3H2ZA

The crystal structure of mannitol-1-phosphate dehydrogenase from shigella flexneri
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
382
structure length
377
Chain Sequence
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTVSGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIACENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPNDPLEVTVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQISGLDANSEVVSEAVTAYKAMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol-1-phosphate 5-dehydrogenase
publication title The crystal structure of mannitol-1-phosphate dehydrogenase from Shigella flexneri
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Oxidoreductase
total genus 130
structure length 377
sequence length 382
ec nomenclature ec 1.1.1.17: Mannitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain
A PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3h2zA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h2zA01
5KIAA 1G1AA 3PFFA 2BI8A 4JQCA 1WNTA 1WXDA 2ET6A 2I3GA 5A02A 4HBGA 2Q4EA 3HFSA 5K6AC 5G2OA 1HDGO 5L7TA 1IHXA 1B8VA 1NASA 4BKRA 3L6DA 1EUZA 3VH1A 3WSVA 3MEQA 3VZQA 1I36A 3E18A 1UP4A 4IIVA 3NYWA 4ZGWA 3P2YA 5JSFA 1YL7A 1SC6A 2O48X 3OFSA 3ASVA 2J5RA 5EL0A 3U5TA 1IULA 4X54A 4AJ2A 3SLGA 1VPDA 3PDUA 2DLDA 3AK4A 4A2CA 1HE5A 3V8BA 1PS9A 4CM6A 2IDZA 4GLLA 1MGOA 4W9NC 3WFJA 4BNMA 5ER6A 4LISA 3RKRA 1DXYA 2BMAA 4BO0A 3VPSA 1LSSA 2HLPA 1XU7A 1OI7A 4DUPA 4E2ZA 2Q99A 4D45A 5I7FA 1B8UA 4DYDA 5FF9A 4J7UA 3KV3O 4L9RA 2YUTA 2QW8A 4MO2A 4F45A 5IXSA 1UAGA 1DPGA 1YS4A 3GVXA 3QQPA 5MGBA 1DLJA 3WGIA 3ZWXA 1PZFA 3GNSA 3WJ7A 3VHRA 1HTBA 4IM7A 1YQDA 1E92A 3DAGA 3R3SA 4TROA 2P68A 3DHNA 3AFNA 2VRCA 3DBVO 1T2CA 4CV2A 3JQAA 4DWVA 3KTDA 3WX0A 3U9LA 4E30A 2XXJA 4CV0A 2B4TO 1Q7GA 2V7PA 4R1UA 1UP6A 4RVSA 3LC2O 4BO1A 4M89A 1KYQA 1DDOA 4MVJH 3RUIA 2GSDA 4DXHA 1RJWA 1H0KA 3LDHA 3LSYA 2VOJA 1YXMA 3AY6A 2Y1GA 3KSDO 3U62A 3JQ9C 3LLVA 4MVJA 2ZCUA 3JQFC 2FSVA 1R37A 5DZSA 4E5PA 1CQJA 1HYEA 2YHIA 4TMFA 1UZLA 3OBBA 3DZIA 2EGGA 2VYNA 5JCJA 3FSRA 4MPDA 5KOIA 4NJMB 1E77A 1C1XB 4JP2A 2AQ8A 4YEDA 3LT0A 1DFIA 7ADHA 1HDXA 3LC1O 3H5NA 2NTNA 4I5GA 4JN6B 4HX5A 1LRJA 4BO8A 3GEMA 3WICA 2TMGA 3VDRA 1ULUA 4U6QA 1D3AA 2PZMA 1VE9A 3A1NA 4F6CA 3UICA 1LUAA 3CZMA 5KVCA 1ENOA 2GNAA 2X0IA 3PTZA 4NFYA 5F1PA 3OQBA 2EW8A 5A06A 1K3TA 1HDZA 1ZXBA 3STHA 4J4HA 4MVJD 1HSZA 1Y5RA 3ITKA 3KZVA 4RVFA 2PR2A 4GVLA 5COQA 9LDTA 2CFCA 3CPSA 2Z1MA 1YVEI 2H9IA 2VHXA 3K6JA 3QW2A 3HDJA 4KDFA 2PV7A 3O38A 3TZCA 4EGFA 1YWGO 3SBOA 1WZEA 4EDFA 3WR5A 4BNVA 1GEEA 2Z95A 1DIBA 1JAXA 4XB2A 3ZZNA 1GCUA 4ZQBA 3RVDA 1MC5A 2FR8A 1YOVB 1LNQA 3C7AA 3KM0A 1VKOA 4ONEA 4E5KA 3AWDA 4R68A 1U3UA 1C14A 3EUWA 1C0PA 1W6UA 2J3JA 4MOWA 4KZPA 2NU9A 4D44A 3QVXA 3QRWA 4L4XA 4JXKA 1KIFA 3HADA 5T5QA 5LC1A 1E7QA 4E13A 2JFFA 3GNTA 2V65A 1DSSG 1IYZA 1RKXA 2FPGA 3WFIA 4J1NA 1TT7A 2X0JA 3MCVA 2ZK7A 4BUCA 3DTYA 2YV2A 2CUKA 2PWZA 4XQGA 1NVTA 3IL2A 1ZJZA 2VHVA 3PLNA 4LVUA 3LT2A 3JCZA 3CUKA 3OJ0A 4WNIA 4YRDA 5JE8A 2ZTVA 2PZLA 1O94A 2NTJA 5IDXA 3BTVA 2C07A 1MG0A 2OL4A 4R41A 5HRUA 4GAEA 2YV1A 3WYBA 3GHHA 3ZCXA 4IQ0A 4J2OA 3H7AA 2CY0A 2RH4A 2EG9A 3OQ6A 2FMUA 1DJQA 3CIFA 4PGFA 4R5MA 1EVJA 2A9FA 1A72A 4BNZA 4R3NA 1KEPA 4JP3A 3PFWO 4WLNA 4R69A 3FNHA 2Z5LA 1ZJYA 2ZJ0A 1MLDA 2NQ8A 2WYUA 3P19A 1XLTA 4J43A 4CL8A 1PQWA 4YB8A 3F4BA 5ILOA 2GERA 1T2AA 1VSVA 4K6FA 1ZSVA 2GO1A 2PGLA 2DFDA 1S6YA 3P7MA 2Z1NA 5JPIA 4K28A 1MA0A 1E3SA 2YQ4A 4BNHA 3V5NA 2I9PA 2OOSA 2Y0EA 1HLDA 2Y0DA 1ADBA 2JD2A 3QWHA 3T7CA 5TS3A 4ALIA 1ONNA 4GKVA 4D41A 4PG4A 3NKLA 4MKRA 3FRJA 3FPLA 1P1FA 3HN2A 1ZXLA 7MDHA 4GX2A 1MP0A 3IUPA 1SBYA 2V6BA 3UFXA 5DBGA 3INTA 2LDBA 4WKGA 2PGDA 4L8VA 4FFNA 4OKNA 2WD8A 4PG5A 3CTMA 4E5YA 2DUUA 3JD3A 1UZNA 3MTJA 1T26A 3E5RA 1PTJA 3GDFA 2BI7A 2A94A 2X5KO 3LF1A 3MWDB 2JL1A 3O8QA 4XJTA 4KUGA 4D43A 1U3VA 3JQAB 4M49A 1W8DA 4YCAA 2PH5A 5DDIP 5T8KA 3PP8A 1XYGA 3P5SA 4GKBA 1CWUA 1BMDA 3TJRA 4I5EA 5B4UA 1VJTA 1P1IA 3WTCA 4E5MA 3LC7O 4L4RA 1P9LA 4RLSA 3A14A 4FGSA 3DEYX 3UCFA 5I8WA 4IS3A 4BQPA 4OOEA 4BNIA 4L0QA 3HN7A 4MP3A 2FR0A 2O3QA 4PFJA 5ICMA 3OJOA 2F1KA 1I2ZA 5CDTA 1UDBA 3JYNA 5LDGA 1NR1A 3T7EA 4W7IA 4B8WA 3ADPA 2YHIB 3MZ0A 1PJ3A 1J49A 1GQQA 1S7CA 3GVIA 3BIOA 3U4DA 2O7QA 3F1KA 2D8AA 3RUHA 5IZ4A 3HHPA 4M55A 1PJ2A 4XWYA 2X9GA 5ER9A 4CQLA 3NDRA 4R4JA 3MJEA 3VH3A 1X13A 4MVJI 2CDCA 3SC6A 1FDTA 1R0SA 1WMBA 3QVTA 4NH4A 2P91A 4Z0PA 5LDHA 1B14A 4YAJA 1X7GA 4Y6SA 1D7OA 2YHUA 3G3EA 4ZQGA 1I3MA 4IMRA 4W4TA 3AM3A 2AEJA 4ND5A 5F21A 5TX7A 5IF3A 3WSWA 5A9SA 1P3DA 1YO6A 4B4VA 3JYLA 4F46A 1F8GA 3PQDA 2VT2A 1ZMOA 4XQCA 1SNYA 5IN4A 5A03A 2EWMA 2Q1TA 4BKOA 1AN9A 3DOOA 4IZHA 1DHTA 1U7TA 5EQDA 4O1MA 2CZCA 4DTIA 4HV4A 4CR6A 4OJNA 4I08A 4FIZA 4TKMA 3V2UA 1CEQA 4QQRA 4BNKA 2O23A 1GR0A 4O59O 5B12A 1ISMA 1ZK4A 2FOIA 2OGUA 3DOJA 2WM3A 2DKNA 2CD9A 2VZ0A 2AQHA 4BNJA 3ZNQA 3JV7A 4PLVA 2ZATA 3WIDA 4I9UA 4BGEA 2I3AA 4YT4A 1H9AA 1UXIA 3JQBA 3V2HA 1CRWG 4JIGA 1Y8QA 5U4QA 4DL9A 3GOHA 3DZGA 4DLLA 5L53A 3KYBA 4NBVA 4J49A 3R3JA 3S8MA 3ZWOA 4FDAA 1XWFA 4MP8A 3KBOA 1LDBA 3TRIA 4CMHA 2B35A 3JQDA 3GR6A 3WQRA 3NUGA 1DFGA 4I9HA 