3H2ZA

The crystal structure of mannitol-1-phosphate dehydrogenase from shigella flexneri
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
382
structure length
377
Chain Sequence
b'MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTVSGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIACENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPNDPLEVTVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQISGLDANSEVVSEAVTAYKAMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol-1-phosphate 5-dehydrogenase
publication title The crystal structure of mannitol-1-phosphate dehydrogenase from Shigella flexneri
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Oxidoreductase
total genus 130
structure length 377
sequence length 382
ec nomenclature ec 1.1.1.17: Mannitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain
A PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3h2zA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h2zA01
1YOVA 2HJSA 2VYVA 5JCJD 4R1SA 1Y8QA 1Q0QA 4FB5A 2GR9A 1J6UA 4ND2A 4LCEA 1A5ZA 3D3WB 1HRDA 2Z95A 3AU8A 3R6DA 4YA6A 4PG8A 4XB2A 3T7CA 5J23A 3MJ4A 4M89A 1XELA 1SOWA 4RVGA 1GFSA 4CL3A 4A0SA 4TWRA 4D3FA 1WDKA 1R66A 5ENDA 1KVTA 1MLDA 4JCOA 4RVDA 4JXKA 2HLPA 3WJAA 4XQEA 2Y05A 1YS4A 4G65A 2GCGA 5I9MA 5A04A 1Q0HA 2Y0DA 3MEQA 3ROPA 4GQAA 3KYCA 4ND5A 4U6SA 1BXZA 2IZ0A 3L6EA 1BWSA 4DVJA 2Y1EA 3E6AA 3GHHA 5TQVA 1F0YA 1LSUA 2DC1A 2UUPA 2EXXA 2WD7A 1O94A 2OP1A 4RVHA 4CMIA 2IZ1A 1HDYA 4IQGA 3SJ7A 4IJVA 3FNEA 4ALNA 1IL0A 4CQMB 1SEPA 2VWHA 4MVJP 4YT8A 3SC4A 5A9RA 1PQWA 3V5NA 4MIEA 3A4VA 1SC6A 4NG5A 4PG6A 3ASVA 4BV9A 4EI2A 2AEJA 1GD1O 2HJRA 3FNGA 5DP2A 2P5YA 3ADPA 3D7LA 3S1LA 1U3TA 4D41A 4U5QA 4R1NA 5U4QA 3GZNB 3G1TA 4WLUA 2F1KA 4ALMA 1RPNA 4CM4B 3KBOA 4P4LA 3H65A 4PRLA 2UDPA 2Y1GA 2OMEA 4IQ0A 4XR9A 1MXFA 4K6CA 4YWJA 7ADHA 3IP1A 2GO1A 1OC4A 2GN6A 3SXPA 5BR7A 3DR3A 1Z75A 1JN0A 4WKGA 2J5QA 4GL4A 4Z0TA 2HU2A 1K0UA 5CDGA 3FF4A 1EQUA 2JFHA 3DEYX 3OF2A 4A2CA 1MUUA 1U5AA 3IAHA 3KYDA 5A9SA 4AJEA 1PJLA 4MVJA 4FN4A 4Z6KA 5EESA 1ZIDA 2IE0A 4J16A 4U8GA 2Q2QA 4BO3A 1FXSA 1ML3A 4X54A 1CRWG 2JFFA 2ZB3A 3PHJA 2VCYA 1BW9A 2Y68A 4HNGA 2QX7A 4QUKA 3W6ZA 4YDRA 3MJEA 3K8ZA 1MP0A 3Q11A 1ZSYA 3ZV3A 3SLGA 2DTEA 2P9CA 4NI5A 5KVVA 3GDFA 4N18A 2IRWA 1BGVA 2O48X 1P1KA 4JP2A 3EGOA 2CUKA 2NU8A 6LDHA 3WNQA 3AUTA 1V35A 4MVJI 4L76A 4MVJF 5IDYA 5ITVA 2ZYDA 1LDGA 3A06A 1E1MA 2P91A 3P2YA 1RM5A 4NU6A 4W7IA 5T67A 3WIEA 1PS9A 4JJGA 5JMWA 4D45A 5B4UA 4PZEA 4IINA 3AFNA 3INGA 3DBRA 1ISHA 1UP7A 2WDZA 1IHXA 1R4NB 2A35A 3LU1A 4NJOA 4R4JA 3VZRA 1JKIA 3PJGA 4EUEA 2Z1NA 3BMQB 3JYQA 4GH5A 3QRWA 3SJUA 1RJWA 1LRLA 1SCUA 1P33A 3ZV6A 3RI3A 2GZ2A 1ZXLA 4CM7A 1WWKA 5AQ1A 1B16A 2PZMA 2V6MA 3ZWBA 1E77A 3TZCA 3OJOA 3C7DB 2JD2A 3GN1A 5A5FA 3I1JA 2QHXA 1HZJA 1K2WA 4UEJA 3BMOB 5TLSA 1QRRA 2NACA 4WK6A 3RJ5A 4PN3A 4B7UA 4BV8A 4E5PA 3RC2A 2VHZA 5ILOA 2BI8A 5CAEA 1LSSA 2XOXA 2HO5A 4DGSA 3INRA 4YEDA 1EK6A 1B8PA 3I4CA 1ISFA 1NPTO 1P31A 1NQAO 2VUSA 1HKUA 1YGYA 4OGWA 1HL3A 2X23A 3QA9A 1LRKA 4OAQA 4EGFA 4XCVA 4OXKA 3WNVA 1GTMA 2ET6A 2JAPA 4I9HA 3DMTC 4UVEA 3HDHA 3WWYA 1P1IA 3CKYA 1ZSVA 2AQ8A 4CJXA 4F45A 1LA2A 1I10A 1EUCA 1PR9A 3VH1A 3D0OA 3ZU3A 1P3DA 2B37A 3HN7A 5BNIA 5CG2A 4WEOA 1PZEA 4Y8VA 1LSJA 3WFIA 4R69A 1ZK4A 4NHEA 5CEJA 3MJCA 2RIRA 3QQPA 2DTDA 1DEHA 2ZB7A 2JKVA 2VYVD 2O2SA 1DRUA 4H3VA 2BFPA 4M49A 3WLFA 1QV6A 4JLWA 1FK8A 3U49A 1KEVA 5C7IO 3PTZA 3HN2A 1GCUA 2GERA 5B4VA 4PLCA 3GG9A 3RU7A 4MDHA 1DLIA 2OL4A 3NT2A 3ADOA 3GVCA 2BD0A 1PX0A 2FR0A 2DVMA 4XYLA 1VM6A 5MGBA 1LQTA 2YHUA 4JIGA 3OH8A 3GOHA 3AJRA 1Z6ZA 4WLFA 4IMPA 3LLVA 3MOGA 2NSDA 3W1VA 3TWOA 2TMDA 2P68A 4BO6A 4FJ0A 1GYQA 2NU9A 4UUNA 3I9OA 3V2GA 1H6CA 1KEUA 2DT5A 2Y1DA 3UN1A 4B8WA 4C7JA 4XQ9A 1QLHA 1E5LA 4XYBA 3ANLA 1LDBA 4PZCA 1UXJA 4EBFA 3JYLA 4KP7A 3DMTA 1KVSA 2ZIZA 4BO8A 2RAFA 4KQWA 5T5QA 4E3ZA 4YXFA 4FC6A 3INTA 4E2ZA 1LBEA 2FP4A 4WE3A 3OEYA 3FWNA 2EW2A 4BNMA 4NR0A 2WE7A 4ZD6A 2OP0A 1VKOA 3CH6A 5C3MA 4FFOA 4UVGA 1H94A 4Q3CA 1DSSG 4KUEA 2GN8A 5FEUA 3TJRA 3U5TA 2Y0CA 3OQ6A 3LYLA 2NTJA 3PEFA 