6A 2J25A 1X3DA 2JI3A 2F61A 3HBGA 1A4AA 2KZWA 3AM8C 3W11C 1HSAA 3AREC 5K9JH 4H0LC 5IB5A 4PJ8A 3GDBA 1Z66A 2J3SA 2X6AA 4G43B 4KK5D 4PCTA 4HF5H 4Q9BA 4ECNA 3LXCA 4GB9A 2XWBA 1H3TA 5IVXB 5DJCB 3O6KH 3QR0A 5DD6B 3K0WA 4PV1C 5EHFA 1OO2A 3ARFC 1TYEB 4XMXA 4Z0XA 3MBED 4XH2A 1MCFA 4OIBA 4XCEA 5DJDA 4TSAL 5C6TH 3I02A 1E2ZA 1KFAH 1WFJA 1PZ5B 4WO4B 4DOHB 2IPKB 4YDVB 4YK4B 4GI6A 3QA3B 4JM0A 2OR9H 1I8IA 3IJYB 1AQDA 3N40P 4XHJD 3ZT5A 5L6YH 2XX1A 2XPZA 1QACA 3OGOE 1XIWA 5IM7B 2BVEA 4Y4HB 3RA7H 5FF6A 4UIMB 5E1AA 3DO7B 3FUFA 3GHBH 4MVBD 4RGMC 3ILDA 5DZ9A 3O2WL 3TM6A 2WNGA 1U6AL 4LVHB 1OSZB 2ZYIA 3NIGF 3WJJA 4G9FA 1R24B 5JORA 2X4RB 3DURA 5JYLA 3MRIA 3O6ML 3RDTA 3CC5B 4QHPA 2AC0A 2V2XB 1AGDA 3T0EE 1VFMA 1JFQH 1MCWW 3ROOB 4YHNB 2AJZB 3D5OF 1KTLB 1VIWA 2JELL 3ARUA 5I8KH 1S9VB 3G7TA 1G7JB 2YSSB 2C4FT 1JZEA 2W81C 5T3ZE 4QT5B 3S2CA 3MUJA 4O4YH 3LIZL 2FIKA 5F3BB 5DD0L 3TGXA 2QQKH 3WJMA 2PR9A 4DP4X 1BQLL 1J1OH 3NH7L 3RGHA 3SQBA 3ZE1B 3MN8A 4XP9H 3HPJB 4HIQA 4M62L 4PUBL 5CWSB 1JVKA 2GQHA 4I3RH 2BHYA 4HZLB 4P5TB 4FXKA 1FL6B 3CDZB 4D8PA 2IDCA 2M83A 2NY1D 4NKOB 2CHNA 4R96B 5ALBH 5CD5C 1RPKA 3ESOA 4OM0H 1PMYA 3LH8A 4QRTB 2YD0A 3RKDD 3ZQXA 2NDGA 3KYNB 2K70A 1UUNA 3TCTA 1X4XA 4N0CC 1E5AA 1ZWIB 2R0WL 3CFMA 4DPBX 2E3VA 2VDQB 4CN6A 3V4LA 2E27L 4LQFL 2JFCA 5JPMA 4XX5A 3WYRA 3S2AA 2HFEA 3LZOA 5KAQF 4NZUL 5I0WA 1OTUD 2LU3A 4EXPX 2Y5EA 2ICWI 4U7SA 4ZOAA 2NQ3A 5AW0B 5JW5A 1MDAA 3I9GH 1ACCA 1M2OA 1S9VA 2YAQA 1FGNH 1DJYA 4PGJA 3ZRSA 4RX4A 4TLTA 4ISVA 2PP9A 2PYED 3CVIH 5I1LB 2IAMB 1VLXA 1TIUA 3FQWB 3MRRB 1KT2B 3QUMB 4HOZA 3O4OC 1UM6L 1N26A 2Z4QA 4IHBA 3WFEL 3QARA 3KBEA 5JXEA 4OZFH 2VZTA 3BQUB 3PV6B 3QPXL 1LDPH 3B9VA 3ZTNL 4J3VA 5IEHB 4RSVA 1IKOP 4IBUA 3LH9A 4Z7UA 4ZSOB 5I66A 2Y7LA 2R23B 4PJAE 3CLFH 4F7MA 1G4RA 1NGPL 2V17L 3CSFA 4XWGH 1T20B 4Y2OB 4E9XA 4A2LA 4NKMA 1U3ZA 4F57H 1UH3A 3D05A 2FT6A 5FGBC 4YFDB 3KXFE 