4PLHA 4TQGA 5ENDA 1R4NA 4BGIA 4Z3DA 5B37A 3FHLA 5BR7A 4J3FA 2G5CA 5KCZA 2O3RA 1XIVA 4YQZA 3S55A 5HTOA 1P45A 2X86A 3AOGA 3WGTA 1NR7A 2VUUA 3HDYA 2VRBA 4M54A 4BNTA 4BB6A 4RCVA 5AXBA 3GGOA 1N1EA 2PZJA 3NJ8A 4KDEA 1SB9A 4MVJF 4BKUA 3I5MA 4B3HA 3ORFA 4A27A 4P22A 4Z0HO 1NFRA 1R15A 3MWEB 1SZJG 1HYGA 2Y05A 3VVCA 3DC2A 4HWKA 1BRMA 1X7DA 4R51A 1LXCA 1NX6A 2W2LA 2FSSA 5BNFA 3DOCA 4ZHSA 1JKFA 3D1LA 2EV9A 2DT5A 3JQEA 2XOXA 3ETDA 4HP8A 2HRBA 3PHHA 4RVDA 1X0VA 5IZCA 1E3EA 4BNFA 3ONDA 1DO8A 1QV6A 4H15A 3QHAA 5HBRA 4YT2A 1AGNA 3RC2A 4XR4A 1ONOA 4S3MA 3E8XA 3PJDA 5JY6A 2J3HA 1YGYA 4ZQHA 4E12A 4YJDA 2GN8A 5CDSA 4GBJA 5ADHA 2ZCVA 1XSEA 2CMDA 1GUZA 2WWRA 3L9WA 4TZKA 3X2FA 4DBVO 2VZ9A 5K9ZA 2OHXA 4NMHA 1NVGA 2PD6A 3E82A 5EESA 4AJPA 3K8ZA 1HEUA 3L4SO 5DBIA 1O5IA 1E1KA 5I7VA 3F4LA 4MJLA 5U1PA 3WQQA 4AG3A 1K6JA 4AJNA 2P4HX 3G1TA 4XCVA 4XDZA 5CHEA 1LDEA 4LW8A 2Y0CA 2Y68A 3O8QB 3PXXA 1Y6JA 2HJRA 2X5JO 3OQ1A 3PVZA 2ZKLA 4LMRA 3C24A 2Y99A 1BG6A 4B3JA 3L07A 4QO8A 2V6FA 3DHYA 5HWSA 3TL3A 2WD7A 2W90A 3CINA 3FTNA 3RROA 1A9ZA 5JDIC 4D3DA 2NLOA 1NWHA 2XAAA 3TZQA 2ILTA 3WGGA 2CF5A 1U5AA 2DTDA 3Q0EA 1XA0A 4PZCA 3W1VA 1I10A 2G17A 1FF9A 4W6ZA 3B1KA 2IYOA 2FZWA 3NTOA 3PQFA 3WBFA 4G5HA 3EZYA 3NDIA 3U0BA 2PA3A 3HG7A 3KEOA 2G76A 5GZ6A 4B3IA 3UKOA 1R0KA 1GDHA 1LU9A 1K6IA 4CM7A 3O9ZA 3G79A 5KJ1A 2Q1WA 2UDPA 4LN1A 4BO2A 3VVBA 3WJAA 2PFGA 3RUDA 2NVUA 3LQFA 1ARZA 3L6EA 5AOVA 4CQLB 4NBUA 1YQGA 3BMNA 1CETA 2FWMX 2ZB8A 4D46A 1YL5A 2RAFA 5GZ3A 3F6YA 3E9QA 4ZVVA 4R16A 4YAEA 1GV1A 1PQPA 2GGSA 4HY3A 2X9NA 4TSKA 1ZIDA 1NYTA 1LSJA 4TRRA 4DMLA 3BTSA 3ULKA 1JN0A 3H3FA 5FFFA 1YB5A 5A9SB 3PGJA 3WXBA 2BHLA 3QP9A 1SEVA 5BSFA 1AHHA 3TFQA 3PEFA 1FDSA 3PIDA 5GMOA 1QYDA 5L3ZA 4NBRA 2YW9A 3KYDA 4B7XA 1Z82A 4DYVA 3MJTA 3NJ4A 1T1RA 1DJNA 1KEVA 2EKQA 1ZNQO 1PZHA 2HQ1A 2YFHA 3A9WA 1T25A 5F5NA 3RD5A 4CMIB 1FK8A 5IG2A 2O2SA 3I9KA 5TGDA 3RUCA 5C7IO 2ZTLA 3KVOA 3KXDA 4WPGA 2AEFA 4NBWA 4NFSA 4PLYA 4XIYA 4E31A 3B20A 1LDGA 2NVWA 2AQIA 3L4BC 4J1QA 1V3VA 4J16A 3FR7A 2D2IA 3IKTA 3WB9A 3HDHA 1I01A 3RSHA 3ZWBA 1LTHR 4J6FA 1NVMB 1YB1A 2OORA 1FDUA 1Y8QB 4BMSA 1WDKA 5THKA 4XEHA 4ZQEA 4EUFA 1U3WA 4IJVA 1V3TA 3KHUA 2CSUA 1ZEJA 2DBQA 4PLZA 1Y8RA 1UH5A 2AG8A 2Q1UA 5JAIA 1ISFA 5CPFA 4FB5A 2IYPA 4L74A 3GQVA 1UXKA 3PI7A 4WCFC 1L7EA 3IUSA 3DAFA 1PQUA 3ENKA 1F0YA 4RORA 4KQXA 2ZTUA 2OFPA 4DMMA 4RF3A 2EIHA 2BRUA 3PZRA 3EC7A 1D1SA 3AU8A 1PJBA 4N54A 3S1LA 3WNQA 4CMCA 4EBFA 3SXPA 1B26A 5KJ6A 1P1KA 2EJVA 1BXGA 3QVOA 5CEEA 1YBMA 4XX0A 1WWKA 1Z73A 3ZU5A 1UUFA 1JDJA 3E1KA 2CNBA 4IGEA 3DTTA 1U4OA 5TIIA 5I7EA 2WSBA 4JBHA 1VL6A 3T4EA 5IDYA 2AA3A 3E48A 1E3WA 1AE1A 1PR9A 3HB5X 5KVVA 1QKIA 1I2BA 1VJ1A 5BSEA 1PU2A 1PZEA 3ROKA 3RASA 2I6TA 3V1TC 5CDGA 2Q2WA 1UJMA 4RVHA 1XEAA 2QZ9A 2GCGA 3UVEA 4DLBA 1BWSA 3EYWA 3WOHA 3ZU2A 1BHSA 1A7AA 1YKFA 2HUNA 4Z9XA 1HE3A 2BFPA 2YYYA 4YPOA 3A28A 5COAA 4P4NA 1NM5A 2ZB3A 3IC5A 4BNGA 3KSZO 2JCVA 1ZCJA 3GVHA 2W2KA 2IEDA 2A4KA 1E7RA 4XGNA 4CLEA 1JAYA 1QYXA 1EUDA 3AUUA 4XDYA 1KVTA 3KLMX 1ENYA 3CSDA 3D4NA 1PWXA 3BXXA 1E3IA 3FNFA 3SC4A 4CR7A 1EFKA 2YFQA 1B3BA 2NQTA 1GEGA 2DAPA 2FPIA 4YJHA 5DN9A 3SJUA 3GUCA 3JYPA 3CZRA 1NQTA 2I5PO 1BVUA 1HDCA 2GF2A 2IE0A 3VDQA 4MIEA 1IZ9A 4Y8VA 2P5YA 4YT8A 1MB4A 4FCCA 3CMCO 4ZRNA 3WQSB 5TJ9A 3D3EA 4CM8A 4A0SA 4DIFA 3BAZA 4XYMA 3NAQA 3IOYA 1GYQA 4YWJA 4EZBA 1HDYA 3PJGA 1SB8A 1P44A 3EAGA 1XG5A 3M1LA 2WD7B 4RGBA 4AJLA 1J4AA 1IB6A 2UAGA 3T4XA 4CL3A 1N7HA 4A5OA 2D3TA 4OHUA 3RJ9A 3Q1LA 2DTXA 3ONEA 2ZJ1A 3ZI0A 2BLLA 3M1AA 3C3XA 3ZU3A 4DPMA 1WVGA 4OSPA 4DBZA 4ZA2A 1DAPA 2EXXA 1BW9A 1XQ6A 3FNEA 5L51A 4L4SA 3DZFA 2QRJA 1LQUA 4LSWA 4OOFA 4XJSA 1QORA 3VZRA 5DCWA 3RKUA 1VM6A 4EEZA 5L4SA 3RUAA 9LDBA 4XGIA 3ICCA 2VUSA 2NU8A 3QWBA 3FD8A 2VZ8A 3ZHXA 2NVUB 1EDOA 3OJLA 5JC8A 4GWKA 1GQYA 1PR3A 1T24A 1GZ4A 1R6DA 5JCXA 3DXFA 4UVEA 1PJLA 4JX8A 3BMCA 1MXFA 2VRCD 1Y9AA 1U3TA 5DBFA 1EQUA 3JQAD 3GFGA 5JYDA 3PK0A 3M2PA 1LLDA 1PJ4A 3G49A 4UUOA 2PY6A 2Q50A 3MJCA 2O4UX 4J90A 4XYBA 1ZFNA 4FGWA 5IFLA 2Y1EA 3K73O 1QSGA 1EVZA 1CF2O 1TT5A 1M75A 1DIAA 3KYDB 4NPCA 4CLOA 4E5NA 3GZ4A 4FD3A 4PLPA 3AJRA 4P38A 4CUKA 2CF6A 4OAQA 3QSGA 4CUZA 3UGKA 3INRA 1VJ0A 4KMSA 1NQ5A 5AXAA 1HYHA 4K9DA 4FBGA 3ZNNA 3X2EA 1QXSA 2VYND 1N9GB 1ZBQA 1KY4A 5JCJD 2QZZA 2BGKA 4G81A 5TSDA 2E49A 1IZ0A 3INGA 4Y67A 1KY5A 3LT1A 4B79A 3IMFA 4GSKA 4ZQFA 4RF4A 1QYWA 1X7HA 4FR5A 3VKUA 4J9VA 3SEFA 1TVEA 3RFXA 1YH3A 4FPXA 4ZU3A 2VOEA 1IE3A 1ID1A 4TRNA 3ZV4A 1Y8RB 1PZGA 4J7XA 5G0VA 2AMFA 1M6WA 1V8BA 3NDJA 3U4HA 4JJGA 4Z3KA 1ZK0A 3PGXA 5FI5A 3AM5A 1K5HA 3RFTA 3KETA 3GRPA 3WGYA 1O89A 3WNVA 3DBLB 3PPIA 3ROMA 1DIRA 1KVUA 2OMEA 4HFMA 5IDQA 4WCFB 2PH3A 1OBFO 3R0IA 1WZIA 4J4BA 4WLOA 4KOAA 3I83A 1BXZA 2JD1A 2P5UA 4A7PA 1BVRA 1T1SA 4ALJA 2DC1A 1XELA 5F5LA 3S2FA 2B4RO 2JCXA 1P77A 1LBEA 1N7GA 3I1JA 3RUFA 3ZU4A 2QHXA 3ENNA 1U5CA 3ONFA 3LYLA 1A27A 1Y1PA 3F5SA 1E3WB 3KYCA 4I9NA 2ZQZA 1P0FA 1M66A 2P9GA 5JNLA 1PGNA 1CDOA 4O5OA 4XRGA 1NPDA 1V0JA 1XCBA 4CMGA 4HXYA 3A06A 2BKAA 4Z9YA 3RC9A 5CFZA 1KERA 4Y6RA 1JVBA 3BTOA 1K6XA 1YRLA 1E5LA 3QE3A 4NZ9A 3PIIA 1RYDA 2JAPA 3FWNA 4BB5A 4C7JA 4CMEA 2FP4A 4DPLA 1RWBA 1YE3A 3COSA 3ZW9A 