2Q2VA 1LTHR 1YB5A 2LDBA 3BIOA 3GEDA 5A1TA 2IZZA 1HSZA 4Z9XA 3GVIA 3UUWA 3WTBA 4A7PA 3PGJA 2UUOA 3WGGA 3BTVA 4EUFA 5EERA 3AY3A 2GASA 1BDBA 4E21A 3D64A 2X7HA 2J3IA 3MJSA 3QWBA 4NBWA 2P9GA 4XRRA 3W8DA 1T25A 2FHSA 3KXDA 2OBYA 2Q1WA 4N5MA 1C14A 1VRWA 5DBGA 4BKQA 4NMHA 4CUZA 4CV3A 2J8ZA 1B8UA 5L95A 4ZQBA 1YJ8A 1ZCJA 3GG2A 4GMGA 5TIIA 3JQAA 2CMDA 3RFXA 3AI3A 1DRWA 3ENNA 4ZVVA 2ZYAA 3TQHA 2ZK7A 1IY8A 5AXCA 3T4EA 3RASA 2HMUA 4W99A 4CODB 3SVTA 5G4KA 1HZZA 3ABIA 1LX6A 4OOFA 3GZ4A 3SLKA 3BHJA 4JJIA 1B14A 1Y5RA 2YDXA 3HJAA 4JROA 2GDZA 2NU6A 4WEQA 3V2UA 4BNLA 3E9NA 4GKBA 1IPFA 4HXYA 3RFVA 3WGQA 2G0TA 3LT0A 3JQ8B 3MTJA 4ND1A 1HYGA 1VL0A 4HUJA 3WGTA 3TRIA 4R3WA 2W2LD 4J4HA 4L73A 4GAEA 4LRSB 1HDRA 4A10A 4QECA 2FY8A 2EEZA 2HRBA 4A26A 4BIIA 3HDJA 3L6OO 1ADCA 2NVWA 3GNSA 4I5DA 5L7YA 4DIBA 1F8FA 1NR1A 2VOJA 1D8AA 4HFMA 3FNFA 1I24A 1Y7TA 4YJHA 1TXGA 3ETGA 5A02A 2XAAA 2NVUA 1IZ9A 3LT4A 3JD1A 2NTVA 3G1UA 1E3WB 1EDOA 4CLRB 1JU9A 3ZU2A 3ZHZA 4GI2A 5FI5A 2VRCA 2X0NA 3FSRA 3GNTA 2UYYA 4BNUA 4QX6A 2GN9A 2HQ1A 3K2BA 5TGDA 4IS2A 3D1LA 4W7HA 1DFGA 3PIDA 2ZYGA 4Y6RA 1GQQA 2YJZA 4I9UA 1UZMA 3LLSA 3Q9UA 5HS4A 1PJQA 1S6YA 3PFFA 3ZWWA 2HRZA 4WOJA 4AJLA 1Y6JA 1WXDA 4D7AA 3MWEB 1N1GA 2I76A 3GR6A 3KZVA 5DBIA 4J1SA 5IJZA 1I2ZA 1DJNA 2FPPA 3ASUA 3B1JA 3D3WA 4CMEC 2P5UA 1GV0A 4Q3DA 3CTVA 3OA0A 3HDYA 2I99A 3VPGA 2C07A 2GYYA 5KCZA 2PGJA 3C7CB 2QYSA 4II3A 2CDCA 4Z0PA 3JYNA 4RLHA 3BMCB 3H9EO 1DOHA 5DF1A 3COSA 4OQYA 3W4KA 3H6KA 5KNLA 4FFMA 1LRJA 1ZSNA 2F00A 1ZMTA 5C37A 5JMPA 2HDHA 3VAZA 4CM6A 4CQMA 2GGSA 3D3EA 2HK7A 2CF5A 3F1LA 1PJ2A 3DONA 2Y1CA 4HWKA 4TKMA 3RKUA 1IB6A 3GMDA 1DC5A 3U4DA 2CVOA 2AE2A 3UCFA 4E5NA 4F3YA 2VT2A 4GPD1 3FR8A 5I9LA 4QSMA 3KUXA 1EVZA 3QVOA 3LVFO 2AMFA 3MOIA 3ITDA 1Q7CA 3JQBC 3GZNA 3S2GA 3AOEC 5BSEA 4BO5A 1NAIA 4B7XA 3QY9A 3JD2A 4CM4A 1YRLA 2D8AA 1ISIA 1E1LA 3KB6A 5CDTA 1H6BA 2R2GA 5DBFA 1C1DA 4NBTA 1BVUA 1C1XA 4EEZA 2I5PO 5F1KA 3TZQA 2PGDA 1UXIA 3IP3A 1UAGA 1DIBA 4FDAA 1NHGA 4W6ZA 1R0SA 2V65A 4YJGA 1C0IA 3BHIA 3JV7A 4CMEA 3PWKA 2O3JA 4U6QA 4DTIA 5I9NA 3UVEA 4AJJA 4LW8A 4URFA 2X8LA 3KTDA 3QW2A 3GNQA 4GX1A 4KTTE 4MP6A 4NBVA 4ONEA 5DOZA 1SMKA 4BO9A 4CLDA 1JKJA 1X0VA 1P1FA 3IUPA 2NUAA 4TSKA 3KM0A 5FI3A 3DB2A 1NR7A 2A94A 3IS3A 4Y98A 2CD9A 1F8GA 1SB8A 1MXHA 4NBRA 1U8FO 4BKPA 4B3IA 3O4RA 4MINA 3ZNOA 3TOZA 2AHRA 1X13A 2BRUA 3RUAA 4GLOA 1Q2XA 4FFNA 2W2KB 5BT9A 2HMTA 5LDGA 3GGOA 1MB4A 2X5OA 4WECA 3VKUA 1LLQA 2V6BA 3JQ7B 2UV8A 4B4VA 1NHWA 3M2PA 3B70A 1HDCA 1P44A 3LQFA 1E1NA 3NJ4A 3PLNA 3VH3A 2HKIA 4XWYA 1X0XA 1R4NA 2B5VA 4AJKA 2DBQA 3O26A 3VDQA 2C20A 3BMQA 3F6YA 3AUSA 2QRKA 2VRBA 1M6HA 2ZB4A 2G1UA 3GEGA 3PZRA 5L4NA 4IBOA 4RF5A 2DAPA 1N5DA 1RYEA 3JQAD 2ZTUA 4UAGA 1QR6A 5THQA 4BUCA 3OA2A 4MVJM 3WYCA 1RKXA 1K3TA 4PG5A 1PJ4A 1Y5MA 1MG5A 1C0LA 5T8KC 3UF0A 4I8XA 1YJQA 5G2OA 2ZKLA 3OBBA 1I8TA 3RCBA 3WMXA 4AFNA 2RH8A 1C0KA 3AI2A 4C7KA 3CPSA 3ONEA 4IDDA 5LC1A 5L4LA 3C8MA 1CJCA 3R1IA 4WNCA 3VH4A 3VVBA 1G0NA 1E7SA 5K0ZA 3PHHA 4XR4A 4I08A 1E0DA 1I32A 4TZKA 2J3JA 1E7WA 3WBBA 5DDIP 4BNJA 2C59A 2YDYA 4RPGA 3H4VA 3HQ4O 4MVJH 5IZCC 3D4NA 1LC3A 2O3TA 4JBGA 4RF3A 2CY0A 1G1AA 2E4AA 2OO5A 4N54A 4IJKA 5COBA 4G5HA 2J6IA 4RO0A 4DC0A 1KY4A 4OOEA 2GNAA 3QWAA 4B4OA 5FF9A 3K5PA 2X6TA 4I5EA 3I9JA 3O03A 2QG4A 1B26A 1GYRA 2PGLA 4FC7A 4YR9A 5EPOA 4AL4A 5IF3A 1O9BA 3AUAA 3GVHA 3WDSA 4BGIA 2PH5A 4DMLA 4ZQHA 4NU5A 1HLPA 1EFKA 3LF1A 3UOGA 1P1RA 1R37A 1XSEA 3RBZA 4BMVA 4N7RA 4DPMA 2Q3EA 4DUPA 3QLJA 1UJMA 4KTVE 2TMGA 3UKOA 1HETA 3ENKA 4D44A 5JC1A 3I9NA 3V1YA 4FIZA 3HADA 1UDBA 3ON5A 1RM0A 2B83A 2VWGA 1N7GA 2O7QA 1A27A 2O4CA 3HZZA 4J91A 1AE1A 1DRVA 1R6DA 2VHXA 3E18A 4IQ8A 4IS3A 1PS8A 2V6FA 3U0BA 4DIOA 2VHWA 1PL7A 4D3DA 2NV6A 2PZJA 2W4QA 4B3HA 1I3MA 2ZTLA 3P2OA 2GPTA 4KWHA 5DCUA 3K73O 3NEPX 1QKIA 5KOIA 1T2AA 1XEAA 1GL3A 3RUDA 1I30A 2BLLA 4XJTA 4BB6A 1V9LA 1F06A 4B79A 2BGMA 3WSVA 3VTFA 4IXTA 5F21A 1DO8A 3NDRA 1KC1A 4YRBA 4D79A 3PYLA 2OFPA 2VUUA 2VWQA 2CFCA 2B4TO 2P2SA 2VWPA 1NWCA 3L4BC 4DLAA 4L0QA 2EGGA 5I7SA 5DCWA 1F12A 4W9NA 1N7HA 1IE3A 3DAGA 4R68A 4XZ3A 3WB9A 4JBHA 4CM3A 4DRYA 