3HMWL 4Z7WE 3GBDA 2FDBP 5C6TL 3FTXA 4UIMA 1XEDA 2P8MB 3WFCL 5E6SB 3NT0A 4OD3H 4EVNB 4Z7IA 4RDQG 2OP4H 3GO1H 3FMGL 1VB9A 3MR9A 5AW4B 2JSFA 3P02A 2EKJA 3FCTB 2IAMA 3MRRA 3UYPB 4KQ0A 4KZ0A 5EH1A 4PS7A 3WDHA 3DX1A 3ARED 1CR9H 3RA7L 2GAZA 4HOWA 1ZHKB 2VN5A 1YPZF 1JZFA 4FQ2H 5CO1A 2CO7A 5L4JA 5A6MA 5L2KA 1IEBB 2I27N 1I31A 4XN1A 4F15C 1RHHA 3UAJD 2E56A 3AG3B 3LQZB 4MJ5A 1S7VB 3GIZH 5HGHB 4EI6B 5D2LF 3BVWA 2JXMA 2ZYSA 4Q2ZB 4XN4A 3TH2T 4ZO7A 3OJDB 2Z0BA 4ODWB 3H3KA 5FO7B 2EVJA 2VR9A 1R1CA 3QG7L 2IQ9H 4JUSA 4JJOA 4GXUM 4K9EL 4PTUB 1NGWA 1GGCL 2GK0A 2QTEA 3QAZC 3LQAC 4AUJA 1XL4A 1FL6A 1RY7B 5JQ6H 4HZLA 4KKNA 2CLZA 3E9TA 3JTSA 3K2UH 1ND0A 2EYSB 2VM9A 4P5TA 4TSBH 2B59B 1BZDA 2ESVA 3EF7A 1DEDA 3NA9L 4F7TA 3D09A 4O5LH 5JQHC 5IMLB 1KB9K 4Z77B 1SY6L 4QWWD 1EERB 4HWZB 3VFGH 4YHLH 5AKVA 5F1NB 2OXGB 1I75A 4OIIH 4Z7QF 1G0YR 4WFFD 1YVLA 1FBIL 2A4EA 3TBVA 4JPVL 3HI1B 3OKEB 4G6KL 4LRIC 5HDQL 1A3LH 1OARH 1XF4A 4QKTA 4QT5A 4U3SB 5D1ZA 1E5BA 5F6HI 5INCA 3S3DB 1M7DB 1FQ9C 2FH6A 4M8QB 4DP9X 2FSDA 2EDNA 5HVHB 3BAEL 1TU2B 3GLZA 5ABAA 4EF3A 5T1MA 4ATTA 5I8KL 1NL0H 4PJ5E 4DKFL 1J8RA 3QT2A 1CD9B 3RGVB 1LEGB 1PZSA 1WHPA 2CHZA 4LSSL 1FZMA 5KYXA 1IARB 5EOCJ 4X0NA 2APSA 1B3JA 1CFBA 3CSYA 3QEUA 5DD0H 3B6SB 4Y19B 5BVPL 5CJ8A 1BQHA 1MAML 2F74A 3FDWA 2IPUK 4U1SB 5DEZA 1RIHL 4L9DA 2IMNA 4K5MA 5GXBB 4JDTL 4MB4A 4PRIA 2PYFB 3PXHA 1XQ4A 5C6PB 4PY7B 4FCAA 2GTQA 3MVSA 4V1DE 1OAUH 3HMWH 1A1MB 4Y19E 3GT6A 4FX5A 3KW7A 5HY9B 4PYHA 4ZAKB 5IBLD 5GGSB 1Q9LA 5GIRA 5CNHA 4JG5A 3BIAX 3N3EA 3WXVL 3V0AC 5IUSA 3RVXC 5IV2B 4G5ZL 3UGEA 4Y9GA 4LQ1A 4WW2B 3G5YA 4ERSL 2NY2B 1YMMA 1E6JL 5E4OA 5GZNA 1S7UB 3WIHA 4NKQB 4D2NA 1JF6A 4BQBA 5EO1A 4CVXB 4FQ2L 2X1XR 3LEVL 1EDYA 1AD0A 5DUBA 3NYKA 4PP1C 3S97C 4HPYH 1A3RL 4K8RH 3D3VA 4KTEH 4XC1L 2E7MA 2IPTH 3MUHL 4YSRA 3UYRL 3LNGA 4DZ8B 3EYFB 2VZOA 5CLZA 3LH2H 3CVIL 5LVEA 1FVDB 4KJWC 4G8GE 4JG1L 