4ALMA 1V35A 4C4OA 1YJQA 1OAAA 3CXRA 4R3WA 4BMNA 2IXAA 1Z45A 1HRDA 2EJWA 3QWFA 2AQKA 3MOGA 2DM6A 2VHWA 1EK5A 3DL2A 5FYDA 3DMTA 3UCXA 1U8FO 1LLCA 5AQ1A 3DBRA 1DC6A 4WLUA 2BFMA 4XYEA 2QYSA 3BMOA 1PX0A 4NIMA 4RJTA 4CLRA 4PZEA 1GPJA 3IKVA 1TLTA 4IDEA 1ZSYA 1Q2XA 4K1LA 4DC1A 4R9RA 4U8GA 3VPHA 4BKPA 4FOSA 4CV1A 4CM8B 2OXIA 5T8KC 6LDHA 3H8VA 4E3ZA 3JQCA 5G0SA 3VPXA 3JQ7A 4RV9A 2WJPA 4PIVA 1L1FA 4EJ6A 1I3LA 4GWGA 2EF1A 4N18A 3RFVA 5F1OA 1NWCA 3EW7A 5TRTA 5A5FA 3F3SA 3RAJA 4OQYA 3DB2A 3AI3A 3OJEA 4UEKA 2PD3A 3B1FA 5JY1A 1A9YA 1U8XX 2EP5A 4PVDA 1E3JA 3GNQA 4L76A 4CMKA 3RI3A 4EYEA 1BW9B 5U9CA 2FN7A 3OHSX 4ROSA 1NP3A 2NVBA 2Y93A 4CUJA 4XYGA 3I3OA 1PSDA 2C7GA 3I9LA 4M8SA 3GA0A 3P2OA 3VH4A 3WGQA 4YRAA 4CM5A 4GMGA 3NT5A 3GLQA 2VHYA 1LI4A 5JO9A 3ANMA 2FZEA 2NACA 2GRAA 2O4CA 3C8MA 5L95A 2BH9A 3OF2A 4KQWA 3F9IA 4IS2A 1QV7A 3IP1A 1EQ2A 4RZIA 3FI9A 1PGJA 3BMCB 2SCUA 4ZD6A 5T67A 4D79A 4Y9DA 4OM8A 3JTMA 1P74A 3LK7A 4XR9A 2C5AA 2C29D 2OBYA 4QUKA 2A35A 3K9QO 1Q7CA 2ZB4A 2VNAA 4ND3A 3TFOA 4Q3NA 2JHGA 1PJQA 2BELA 5BSHA 4RDIA 1P1HA 3R6DA 2JHFA 4AJIA 3D3WA 4JGBA 3TPCA 3RBXA 2AEMA 1KETA 4M86A 2FR1A 1WW8A 1TT5B 5ENVA 5KJEA 1E1LA 1X1EA 4XKJA 4Y98A 4CLOB 4DIOA 4E4YA 2WE8A 2GUGA 3OSUA 4AVYA 2X22A 3HWRA 1EVIA 2IXBA 3I6QA 4YYZA 1IPEA 5C3MA 3K5PA 3W8FA 1R4MA 4FFRA 4YXFA 1QYVA 2EHDA 3GVCA 3GDOA 3C1TA 1UP7A 1ZKMA 2VTEA 1PGPA 3W4KA 3D4PA 3RQSA 2AE1A 3NRCA 4YAIA 5LCXA 4HKTA 4II2A 1GAEO 2X7HA 3JQBC 1HLPA 2YQ5A 2OZPA 3IP3A 2G82A 1AUPA 4FJ0A 1JVSA 1ISHA 4N5LA 1NHGA 1ENZA 1H6BA 4NR0A 1GQ2A 3AW9A 2QX7A 4M1QA 2Y66A 4BNXA 4D0SA 5JMPA 2NU7A 1B3RA 3H4VA 3JSAA 5EIOA 4Z0TA 4RPGA 5K0ZA 3PWZA 3Q2IA 5A9TA 4BQRA 4QEDA 1GL3A 2ZYGA 3BTUA 2ZB7A 5JXWA 4OGWA 4JBGA 4NDNE 1LQTA 1O9BA 1Y5MA 4BO6A 5JLAA 2WEKA 4RL6A 3AUSA 5TLSA 4YVFA 2RHRA 3QWAA 3U4IA 4GVXA 1X15A 1KVRA 1B2LA 2BD0A 5KNLA 2O3SA 2WDZA 3NTQA 1LC0A 2JAHA 3F5QA 4LMPA 1VL0A 1ML3A 4N5MA 1GYPA 2C82A 3GG2A 4RZHA 4ALLA 4FS3A 5KVSA 4JROA 4FJ1A 1H2BA 8ADHA 3GZNA 1KEWA 3E6AA 4DQUA 1H2HA 1HKUA 2HSDA 5L45A 1KEUA 3VTFA 1P31A 2GN4A 4H16A 4KTVE 3KYCB 3ZV6A 4BO4A 4RQUA 3AOEA 3CE6A 5CPBA 1O95A 4YAKA 2QQ5A 4A26A 3W6ZA 1VL8A 4JLWA 3RC1A 3KUXA 5IZCC 3LZ6A 2O3JA 2HCTA 2DFVA 3E9NA 3PYMA 2DVMA 1JWBB 4BS9A 4CV3A 1K2WA 4RF2A 3DBHA 4HNGA 3KB6A 4NHEA 2V6MA 3FCOA 4ITUA 1N8KA 1IL0A 3V1YA 1CQIA 4WK6A 4NQZA 3ZWCA 1YDEA 4U0KA 4AFNA 1C0KA 4JCOA 1HZJA 1JTVA 1BDMA 4J9UE 1LDNA 2C54A 2VNSA 3PJFA 4UAGA 3WYEA 1UAYA 3HB4X 3L9XA 3DBRB 3KSUA 3GEGA 1M2WA 4CLRB 1I8TA 4R1NA 3TSCA 1H93A 4RPHA 4A10A 4DVJA 2VUTA 3DZJA 3GF4A 1OC2A 2B36A 3BHJA 4LGVA 4OMUA 5IXYA 1ULSA 4UUMA 2GN9A 2DQ4A 4CM9A 2VWPA 2E6UX 1HF3A 1PIWA 1UXGA 3HSKA 3QV1A 4FC7A 3WGHA 1E6EA 1EFLA 2NNLD 2W2LD 4I8XA 5KKAA 3JQ7B 3D7LA 4UVDA 1T2DA 1QG6A 4CODB 4I5DA 2BFAA 3OIFA 4IPTA 2Q4BA 2VYVA 5BSGA 5KJCA 3VAZA 3IQDB 1XQ1A 3H2SA 1DHRA 2UYYA 4IY1A 4MKXA 5IDWA 4ND1A 2XPCA 5C7LO 2EERA 1KOLA 1R16A 3OA2A 3NX4A 3WMXA 4DQXA 1NAHA 1HL3A 4FOOA 2YJZA 1ENPA 1Q0QA 1B7GO 1E3LA 3GVPA 4K6CA 2IODA 2O7SA 5DT9A 4RF5A 4AJ4A 2RHCA 2GDZA 3GH3A 1GV0A 3I9NA 5DF1A 3ZWWA 4CQMA 3G17A 3I52A 1CERA 3OA0A 1RM4A 2UUOA 1Z7EA 2DPHA 3TZHA 1PL7A 1T2FA 3QLJA 3D5TA 5TF4A 2HK8A 3FBTA 3WBBA 3ZHZA 3EHEA 4DPKA 3TDKA 1DOHA 3DZHA 4GPD1 4D0RA 4EITA 2JD0A 3VH2A 5CAEA 1A4UA 3QJ5A 1CJCA 4BO3A 3L77A 1CIVA 5A04A 4F6LA 2J3IA 3H9QA 4FQ8A 3ADOA 1Z74A 1OZAA 4WUVA 1F8FA 1LLQA 3WIEA 3M6IA 4XQEA 2PD4A 2VYVD 1EEHA 1W73A 3EDMA 5IAAA 3O03A 2HDHA 3UAGA 1R66A 3S2GA 1E0DA 5TQVA 2X4GA 4ID9A 3D3WB 4N7RA 2R00A 2V6GA 1RM5A 4TRMA 1C0LA 4H7PA 3S2EA 5L4NA 1IY8A 2CVQA 1PWZA 4IQGA 4OL9A 2H1SA 4OXYA 4INAA 3NGLA 1WMAA 4PCVA 5AYVA 1FDWA 3W8EA 2B0JA 1SOVA 4Q3EA 4R1SA 1FDVA 1ZUD1 3EMKA 2XXBA 4Q3BA 3OETA 2J5QA 1R4MB 3AUTA 4PN3A 1E7WA 1UDCA 3ZV5A 1SEPA 3RIHA 4G2NA 1OMOA 3Q3CA 4URFA 4XYLA 3ZHYA 4UUPA 4RPLA 5L7WA 2RBEA 2ZYAA 1O0SA 4B7CA 2P9EA 1DFHA 3DFZA 2X0NA 1YL6A 5CDUA 5JS6A 4J1TA 4KUEA 1ZZEA 4CMAA 5EPOA 3VC7A 2Q1SA 3ZNPA 2GR9A 1B8PA 4NBTA 5BNTA 4J7CA 2C20A 4RVUA 1P0CA 3ZWMA 5KTKA 4AJ1A 2W98A 1PL6A 5ICSA 5CEFA 1X1TA 2EKPA 3PDJA 1H6AA 3C7DB 1Y9EA 1BXKA 2JJYA 2Y1FA 5CDYA 2X8LA 1R4NB 4YA6A 4C7KA 4CPDA 5FI3A 4TKLA 4CLXA 1R12A 5H81A 2J5KA 5JDCA 4WEOA 2Q49A 3E03A 3PHLA 3ETGA 3NGXA 3U4CA 4PLWA 4WLFA 3VZPA 1BTOA 2FRDA 3QVSA 1OC4A 2B4QA 3LF2A 4MP6A 3D5QA 4XB1A 4IIUA 3GZNB 3G0OA 4AJJA 2Y1DA 4Q9NA 5H83A 2JCYA 3F1LA 4S1VA 4IJUA 3I4CA 1UDAA 1E5QA 3WMWA 1TXGA 2CVOA 4QT0A 4OIMA 4GGPA 4J1SA 1E7SA 1UZMA 3OICA 3FNGA 3OIDA 5T6BA 3EVTA 4U7WA 3TNLA 2BFOA 2AHRA 4Q3CA 2XF8A 1JKJA 1U9JA 1EE9A 3E9MA 3PHJA 3DBHB 2NSDA 3H9UA 4BV9A 3UH1A 2W4QA 3DHEA 4MVJG 2UV8A 1ORRA 2C7VA 2Q2QA 1SMKA 2NUAA 3HDQA 4LRSB 4WASA 1KC3A 3I6IA 1PS8A 4QFDA 2D5AA 3GT0A 3OIGA 1XDWA 3ZHBA 1ZH8A 3WYCA 4MIYA 4B4WA 1YONA 3W6UA 2FY8A 4W7HA 2D1YA 4UVGA 5ILGA 4CM1A 5I7SA 1I33A 2B83A 3U49A 8LDHA 3RJ5A 5K6AA 3O26A 3ICPA 3GAFA 5EMHA 2E48A 1V6AA 1GADO 1ISGA 3ROPA 4R9SA 1WP4A 3WGZA 2PLAA 1MFZA 1NFQA 4KWHA 5FWNA 2HAEA 3FTPA 5ITWA 4FW8A 2WMDA 1J5PA 3H9GA 1GYRA 3RU9A 5C7OO 5C37A 5JYEA 3H2ZA 4YJFA 4U0JA 4TVBA 1PGQA 4UREA 4IXWA 3OECA 3BA1A 1WDMA 5THQA 2VWQA 4W9NA 3W4JA 4OSOA 5KKCA 1MFPA 2ZTMA 4O0LA 2PKQP 1IUKA 3N58A 3K30A 