4E5MA 5HRUA 1IOLA 3ZHBA 2I9PA 2IDZA 2W8ZA 4M87A 3Q0EA 4CMKA 2Y66A 1H9AA 1ZK2A 3AUUA 4Q39A 2PR2A 4KDEA 1T1SA 4ZQGA 4DXHA 4HBGA 5ICMA 1JAXA 3W8FA 5GMOA 2PH3A 5TJHA 5TJ9A 3VKVA 3LC2O 5KKCA 3B6ZA 1GADO 1BTOA 1NQTA 2EHDA 5H81A 5JFOA 2JJYA 1NPDA 2JFGA 3AK4A 4CM5A 4ND4A 3BMNB 4Y6PA 3UHAA 3QVWA 2ZCVA 1SBYA 2PWZA 2DTXA 2XXJA 3A1NA 4IDEA 5AXBA 1HE3A 2BKAA 3OM9A 3PYXA 3WGHA 2NADA 3GPIA 4P38A 5TS3A 4OYRA 3HE3A 1NQOA 4YJFB 4YACA 5COAA 1U3VA 3RKRA 2DFVA 3BTOA 2WEKA 4QO8A 1GQ2A 4IUYA 4Q3AA 4ALLA 3X2FA 4CUJA 1ORRA 1DIAA 4UUOA 5KTKA 3U4CA 3KOUA 1GZ3A 5IDWA 4ILKA 2H63A 2VZ8A 1WP4A 4DYDA 4XEHA 4KDFA 3JQ8A 3M2TA 4OKNA 1TT7A 4EITA 1D3AA 5CDSA 3JQ9C 4YAEA 4ZHSA 3L4BA 4K1LA 4XA8A 5COQA 3H9QA 2VHVA 5TX7A 2C5EA 4TMFA 5JAQA 5IXSA 4R9SA 4BKRA 1B7GO 1T2EA 1L7DA 1FMCA 2X5JO 3VHRA 2IYPA 4PLPA 1CWUA 3WGIA 4GSKA 4PLYA 3KRTA 1XGKA 5A06A 2NLOA 2WTBA 4IGFA 4CLRA 1MFPA 2C5AA 4YAGA 4CM8B 2JHFA 2HMSA 4RGBA 3RJ9A 5JPIA 3NGLA 2NTNA 2R00C 4OXYA 5DULA 1H0KA 4G81A 3E5RA 3CZRA 1PWZA 1T4BA 4UUMA 5BSHA 2YQ5A 3ZGYA 5JY6A 3PJEA 1I3LA 4NFSA 3RUCA 1AXEA 4D42A 1ENOA 3LZ6A 3QIVA 2ZQYA 2GLXA 2A9FA 4IY1A 4L4XA 4OO3A 5L40A 1GY8A 4E0BA 1YB4A 3I52A 2DU8A 1ISJA 1PQUA 4CMGA 3T4XA 5JXWA 4TRRA 1CQJA 4BNNA 3ZCXA 4XQGA 4BS9A 2QZZA 2W2LA 3CXRA 4QFCA 4E32A 1U7TA 3EYWA 3NTRA 1LDMA 2J5KA 2VZ0A 3MTGA 3PRJA 3BMCA 1OAAA 2DPHA 3EW7A 4H7PA 1P1JA 4WNIA 2Q50A 2DLDA 2YUTA 1IPEA 2Q45A 2X5KO 2VYNA 3RVDA 3JQ9A 1FDTA 3KSDO 3PHIA 1DHTA 4CLXA 3PWSA 4CUKA 4YVFA 3BYZA 1JA9A 1PU2A 1ZZEA 2AW5A 1JW9B 2DUUA 3C85A 3K31A 1LXCA 4LSMA 1KVQA 1A4IA 1DPGA 1GU7A 2WMDA 3ONDA 4L75A 3S8MA 4RL6A 5KJ1A 4BGVA 3PI7A 1PQPA 4E6PA 4Y9DA 1LSOA 1ZJZA 3CUKA 4BHTA 4LISA 3NTQA 4QO7A 3H8VA 3K2EA 4IDCA 2JL1A 5JSFA 1O5IA 5K9ZA 3S2EA 4IDAA 1N2SA 1T2DA 2R00A 3BHMA 4AJHA 5BSGA 3GMSA 4LMRA 4FR5A 1YQXA 4HFJA 2ILTA 3KO8A 5KWEA 5K6AA 1FDSA 5AVOA 2Q1UA 4OIMA 2V7PA 2CSUA 1DDOA 2PD3A 4I5GA 5ER6A 1QG6A 3H9GA 3DZBA 3F4LA 3CTMA 3O9ZA 4HFNA 2GD1O 3OJ0A 3PDJA 1YO6A 4CL8A 3PQDA 3BTUA 4FFPA 5JAIA 1DC4A 1DAOA 3RD5A 2W98A 2FOIA 1K89A 4KQXA 3LC1O 3PJFA 4FGWA 5DP1A 4OXNA 4RJTA 1ZEJA 1E3IA 2YYYA 1I2BA 5IN5A 5CG1A 1E7YA 5TNXA 2GZ3A 3UICA 1LLCA 3C3XA 3Q3CA 1A72A 1E6EA 1GQYA 4JX8A 4YRDA 1PR3A 3LSYA 2QRJA 1YDEA 4RF4A 4XGKA 3VH2A 2BFOA 4J0FA 3DMYA 3RUIA 1VJTA 2OOSA 3A28A 2W2KA 4R54A 1QMGA 5JDIC 2VTEA 5AYVA 2RH4A 1EE9A 1JTVA 2VTDA 3E5MA 1ENPA 5ES3A 3S55A 5JS6A 1PIWA 2JCVA 2P4QA 2I66A 1EBUA 3ZHXA 2C2XA 3EZYA 5I8WA 1SOVA 3L07A 4KUGA 3NTOA 1ISMA 5I8ZA 2ZQZA 5MDHA 4BL5A 5AXDA 5TT0A 4NDNE 3GK3A 3K92A 4DC1A 4RORA 3EAGA 1WNTA 2AQKA 1GCOA 3DZJA 4IDBA 4BOYA 2X9GA 5BQFA 5G4LA 1XDWA 3D4PA 4KMSA 4M1QA 3WICA 1CDOA 3RU9A 2OUIA 1FDUA 4P8RA 3AOGA 2AG8A 2BFAA 3IJRA 1DIHA 1KBZA 1LNQA 4NZ9A 3HHPA 1VE9A 1YQDA 2YHIB 1YQGA 3L9WA 2I3GA 5IFLA 1T1RA 2HK8A 2Z5LA 3GC6A 3D4OA 3WJ7A 2PY6A 1EE2A 1HDZA 2FPGA 2LDXA 4BNFA 1UZNA 4LN1A 2GF2A 4RZIA 1V8BA 3ZWVA 2C29D 5I7EA 2JD1A 4MIOA 4ZRNA 5L9AA 3BTSA 3T7EA 3HG7A 3NX4A 3AI1A 3NT5A 1VLLA 3WGOA 4WUVA 3NUGA 1M75A 3VZSA 2X0RA 4BNYA 4GVXA 3ZWXA 1V6AA 1KETA 5JDIA 1K6JA 4GLLA 4R1UA 4MVJE 2VZ9A 3UGKA 1A9ZA 1H6DA 3QJ5A 1WAMA 1JDJA 3FPCA 3KYBA 3D5TA 2IODA 4RQTA 3WQQA 1KVRA 3UFXA 5EL0A 1UDCA 2PA3A 4TVBA 3CSDA 3F3SA 2ZATA 3DBHB 4AJ4A 1CQIA 3DZGA 4XIYA 2Q1SA 1KS9A 3IL2A 3KYCB 3PQFA 2PKQO 3ROMA 2SCUA 2B4RO 3EDMA 9LDBA 1Z7EA 3GY0A 3MWDB 3JYOA 5EMHA 5KJ6A 1SZJG 1F17A 3PYMA 3B1KA 4RVFA 4S1VA 4EUHA 3R3SA 4D46A 3G0OA 1YKFA 4MP8A 3WS7A 4HP8A 1XWFA 4FCCA 1KIFA 4YJDA 1M76A 1EZ4A 1OBFO 3JQFA 3O8QB 3ZDFA 1ONNA 4IZIA 1KYQA 3M1AA 4B3JA 2Q49A 2FR8A 3JD4A 3WR5A 4M54A 1Q7GA 4RV9A 2X9VA 2X0IA 3ITKA 3ZNPA 2V6GA 2VYND 3GA0A 2D5CA 2A92A 5F3RA 1TB4A 1V0JA 3F47A 2PLAA 1XA0A 4GX5A 3JQEA 3UH1A 3EUWA 1ONPA 3S2FA 2X0JA 3N7UA 5LDHA 3U9LA 4UULA 1LLDA 4IMRA 3NRCA 1E3LA 2C7GA 3VC7A 1N92A 4IZHA 5C7OO 3ZI0A 4L4RA 1WZEA 1LDYA 4XIJA 4ZA2A 4DQXA 1YVEI 1GUZA 2VT3A 3OJFA 4JBIA 2ZJ0A 4JP3A 3WFJA 3E82A 3AW9A 4FS3A 5L7TA 1X7DA 2GN4A 1HTBA 5DCYA 1K6IA 5HM8A 2E49A 1H2HA 1W8DA 2JCXA 4WASA 4XDZA 3EZLA 3TL2A 4TVOA 4WCFB 2EIHA 1RM4A 3KEOA 1GDHA 5CPFA 3PXXA 4J6FA 1XU7A 1XCBA 2HAEA 4FOOA 4BNXA 