4D0DA 5C3LD 3FW6A 4JFXB 5FUOL 4QR7A 1XH3B 2Z91A 4FDWA 2YD5A 1C7TA 5FWQA 2DBLH 4ZFOL 3SN6N 1OF2A 1DR9A 2A9NL 3LCYA 2J21A 1SNRA 3OWRA 4JDZB 2O5XL 3S35X 2VISB 4MNHB 3ZN6A 4FQ1H 3MLWL 3ECVA 2BDNL 2C3VA 3PP3H 3QUML 2B2XH 4JVPA 4TL5A 5J1AB 2FQEA 3MNZA 4MD5B 3SDDC 1NCOA 4XO5A 4DZBB 4LKCA 1QO3A 3ZZQA 1Q9KB 5SWZA 1WS8A 2ARJA 5L8LB 1MRCH 2BY0A 1RH8A 4A1RA 4B9GA 3NPSB 2CJ3A 2DYSB 1MIEH 2DWDB 3MRNA 1JNNL 1SOQA 1MOEA 2X44D 5CEYB 1J9CT 4WFFE 5JOFA 5HGDB 1GW0A 5IBUG 3GC3A 4QLRA 4RNRB 4R5VA 4U6TA 1OQXA 2JKIS 5HTSA 5FOJA 2WIIB 3V6ZA 2DLGA 3BUTA 2X6VA 1XD1A 2BS8A 4OLXH 1GRWA 2GCYA 1J8HA 4LHUD 2ED6A 4G3YL 4MTMA 3VFGL 3FULA 4D0DB 3ESUF 2IOOA 2YKLL 1RZKL 1KB3A 3QQDA 4L4VB 3RWEB 4N0YL 1E27B 1IBYA 5HVGB 3L3IA 5H37A 5FGBA 3QUZB 4FC3E 3VFOA 1F4XL 1T03H 1BFVH 1WA1X 3MLVH 2N7BA 3FFDA 4PBDA 3DK0A 1TMCB 1Q0YL 4O51B 2CBTA 5LWYH 1X6LA 1FI8C 1AIFB 1DQJA 3NFPB 3WIAA 4I0KA 2DWYA 2R51A 1S78C 3FQUA 1AY1H 3Q7JA 1TEYA 3KPSE 1MFNA 2NY3B 2EAEA 1FLRL 1MLBA 3RPIA 1G87A 1V55B 4QRRE 2OAAA 1I7RA 3BE1H 1OOWA 3QFJD 1CYWA 5IMOA 3BPOC 1L0YA 2J8OA 1MHEA 2X4QB 4Z78B 5JXAL 2QEJA 4Z0BH 2APTA 2VLKE 3HC3L 4Q0XL 1HZHL 3UZVA 3JWOC 1FRGL 4WKZA 3HG1D 1EFQA 4PJ8D 1TCRA 3QG6A 1KTDB 3WFDH 1H0DB 3QCUH 4N5UA 1SXAA 2D0HA 3LKQA 2EADA 2IADA 5EEVA 1IGYB 2QKIA 3F12B 5GGVH 1F3JB 1X9UA 1NAMA 4NQDA 1KJVB 1UXSA 1DEEB 3IWVA 4RISL 5DS8A 7TAAA 1D5XB 2WNXA 5IFHL 1KZQA 4C56D 3MC0A 4ONHA 4DO6A 3MJ8A 4OGAC 4BGDA 3DK2A 3EO9L 3VWKB 1AZCA 3WO3B 4QRRD 2NTFA 2DQTL 5ESAB 1NEPA 1I8MB 3ZLQC 4J1UB 4L18A 2FNBA 3QXDB 4X42A 2CDFA 3AAZA 3DX4A 4Y88A 2JE8A 2WXPA 3MRHB 5FPIA 4RWYL 1BJ8A 4OZIE 1X5ZA 3F01A 1I8KA 5EORL 2WTOA 3CD4A 3P3UA 5DJXB 2VDRH 3UO1L 2W60B 5EO0B 3S35L 1P9MC 4M93B 1X5IA 2YOCA 1FWXA 3L3OA 1W80A 3RX9A 4OM1H 5EBGA 1JGIA 2X5PA 3Q5TA 1JHTA 5MEQB 4HWZA 2J56A 4QHKJ 3LNFA 4XNAA 2E59A 3KJ4B 4ZFZB 1MCSA 3LYRA 5KOMC 3F7YA 3L8QA 1YY8A 1S46A 2B9BA 1DLFH 