1ZMTA 2GZ2A 1NXQA 3MTGA 1ZSNA 1I24A 2ZIZA 4G65A 1F17A 2I99A 3WDSA 1ADGA 4FSHA 1I3KA 3Q9UA 4J91A 3GFBA 1CYDA 4TZTA 4CQMB 4L73A 3TL2A 2LDXA 5HS4A 1LDMA 5F3RA 4GLOA 3RC7A 2G0TA 3C85A 3QIVA 1KC1A 5DNAA 4A03A 4RQTA 5B1YA 1IPFA 3RCBA 2POQX 1GZ3A 2O2YA 3BMNB 1EBUA 2H6EA 5HA5A 2IEBA 3VKVA 2G1UA 4GX0A 1DIGA 3DONA 3H5AA 5B4VA 2OO5A 3UXYA 3DFUA 4R01A 1T4DA 3VOSA 3DWFA 4BKQA 1RYEA 5I9LA 1UXHA 1LRLA 4OQZA 4I5FA 2GN6A 2GPTA 3GN1A 3JQ9A 1ZK2A 3JQFA 3U09A 4CLHA 3EK2A 4JK3A 1DRVA 1MV8A 5B4TA 1PGOA 3C7CB 1NBOA 2RH8A 2X23A 4W82A 4EUHA 4PLFA 1ISJA 2HJSA 1H6DA 4PZDA 2CDAA 4E0BA 5EERA 1D8AA 4Q39A 2A92A 1OFGA 5A05A 4PVCA 3GDGA 2C2YA 3H9JA 4E33A 4O6VA 2X0RA 4WLVA 3K31A 1ZVMA 1VI2A 1QLJA 1ONPA 1UXJA 4EI2A 1Q1NA 4CM4A 4KP7A 3NT4A 4Q3DA 4UVHA 3OMLA 4J0EA 2P4QA 4FC6A 4EJ0A 2R2GA 3ST7A 3H65A 3WS7A 1I32A 1NFFA 3ZNOA 5L4LA 4MVJM 2GYYA 5BT9A 1C0IA 4KWIA 4D3SA 4QECA 4RDHA 1ZW1A 4E2XA 2O50A 1DB3A 3AU9A 4LVCA 3ZWYA 4BNLA 4IDFA 5TT0A 2WTBA 2UVDA 1HETA 1T4BA 3HJAA 4XD2A 4Z6KA 1TB4A 2Q3EA 1H6CA 2PZKA 4E21A 2I76A 3DAPA 4OYRA 3RWBA 1Q0HA 1FXSA 4WEQA 3KLPX 5A3VA 3GHYA 2JFHA 3AFMA 3JD1A 3RUEA 3N74A 4RVGA 4XQ9A 2DBRA 1X0XA 3ZWAA 2HO5A 5ES3A 1T2EA 2DUWA 3GEDA 1P1JA 2H5LA 1XGKA 3HFGA 4IXTA 4U6SA 1BXGB 2NWQA 4A73A 2ZQYA 4YDRA 5G0UA 4IDDA 2X1HA 1A5ZA 1P1RA 2YY7A 3VPFA 4J2HA 4EJMA 5A9RA 4WGGA 3LT4A 4LSMA 3QY9A 4DIBA 4E2WA 1GTMA 3C1AA 1Y81A 3HE3A 5KJFA 4Y6PA 1DLIA 1U1IA 1EDZA 2Y67A 1MX3A 4NJOA 1DAOA 4AJHA 3DZBA 3H5RA 3OM9A 4GMFA 3EY4A 1HE2A 4BOYA 1XHLA 4ZICA 1E6WA 2EP7A 1Y7TA 4CMEC 4MINA 3OEWA 1DC3A 1O8CA 2DBVO 4XZ3A 4BNNA 4LCEA 4LK3A 1U28A 4WECA 1QP8A 2X6TA 4HFNA 2HK7A 4CM3A 5JAQA 1DEHA 4NG5A 1HDRA 3W4IA 1M6HA 1NAIA 1W0CA 1YQXA 3DMTC 1DRWA 3I4FA 5AXCA 3Q2KA 3TZ6A 2W2KB 2Q45A 1I30A 1JU9A 3GMSA 4L75A 4BGVA 5HM8A 1JQBA 4JNKA 2B5VA 2QRLA 3TOXA 4AL4A 3F46A 3NT2A 1PJSA 1EE2A 3DR3A 3GUYA 2GASA 1A71A 1HXHA 2YDYA 5AXDA 3V2GA 1HT0A 2E4AA 3B70A 1LA2A 3HZZA 4YJHB 4E2YA 3SX2A 2YV3A 1H5QA 1WLYA 1A4IA 2OUIA 4R54A 4GH5A 3TOZA 1LRKA 3B6ZA 4FFLA 3FN4A 4WNCA 2O3TA 4DLAA 3UUWA 1GCOA 4NU6A 4OH1A 2Y1CA 4UUNA 4YJFB 5HS6A 3BZUA 5MDHA 3IDSA 3ZN2A 3JD0A 3JD4A 2C2XA 5F1KA 5G4KA 1NHWA 3IJPA 4BMVA 2PKRA 4II3A 3AM4A 4PG6A 3EVNA 4R1TA 3GPDG 3L0DA 3ZWVA 1QYCA 1EVYA 3UF0A 1NPTO 3LVFO 3ASUA 1JKIA 4IDGA 3GG9A 2J6IA 4PRKA 3I9MA 4P4GA 2J8ZA 3FBGA 4ZN6A 1WAMA 3PZBA 3Q6IA 1I2CA 1SCUA 3Q9NA 4J0FA 3MOIA 4EW6A 1GUYA 4AJEA 4W99A 2PK3A 5A3JA 4IINA 2AE2A 3AUAA 4B4OA 1MUUA 4E6PA 3WWZA 4DQVA 1E1MA 3GGPA 4TWRA 2HMTA 5TJHA 4QXMA 3JQ8A 1E6UA 1FJHA 4P4LA 1XU9A 3TQHA 4ALKA 4O63O 2QG4A 4IDBA 3IJRA 4WLEA 1IHYA 1YBAA 5EJ2A 2QIOA 3VTZA 4BNYA 3ZWNA 4ZJUA 2NADA 1FMCA 2DTEA 3WLEA 1H9BA 2EEZA 2JKVA 2GZ3A 4IJWA 2J3KA 2OP1A 2HMWA 1AHIA 2DPGA 5JMWA 3OEYA 4WOJA 2ZYDA 3DDNA 2D4AA 3JYQA 1WDLA 5G0WA 5BQFA 3KO8A 4YTEA 3E5MA 1R0LA 1BGVA 4FFPA 2Y1OA 1PJTA 1C1DA 1EUCA 1LLUA 1LX6A 2VWGA 5JW6A 1B16A 3PYLA 5JO0A 2NU6A 4CR8A 2HMUA 3IIEA 5COBA 5EINA 1M67A 3HUDA 2NV6A 2C5EA 1NQOA 3EGOA 4DREA 5A5EA 3K2BA 4GX5A 4UEOA 4DRYA 4GX1A 1HDOA 1G0NA 3NEPX 1JLLA 4MVJE 4QO7A 4I1IA 5FEUA 1SOWA 1DRUA 1NNUA 2NTVA 4CM4B 2C59A 4FN4A 2DU8A 3PQEA 2WYVA 1WPQA 1VSUA 4HUJA 1F14A 4P8RA 5H82A 3AI2A 3ANNA 1D1TA 5DP2A 1MXHA 2FPPA 1VC2A 4XGKA 1JW9B 4CJXA 3ZDFA 3GN2A 3IS3A 2EW2A 4U5QA 1LSOA 4BO7A 4XRRA 4CMIA 1RM3A 1DBVO 3UHAA 2I65A 1A7KA 1AXGA 1U2DA 2RCYA 3CH6A 3UCEA 3WLFA 4UULA 4WJZA 1GFSA 4Z9FA 2FHSA 3RU7A 4YJGA 2OP0A 1JA9A 5TC4A 4IQ8A 5CG2A 2B69A 2AW5A 2IZ1A 2D5CA 2WE7A 4OXKA 1GY8A 1Z75A 3BMQA 3Q11A 2WYWA 3UN1A 3H3JA 1O6ZA 2JFGA 3FF4A 4LCJA 1ADCA 2VT3A 4YAGA 3JQGA 3RBZA 1RM0A 1B0AA 2GLXA 4WE3A 2X58A 1JWAB 4AICA 3G1UA 4GQAA 3O4RA 3PYXA 4IDCA 4EEXA 1ZK1A 4AJKA 3AOEC 4IMPA 3W8DA 1LSUA 6ADHA 1XR3A 2VQ3A 1P33A 4E32A 1LDYA 1QR6A 3ON5A 1YJ8A 2HKIA 1W4ZA 1QRRA 4OKIA 4ALNA 5A4DA 2I67A 3S2IA 5KWEA 2P2SA 1J6UA 1I0ZA 1DC5A 4MKZA 4CMJA 1X14A 5C5IA 1V3UA 3ZWPA 1LJ8A 1Z7BA 5JFOA 2B5WA 4B4UA 2O3UA 1YBVA 2EKLA 5G4LA 3LLSA 4UEJA 4R5HA 2Q46A 3I23A 5ITVA 4IJKA 2IRWA 1I3NA 2QYTA 3C1OA 3OH8A 1U7HA 2F00A 3NTRA 3GRKA 5IN5A 5JAMA 3DO5A 1U2GA 4HFJA 2CDBA 1GPDG 1G6KA 3D0OA 2NM0A 3HNPA 5TT1A 3V1UA 2HU2A 1SPXA 3BMOB 2X5OA 4QSMA 4YBZA 1PJCA 1EMDA 3OP4A 5EN4A 4BGUA 4DC0A 1C3VA 4PG7A 1PL8A 1B15A 5T57A 1GUFA 3QVWA 2PNFA 2TMDA 2GD1O 3M2TA 3B1JA 1N92A 2D59A 3VPGA 3GAZA 3PHIA 3SJ7A 5G4KB 1F12A 2VHZA 4F3YA 2QRKA 2Q2VA 4TRJA 1TEHA 5J23A 1ADFA 1ISIA 2E82A 4UVIA 3AY7A 1N5DA 1N2SA 3KOUA 4Q3AA 4DGSA 2VTDA 3H6KA 4IZIA 2HK9A 4N5NA 4NNJA 3PWKA 4TVOA 3PWSA 3UOGA 1LEHA 4WCDA 2AXQA 5L40A 3AY3A 3MJVA 1L7DA 1E7YA 1E1NA 2H63A 3BYZA 1YDWA 2X9VA 4IDAA 1PS0A 5CEJA 1K89A 3WGOA 4PRLA 3D4OA 2VWHA 3TZKA 1VKNA 4FJ2A 3DZKA 1HE4A 5GZ1A 3ETEA 3CMMA 5T64A 4CMBA 1MG5A 3PHGA 2B37A 4KUHA 3BHIA 4PLTA 3UW3A 1KVSA 3JQ8B 4IBOA 3FWZA 2PKQO 1LC3A 1HSOA 2BGMA 2R6JA 1ZO8A 2YZ7A 5JC1A 3GK3A 3GGGA 4EUEA 4IGFA 3DQPA 4CM9D 5BNIA 5JDIA 2PTGA 3TF5A 2AG5A 4HNHA 4YACA 4B8ZA 1ZK3A 1G0OA 5CG1A 1EZ4A 4LRTB 4GI2A 5DOVA 3GMDA 3TWOA 2P9CA 2R00C 4PG8A 3IAHA 3JQ6A 4GGOA 4WOKA 1N1GA 2E37A 1NPYA 3I9OA 3K92A 4PLCA 5CP8A 1C1DB 4KTTE 3KEQA 3WTBA 1DC4A 1GU7A 4J4TA 4ND2A 1TI7A 5I9MA 1NQAO 4D42A 1SO8A 4NJMA 2VN8A 1C1XA 