1VJ0A 4JN6B 4ND3A 2VNSA 3ONFA 4CQLB 1K5HA 3AFMA 1BMDA 1E5QA 2BGKA 4NIMA 1DLJA 5TT1A 4A5OA 4AG3A 2C2YA 3QE3A 3HNPA 1WPQA 3BMNA 3DOJA 5JAMA 4TQGA 3VTZA 4N5LA 4J49A 5G0TA 2NVBA 3FWZA 1BG6A 1JQBA 1HXHA 1T24A 2YFHA 5KVSA 3K30A 2RBEA 3H9JA 3DBRB 2ZJ1A 1IHYA 1NTOA 3GEMA 3GGGA 4PG7A 1DC3A 3WYEA 4ROSA 3W6UA 2PZKA 4ID9A 1P0CA 1FF9A 3ZWCA 1NFFA 3NAQA 1V3TA 4AJPA 4AJ1A 1N9GB 4XYGA 1J49A 1NP3A 3GUCA 4R9RA 1T2CA 4CLHA 3IKTA 1PJTA 2CNBA 3JTMA 2EF1A 1MFZA 1PZHA 4GWGA 2X1HA 2CDAA 3PGXA 4AJNA 1UUFA 3HFSA 3TF5A 4NPCA 3ST7A 3GLQA 1EVYA 1TT5B 8LDHA 3KLPX 4E2WA 2XF8A 4CMBA 4GVLA 3AM3A 3FD8A 2B36A 1PGJA 4WLOA 1I3NA 1RWBA 4RPJA 1B3BA 4OQZA 3ANMA 1VKNA 1XU9A 3IMFA 4R3NA 1OMOA 3JQ6A 4IJUA 4PZDA 2BHLA 1UXHA 5A3VA 3RC7A 5G0UA 1CIVA 4DPLA 2B5WA 1ZH8A 4B4UA 3PQEA 3KETA 1BDMA 2Y99A 1NX6A 4J90A 5JDCA 1UXGA 4NK4A 3KHUA 1FDWA 5HBRA 4BMSA 4GGOA 3ROQA 3IUSA 3FBTA 4HFRA 4U0KA 3SEFA 2OZPA 4ZN6A 1R16A 4MIYA 1VSVA 4MP3A 4UEKA 3WSWA 1HT0A 3QVSA 2PK3A 1D7OA 1E7RA 1WLYA 4CM9D 3ZWPA 1BXGB 4BMNA 4BNKA 3RBXA 1H93A 1U8XX 1VC2A 1XYGA 1YL5A 2YQ4A 3HDQA 4FPXA 4AVYA 4BNHA 4E2XA 3JQCA 3GH3A 4Y67A 5I7FA 3E1KA 3KSUA 5A5EA 5AXAA 1H5QA 1ENYA 3PHLA 4UVHA 5JBIA 1JKFA 1QYWA 1NVMB 4NQZA 1QV7A 4YAKA 1X1TA 3RUEA 1CYDA 1NVTA 3GGPA 3DHNA 1X7HA 1Y81A 2Y1FA 3AU9A 5B12A 4PLFA 3VDRA 3AY7A 1X1EA 4E30A 4P4GA 3DAFA 1EVJA 4FW8A 2GSDA 4CR8A 1LDEA 2H1SA 4RQUA 4BO0A 4HKTA 4WCDA 4PVDA 4Q9NA 1L1FA 2YZ7A 4FFLA 3ZWOA 4YT4A 3VVCA 3I83A 3BMOA 5EN4A 2PV7A 4FFRA 1HDGO 3LDHA 2EP5A 3H7AA 1JVSA 1GEGA 3L4SO 4YBZA 1W4ZA 4BQRA 5JYDA 1R12A 4XD2A 1X15A 2PFGA 1OFGA 3OJEA 1U9JA 2W90A 2Y67A 4QXMA 5BNFA 3IDSA 4EJ6A 4GWKA 5L45A 4FSHA 3RSHA 3LT1A 3DBLB 1EBFA 4CLOB 2YFQA 3X2EA 5CFZA 2RHRA 2B4QA 1YBVA 3U62A 4II2A 1EMDA 1NXQA 1LLUA 1XR3A 4NFHA 1QORA 3GQVA 1SEVA 4H15A 4Q3NA 3FI9A 5A9TA 1BRMA 3ULKA 1TVEA 3OQ1A 1ISGA 1NFRA 4WLNA 2GUGA 4L9RA 4CR7A 1HLDA 3DZIA 4D3SA 2RCYA 3F5SA 4CR6A 4W9NC 3D5QA 1KERA 1U5CA 1YBAA 3FBGA 3LK7A 4HNHA 4J2OA 3TZ6A 3VPFA 1YE3A 5CDYA 1NWHA 1QSGA 2EV9A 4R5MA 4ALIA 3N58A 1JLLA 2PZLA 1DXYA 1FDVA 1T26A 4BNZA 2DUWA 3RC9A 3IQDB 3DHEA 1PS0A 2HCTA 2Q99A 1Z82A 2DKNA 3H9UA 1U28A 2Q4BA 2WM3A 3C1TA 4PRKA 4WPGA 3I9LA 5I7VA 5L4SA 4R5HA 1R4MB 1ID1A 3G17A 1YWGO 1N1EA 3EK2A 3ICCA 5U1PA 2Y1OA 5EINA 2O2YA 2CVZA 3P19A 1H2BA 3PWZA 4RVSA 4YB8A 1ZFNA 3VPSA 5DZSA 1SNYA 3WQSB 3KEQA 1GUYA 1A7KA 2EGHA 1PEDA 4E13A 1TLTA 2AE1A 3TZHA 3DZKA 3HB5X 3OIFA 1ZO8A 4KOAA 1HYHA 1C0PA 3RROA 5LCXA 3L77A 2BMAA 3ZN2A 2J3HA 4J1QA 1VL6A 3GDOA 4GGPA 4OH1A 5F5LA 3EY4A 4XX0A 4A27A 4IDGA 1U4OA 1T4DA 2B69A 2DBZA 2WD8A 2P4HX 4ZQEA 1J0XO 4BNIA 4PGFA 3RIHA 1U1IA 1UAYA 4DL9A 1ZVMA 1KVUA 3PVZA 4Z9FA 2YHIA 4INAA 1M6WA 1ZKMA 1J4AA 2AQHA 4RVUA 1PZFA 2YV1A 1E7QA 2D0IA 2OBNA 3R0IA 4U0JA 4CPDA 3JSAA 3RFTA 2X9NA 1P77A 2C54A 3UW3A 2NVUB 4EYEA 4Z9YA 3OJLA 3Q2KA 5HWSA 1E3SA 4R41A 2EKPA 3ZWNA 3I6QA 4RDHA 1B15A 3WMWA 3PZBA 3U4IA 4PLZA 1GZ4A 3WBFA 1JVBA 5F1OA 4L4SA 2NQ8A 3H5RA 1ADGA 4BNTA 1E7MA 3DZFA 2C7VA 3BZUA 3RBVA 1ULSA 1EQ2A 3DWFA 3GPDG 5FYDA 4NJMB 4YTEA 3OHSX 5ENVA 3CMCO 5G0WA 4XRGA 4H16A 2FSSA 4IM7A 5HTOA 4B8ZA 4XQCA 3U4HA 3PFWO 1LQUA 3R3JA 3H2ZA 4EZBA 1WW8A 4K26A 1TI7A 4DQUA 4RLSA 4W4TA 1E92A 4WCFC 1PJCA 1UH5A 1AXGA 1VPDA 3DBHA 1LUAA 4PLWA 3F46A 1MC5A 4GX0A 1A4UA 3W8EA 2FZEA 3WXBA 3TPCA 3BAZA 3P5SA 1E3EA 5JAZA 3PPIA 2CZCA 3JQGB 3ZZNA 1K6XA 5A03A 4BNWA 3NT4A 3PP8A 4UUPA 2AQIA 3I4FA 1I2CA 4GMFA 5IN4A 1GPDG 4RPLA 5GZ6A 2OHXA 5A3JA 2EWMA 3OSUA 2I6TA 3O8QA 4E5KA 1U2DA 2O7SA 3S2IA 5B37A 4CV0A 3W4JA 3WIDA 2HMWA 1EUZA 4OMUA 2JHGA 4RPHA 4ZRMA 5A4DA 2BI7A 1I01A 3H2SA 3MJTA 1PWXA 3GAZA 4NFYA 3LC7O 3ROKA 3WTCA 2WWRA 3F5QA 2B35A 2I65A 4ZU3A 3C1AA 1E3WA 4JNKA 4DIFA 5KJCA 5JO9A 5EIOA 3TZKA 5KIAA 1QYXA 4FJ2A 4J43A 2FWMX 4XGIA 1DC6A 2AG5A 3MJVA 1NFQA 2FRDA 4B7CA 1C1DB 3FTPA 3H5AA 1NNUA 5KVCA 1C1XB 4TROA 5GY7A 3WG9A 5K6AC 1QYCA 1X7GA 4RF2A 4GKVA 4YJGB 3DXFA 4F6CA 3MCVA 4DMMA 3GDGA 5T64A 2O4UX 3EVNA 1MG0A 5TC4A 1JAYA 1UP6A 4QEDA 2P9EA 3DTYA 3EVTA 2O3QA 1JWAB 4OL9A 4WCFA 4ALJA 2HUNA 2QRLA 4TRJA 4DREA 1YL6A 4F46A 4YAIA 4TZTA 1U4SA 5A05A 3FPLA 3N74A 5L53A 3HSKA 