2Y3AA 4D0CB 3IWUA 1NAMB 4L1LA 4NQDB 4ERSH 5AW1B 1SM3L 2BH0A 4ZTOH 2VTFA 2HPTA 3HCVB 1BPVA 3P54A 4KI5C 2XTJB 1B9ZA 2R0ZL 2X0UA 1SVZA 4MQXD 4X4ME 4G6AD 1JWUB 4DUWA 3G6JE 2EH7L 3JWOH 4CL7A 5J6HA 2HVJB 4X5WB 2Z8VC 1RHFA 3DV6A 2WTPA 1G9MH 3ULVF 1QHOA 1UOVA 5F71A 3QXAB 1RK0A 3HFMH 1XEUA 1CXFA 1VPOH 1WBYB 2DAVA 1C16B 1CDGA 1D7CA 1F90H 2M26A 1JF5A 3D2UD 3LXAA 3VI4B 2DEYX 1OW0C 3KBHE 1FZKA 4GBXD 3UGXA 5DHYB 1EEQA 4OM0L 1HL4A 3UCRA 5B1AB 3FU0A 4TL4A 3S36H 2YXWA 3DHMA 4LDLB 3S96A 1OGTB 4HHGA 3UTTA 4AZUA 2BO0A 1YN6B 4XP5H 1A02N 3TO4A 4F15B 2WBJA 3VI4E 2EO1A 1BMZA 1E4WL 1ZEAH 4OGXL 5EU7C 2A6DA 2XRAL 3D39A 3P9MA 1JDCA 3WO4B 1AZZC 4KQ3H 4PIBA 4XBGA 1I3GL 3LKSB 4LVEA 2XXFA 5JXAH 2KH2B 4YWGL 2VUOA 1T0MB 3DOSB 2F18A 1BOGB 4Y0GA 4BFIB 1WP6A 3CZJA 3JWNE 2OW7A 2NNCA 4NZJA 3PU7A 5HHME 1I1CA 4N6RB 4ELMA 1G9MC 4J3OG 3VXNA 4FN0A 1F1AA 5C08E 5JPMC 2YBGA 4Q52A 4O2EA 2Y0SA 2H32B 1JGUL 2WHVA 4OKVB 4GUQA 2ISDA 5TE6L 5AOLA 5D6CB 2KQMA 3BP6A 3FONA 1AO7B 3B3IA 4OGQC 4JG9A 3RHWF 1AI1H 4P46A 2NTSP 1RK0B 2VLRB 1NMBL 2X40A 4PRHD 1F8TL 3ZTDC 1BBDH 3HRPA 1KT2A 1A4JB 1DJHA 2E4TA 5I1JL 1DFBH 3TV3L 2HFGH 4AE1A 1FFRA 3EJCA 3MNVA 1NIDA 5E9AA 4OF3A 2VISA 4MNHA 4YSCA 1IM3B 4E41A 1UATA 4NLHA 3BPLB 1FIGH 1ZPUA 4G6MH 3H9YA 4P23A 1VCAA 4QYOB 5A3ID 1LE5B 2XZAL 5B8CA 4HKXB 3BEWA 2IPUG 4YC2B 5D5ME 3HS0B 1M05A 4KITB 3BZ4B 1YNLH 4R7DB 3BW9A 1QA9B 2BJMH 3O4LD 3ZMNA 2J6EA 5DJ2A 5EU6A 3FBQA 1JI1A 4QY8B 4J28A 4Z7OF 2DH3A 4PJ9A 4LP5A 3W0WB 4EDXB 4G8IA 2J1WA 1S8DA 2YPKB 4K71C 2F5AL 1CGYA 4GAGH 2Z35B 1M71B 2FJSA 3PCYA 3SDDD 3WAKA 4BA0A 2JIXB 1SQ2N 3NK4A 1SLWA 1VADA 4GW5B 3QCUL 4NQVA 4OJFH 4J27A 4X99B 5HJBA 5IB1A 4PJ7B 1HX0A 4E5XG 3LRMA 4XE5B 2ALWA 3B37A 2JJSA 5EZJB 3VNZA 2COQA 2YD4A 1J8SA 1TJIL 3H7BA 4K2UH 3VSTA 3OR7B 3EF4A 4FABH 2VDOH 3FJTA 3SIKA 3QEGH 2AKRA 1QI3A 4TYUA 4N0UE 4JRXD 2V5YA 5J11C 5DRWB 1AD9A 3UTSE 1A4BA 1MCPL 2F54D 