1Z6ZA 4YT5A 4DA9A 3GPIA 4GSLA 3RBVA 2D0IA 1ZEMA 4CQMD 5IJZA 4B7UA 3ZGYA 1TA4A 1NTOA 4D7AA 2IZZA 3H9EO 4K26A 3WWYA 1Q7BA 2HRZA 4FFMA 4MVJP 5JBIA 1J0XO 2BF7A 5L9AA 4YRBA 3ZW8A 3ROQA 5A1TA 3LU1A 3EZLA 1VLLA 1BDBA 3ITDA 1SAYA 3KRTA 3K96A 4XIJA 4YQYA 4NK4A 5TNXA 1KBZA 3ZV3A 3GY0A 4HFRA 3VZSA 2VCYA 3AI1A 3I9JA 4RO0A 4OXNA 4BO9A 1UR5A 2EGHA 2YDXA 3ABIA 3U3XA 4GL4A 1EBFA 3D64A 3PJEA 4AJOA 4ILKA 3JYOA 4D3FA 3ANLA 2OBNA 4YJGB 1YB4A 1I5RA 1XKQA 4JBIA 3SVTA 2UUPA 4QTZA 5AVOA 1N9GA 1GD1O 5JDCC 1KVQA 4JJFA 2HMSA 3A4VA 5I9NA 3BMQB 3R1IA 4NK5A 4QFCA 1MC4A 1PEDA 3K2EA 3QA9A 4JJIA 5DCUA 3CKYA 1OOEA 1YOVA 3QWIA 4RPJA 2IZ0A 3CTVA 3FR8A 3MJ4A 5DOZA 4BVAA 1U4SA 2BGLA 1HWYA 2DBZA 4NU5A 4YR9A 3L4BA 1F06A 3TN7A 3JQGB 3PRJA 3WG9A 3F47A 1V9LA 3MJSA 3GC6A 1VRWA 3DMYA 2HMVA 4ND4A 5GY7A 2GZ1A 1QLHA 5DULA 1KS9A 1GZ6A 4BNWA 3OJFA 1E7MA 3CEAA 1DIHA 4H3VA 1AXEA 5JAZA 1RPNA 1IOLA 4PLGA 1QMGA 4HADA 2I66A 2RIRA 3NV9A 1BSVA 3HQ4O 4XA8A 3ZH2A 2W8ZA 1H94A 3SLKA 1HZZA 4BIIA 4FFOA 4BNUA 3DBLA 4BO5A 1Q0LA 4IUYA 2PGJA 4QX6A 4WCFA 4RPKA 4M87A 4BHTA 4ESOA 4BL5A 3N7UA 4CLDA 1K0UA 1M76A 4MIOA 4NI5A 4RLHA 2CVZA 4NFHA 3BHMA 5KVQA 2C0CA 4ZRMA 3PLRA 3JD2A 5EQFA 4BV8A 4OO3A 5DP1A 3FPCA 4MDHA 5L7YA 1EK6A 5G0TA 5DCYA 1D4FA 3L6OO 5I8ZA
chains in the Genus database with same CATH superfamily
2P5TB 4PANA 1U02A 2XJ4A 1G1AA 2VHEA 3PFFA 4JQCA 3DA8A 3BJZA 3GPBA 5JHHB 1X3LA 5FLEX 4BZZA 1M72A 2I3GA 3BS4A 4HBGA 3RT1A 5JNUA 5G2OA 1CJMA 5T3UA 1VFNA 4LOLA 3C3JA 1B8VA 1FNSA 1NASA 3L6DA 3GT3A 4GC9A 3C8HA 4M9ZA 5BW8A 3VR1A 1G21B 2FMKA 5BW5A 4UJ3A 3E18A 3N2LA 1UP4A 4ZGWA 1CLEA 2B7LA 4A8JB 2XB2A 2J9FA 1YL7A 3C6QA 3HO8A 2G5GX 2DE0X 3ASVA 3QU9A 3U5TA 3IOBA 3L2OB 1YB6A 4NJEB 3MLEA 2WIAA 3PDUA 2DLDA 3ABRB 3K53A 4MV8A 1QRAA 4D4MA 2CT8A 3REFA 1WCWA 1ES9A 4KG7A 3D7NA 4KLZA 4W9NC 1X8JA 4P9NA 4LCBA 5AM1A 4BNMA 2EEPA 2WWIA 3I8XA 5AW8A 2QG6A 2UVPA 4LISA 1WU8A 4YBRA 4MARA 4DG5A 2BLNA 2PSEA 3GLTA 1I3OA 3VSBA 1T3LA 1ORVA 4X8LA 3GGCA 5CURA 4D45A 5FF9A 3LA6A 7MHTA 1U6IA 1SRRA 4JI7B 1UXOA 4UD6A 4ZT4A 4KKXB 4OYYA 2NYRA 1TCVA 3E81A 5CK5A 1IJEA 4OK3A 3VI4B 2QUIA 5IMSA 2E55A 2XQKA 4B7AA 3LAWA 2JAXA 1GM5A 1BIFA 4JVOA 5K8VA 1Q84A 3IPCA 4XJXA 1OH6A 1GRNA 5K0SA 4LWPA 2XAUA 3ZWXA 4EG6A 4R05A 1KH3A 3T35A 4UOQA 1C9JA 3HP1A 4DHWA 3DHNA 1WQ1R 4CV2A 4XOUA 5HMLA 2GF9A 3K71B 3SJBA 3KTDA 3WX0A 1RRFA 2Y6VA 4FVTA 1N6OA 2L19A 2CLDX 4RKQA 4CV0A 3BAFA 1DBIA 2FN3A 1PFGA 4EQZA 4GZ5A 3FE2A 4ZO4A 1V43A 4R1UA 1UP6A 4Q5IA 2HLDA 4B81A 4K81B 4CHTA 2Y8EA 1JKMA 5F1YA 5A4AA 4D25A 1KYQA 4HAWA 4L5CA 4PZUA 3K0EA 3ZHQA 1EM8A 2XWPA 3RC8A 3FVTA 2PWAA 4EIWA 3DOUA 3BCSA 1BE8A 3H05A 4IEEA 4WMLA 1F2VA 5DTJA 4CIAA 2PBFA 3TTWA 3LDHA 4RK4A 4Q9DA 1FOEB 3ZHSA 3DO8A 1SIBE 1GNSA 4K88A 1YXMA 3SYTA 4RMJA 1F48A 3COJA 1AQUA 3LLVA 3IQEA 2BL4A 3ZW7A 1G1MA 3JVIA 4KXQA 4YRIA 3PXDA 2FSVA 1AIPA 3PE3A 1CQJA 4TVKA 1U8AA 2AGVA 2R84A 4TQAA 1XT6A 2BKUA 2ADFA 1OXKB 1GPH1 2IU3A 4R2LA 2VYNA 2B6NA 1ULAA 3QVLA 5B1DA 5LP6A 4LA4A 4QBFA 2W6CX 5BWMA 2PT5A 4U63A 3ZEAA 1Z35A 2FPSA 2WR8A 2DKFA 4REQA 5LVAA 1BN7A 1ODKA 3LT0A 1DFIA 4HS4A 2ZSFA 1IBMB 3MINB 4YQEA 2A9JA 4JHLA 2AN4A 1XLWA 1MEJA 3BFPA 4KXMA 2NZYA 2OHJA 1MH9A 1OF1A 5ARBA 2GAAA 3HXPA 3C5VA 2ZE8A 3N2KA 4XTRA 3I04A 3QPAA 2ACVA 4S1WA 2YVUA 4BO8A 3MFYA 4AP9A 2PVSA 3FRIA 2D54A 2FWRA 4JOQA 3QI7A 3V46A 5JWHA 3ZD9A 4G4SP 2C7RA 4MKHA 3R6LA 3R8FA 2HH9A 4NECA 1VXRA 4U6QA 3A1NA 4XIFA 3IR5A 1WXHA 3E27A 1FA9A 2YCBA 2C8JA 2WFLA 3OQBA 1NJ5A 1XZPA 3FZGA 4WKCA 4EB8A 3FCUB 2BW0A 3STHA 5JCZA 2NV2B 4QFMA 3OY2A 1AG9A 1KAQA 4MVJD 1HSZA 5AR1A 4OA8A 2PR2A 1S9HA 1FRNA 5COQA 3RQIA 2CFCA 1B00A 4RPCA 1AKEA 2H9IA 4H60A 4E07A 2C3MA 1NUQA 2R8EA 2QZSA 5AP9A 4GEGA 3O38A 3PUXA 3TZCA 1HX7A 1P5JA 1GGMA 1YWGO 4N6OA 3JRXA 4IH4A 2XADA 5F3DA 3V8QA 3WLAA 4EDFA 1XRLA 3CRRA 1A76A 4XB2A 3ZZNA 1WSDA 3OX2A 2PRIA 4OHPA 1YASA 3KPYA 2FR8A 3RVDA 2BCGY 1Y5IA 1KJWA 3KM0A 3BFJA 3EQ2A 3L7LA 3LKDA 2PKCA 5GJCA 3VC2A 2R4QA 4KX5A 1DQRA 1U3UA 1V5EA 3CO5A 4R68A 3U61B 1L3BA 2RSLA 3EUWA 3QUAA 1W6UA 2A5JA 4ZCRA 1RRCA 2XCLA 1MX9A 2A67A 5JQWA 3A9CA 5F4BA 5D5QA 5DHAA 3PUVA 5G3YA 1OKKD 3QVXA 2HA5A 2IZ7A 4JZKA 2NAPA 1A77A 3AZOA 1KIFA 3QXGA 5LC1A 1SHUX 2QR3A 1KBOA 3S81A 3Q5EA 1AC5A 2OAEA 1JG1A 2JFFA 3GNTA 4NBLA 1ECFA 4RYLA 1RXVA 1DSSG 3OD1A 1Q0SA 1RKXA 4P86A 4X6UA 5C0OE 1MKYA 4J1NA 3G6WA 4Z4IA 4QU0A 1JR4A 4MB0A 4A23A 2GCEA 1XTQA 2GNPA 1GZUA 2ZANA 4BUCA 3TDNA 3Q6NA 3CVXA 1MJGM 3E9YA 4AMBA 1JUDA 2CK3A 3VU3A 2EHJA 2TS1A 3ZLJA 2FFBA 2C97A 4M1KA 2VHVA 3PLNA 1T0BA 4M88A 3JCZA 1QTRA 1G8GA 2GZRA 1NUAA 4YRDA 1D2EA 3LM8A 2NTJA 1FFDA 1NBIA 2D0DA 1MG0A 2OL4A 4PQEA 4TKZA 3E5NA 3LIIA 3U3MA 1PVOA 4NCJA 3EUFA 4HTFB 3ROGA 2VUIB 3ZCXA 4IQ0A 1CIJA 5FULA 5DV9A 3ZHCA 4CKBA 2EG9A 4ESHA 3Q0TA 1EDBA 3NOXA 4ZI5A 3I1IA 1DDGA 1LS6A 1ETHA 4ZDKA 4JP3A 4QYWA 4BAGA 1X42A 1HPLA 3CZ4A 1LQ2A 1AHNA 2WMYA 1ZLYA 4RIHA 4DWWA 1JDVA 1WJGA 1XLTA 2B1JA 4FZJA 3NBMA 2Q28A 5CLFA 2OGZA 1JALA 1PQWA 3O4HA 1UK8A 3UA4A 1J5EB 4Z54A 2FW7A 3EVAA 4BFVA 2VXBA 3EQ6A 4KXYA 4K6FA 2GO1A 4PW0A 4DDTA 2FSFA 2AG6A 1ZL2A 4C14A 4JKYA 2ZIUB 2ZXUA 5EJ4A 2LNDA 4TTQA 2GB4A 5JPIA 4K28A 4JI5B 4C4RA 4N01A 2YQ4A 5IKEA 