1AGNA 4CMHA 2XXBA 1MV8A 1M67A 4CQLA 1HYEA 1GAEO 1EVIA 2EKLA 2J5RA 1GPJA 5JCXA 3QP9A 1HEUA 3UCXA 3ZU5A 4F6LA 4D0RA 4BKOA 4IPTA 2C82A 4P4NA 5HS6A 2CVQA 3VOSA 1GZ6A 2D59A 1PGQA 2BH9A 5DT9A 4M55A 4DBZA 3E48A 4Q3BA 1HWYA 1O0SA 1D4FA 4FQ8A 4LMPA 4YPOA 5H82A 3KSZO 1E6UA 4AICA 4J1NA 2H5LA 1N9GA 3C7AA 3DAPA 4IIVA 4Z0HO 4ZICA 1UXKA 2H6EA 2VNAA 2B0JA 3DO5A 3F1KA 1XKQA 4G2NA 3TNLA 4FGSA 1WMAA 5EQFA 3NGXA 4J4BA 4HY3A 3SBOA 1H9BA 3PLRA 4J7CA 5JNLA 1ENZA 3QV1A 4U7WA 3NKLA 1G0OA 4O1MA 1OZAA 1TT5A 2G76A 3QWHA 5DN9A 3VZQA 4J0EA 4K6FA 4IGEA 2IEBA 3CEAA 3JD3A 2ZCUA 5F1PA 1LEHA 1R0KA 3QWFA 4CM1A 1ARZA 1BSVA 4IDFA 3VPXA 4ALKA 5L51A 1UP4A 3OETA 1DAPA 4WLVA 4BO7A 4OSOA 3OP4A 2FN7A 1PTJA 2CF6A 3RWBA 3NV9A 4RDIA 4A03A 4CV2A 1NM5A 4Y6SA 3RAJA 3V8BA 1DFHA 3WGZA 4DWVA 4C4OA 2E6UX 1ONOA 4FOSA 4E33A 1W6UA 4J3FA 3FCOA 3ZNQA 3I5MA 1WDMA 2VUTA 4BNGA 1I5RA 3EMKA 1UZLA 3GVXA 3TL3A 1PL8A 1IULA 3ZNNA 2VHYA 3DHYA 1B2LA 1ZW1A 4LSWA 4O6VA 1WMBA 3CINA 2ZTVA 2VN8A 2DM6A 1BHSA 3LF2A 1BXGA 3FRJA 2EJWA 1X14A 2BF7A 3JQ7A 5G0SA 1R15A 1H6AA 2PD6A 4JGBA 3FTNA 4I9NA 5FFFA 1L7EA 2PNFA 1G6KA 1VL8A 2BFMA 3DOCA 1DB3A 4R16A 1I33A 3ZU4A 1HE5A 2Q2WA 2EG9A 2D1YA 1XQ1A 3KV3O 4MO2A 4Z3KA 1Y9AA 5GZ1A 5TF4A 1GYPA 1Q7BA 4J7UA 3CIFA 1PGOA 3TOXA 1UDAA 4ZJUA 3ZHYA 4FD3A 4LRTB 4BB5A 1ULUA 2QQ5A 5G0VA 1PJBA 4E12A 5AOVA 4DBVO 1HE2A 4DQVA 3K6JA 3WWZA 5IG2A 1YB1A 1HF3A 3UXYA 2JD0A 4ZGWA 2Y0EA 1UR5A 4K9DA 3JQFC 1B3RA 4WOKA 2WYVA 3U09A 2YY7A 5BNTA 1LDNA 3P7MA 9LDTA 2IYOA 4UVDA 2FR1A 5IDQA 3ETEA 4NBUA 3WGYA 2FMUA 1ZK0A 3DBLA 4CM9A 5T57A 4CLOA 3AM5A 3STHA 3LT2A 7MDHA 3NYWA 4UREA 3F9IA 1Y8RB 2Q46A 4HX5A 2Q4EA 5CHEA 3A14A 3ZW9A 1NVGA 1RYDA 1A7AA 1F14A 1YOVB 1I0ZA 1Y8QB 1Y9EA 4D0SA 4BO2A 1ZK1A 2D4AA 5TRTA 4R01A 5JLAA 3Q6IA 1YL7A 2NQTA 4O5OA 4GX2A 3M6IA 4ZQFA 4DLBA 4TKLA 2DBRA 4R1TA 3Q9NA 3E03A 3TN7A 4IXWA 4JQCA 3WLEA 4OM8A 1W73A 5KJEA 3DBVO 1RM3A 3BXXA 3GFBA 1HDXA 3QVXA 2IXAA 3GVPA 3DFZA 5C5IA 2FPIA 1CERA 1SO8A 1ADBA 2HK9A 2QIOA 3ZH2A 4J4TA 2NM0A 4MJLA 4MVJD 5DNAA 3OMLA 4L74A 5ADHA 1R4MA 3GRKA 1I36A 2YV2A 4E31A 3L0DA 3PJDA 1PSDA 3GAFA 2WD7B 2Z1MA 4Z3DA 1TA4A 4JK3A 4NNJA 4CMIB 4E2YA 1DFIA 3VZPA 3G49A 4I5FA 2Q1TA 2HMVA 4HADA 1IZ0A 1OOEA 5TSDA 2OORA 3UCEA 4OJNA 2G5CA 3PK0A 2O3RA 3H3FA 1S7CA 4YQZA 2BGLA 3EHEA 3U3XA 1T2FA 3QWIA 5BSFA 5JO0A 1PZGA 3TSCA 3AWDA 5JC8A 2G82A 2CDBA 3DDNA 3PHGA 2QZ9A 4AJ2A 5JYEA 1XIVA 3GUYA 5EQDA 5KJFA 2X58A 1D1TA 3TFOA 4BQPA 4LK3A 6ADHA 2O50A 3QHAA 2GZ1A 1XG5A 8ADHA 2J3KA 2NWQA 4PCVA 4YT2A 3I3OA 3Q1LA 5CP8A 2O3UA 3DC2A 3ZWAA 4EDFA 4NK5A 5ILGA 4WGGA 1HE4A 5A9SB 3KYDB 3O38A 2YV3A 2PTGA 5ICSA 4ESOA 1AHIA 2HSDA 1Y1PA 5CPBA 3JD0A 2QYTA 1P1HA 4EW6A 1CETA 4BGUA 5U9CA 1PJ3A 1EUDA 1JWBB 1BW9B 1OC2A 4J1TA 4YCAA 1U3UA 5B1YA 4UEOA 2WJPA 3TFQA 3ZWMA 3Q2IA 4KUHA 1NQ5A 4XGNA 1KOLA 1DIGA 5JDCC 4NH4A 4PLTA 3GHYA 3ICPA 3OEWA 1DBVO 1SAYA 5T6BA 4XDYA 3K96A 5KKAA 4NJMA 3V2HA 3I6IA 1NYTA 1LI4A 1MX3A 4OKIA 1YBMA 3DOOA 1IYZA 2EJVA 4RCVA 3CZMA 4CLEA 3F4BA 4PG4A 3W4IA 1U3WA 3AY6A 4PIVA 3QVTA 2Y93A 2IEDA 1HSOA 3A9WA 3I23A 4YJFA 5EJ2A 3WQRA 1GEEA 1MGOA 3RUHA 4CMCA 1Z45A 3G3EA 2NU7A 3HFGA 2FZWA 3M1LA 1HDOA 1EFLA 2EKQA 1YONA 4PVCA 1LC0A 1VJ1A 4QFDA 3EC7A 3JQGA 1LJ8A 4BNVA 2WYUA 1IUKA 5B4TA 3GN2A 1QYDA 2D2IA 1XHLA 3GT0A 5DOVA 2E48A 4J9VA 1KY5A 1CF2O 4YAJA 1V3VA 4E5YA 4PLGA 5H83A 1W0CA 2O3SA 4DPKA 1O6ZA 1NPYA 2IXBA 3FNHA 3OICA 1Q0LA 1NAHA 4YYZA 1J5PA 2FSVA 1N8KA 2DBVO 4ITUA 4LVUA 4BVAA 5JCJA 2RHCA 5JW6A 3JCZA 4I1IA 2VQ3A 3IJPA 1ZMOA 1DJQA 2X4GA 4CM8A 3H3JA 4LGVA 4EJMA 1ZEMA 3HB4X 1GR0A 1XQ6A 1ZBQA 3CMMA 1M66A 1P9LA 4N5NA 3GF4A 1WZIA 3FR7A 3DL2A 2X22A 2DFDA 2JAHA 2O23A 1BXKA 3RQSA 5FWNA 5L3ZA 1ZNQO 3GFGA 1FJHA 4IIUA 3CE6A 4OSPA 3NDIA 2DQ4A 5HA5A 4XB1A 1BVRA 4MOWA 5CEEA 1YH3A 4BGEA 2E82A 4WLEA 1EK5A 4MKXA 1Q1NA 2EW8A 2OXIA 3PDUA 5GZ3A 4A73A 3OFSA 4K28A 4XJSA 1YXMA 2GRAA 4MPDA 1DHRA 2OGUA 1EEHA 2JCYA 3ANNA 2I3AA 3WX0A 1TEHA 4CMAA 2EERA 3C1OA 5IDXA 1WDLA 4O59O 2ZTMA 3I9KA 3RUFA 1SB9A 2WYWA 4QQRA 4O0LA 4R51A 2YW9A 3I9MA 4D43A 5IZ4A 4GSLA 1QXSA 2A4KA 3ORFA 3AM4A 4JJFA 5IXYA 2G17A 4DA9A 1GUFA 1KC3A 3QSGA 