3ARGB 1MEXL 2WLLB 1P4UA 1EHXA 2FBJL 3UTOA 4S0TD 1BJMA 1VZHA 1Q0XL 4Z7OB 4NZRH 4QNPF 1MLBB 2FD6L 3QI9B 3RPIB 5D9SB 3D52A 3MRCB 1HCZA 5DDHA 1IFRA 2W94A 5DUJA 1AQKH 5AG8A 4E41D 1G7HA 3U6XS 2NR6A 4JFZL 3OAZK 1EZLA 5DMGC 3CZSA 5DFVD 5GRJL 4JZJB 5TDPB 2VIRA 4ODUB 4ODVL 5D7IF 5D6DA 1IVLA 2E74C 3KPQA 5KVEH 3B5GA 3EG9B 4K73A 1HXYA 2CJUL 3GEFA 3K2UL 1RU9L 5BW7C 1XGYH 5LGJB 4J8RA 3B5TA 3ILQC 2E9IA 4YDVA 2A7BA 2QV4A 1OP5H 1Z9OA 3L1OH 3W37A 1J05B 3O8XD 3Q8AA 2OXHB 2UZXB 1EHLL 1ZLDA 3WN6A 4P2OA 4G1EB 5EBLA 2PNDA 4TUJB 4F7TB 2C9VA 2SODB 4NO5A 3NZ8A 4N2KA 3AT8A 4YVUA 5DRNB 3VFNA 1OP5K 1YHPA 3PWLB 2PP7A 4WI7A 5E2JA 3T65B 1DN2A 3NEOA 5LGHL 1II4E 5JQIB 1FO0B 4LBEB 1A1OB 2OK0H 3ARBA 4N24A 4EN3D 4LPWA 2VB5A 5J12B 2GJZA 2NZ9C 3CSGA 3D69A 4KHTH 5HYIA 1A47A 4FXTA 3AS3A 1ICTA 3LKNB 1EEZB 2PCFB 2HJLA 2Q86A 4NIYE 3U30C 5E5MB 1E7VA 2YFOA 3VFWB 4EBQL 3QVAA 4UMSA 4ABUA 2QSTA 4F2ME 5BCAA 3P0YL 4IRZA 2EDKA 1CLOL 3QYNA 5E5LA 3V9FA 5DEGB 4OTXH 2JCWA 2QLVB 4QWWC 5I24A 4F37K 3RLSA 4OCYH 1GPOH 2DQFB 3MODL 4XCCH 4ZFFA 1RVFH 3JV4A 5AEAA 3RDTC 3BAIA 4F91B 1S3KH 3ABMB 3VDAA 2JCCA 5JIKA 1TETH 1XB6A 3HI5H 3HE6D 1U8LB 4O9HL 1ZLWK 3FB6B 2HTLC 1HZKA 3L3JA 1E4XI 1AR2A 3FUEA 2IGLA 5D2LE 1LEKA 3KWTA 1DVFD 5L9DH 4JFFB 4X0KA 2HLFD 3P3RA 2F53B 4IRSA 2X42A 3VFNB 4LCYB 1PPIA 2J5WA 1KBWA 1RZ7H 4XBEH 4B41A 1MFDH 5D7SH 4JKPH 2HJKB 4RMUA 4IU3A 3F00A 1IL1B 1UEMA 5BNXD 2UZPA 3TV3H 1CPUA 3U0WH 1KN2L 4RBPK 1OXYA 3RPKA 3P4MA 4HFUL 2DICA 4KJWD 4N1HB 5I18L 3P2TA 2NY2D 2YPLE 1Q0EA 1A9EA 3FH7A 4K71B 2J55A 1DLHA 4LDEB 1IQDB 4JPIB 3N0AA 3QJZA 2UXGA 1BVKA 2YJQA 3QI9A 3QYCA 4RAVB 4XMVA 4KXAA 3JUZA 4N2HA 4G5ZH 4XPBH 5E51A 5I1LA 1XSJA 4ILDA 5D7LA 5D7LD 1A2YB 4CADB 4LVOC 3LMJH 3ZZ1A 5CN3A 4G6FB 2CAKA 2Z4QB 3MGOB 4JPKL 3LEVH 1E30A 5KYXB 3QHZL 3FB8A 5FYLL 5F7WC 2E9WA 4MDIB 5TDPA 1RUQH 1XSOA 2WBJB 1XH0A 4P0DA 1J18A 3HMXH 1ET5A 4M4RB 3JV6A 