4EUNA 3KPJA 2OOSA 1NW6A 2JANA 4MTCA 1ADBA 3T7CA 2CZQA 3KT6A 3QWHA 3UB3A 2IU0A 1Z13A 1U98A 1DCMA 3CLTD 2HV9A 2C77A 4ETIA 3HJCA 4DR2B 5KUTA 1ZHOA 2HPHA 3FPLA 4N4AA 4AYWA 3LIPA 2QMZA 1ZXLA 2C9YA 1PN3A 1XXLA 4ZTBA 3GPLA 4ENVA 1RIFA 2WMOB 3A2NA 5AM4A 2V6BA 2WC1A 3U7GA 5DBGA 4Q6BA 2YIJA 4HNUA 4WKGA 4DCMA 4L8VA 4WVLA 4DABA 3WZ2A 3IVGA 2E4VA 4AMGA 3CTMA 5AKIA 3EZ9A 1XRQA 1G5IA 2AW3A 2F1JA 2ZS9A 1QKKA 5BV7A 1UOQA 4UU0A 3PKZA 4MULA 1SUAA 3ASZA 4AXXA 2IS4A 4DEVA 3O8QA 1EZZA 4D43A 2XHEA 3D8BA 4RSMA 3EF3A 4ZT5A 1U3VA 2HCRA 3MT7A 1XJWA 3VJRA 3O73A 4GNKA 4YCAA 2PH5A 2QROA 1W1IA 3KALA 1XYGA 3P5SA 4KDRA 1VMDA 2DYKA 3GFRA 2REQB 3QUTA 4LI3X 4B9EA 4D4JA 5JI3E 1BMDA 1MOSA 1RQRA 4CIDA 1PK9A 5T4EA 4H4CA 3KR1A 3LC7O 3ICQB 1UQUA 1G17A 1R8QA 4I36A 1P9LA 1ZVQA 3ESYA 4QHSA 2EBUA 3DV0B 3N0RA 3DEYX 3CX4A 1RXSA 3K4HA 4FGSA 4RLSA 4OJYA 5I8WA 1I2MA 5HIAA 2HU8A 4QULA 5BY2A 1FZTA 1E3DA 3HN7A 4B6GA 4LZAA 3AVWA 2FR0A 1BDJA 2RH9B 4GRIA 4PFJA 5ICMA 2F1KA 4F56A 1U7WA 3B89A 3QTTA 4GIBA 4U7FA 1RWPA 2LPMA 1YZKA 5I7OA 4W7IA 3MZ0A 5JNTA 2IP1A 1GQQA 3BIOA 1NI4A 2XUGA 3RUHA 5AW4A 1WZUA 2XLCA 2ZE5A 5TQJA 1CB0A 4G0OA 2X9GA 4EHDA 3D6FA 4F92B 1J7JA 3NOVA 1JECA 4L1KA 3HV2A 5L6MB 1S2MA 4XUDA 5K3FB 3CQ9A 2KI5A 1FDTA 1WCIB 1U11A 2X41A 2LUOA 2WHRA 1HBJA 3JR7A 4EG1A 1AKTA 1U9YA 2YWBA 4MH0R 1B14A 4NG4A 4BZQA 1X7GA 4P4UA 4PPGA 1AS3A 2A9QA 3UG7A 3G3EA 2J6CA 1I3MA 4IMRA 2ZFUA 3ZIAD 4MPTA 2AEJA 3Q7SA 1QH1A 4HOYA 4WZAA 4C6HA 5A9SA 3VO2A 1YA6A 1V1JA 2IP2A 5HF9A 1N78A 1K0FA 3LDFA 4L5YA 4EYQA 3OOEA 2IHBA 4LYYA 5JD3A 2QD3A 2XQJA 3O4JA 5J2TB 1Q44A 2Q1TA 2QT1A 3QVMA 1MEEA 1U2DC 3DOOA 5CFLA 2JFVA 4TV9A 1DHTA 2OE2A 5EQDA 5F64A 1OV6A 4O1MA 3B5EA 4QFBA 4DTIA 2ZRMA 4LXHA 4HV4A 4I08A 3UUEA 4YXWD 2J07A 5CLJA 1CEQA 3IA2A 4PYRA 1GR0A 1L8QA 1GJRA 2I22A 2RB4A 2WJZB 3SZGA 1VMEA 2J7KA 4QREA 3K0AA 1ZK4A 5DI3B 4PY2A 1JIVA 2I1LA 4HEA6 3ZE0B 1OB2A 4TMYA 1Z3IX 2C4TA 3EWAA 3OX1A 4N65A 3V6MA 3SYLA 2YJTD 3ICWA 3WHIA 3ZY6A 4BNJA 4I7EA 4YP9A 5D8DA 3HP4A 4IJ5A 3UWOA 4EX6A 4OLAA 4N0PA 4PLVA 2EL7A 5HIJA 4BFXA 2GAFA 3AEQA 2AXNA 4OQLA 4RV4A 3NCTA 2N47A 2ZSDA 1EK1A 3JQBA 1CRWG 3SM3A 1R9GA 1NA5A 1W5TA 3CGWA 3R0VA 3DZGA 4DLLA 4TWJA 4NBVA 1OX4B 5CT9A 1Z22A 4JKIA 4BV3A 3IA7A 4FDAA 4H27A 2DERA 3L5OA 3PFNA 3MM4A 1NF8A 4WCVA 4I5IA 2B35A 3RRNA 3TLBA 4CMHA 3JQDA 3LGXA 2BEWA 3ZCPA 3UK6A 1JGTA 1ECGA 5ENDA 1LK0A 1NVEA 2V4ZA 3FIUA 1K3UB 1I4TD 3KOZA 3L0OA 5GWXA 1BS9A 1Y3HA 3ZS8A 4BGIA 5K8UA 4RW0A 1K68A 5B37A 2O2CA 4S05A 2LRHA 3PHBE 4B3SB 5FTNA 4JI1B 1NYQA 3D7MA 1CS0A 1SXHA 3S55A 1VRCA 5JYCA 3PUYA 2BM9A 4UNSA 1XMQB 4GMKA 5HNKA 1F5NA 2FZGA 2ZRKA 3O90A 3QF4A 4FGLA 5LZ2A 2A5YB 4M54A 4BNTA 4RCVA 3PR3A 4ZI7F 4PSDA 3T0FA 4EZIA 1WXEA 5HRAA 1J1UA 4KDEA 4MWZA 1FFWA 1SB9A 2CL7X 3UBMA 4ENRA 2FCRA 1DEAA 3CVOA 3ORFA 5EP1A 3QV2A 2VP2A 4P22A 4Z0HO 2PAAA 1T8RA 1SHTX 3MWEB 4WFKA 2ZI7A 1U1EA 4H6WA 4MWOA 3VVCA 3GCXA 2ODPA 1KQGA 1U2GC 3QLEA 3QVVA 5D51S 1N2ZA 3OLZA 1DRJA 5ESRA 4DJEC 1BRMA 3DAYA 3SSOA 3H0CA 1X7DA 3P9YA 2KQUA 4NATA 3VNBA 4C3VA 2E2WA 2W2LA 3OLXA 4I4LA 3P2MA 4P7GA 1JKFA 3D1LA 2EV9A 2YYZA 1FQKA 2DT5A 3Q8LA 3VYWA 4HP8A 2VBCA 3PHHA 2AJCA 2AR9A 1X0VA 3LHSA 1E32A 3EG9B 4GT1A 4PO1A 4RVDA 5EY5B 4B46A 4D82A 5G40A 1QV6A 3ADKA 3PKJA 4YT2A 4B6PA 3GIWA 4KYTA 1AGNA 1B1AA 2J9YB 4HDKA 4MQFA 4OP1A 3TGPA 4R31A 1IEWA 2J3HA 3ZD8A 1X9GA 1QVAA 3CCCA 2GI4A 4OAPA 3KUKA 1W0KA 3RS4A 3SF8A 3D7RA 3OCCA 4NCIA 1SULA 2OAGA 3H1AA 3HWWA 1M1NA 2WWRA 3L9WA 4G5GA 4FS8A 2BC9A 4NLLA 4UMEA 2OHXA 1TLLA 3A32A 4G0XA 4K6OA 3FTFA 1MIHA 3FYUC 1ZDMA 1IMOA 2HV8A 3FM9A 1CQWA 1D1QA 1YS2X 3E82A 2AC2A 1RXIA 3QXCA 4Y9RA 4DIDA 2GN2A 1T8WA 1CZKA 3FMFA 4MRVA 4FHFA 3ZD7A 2V97A 5DBIA 5HIIA 4ZFNA 2ZUBA 2VDMB 3GUHA 3S99A 2FSGA 1E1KA 5I7AA 3O4IA 4NULA 4QRDA 4AG3A 2ZOSA 5AM0A 4B40A 4AJNA 2QRGA 2XKBA 3DL7A 4YJ3B 2JIDA 3G1TA 3QKTA 5IJ9B 2XB4A 1U65A 4XDZA 1LDEA 4LW8A 4P0TA 1FFCA 1W94A 2WJAA 2CUNA 4RA9A 4ZOLF 5FBQB 2Y0CA 2Y68A 4YN3A 1YC2A 2ZSJA 1LX7A 5F7XA 4BU1A 3TKAA 2HJRA 4URUR 2H1CA 2PXXA 1YZQA 4R0NA 3C24A 3ADBA 1D2NA 1DAKA 4BEBA 1NV9A 2V6FA 4UMVA 1TX4B 5HWSA 1P2GA 1QGED 4PO3X 5FEMA 1XMOB 2VTKA 5AOCA 1NW4A 2QN2A 5KYYA 5H80A 1A9ZA 2V0NA 4RY2A 3HM2A 3TZQA 3AETB 2ILTA 3X1YA 3TLZA 5ALGA 3EFEA 2CMHA 4KMOA 4O4JB 2J7PD 5AI4A 5K0LA 5EJEA 3QKUA 1EFPB 2IYOA 1DCKA 1H2YA 3CGGA 2C2WA 3EZYA 4NPAA 4N49A 5DIFA 3OAAA 1U7DA 4H0NA 4TTTS 3T61A 1T9GS 5HK9A 5ANRB 1LK7A 1GDHA 1R0KA 1VCMA 2OC4A 4KIWA 4CM7A 4NCXA 3G79A 1ZLXA 1UM9A 4Q4JA 2GOYA 1ZMXA 2Q1WA 3CONA 4QUEA 3STYA 3RUDA 3OTGA 2NVUA 5JQGB 3GFQA 3BF7A 3KEMA 3OE5A 4ZAZA 1IDOA 4CQLB 1EIZA 2ZAIA 4K7JA 3BMNA 3BDAA 2FG5A 5IAKA 1WBDA 1PR0A 3GIDA 1IUNA 4LYHA 3ODGA 2H4XA 4W82A 2I7TA 3HLYA 3KCNA 3I0ZA 3F6YA 1AZTA 1BMTA 4JLAA 1BH6A 4D4HA 1O6BA 4R16A 4HY3A 1PQPA 1T9KA 3M82A 1ANKA 1ZIDA 4N3CA 2Q5IA 5BRAA 1IQPA 2I2CA 1SXJD 2OR3A 4I1UA 1X9IA 1CKEA 1DELA 2VK2A 3K35A 3WXBA 2X1LA 2BHLA 2C3YA 3Q3GE 3R5HA 3U0VA 1DDIA 1E4YA 3G2JA 3QP9A 3QVJA 1SEVA 4FX5A 4G1BA 4MJ3A 3F7TA 4Y2HA 3HCWA 2GEVA 3SJAA 3V97A 2XKJE 3WP1B 2PU7A 3DWIA 2IYWA 3ZJUA 3PIDA 1FX1A 4AY6A 2JH8A 5GMOA 4F4HA 5L3ZA 2HUPA 1AMOA 5DX8A 1Z82A 1XXHB 4C05A 2QN6A 3BCUA 5PGMA 1DJNA 2W5UA 1MAVA 