4DLLA 1E1KA 4XKJA 2EP7A 1VI2A 2UVDA 1QP8A 3C24A 3IIEA 3HWRA 3OIDA 4B4WA 4CV1A 1A9YA 1QLJA 1EDZA 3JQBA 4J7XA 4E4YA 5CDUA 3AOEA 2AEMA 4BO4A 4S3MA 5CEFA 3OECA 1ADFA 2C0CA 4EJ0A 4LCJA 1XLTA 4M8SA 4Q3EA 1ZK3A 3DZHA 5JE8A 4UVIA 5C7LO 3K9QO 4QT0A 3OIGA 3TDKA 1D1SA 5IAAA 1KEWA 3PIIA 1B8VA 1LU9A 4FJ1A 4CMJA 4GBJA 2PKQP 2X86A 3KVOA 2R6JA 1AUPA 1ZXBA 4YQYA 1Z7BA 1P74A 4IJWA 4P22A 3DTTA 4DYVA 1E6WA 2H9IA 4OHUA 2AA3A 5THKA 3GRPA 1OI7A 1ZJYA 1MA0A 4MVJG 1PGPA 3VPHA 1R0LA 4W82A 3ETDA 4WJZA 4TRMA 2BELA 3B1FA 1A71A 3V1TC 1U7HA 3WYBA 2PKRA 3JQDA 1NBOA 3FN4A 1QYVA 3E9MA 1AHHA 4MKRA 3KLMX 3ZV5A 2QW8A 3BA1A 1V3UA 1KEPA 3IC5A 1CEQA 4XYMA 2WE8A 2DPGA 4PLHA 1SPXA 2AXQA 1YDWA 2VRCD 3NJ8A 4RZHA 1Z73A 1P45A 3JQAB 3OQBA 1O8CA 4YRAA 5ITWA 2I67A 1B0AA 4J2HA 2XPCA 4LVCA 5ER9A 1WVGA 2POQX 3E8XA 3RC1A 1M2WA 2UAGA 4YT5A 5G4KB 1VSUA 1Z74A 2AEFA 3G79A 1AN9A 3ZV4A 1O95A 4KZPA 1I3KA 4J9UE 1PL6A 1PJSA 2D5AA 4BO1A 4PLVA 3ZW8A 5T8KA 1PGNA 1E3JA 3MZ0A 2PD4A 1O89A 4FBGA 2WSBA 4KWIA 4XYEA 3V1UA 5F5NA 3FHLA 1GV1A 1NASA 3L9XA 5JY1A 4BKUA 3DFUA 2NNLD 4AJOA 4QTZA 3WOHA 3L6DA 1U2GA 3UAGA 4MKZA 4YJHB 4EEXA 4L8VA 5L7WA 1ZUD1 4O63O 3NDJA 4PFJA 5KVQA 1MC4A 2ZB8A 3DQPA 5IZCA 1P0FA 2E37A 1C3VA 4RPKA 4CQMD 3SC6A 3H5NA 4TRNA 3IOYA 4AJIA 3IKVA 4M86A 3SX2A 1Y8RA 2VOEA 3ZWYA 3B20A 3JYPA 2D3TA 3HUDA 4HV4A 1DIRA 3E9QA
chains in the Genus database with same CATH superfamily
1XDUA 1TKBA 1WXFA 2XNHA 1Y8QA 1WX1A 4Z4QA 1YV9A 2JI6A 2ZUDA 2JI7A 4UCWA 1XWIA 2JF0A 2KBEA 4YI5A 3K32A 1YMUA 4F86A 1VB3A 4FNMA 1YC5A 1N0WA 1PUXA 4A8PA 5BXQC 2C4VA 2EL7A 2A78A 3LVBA 1SURA 3B82A 3QGMA 5I4KA 3QOXA 2Z95A 4YA6A 3R6DA 3TLZA 2WAXA 4XB2A 4L6IA 1QAOA 4M89A 1VGRA 2HPVA 4CL3A 4Q9HA 1PUJA 3CUTA 4CCYA 4TWRA 4D3FA 2E4YA 1R66A 1LWNA 1TO6A 1VQ1A 5ENDA 4YH1A 1MLDA 5BXYA 1W581 3FKSA 4JCOA 5HTKA 1FYEA 3KXLA 2W6NA 3V7UA 3WJAA 2CSXA 2Y05A 5JAOA 2A9QA 2XXAA 2ZUBA 2Y0DA 3LTEA 1WW3A 2NIPA 3KYCA 1SGWA 1EFPA 1Y37A 2XCLA 1XMXA 2Y1EA 2YZMA 3E6AA 3GHHA 3KNZA 4HDKA 5EZQA 1A1SA 1A95A 1LSUA 4RU1A 4EFLA 2UUPA 1U0OC 1ZCFA 1EFTA 3KPJA 1XTZA 4F9TA 1O94A 3QUSA 2OP1A 1UMDB 2XTAA 1TYDE 2ZETA 1QG0A 4IQGA 3SJ7A 4IJVA 3FNEA 1OILA 1HT1E 1UADA 1YVPA 3VO9A 2XNKA 4YQEA 1SEPA 1PSZA 5FP0A 2V9PA 3D8SA 1EZ1A 4TT8A 3WHPA 3KCNA 1M6VB 3V5NA 1CS0A 1SC6A 2KQUA 1GXSA 1UEIA 4MB2A 5E4JA 4BV9A 1O6CA 1KY2A 2DKOA 3I2YX 1KIAA 1QH1B 4PYNA 3JVDA 3S1LA 3NDBB 1KJQA 1KKMA 5I5GA 5KX5A 4EA6A 4ALMA 4F2PA 4DT1A 4LDJA 1RPNA 2Z2JA 1EGVB 4P4LA 3TUIC 3FRIA 2TYSB 3REOA 4EZIA 3RJMA 4PN7A 3HK2A 4MV5A 4KWCA 2Q8NA 1K0FA 2GM5A 4OA8A 1AV6A 4JJ8A 1OC4A 1I4EB 2ZSEA 4X20B 1UWVA 3PICA 3A9VA 1CR6A 4ECEA 2P3SA 3CONA 4Z0TA 2YZKA 2JFHA 3DEYX 3MG9A 3KKPA 3I76A 4GWLA 1MUUA 5CT9A 2BCEA 1BS1A 2VJCA 3AERB 3AYZB 3C16C 3UMGA 1PJLA 1OKKA 3NJRA 1R00A 3E3AA 3B78A 4OAPA 3UUEA 1U0FA 2XCUA 5E6SB 4NYJR 1KYXA 5EESA 4Z6KA 5BPFA 1U6IA 1V48A 3N1UA 4HDNB 3TLGB 2W6CX 4LF6B 1FXSA 1ML3A 4X54A 1CRWG 2JFFA 5TGTA 2A4MA 1DO0A 4HNGA 1BW9A 2Y68A 3KT3A 5FBQB 3W6ZA 4LDZA 3MJEA 4W1QA 3ZV3A 1ZSYA 3Q0IA 5HVNA 3CURA 1Z4PX 2OT3B 4B6JA 4Y2QA 2IRWA 2QVZX 1F1JA 1Y6QA 2DF8A 4LJLA 1SBNE 1XV5A 3MFQA 4RTJA 3R77A 1D4OA 2NU8A 6LDHA 3WNQA 3LVQE 4PYIA 3NWPA 2JRLA 1P3JA 2OCDA 1BH6A 3L8CA 3DT8A 3QITA 3D8TA 3P96A 5JU6A 1EGQA 4AECA 1RM5A 1DADA 5T67A 1Q84A 1DTWA 2J6BA 2RGGA 2YIVX 4PZEA 4ZCSA 1TEZA 1N9KA 1X7ZA 3R9XA 2QRGA 2P4EA 1BJRE 3DBRA 3DZ8A 3I53A 1UP7A 2WDZA 3NOXA 4OBEA 3BE8A 3SWWA 3A1DA 2D7JA 3VZRA 3GUZA 3NM6B 4G0VA 3A4YA 1RABA 2JLBA 2PUHA 3H8WA 4Y9UA 4EUEA 3IDOA 3JYQA 4LYDA 2JVIA 5BN3B 1ZD2P 3SJUA 3P0FA 2IHNA 1LRLA 1SCUA 2BDUA 1GPLA 2EGUA 1P33A 5AP9A 3B6IA 3SF0A 1AS2A 2BMFA 1M2FA 1E66A 3OTQA 4F2WA 3R2JA 1TM5E 2BDTA 3OX3A 1OH5A 1B16A 2IPXA 1QQBA 2QJRA 1F5SA 3OPYI 2LD4A 3DTVA 3H4MA 3LP8A 1J90A 3PKJA 5CYPA 5GPBA 3ROXA 3TZCA 3UK2A 4B6PA 4EHHA 3GN1A 2I1QA 3WHKA 1WEKA 2Q5CA 2PUAA 4P4TA 1DPFA 1YFKA 4ZDIA 2F3TA 1IH8A 3ANSA 2ACWA 1H2AS 4N6OA 4PGAA 3TQFA 2W6IA 4DA8A 4ZI5A 2VTVA 1T3ZA 4B7UA 1HPLA 1X39A 2H85A 3EVBA 4BV8A 1P0IA 3RC2A 4DJ5X 2VJQA 4E5PA 5IS2A 3HM9A 1Z25A 1XZGA 3P9KA 2BI8A 4MQBA 3KZ1E 3P0EA 2XOXA 3WYDA 5CAEA 4RTSA 