2AXFB 2OMWA 4R0LA 1N5YH 2NYYC 4WHYG 5JW5B 4P07A 1E65A 3X13B 5JIMA 1FFOA 2N4IA 3UTTE 1NGXA 3NN8B 2WJ5A 3EGDB 1OGAB 2PETA 4KFZC 4RFEA 5C0GB 3MLZL 4R96A 2XWRA 3DI2B 1FIEA 4UYPA 1KLFB 4NO3A 1NCGA 3NPZB 1F97A 1FG2A 3VM7A 4A7SA 4EBQH 2NCEA 3F7YB 5FK9A 5KW9H 1BQRA 2LLGA 4OZHF 3U46B 5A2LH 1EHLH 3L5IA 2OMXB 5KSBA 4UT6A 1RZKH 2AKRB 1CICA 4FG6C 2YQBA 5D7IE 5G4OA 3RWFA 4F2EA 3TEYA 3VXMB 4MS6A 3NBNA 2LT9A 1PD6A 5ADPL 4EN3C 2VOTA 3OKOB 4LSPL 5B22A 2UZYA 2ZXWB 6TAAA 2H9GB 1KELL 1ESOA 3A4FA 1HDMB 3BKYL 4AMKH 3KYMA 3OKDB 4GLRH 3CVCA 5DJ8A 1NCNA 1NBVL 4P05A 2F8VA 1PDKB 1F6AA 3W38A 1RU9H 3BCDA 2C4XA 2QPEB 1HH6B 1RURH 1L3WA 2GSMB 4PGDA 2QTVA 4HG4K 3WIHH 2DQGL 2NTFB 3Q8BA 5ANMA 3KGSA 4JDEB 1AC6A 2BIOA 3MOBL 1M9WA 2LFGA 2NT0A 3IMVA 3U4KA 2QGCA 1Q8MA 3BT2H 1KBGL 1IBDA 4TS6A 1R24A 4LCIH 3ZDYF 1DO6A 4Z7UE 1LQBC 3SDAD 5DMGD 4DETA 2Y7NA 1K2DB 5D7IB 2IANA 5AL0A 4KVCH 2B14A 2L7EA 1FNEA 3UAJC 2X4NA 3LB6C 4IU2B 5I71B 3ZHKA 2RAMA 3SQOL 4ELDA 5EZIL 1INDH 3D0VA 2H32A 1R33A 2OS7A 4HX1B 5E94A 4NLAA 3MMEB 2MPAH 3CN2A 4ZX3A 4UZUA 3U6XA 3CSBA 5TH2A 1BX2A 2DQIH 2VDKL 4KK5C 2OBGA 4P46B 4H8VA 2O5NA 3MXVL 1HEZB 1GYWA 1GGBL 4FYSA 5FOBA 4C54A 2DD8H 1HSAB 1QPPA 2IWFA 4PSPA 4G1MA 1I3VA 1MFAL 2B08A 3M17A 1G9NH 3ECUA 3QPKA 4LRIA 3VSUA 3T6ZA 4PWHA 5EBWB 4P2QA 5HHNB 5HYJA 1T5WA 2W80C 4KK8C 2QADC 5EPMA 5GGSY 5AVTB 2XFXA 4JO4H 3O2DL 5F7NC 1C7SA 1UENA 4L05A 1IT9L 4HA1A 4H5SB 3T0XA 2J8UE 3C8HA 1OCWL 2XBTA 5L9DL 1U3NA 2NZ1A 3Q43A 4G8FA 1A6AA 2J2ZB 1RZPA 2FJHB 3Q5YA 4QOKE 4RETB 1NDGA 1A6UL 1M57B 2Z7ZA 1LO4L 2XXGA 4PY8I 1B0RA 1P4IH 4M1DH 4WK4B 5C2UB 1J5DA 4LGRB 4ANVA 5I1DA 5J6GB 4CC1A 5AVZB 4U1IA 4NN7B 2NY0D 3ZR6A 3OXSA 3NFNA 3QS2A 2CCVA 4XAWL 3X1NA 4MD5A 2WAHA 2JKNA 4RDBA 4B0MM 1UB5B 1JGUH 3MV8B 1HEJC 3OG6B 4HFWB 2A4ZA 2ARJQ 1J7VR 5EU6D 4V2CB 1NMBH 5IVOA 5C0AD 4HIXH 4W6YB 1KXVA 4OGZA 4ALAL 2J73A 5E8EB 2L04A 1LWRA 5KZCB 4ONHB 