4KQEA 5F5NA 3RD5A 4CMIB 4YUXA 1EX7A 1SVWA 3BDIA 1LVUA 1SCJA 1UPFA 1R8YA 1YDHA 4FUTA 3RUCA 4BNDA 4LXIA 4F4JA 1SRQA 2YWGA 1E9DA 5D84A 3QYFA 1IWPB 4FIDA 1V8OA 4NBWA 1JR3E 4NFSA 3VMMA 4DCVA 1LDGA 1PCXA 3TEJA 2HA4A 5HDQA 4J16A 1I01A 2G3YA 3BG5A 3ZWBA 1F2TB 3CKMA 1T1EA 3F6CA 4U7TB 5KYUB 2OORA 5C1OA 1FDUA 1XTPA 3V4VB 4ZYYA 5ENZA 1WDKA 2WVHA 5EIFA 4BQSA 1KAHA 5IABA 2FZCA 4ZQEA 4F0JA 4F12A 1V3TA 2YH2A 4HEHA 5E95A 4EBBA 5FWAA 3MA0A 2QN8A 1UH5A 1LTQA 1ISFA 5CPFA 2PIDA 4D6PA 4Z5XA 2IYPA 1TRKA 3FZQA 4GZMA 1IBCA 3GQVA 5ALDA 3PI7A 3N2ZB 5C8YF 1L7EA 4G8JA 3V2IA 5TVKA 2V7QD 3VYUB 5JZMA 2EAUA 4XVCA 4RORA 2G7ZA 2GEKA 2RHLA 4KQXA 4Q01A 1NN0A 2ZTUA 3LZCA 2OQVA 2QN1A 3ER6A 5IBPA 4MI9A 3IYLW 1DJPA 5GONF 1D1SA 3NNDA 1L5LA 3WNQA 5IPFA 4YHHB 5JVDA 5LFAA 1R3DA 3SXPA 1XRRA 3BZBA 5FNVB 121PA 2Q27A 3QA3E 1XVUA 2FXVA 1FU8A 4PXYA 5F23A 1Z0ZA 2D2EA 4U2DA 1SCQA 4PFQA 4AQDA 2UVQA 4HXGA 2VTBB 4XPIB 3LYAA 1ZP6A 1EA5A 4YP1A 4YYEA 1N5JA 5IDYA 1BX3A 3Q5DA 1ZZGA 1AE1A 2G83A 2CE2X 2GPAA 3TD2A 10MHA 5K5EA 5I5EA 1OTHA 5BUZA 3PC7A 4AMVA 4MW5A 1QKIA 3EXEA 1I3CA 1KQ3A 4L3OA 1PU2A 2B2XA 3RASA 2I6TA 3MILA 5LQSA 1KA9H 1CUJA 4RTSA 3LX6A 1ST2A 1UJMA 3E3LA 3ER8A 2QZ9A 4WKNA 2B3DA 3M6VA 4W5JA 3WJ1A 4MV0A 4ZJPA 1L7XA 3IUNA 1YUBA 4N6NA 4EMTA 2HUNA 1L5SA 1GA4A 4PNHA 4Z9XA 5AM3A 2G88A 2IGBA 4PTYA 3LXRA 4YRSA 2OTCA 2C7QA 3QXSA 5FOTA 3GLUA 4EA9A 1MIOB 1V5FA 1SBQA 3A28A 2PJUA 2LKCA 5COAA 1NM5A 2ZB3A 1ISRA 3D31A 1GHTA 4HAOA 3PDIB 4XM2A 5JCPA 3HGQA 3K9FC 4US1R 1PT6A 2IEDA 4DMCA 3HDGA 2OV6A 2XMZA 3K32A 3EBLA 2SKEA 5JCOC 4XDYA 3VKHA 1KPHA 1KP9A 1ZGHA 2IIBA 4B9AA 3I5XA 1PWXA 3BXXA 1E3IA 2F3QA 1A9RA 3G23A 1RPZA 5IASA 2HA2A 2ZJAA 1B3BA 2UYGA 3NBQA 3Q8KA 1E4OA 4MVWA 1BD3A 2FPIA 3PT9A 4JJ6A 2R66A 1NQTA 4M9RA 3WHLA 4N0DA 1N0UA 3PGMA 4L5BA 4AWXA 1H2XA 4YRKA 1HDCA 2GF2A 3PG5A 4EDHA 2A0YA 2P5YA 2QE7D 4QNMA 4Y8VA 4YT8A 3IPYA 3CMCO 4FCCA 4RXTA 5AK3A 1EP3B 1I7PA 4AK9A 1BJTA 1E3QA 2AFIE 2JLVA 3P0EA 4CM8A 4MYCA 3PWTA 5BYKA 3IOYA 4FZ3A 3WC4A 1J06A 1RI2A 1R64A 2C00A 3K4PA 3PNBA 4F04A 4J0CA 1M6VB 2E89A 1HDYA 2MSDB 2V1XA 4W1QA 3DKRA 3ZXIA 4DNPA 5JJBA 3EAGA 1W0JA 1SXJB 3M1LA 2WD7B 3MLAA 4KBYA 4RGBA 1IB6A 3ND7A 2G8NA 1N7HA 4A3SA 3R7DA 3ONEA 4R0VA 4BE9A 3M1AA 3ZU3A 4DPMA 4ZVRA 2F43B 2D1TA 4OSPA 4DBZA 4ZA2A 3X1WA 1R74A 4K87A 1ZNWA 2WPDA 3PQCA 3MT0A 1XKXA 4FNMA 3W05A 3HABA 3EPKA 3BCHA 1XZGA 3FNEA 3SR0A 1RLJA 2FMTA 1Q12A 4RH3A 2ALJA 2KHZA 1A9PA 2G04A 4G67A 1QORA 2I2BA 3ZV7A 2HPAA 2ZDGA 2OSVA 3SFZA 3C6ZA 2IS1A 4AZTA 2PUHA 3I1YA 2XA9A 4M76B 4OXIA 4EI9A 1JIUA 2B8EA 2ODWA 2QEQA 4P3YA 1L5FA 5JC8A 1OVGA 4WESB 4EUSA 5C5DA 1GQYA 4XSHA 1R6DA 4ER5A 5JCXA 1FTWA 4IUBS 1VKHA 1PR6A 4JX8A 3RVKA 5EXEA 5DBFA 3T12A 5HXAA 1I7QB 3GFGA 1YZNA 1K6EA 5C37A 1R7RA 1PJ4A 3A37A 4UUOA 1DZ3A 1KYVA 2QLTA 3GJXC 1O7JA 3BQNB 4HH4A 2PY6A 3ZIUA 2ZM5A 1Y8ZA 1JEAA 2Q50A 1HKHA 3EXHC 3VR4H 2WIKA 4KSCA 2PLWA 2VK1A 1ZFNA 5JSYA 3ABQB 1GPNA 2Y1EA 3K73O 3OI7A 5AI8A 1DC7A 2F90A 2HCFA 2Q9UA 5D5PA 3QFCA 2YY5A 4NABA 2I62A 1YRHA 3NM6B 4PLPA 1TA9A 2NSYA 2QSUA 2QB5A 3HXTA 1XP5A 2BR4A 3L04A 4R2WA 4TWIA 5CT5A 3INRA 3BWEA 2F48A 4RXMA 1NQ5A 3EAFA 3BXEA 1HYHA 1RC0A 1VYUA 3ID6C 3NPAA 2G5TA 2QY6A 3EVZA 4JASB 5AHRA 2VYND 4YP7A 3TVDA 3ZDFA 4AUKA 1N8TA 1AOXA 2BGKA 4G81A 4AYTA 2NIPA 5AD1A 1W2HA 2YRXA 4EHNA 5FH9A 3CVYA 4XJVA 2GK3A 2Q5HA 2Q4OA 3INGA 4INJA 4RX1A 4ZQFA 2FPUA 3ZVLA 4EGJA 4TWAA 3C43A 4RD0A 2KB0A 4YCDA 2IS6A 3D2CA 1NSFA 4QDJA 4RA6B 1FJGB 1TVEA 2BFCA 2Q0QA 2RG7A 4HVLA 4YAWA 4OLBA 4R71A 4FPXA 1XRJA 2VOEA 2O6HA 5CYFA 1D4OA 3NWPA 1XDSA 4MW2A 4FI3F 4NWIA 4OGKA 1Y8RB 4IHAA 5AHXA 3JWPA 1L7PA 1CZOA 5B53A 4ZDIA 1AMUA 4F93B 1M6WA 1V8BA 2CFTA 4LHSA 3NDJA 1JHRA 3EDCA 2QM7A 3AEZA 3M8KA 2VPTA 1JFRA 2H4WA 3AM5A 4I50A 1NP7A 2R25B 4BJ1A 2QMQA 1O89A 4YCNA 5KAMA 2Q8QA 2HXGA 4DSNA 3OPYA 4HFMA 4CVNA 2OCIA 3CNBA 4GRDA 4WCFB 2ORED 4J4BA 2FW6A 4WLOA 4RWZA 2NG1A 1R8JA 4ODIA 3W2GA 2Q5FA 3UK1A 4P5PA 2P5UA 3CURA 3ADCA 4A7PA 3W5JA 3LK6A 2XUOA 4DG9A 4IF4A 2I8LA 2RI0A 4I1VA 5F5LA 1HI9A 1CDEA 4MVXA 5FOUA 2YS6A 4B35A 3JWEA 3NAGA 2O0MA 1LBEA 3GLRA 3EIUA 1TPYA 2PUWA 3CNNA 4C0HA 3BN3A 3DJYA 3ELYA 3ENNA 3ONFA 3IEUA 2ECFA 4DDVA 1OU4A 5FLYA 2PZBA 2X2EA 4EFKA 1XCOA 3KYCA 5ALYA 4I9NA 4YLGA 1P0IA 4J03A 2WHYA 3L1UA 1OGJA 3LS2A 1CDOA 1CT9A 3C2QA 5EUMA 5LNK1 4TYWA 1NPDA 1XCBA 3SM9A 2BCEA 4HXYA 4Z9YA 1JDNA 5FBWB 4FFDA 2ZGVA 3GJ8A 1U0HC 2NUTA 2J3EA 5IH7A 3IP6A 3L1HA 4MA0A 4X1IA 1K8ZB 3GBSA 4Y6RA 2O8EB 3NIBA 2I6SA 4MHSA 1JHZA 2Y9ZA 3RF6A 1KAGA 4MQBA 3K70C 3EBPA 1MBZA 2JGEA 2JAPA 2XI4A 4C7JA 5C18A 4IIBA 3TQSA 4C0AC 4E14A 3QK7A 3LOQA 1IXSB 3ZW9A 3IR6A 3EZXA 3T6KA 4C4OA 6AT1A 4KNVA 5IUKC 5G1PA 1KOJA 3BEOA 1EFVA 1Z8NA 2CK3D 1GILA 2IXAA 1T5OA 1Z45A 2EJWA 2GN1A 1XZEA 2ZVPX 4KIUA 4ATNA 3KSMA 2VHWA 3PUKA 2R5FA 4YPFA 3TKLA 4DUGD 1QF7A 4B3FX 2UVPB 3DMTA 1VGVA 1U8FO 1M7HA 4RCYA 4ITRC 1RBZA 4XYEA 3W6PA 1E64A 1Z6AA 4RH0A 2R11A 3C6KA 3L8ZA 1GPJA 5BSTA 1UF9A 1HQYE 1PTJC 2CJWA 4FUQA 4GXTA 4KGVA 3S4YA 2FTKE 3TUIC 4B33A 3EC1A 2UXCB 4M0DA 1YQ9A 3IDZA 1JF8A 4AU1A 3KJQA 4C5AA 3JASB 4D4KA 1RT9A 4U8GA 2ATVA 3WLTA 3HJHA 5JNRA 6LDHA 1R0XA 2HNBA 1UEJA 3H8VA 5G0SA 3VPXA 3JQ7A 5ARDA 4RV9A 