4TZ0A 1QG2A 1SUWA 1ZUWA 3INRA 4K2AA 1BFDA 1OXTA 4JH0A 4KODA 1EK6A 1E63A 1ZA1A 1ISFA 1YMQA 3TX2A 3ZR4B 1ZM4A 2JFYA 4QDZA 4BU1A 2OKGA 2VDQB 4OGWA 4QQKA 3QA9A 4OAQA 5CIWA 1WU7A 3OZIA 3FYDA 1CJBA 4DC9A 1E32A 4I9HA 4OGKA 4U3JB 5JIBA 1NATA 1KZ6A 3CKYA 2AFIB 5BUSA 1LA2A 2E5FA 2OXEA 1EUCA 2HNKA 3W6NA 2OCIA 3IHWA 4LBZA 3ZU3A 3PXBA 1FYDA 3GJ6A 3USZA 2B37A 2EQBA 2ZIWB 4RFSA 3T7TA 2R4TA 5BORA 1EGAA 2LCIA 4R69A 5BW4A 1OA1A 1ZK4A 2IKQA 2SKDA 3CF4G 3VNAA 3I01M 3O94A 3MLEA 4KN8A 4JWKA 5D7BA 4DLNA 4MI1A 1VDZA 3GQBB 4HAOA 1KYVA 4I3HA 1SBTA 1W87A 2QGFA 4ACAA 3UTDA 3UZUA 1M2OB 2VJNA 1BS2A 2HC9A 2VYVD 4YP5A 2Y9YA 3IQGX 3R9KA 2GDJA 1ACMA 1DDIA 3F9CA 2OHOA 4WVFA 5K0GA 1WHSA 2XCRB 2GERA 3DEAA 3PDIB 4PLCA 3KQVA 4EYOA 2H0AA 1NDHA 4Q7EA 3B38A 4C6RA 1TGVA 4IILA 3N2EA 3ADOA 1U0LA 3IEMA 1I0IA 1KI1A 3KQQA 3O1JC 1FZTA 1WMDA 3LHDA 1VM6A 3CGGA 3CZ5A 4UBJA 5FQOA 1MW8X 5J5CA 3T1QA 3OH8A 1G1MA 1Z6ZA 1DG1G 2GTPA 3HJHA 3L6RA 3K9HA 4UHCA 1AB5A 5EIHA 1I4LD 1R4ZA 2IHJA 2Q1XA 5KNBD 4URYR 2F8LA 2WHEA 3LLVA 4WY8A 2QN7A 3UEOA 3UY4A 3W1VA 1HM5A 4TUYA 4AO6A 3C2QA 1QO7A 2RAPA 1EXMA 3WRWA 1X7YA 2IHBA 1IXKA 4BN0A 4Y6QA 1H6CA 1KEUA 2AR0A 3V3TA 4C7JA 4G9GA 4N12A 2EQ5A 2C5LA 2YJNA 1JT2A 1EVKA 3AF5A 3DMTA 1PFGA 1KVSA 1Y4DE 3OE7A 4XLLA 1GLGA 1QOPB 2QAGA 3GBVA 5T5QA 4BO8A 2G25A 4ZTUB 1FRQA 2ZS9A 3INTA 4YHBA 5PNTA 2QL9A 2FP4A 1FNBA 1XVVA 1NV9A 1K75A 4BNMA 4FFBA 2ETXA 3M6MD 2WRZA 1DCTA 1USWA 3X43A 2Q3HA 4TUYF 5CYGA 4ZD6A 5DNDA 1VKOA 2ZULA 2Q7XA 1JLHA 3CH6A 3AHJA 3KZKA 2YBEA 1MCZA 1WUIS 4MRVA 3EDCA 4Q3CA 5CBPA 1R0BA 2YH2A 3L8GA 3OC0A 4XTRA 1FW8A 3IELA 1YZUA 4H7FA 1RKQA 1SKYE 4CFSA 1KO1A 2Z3ZA 2Y0CA 1ZM7A 3LYLA 3EEBA 2NTJA 3PEFA 3C3YA 2ERCA 3BIOA 4G85A 4RMGA 5EIFA 3TOVA 5A62A 2IZZA 1DQZA 1HSZA 4Z9XA 2CJFA 3AY0A 2M1XA 4YAUA 2WU3A 3PGJA 1OH6A 1JV2B 2UUOA 3EZ7A 3R5TA 1J1IA 3PGMA 2WA1A 3CVOA 4JC8A 4XPIB 3REQA 2FN3A 3HEMA 1MABA 4BMCA 3AY3A 3MRXA 4EFKA 2Z8YM 3KAJA 2QJTA 4HYYA 4MAFA 2OXTA 1BDBA 1EBBA 2V3VA 3NO4A 1RXUA 3NHAA 2PUCA 2TECE 1UMKA 5E7QA 1T25A 1C2TA 3KXDA 2OBYA 5JAHA 5D1HA 3RSFA 3JQQA 1C14A 1VRWA 4NMHA 4CUZA 2XKKA 3A27A 4CV3A 2WM8A 1YJ8A 2QN1A 3KG2A 4TLBA 4TTJA 4V2IA 5TIIA 3TZBA 3SSMA 1Z07A 5KOHB 4MRSA 2E1PA 1L8XA 4OUDA 3ENNA 1DUIA 1JH9A 3OEHD 2ZYAA 3C4VA 2R1UA 1RWVA 4HLUA 3W9YA 1JFTA 5AFSA 2X3UA 3GLUA 3RASA 1FRNA 4DA7A 3LTNC 4W99A 1RWNA 4CODB 3SVTA 1H22A 4J7AA 1E99A 4NECA 4JKIA 1CE8B 3AR2A 4G0PA 4KKVA 4P3OA 2IYFA 5AHWA 4JLMA 5EJMA 1ZD3A 5L3QB 2O8DB 4OOFA 1JAZA 4OKSA 1B14A 1Y5RA 2YDXA 3HJAA 4G2TA 3V2UA 4MUKA 4GKBA 5KO2A 1HFEL 2D5LA 3LV8A 3KR0A 4LSGA 1YZYA 3ZE2B 4ZK2A 1JNYA 5FUYA 3MTJA 4ND1A 5HQJA 1HYGA 1VL0A 4HUJA 4AUNA 4DIDA 1FPQA 1GPAA 4GQIA 3OAAA 4R3WA 2CNLA 3CX8A 4F2HA 4Y1RB 4QECA 1BHJA 5FBKA 2FY8A 4MPJA 3L4KA 3L6OO 3ELYA 4ZK6A 3FIUA 4Q7QA 1UT8A 1UZUA 3PNMA 1RVDA 1VIVA 2KI5A 3EGDB 3EXFA 4HFMA 1I24A 1Y7TA 1SBHA 1VPWA 5KHAA 1C9KA 5K0EA 4L3VA 1IZ9A 1WQ3A 4HHEA 4O4IB 3JD1A 5LZ7A 3G1UA 2FK8A 3D3JA 3EWIA 5ICCA 3AKDA 3LL4A 1RI4A 1BU5A 3ZU2A 1K8ZB 2OBLA 4YJ2A 4PYLA 4I2NA 3A3NA 4BWYA 3FSRA 1DAEA 3GNTA 4ARVA 3C3AA 2UYYA 4IJQA 4F6RA 1BXRA 2LR0A 3K2BA 3HBAA 4FZ5A 4IS2A 4ZPJA 3F5MA 3ZCPA 4JFAA 4W7HA 1Q1GA 2XY4A 1DFGA 4X1IA 3TXYA 4Y6RA 4RA9A 4Z8YA 1UZMA 1JU4A 2AEEA 4O8CA 2PL5A 4WZZA 3WO1A 3QEAZ 3PFFA 4Q1VA 2A3NA 1KHHA 2CYBA 4QOFA 4JMLA 2PMCA 4NKRA 4AJLA 3AM1A 3MWEB 4BRWA 5JS7A 1NXPA 1N1GA 4EUKA 5DBIA 2IZ6A 3VKFA 4X91A 2GBLA 3R7NA 4QXAA 2IZ7A 2BGIA 1GKYA 4PAOA 3ASUA 4XUGB 4YJ2F 3L1IA 3DYIA 2P5UA 3PE4A 4F8JA 1ZJWA 3CTVA 3W5AA 2AOVA 3HDYA 2ZLBA 3D6VA 2I99A 5CM8B 1DXHA 2RJNA 2HRQA 3GRYA 4TWZA 5ALIA 1K66A 4R2MA 3HL4A 2PGJA 5CX4A 3C7CB 3QMPA 4RJLA 5FBZA 2C2HA 1ZYUA 3WGLA 2UXCB 2PSJA 1F0KA 3JYNA 4YLEA 1P2SA 3INYA 1II9A 2JDID 4QNRA 3ZGVA 1DOHA 3PDWA 4KOEC 3COSA 1FJXA 1TRHA 3H6KA 1EYZA 4G4SO 4P34A 1KK1A 1AO0A 1T8SA 3ACCA 3H86A 4IJMA 3QNUA 2OCLA 4KHZA 1YQTA 4IICA 1DEXA 1QHIA 2AFHE 4KGVA 3SQNA 4OHZA 5AT1A 3ZUPA 2IBSA 4BFSA 2BMDA 2F00A 2Y3IA 1ILEA 1L4BA 3HUTA 3BXGA 4D9KA 1SXJC 3TW6A 5EZYB 1Z0AA 4GUDA 5DWQA 5BNWA 2HK7A 4ARZA 1PLKA 1Z68A 2NZUG 1MEJA 1XZJA 2ARKA 4HWKA 4TKMA 4X7BA 5DO9A 