5GRVK 1QVOA 2E7DA 3LRLA 3A67H 5C0JB 1TUPA 2HFTA 2I7OA 1K5NA 1BM3L 2WWMC 2JV6A 5ESAA 3V0DA 4PJAB 4NZ8A 4KO9A 2WUBH 3UC0H 4HUMB 3AUWB 1AKJB 5SX4I 4W9DC 4A6YB 3BSZH 3NGBB 4LLYA 5DK3A 4PWEA 4QXGL 3VMOA 4QTFA 4N8UA 3CQQA 4DTGL 1NBYA 1HIMH 2EXYD 3EOBA 2Z92B 5GGRA 1R46A 3FT1A 3F7VA 2YPLB 4IK6A 1QEWB 5DTFA 1BIIB 1TT6A 3DVNB 3WKPA 4Z3IA 5JUEH 5I0DA 1A4KB 4M9PA 4FNPA 1RJLB 4A6YA 4DVBA 5DQ9A 5DWPA 3DIFB 5JW4N 4IOIB 5ETUA 3Q2CA 4IDJH 3UYOD 4BZYA 3DO4A 4JR9L 2D7TH 5I8CA 5DR5H 4AQEA 1WHOA 2WINA 3NUKA 1S5HB 2FX9H 1U8JB 4M9OA 3UAJA 3BYTA 5EB9A 1KXTB 3SCMA 3CLEL 3QUZC 4HJJL 2Z7YA 1EV2E 3HBZA 5D8JL 5BS0B 5GGQL 2ZPKH 2VMFA 4A63A 1O5PA 1XSIA 3G5WA 4JM2D 4MZ2A 3KGRA 5IREA 2Y3NA 1OM3L 4IKJA 3U9UB 1QX1A 1DVTA 2DD8L 4PTTB 3EYOA 3KBFA 3ZHFA 3MRMA 5DZNA 1G9NL 4G9FE 4HALA 1GZPB 1JV5A 4HGWA 4JG1H 4N8CH 4AM0A 2ARJB 1WA2X 3DNKA 3W0WD 2OR8A 1SJHB 2XZAH 4XOCA 2ZJSH 2Y06L 4K3JL 3M8OL 2P42B 2ZX5A 1CFTA 3FUKA 1ZKAA 1GZQA 5T3XE 1URLA 3B9KB 4M5ZH 3TBYA 2X3AA 2FR4B 3RGVD 3VRJA 4M7LT 3IDGB 4NFBA 1KPRA 1A5FL 2F53E 1AGEB 4L4TA 3RIKA 5K1NA 2AV1B 3ULSB 5CS7A 1KLUA 3D33A 1N6UA 1JRHI 3V7AE 5CILL 2XA8L 3MCLH 5GS1A 3N2JA 2WSKA 5FYJU 2C3GA 3DTXB 4JN1L 1NC2D 4S1DC 3VWKD 4N25A 3F3HA 2J2ZA 1G7LA 4D7PA 1UJ3C 1VCBC 3B8SA 3CPLA 3JSSA 4P2RB 2Q3XA 4PBXA 3VFSB 1MI5B 4ZMWA 1FNGA 3Q9PA 1Q9KA 1Y6KR 4BHUI 2VDOB 2DQMA 5J1SC 4U1NB 4FZEL 4OV5B 1EJ8A 2EDFA 3VD5A 4B9FA 2B9AA 2EXWD 3K72B 4WNQB 3WFDL 5I28A 1CUOA 5I6OA 1V7MH 1NUFA 3EFDL 4XO9A 1LWJA 3NJLA 5EBWA 5A2BA 4X6BA 3PY9A 4D9QD 3F2LA 3OTTA 1KGCE 1KXVC 1NIBA 1OPGL 2CO7B 2J12B 2KUTA 4QF1B 3SE4C 4IU2A 1YEIL 1NCWH 2MHAA 4EI5B 3BPCB 5DJ6B 3QXTA 2X2UA 1B0GA 2VZVA 2Y25A 4NQDD 4WNSA 1MCWM 1NAKH 2RMNA 5K33A 1FN4A 2X2HA 2AJUL 3MRLB 1Q0YH 2UX6A 5HHPA 4DZ8A 2F8OA 3H4FA 3LN5B 3VQLA 1BAFH 3II2A 5BVJA 4CAGA 1QEWA 4XP1L 5E2UH 4AIZB 5BUAA 2VABA 2A6IA 3G5XA 1QFWH 2WLIA 3MU3A 4OD2A 2QZQA 3WGVB 