3U44B 3JAKA 4PIVA 4YMWA 5LQCA 4AZ3B 3HL4A 2QS9A 3P32A 4QYSA 1DWPA 4RETA 3MTDA 3R9XA 4N8EA 2PBRA 3C48A 5KOJA 3DL0A 1U1CA 1G6HA 1NOKA 1NWCA 1IXKA 2OV8A 3AP1A 5DH9A 3F3SA 4K0RA 4LGCA 5A5FA 3DB2A 2CL6X 5C35A 3KQNA 2VXYA 2JJQA 3N76A 2YXNA 3LY9A 2ZI4A 2PD3A 3B1FA 3NHPA 2FW9A 4GOMD 5HKOA 4CL0A 3IVXA 1JBEA 5JXGA 1P61B 1Y8CA 2EP5A 1E3JA 1YVDA 2FFHA 2P6OA 2Z58A 3EDOA 3GNQA 3K6KA 4X84A 4CMKA 3LQ4A 1O3YA 2H17A 4QDKA 5U9CA 4ZP1A 1YVRA 2OGTA 5DWDA 1WB6A 3IV9A 1D0VA 5A7HA 1I7DA 1P80A 2BMWA 1HM5A 1W581 5KX5A 1ZUIA 5IBRA 1FFYA 1S2IA 3CUVA 1Z5GA 4FE3A 3GA0A 5DLQC 3VH4A 2PGNA 4BLOA 1PT5A 2ACEA 2IOHA 2A9KA 3CUWA 2FPKA 2VJLA 4G0WA 4RFLA 1X7ZB 1LI4A 2LD4A 2FZEA 1UZAA 3PICA 3QLUC 4LV6A 3P1JA 3Q12A 2O4CA 3A0UA 3A2LA 4Y2SA 2JGAA 5LP6B 2BH9A 3CG4A 1XEXA 4KQWA 3F9IA 2P2LA 3CN9A 3KJHA 3N6XA 1EZ1A 2JEYA 3LXMA 4FB4A 1WOYA 1F4LA 2GZHA 4Q16A 3BREA 2H2AA 2SCUA 2XR1A 3A4LA 2OBYA 4G1MB 4M9XA 2VRNA 3EVDA 4ZDJA 3K9QO 4JQOA 2XUPA 1DX6A 2RARA 4N8DA 4D9EA 1XZDA 1PJQA 1RW4A 1K9VF 4UNPA 5BNZA 4D9HA 1KZ7B 1JR3A 4OXXA 3ELUA 3FDJA 3PE4A 3QU5A 4AJIA 5AVZA 4JGBA 1L1RA 1PKEA 3UV3A 2AEMA 3K0FB 4UNIA 5ENVA 2FR1A 1TT5B 1KWKA 5H4GA 5KTOA 5KJEA 2D1SA 2WFLB 3GEIA 1YE5A 2E6KA 1R0CA 3KVVA 1IMJA 4AVYA 2X22A 3ESAA 5EMMA 3I6QA 4TLCA 2OXTA 3CNLA 5C3MA 3DQZA 3D2BA 3K5PA 1N5LA 3W78A 2JI4A 1Y1SA 2F7SA 3LY7A 4AKTA 1IHDA 4H59A 4TKUB 2JFZA 1TIBA 1KYYA 3IHTA 3ZBUA 4B34A 5I3CA 4IILA 1UP7A 4BYGA 5KWVA 1U0GA 1PGPA 4I1RA 1Y8AA 2NTYC 3C3WA 4LJ8A 1EVLA 2P78A 1GGKA 1K63A 1T0UA 4L7QA 4QRHA 4RTRA 2RKBA 1HY3A 2X7HA 2ZAGA 5B7PA 2YQ5A 5KYXB 4BFWA 4U3JA 3THYB 1KDRA 4OHKA 1SUBA 4MNTA 3OE4A 5CM2Z 5JADA 2H65A 2OCXA 4KLRA 1A95A 2XT6A 3HU1A 2QX7A 4GYJA 2J4DA 4FWIB 5PNTA 2VHJA 2Y66A 4BNXA 2YS7A 2C31A 2GCOB 3H75A 4I9FA 1RR6A 3R5JA 3JVUA 4Z0TA 3JSAA 3QVGA 4EI7A 4UM5A 3MCAA 1Q3KA 4QEKA 3SX0A 5JT1A 2ZYGA 4L5JA 1U5BB 2J87A 2QMHA 3KJXA 4HH3C 1YHNA 4OGWA 3VPDA 4B74A 4JBGA 4BBAA 2C9CA 1LJUA 1SA0B 3AZPA 3F8TA 3SEZA 4BVJA 4JOSA 4YVFA 3RR2A 3L05A 4X1KB 1B0PA 4QPPA 1X15A 1B2LA 4L08A 3V8NA 4LV8B 2OO7A 5ALNA 1VL0A 4YUVA 4RVCA 1B6GA 4QGHA 3TQRA 1U8UA 4Y0AA 4E0BA 4Z7QB 2Q29A 5JFGA 4US0R 2C82A 3BGVA 2XDYA 3KSBC 1OAOC 1G2IA 2AXPA 2R4TA 1IBRA 4UQLA 4A82A 1KEWA 5L45A 1TADA 3OZTA 3F71A 2COKA 3EB9A 1DT5A 4QBIA 3PC4A 2CUTA 4LYJA 3CLSD 7YASA 2P6NA 1NKSA 4BC1A 2PGXA 4BN5A 2GXAA 5CPBA 4EO9A 5K8JB 3P20A 2DFLA 1L1EA 5CUQA 1TM7E 4YRFA 4F9TA 4TQ9A 4LF8B 2QQ5A 3OKCA 3PT5A 1GGHA 3M4XA 2GLUA 2X76A 3KUXA 1FYFA 3SZOA 3KOYA 1TK9A 2XUFA 3PYMA 2FEXA 4WOPA 4RF2A 2R1VA 4NCNA 4U2GA 5JPCA 1A4XA 3HS3A 2XWJI 2XTZA 1U7OA 1W30A 1YUMA 2FP4B 1FLDA 1J33A 1Y48E 2P9ZA 5MN6A 4LBYA 3PE6A 4O4LF 2V58A 2A86A 2JFYA 1E99A 3CBGA 1CJUC 2PZAA 4WK6A 2GWHA 1AV6A 7GPBA 1ESMA 3W6OA 3ZWCA 2XZDA 2AFIA 2PCJA 2Y2UA 3BXPA 3KKOA 4LJ9A 2ZJZA 4U0KA 1BDMA 4OXQA 3ZHOA 1LDNA 2NUBA 5DYWA 4RKWA 1D6MA 4FEGA 1IN5A 4G56A 1N9ZA 3EBOA 4Y2VA 4HLCA 3RRBA 4R8MA 1JNYA 1MDFA 3CUYA 3WYFA 5IJ0B 3FFAA 1M2WA 5FFNA 4KNYA 1AKWA 1H93A 1CS4C 2RHOA 5AIAA 3T0IA 3ECAA 3VDMA 2CNKA 3HNRA 3OPXA 1SG6A 2E0IA 3EXAA 3N75A 3EE6A 2IQ5A 4LGVA 1DXHA 3GCZA 1FRVA 5IXYA 2GN9A 2DQ4A 4CM9A 2QU7A 3AGPA 3KAPA 4R1OA 4DWOA 2B30A 2GBIA 3HSKA 4JLMA 5K4AA 2Z3WA 1EFLA 2NNLD 2W2LD 3NBYC 4QYIB 3TOVA 4UVDA 3PD7A 1G2QA 3K1AB 4HGYA 3G0CA 3L84A 2CHGA 4CODB 3RC3A 2BFAA 1RMYA 2P27A 3OIFA 4LEIA 2Q4BA 5KJCA 2V1UA 2VJCA 1BFUA 1KI3A 4AS2A 1N2BA 1XQ1A 2PLRA 2XUQA 3OWHA 4KFUA 4L2IA 4I8IA 4BEJA 2UYYA 5IX8A 4ND1A 2XPCA 2ZIVB 3RJZA 4CU5A 2JVIA 3ILVA 4QDZA 1KOLA 3NX4A 3UAZA 3ZZ1A 4H08A 3CH5A 1D5CA 1NAHA 2WFMA 4FOOA 4QDUA 1Q0QA 3REQA 3KJZA 3WLKX 1NUTA 1W0KD 4GQIA 5FJJA 3K0CC 4Q9JA 4OHRA 4YCLA 3F8WA 2RHCA 2GDZA 3DGFC 1CY4A 3GH3A 5FV4A 9MHTA 3G17A 5LD2C 1BKSB 2HXSA 2QQFA 4AM8A 3L7IA 1MW9X 2XODA 4WOCA 2M9MA 1CERA 2PMKA 4FQ7A 4EO4A 2IX3A 2J45A 1P4HA 1RM4A 2UUOA 4N6GA 3IPLA 2DPHA 4O25A 3TZHA 4M38A 3MTAA 1GUDA 3TEFA 4HDRA 4F2DA 3DAOA 2CD7A 1V45E 3FBTA 3LQRA 5LXTF 2QQEA 4NZMA 2GFQA 3A05A 2ZU6A 4N40A 3E22B 3DZHA 4G5SA 4Z8YA 3UJBA 5CAEA 2JD0A 4UMDA 3VH2A 2BP7A 3QJ5A 4B6FA 5HVNA 4ZTZB 1RWVA 3CLRC 3QTLA 4WH0A 3RRJA 4BQQA 4GMHA 4P7BA 3UO8B 1UMDB 1U0TA 1H3NA 7ABPA 2RE8A 4FQ8A 3ADOA 1YJXA 4PONA 4M6WB 3ZGZA 1LLQA 4MHOA 2HPZA 5FR1A 4ZHQB 5AK0A 3LFTA 2CBXA 3ZJTA 4TXMA 1N32B 4BEVA 2MDTA 2MTBA 3S2GA 4URZR 3F7OA 2XTNA 4TZ0A 2GO7A 2R00A 2V6GA 2X0KA 1RM5A 2DFNA 3RG8A 4ZI2A 5L4NA 1MAAA 2I33A 2RCNA 3P9RA 4HWOA 1IY8A 4ZC8A 4CF3A 5K7SA 2NW6A 3B3QA 2I91A 2AJLI 2MSKA 4B09A 5AYVA 2HJVA 5DMHA 1L8LA 2B0JA 3KHKA 4Q3EA 4AF6A 1G55A 3KB2A 3OIVA 3OAAD 4HYTA 3IRUA 4ERXA 2G25A 3U1VA 2ZBEA 4TSFA 3NRJA 3U6BA 5JS1A 2IPOA 2YHSA 1QHGA 4PN3A 2VHUA 4DSUA 3CVJA 1UBMS 1DV1A 2J33A 5LIPA 3K0AB 1II8B 1VG0B 2ZYSA 2QSZA 4G2TA 4RIFA 1G64A 1KK2A 3G85A 4XGQA 4Q18A 1YD7A 2ON6A 4UUPA 5L7WA 2RBEA 3EIFA 1KO5A 3IIIA 3JR3A 4HGZA 5DBEX 3ZZ0A 1DFHA 3DFZA 3EOAI 5AJZA 1GRCA 2H2IA 4Z4QA 1N2GA 2E5WA 3NVMB 4O2AA 1ZZEA 4N39A 3UAOA 4B43A 3MS4A 4LWQA 5EPOA 3K8YA 3VPBA 2DR0A 4UBJA 3ZNPA 5AW6A 4HRAA 2ZP1A 2R0QC 4NONA 3RS8A 4NBTA 1OTYA 1PRYA 3WA6A 1S8OA 1VXOA 2C20A 1R4AA 3P8ZA 4X93A 3TGLA 1YOBA 4RVUA 1P0CA 4PTLA 1Q11A 5TQ2A 1RBYA 3OQMA 3CTPA 3RSZA 1TVCA 2P4UA 4RJIA 2C88A