2DOCA 5LN4A 3QNYB 1XR9A 4LB8A 1G1KA 4UQIM 5DWUL 2CJUH 4R4NC 1A25A 4PJGF 4P9HH 4ZMQA 4P2RD 5E70A 4PJ5A 4WEBL 1M6UA 3IKKA 5K9KB 1ZSDA 2MPVA 1C5BH 4ZSOA 5CCJA 3CC1A 5HYQA 3EO0A 4MASA 3U1SL 4GW4B 5D2NC 2YHGA 3D18A 1BZEA 5D4HA 3POCA 5DVNA 5IEHA 5DC9B 2HX8A 4F9PA 3V0GA 2GKIA 4EEEA 1JPFB 1ED3B 2GPZA 4HS3A 1OM3H 3SKMB 4BH7A 4OJAA 5EU5A 4N86A 3U0WL 1HH6A 2J88H 2JKSA 4YDLB 2VAAA 4CSPA 1QSFA 4Y16B 2AI0H 1VGKA 2DQHL 2FJGB 4OZHE 4K7FA 4CU6A 4BFOA 5IMMA 3LHPH 1EFXB 4XCFH 3IFLH 3IGUA 1T7XA 4X98A 3ZSTA 2FO8A 5DRXB 2XVGA 4ZS6D 4RQQA 2HMID 4W9GC 4MCZB 1TZ8A 2JJWA 4OF6A 1EAPB 5C9JA 2E6PA 2N59A 2G5RA 3QULA 2ZPKL 1ZV2A 5HHOB 4ZW5A 3V0FA 3GDCA 5JPMB 3HG1B 2QR0A 2XFGB 2XA3A 4GBXA 5EIQA 3LZQA 5D1QC 1AHWA 2XV0A 4QY8A 5T3XD 3S35H 3BCFA 3QDGB 1ZLUH 5IB3A 1MFBL 2CLRB 3SDXA 4L29A 3D3VE 1B0RB 5BMFH 3L7EB 3TIDA 4DVRL 3DVGA 2X6MA 4MMYB 4WLCA 3QUXC 5ICZA 3H55A 3TBWA 1S5IH 2H3NB 1XTLA 4TVUA 3TT1H 1XTMA 4LLUA 1PZCA 3ME0B 4L3EE 4NS0A 4OGAD 1BZ9B 1TJGL 5E9DE 4AEIL 1LGVA 2YEZA 4G6KH 2Q7YB 2NY3D 3CBKB 5GSRA 1B6DA 1FNSH 1WFNA 1QW8A 4L0PB 2OJEB 4FOMA 4PY8J 1I53A 1BREA 3AITA 2KZ1B 4QI3A 3JBG7 4PCYA 5EU4B 2ZOUA 3IJ7A 4F2MB 3SDAC 1LMIA 2YR3A 3L95B 4JFQA 2OR7A 3WELA 4O2FA 3FTUA 3D3VD 3FZUD 3THMH 2D4FA 5E8PA 1JGLL 3TBBA 1MAMH 1FGVH 3BSGA 2YXFA 3P0VL 4O2EB 1G7IB 1X5AA 5DYFA 4FYRA 4KDVA 1HEHC 4GQRA 3O11A 3NIDB 5K9OA 2Y2YA 2VDKB 3L9RA 1A7BA 3GMPB 3QB7C 5TPWL 3HN3A 3TONA 3CFJA 4OZGE 4JFDA 5EN2B 5AVQB 4LSRL 2ITEA 1I3GH 1KGJA 4FTVE 4GS7C 2AW2A 4N2BA 1J9QA 2A9AA 3UYPA 2KLTA 3VG9B 4QJ5B 5B39A 5ITBL 1CD1A 4PJDA 4PCKA 1AZUA 1J8HE 4C4KT 3KYOB 3TH3T 2B1AL 4AQ8A 3FQTA 2O6CA 1QLFA 3MA9L 2K7QA 1JD7A 2EVFA 5K1JA 2CDEB 2FEDC 1UWEH 1IAIH 1S7XA 1MCIA 5E00A 4NWTL 5FYKH 4PB9L 4IIQB 2VLKB 1MRDH 4WW2F 1UD8A 1CQKA 3E8VA 4PWJA 3QJVB 4WI8A 3NZSA 1CYGA 5JHLL 4J6IA 2FLMA 3EDFA 4JE4B 4MNQE 4QHNB 1WWAX 2L8AA 4MJHA 4PJEB 2MRYA 4LVOB 2C3HA 3NCCB