3GMDA 5BYJA 3HI6A 3RNOA 3U4DA 2CVOA 1CVRA 3EISA 3GROA 1CUIA 4B82A 2HT6A 3AEUA 3CLTC 3I92A 4MR8A 2CL7X 2VAWA 1JDBC 4I36A 4PAWA 1ZU5A 1JXAA 5ELXA 3JQBC 1DE0A 3GZNA 1X9GA 4B7XA 4YUXA 3BL6A 2DLNA 2BSXA 1ISIA 4I4NA 3QX7A 4W1PA 3UV7A 4AZSA 1VA4A 2R2GA 5AKJA 1Z3IX 2YWXA 3BF8A 1J9GA 1PG0A 4OQDA 4DCGA 2PBRA 3TKYA 3DW3X 1Z56C 2PGDA 4F4JA 4N3BA 1UF9A 1VFNA 2IVZA 4FDAA 4IR7A 1I6MA 1XVIA 4RS3A 1C0IA 1ZITA 2YXBA 3BHIA 3Q3EA 2D1QA 3H0CA 4OL0A 3T52A 2F3QA 4CMEA 1CIPA 3KVRA 1NXWA 2O3JA 4EF4A 4B5LA 5I9NA 1E2JA 4LJKA 1WR8A 1X8KA 1M8PA 3ZJYA 4GX1A 2CLEB 2NO6A 3GNQA 4KTTE 2ODEA 4ONEA 2ECFA 1ZJJA 4B4KA 2QE6A 1X0VA 3GEPA 3IUPA 4TTSA 3SIWA 5HKOA 3ET5A 3KM0A 1ZD9A 5FI3A 3ZWQA 1NR7A 4OQLA 5DTJA 2A1TR 4OPMA 3A4LA 4KI0A 1WUYA 5AHOA 3UWPA 5J5VA 1RBYA 1TECE 3TGLA 1U8FO 4B3IA 1XDZA 4CEJB 4MINA 1X13A 4RC9A 3O8CA 5IASA 1YR7A 5JSZB 3BB1A 1PEKE 1UT5A 1XMVA 2YJ4A 3FYUA 5BT9A 4CTMA 1CZOA 1YA6A 1RRGA 1XHEA 5KNBH 4LFBB 5C1IA 1RAAA 2PZGA 4WECA 4QULA 2PX5A 3FPFA 4F5ZA 1AK2A 3TJMA 3WL8A 3L6CA 3QJYA 1YR1A 2QR5A 4LJ9A 4DSOA 3NBMA 1KQGA 3PLNA 3EDRA 4YMVA 1RJDA 1R4NA 3KP1A 3EG5A 3SC2B 4WCVA 1UWKA 2RJOA 2DBQA 2GXUA 3O26A 4NU8X 4V24A 4BATA 1T0PA 4B6SA 3R0XA 2VRBA 2RD2A 3GCDA 3VDMA 3NXSA 3C5HA 3JQAD 5F4BA 2R6HA 2A7QA 1QR6A 3SE7A 2ZPTX 4BLOA 3BSWA 3PVSA 5E95A 2DQZA 2PGOA 3QLVC 8MHTA 5EHNA 1PJ4A 3OFND 2YQZA 4TLMB 1MG5A 4W5NA 5T8KC 3IV9A 4KSBA 2K5UA 5L3RA 1EWKA 5G2OA 2LV8A 3SKVA 5IVDA 4AFNA 4MV3A 3IMGA 1GZ5A 2WWYA 4C7KA 5KEIA 3ONNA 2B7LA 3ZYZA 5DM1A 2FPGB 1CJCA 3R1IA 2TMKA 3FCXA 5K6TA 4WY2A 2BLNA 1I14A 4QGBA 1Q77A 2XYRA 5CNJA 2J3JA 3CN9A 1E7WA 1AKYA 1VXRA 2O0KA 2YTZA 1KJNA 1A5SB 1K7XB 1RWOA 3AJ8A 3GCZA 4KYTA 4PC2A 5DDIP 3CLSD 4RPGA 3HXOA 3IT0A 1AKNA 3HQ4O 4MVJH 3TOSA 5H3CA 1Z4QA 4KC0A 5EJGA 2QJFA 2PX0A 2XKBA 3CLUD 1G1AA 1V8FA 3T61A 2OHHA 3Q40A 4YGYA 1KI4A 1U8EA 4KWEA 1ICIA 1KY4A 4ISCA 5CLLA 1RYZA 3FYCA 1D9ZA 3AJEA 4TLDA 3K5PA 2VYFA 4NHOA 4I5EA 1V16A 2PVPA 2YNMA 5ESWA 1GYRA 2CZQA 5BN1A 1JEQA 3KPUA 5IF3A 5EOVA 5K8UA 2QE7D 2PH5A 4M1SA 2HQBA 2FPUA 4ZQHA 3UUGA 4GPTA 4OJQA 5A4KA 4H7IA 4RIEA 4DCNA 2QVLA 3E7WA 3MHPA 3R5SA 4LS3A 3SIRA 1I0LA 3RBZA 2YYZA 4KE8A 3MBOA 1KQOA 3KL2A 4GU5A 2AT1A 4DUPA 3A3PA 3Q3IA 1MJFA 3D7SA 3QLJA 4FKMA 4YCMA 1H69A 1O9GA 3BRWD 1W5AA 1HO3A 1TDJA 1BH2A 1L5HB 5DYYA 2M6LA 3UKOA 5MN6A 1AD2A 2WU8A 3A2KA 4M1YA 3I9NA 3V1YA 3R7DA 3HADA 1PR6A 1UDBA 4GLBA 1KAEA 2M9MA 4ZVTA 1GPYA 1N7GA 3AZPA 3UMYA 3UV6A 2QWXA 2C3PA 1W0KD 3FWPA 4J91A 4MGZR 1Z22A 3MUEA 1WSBA 4I50B 3FX2A 2FE4A 1G21E 1R6DA 2ZUSA 4CLHA 2PRJA 5FXMA 4Z5XA 4IQ8A 3X1WA 5T4HA 4BMPB 1H4QA 3EAFA 4C07A 4HWTA 1E9AA 2KSQA 3DC7A 3U0BA 3FOAA 5KYTA 2W4QA 2ZR8A 1U81A 1SCJA 5DRTA 4UHDA 2D7DA 4RD2A 3P2OA 3DCNA 3E58A 1UC4B 1FTWA 4D9FA 4QPZA 3K73O 4QOIA 4IQ4A 2Q5QA 4PYKA 2VXOA 4WXMA 3RUDA 4PYQA 2EC5A 2KLHA 4NPHA 1V9LA 1F06A 3VTFA 2HF8A 4IXTA 5F21A 1DO8A 1G3RA 2E4WA 3K09A 2GHQA 2HH9A 3OLXA 3PNVA 4YRBA 4YONB 4B80A 5JEDA 2WFLB 2AMJA 1U7PA 5J43A 3BCSA 7REQB 1I4WA 3F4KA 3RTBA 3D7NA 4M1TA 2J7PA 2VWPA 4UMVA 2NOGA 3FPAA 3V6MA 4OLAA 3BE4A 2EGGA 4PS1A 1RVV1 2VJPA 4J0CA 1PFVA 5IFKA 1F12A 2NUPB 4W9NA 1RU3A 3LK6A 4JKYA 2ZYRA 2IDJA 2VP5A 4JHXA 4AIRA 4U7JA 4DRYA 3VVLA 4CDGA 2AOTB 1A98A 1B6RA 1CJVC 4QJ4A 2SKCA 1J97A 3OI7A 1K7YA 1LBTA 3Q0EA 3OPNA 4BTLA 1PNTA 3U7IA 2TMYA 4L27A 2QN6A 1HEIA 1H9AA 2B1JA 3AUUA 3HBMA 1I4DD 1D2RA 2A0KA 3C3WA 3KCQA 4KG7A 3QE9Y 2PR2A 1AKUA 1P4GA 4PYOA 1OB5A 4V3BA 1M2KA 3EOBI 3LQ2A 3W8FA 4QQFA 5JS8A 4KBGA 2Y9ZA 3N2YA 4EGQA 5IT0A 1Z4JA 4X3CA 3EUFA 2FWPA 2QROA 3PGVA 4CIWA 3ZHOA 4CM5A 4Y6PA 3UHAA 4NJEB 3N5KA 4FP9A 2XV1A 2ZCVA 2PWZA 2DTXA 1Q91A 2XXJA 2GK7A 1FVHA 1ZRNA 1L1QA 2TS1A 5AXBA 3G8BA 2NADA 2O1WA 4L8WB 3VSDA 4C4YA 4WZ6A 1GRNA 1EK1A 1ZD5A 5TS3A 2V5AA 2FSUA 4UAVA 2Z6AA 2I1LA 2JK0A 4DV2B 2J3MA 4XW2A 1TYAE 1R0WA 2XQIA 4QTTB 1EESA 1ORRA 4UUOA 5GGXA 4PPYA 2J3QA 3LC0A 4PZLA 3K8OE 2Y77A 4X8LA 2AX3A 2O8BB 1DBIA 1SVNA 2XA1A 4NYMR 2IWHA 2O8CB 3RS7A 2C7OA 1IBCA 1ZNYA 3FYTA 3KXIA 3Q7SA 4XEHA 1VGVA 2WJWA 1OREA 4BXOB 1XZIA 1K7SN 2ZRMA 1T4GA 3BQNB 1EX9A 1TT7A 3N0VA 4LJ6A 4X1YB 4DFDA 2BSQA 2UUCB 3K35A 1C3EA 1T5SA 3CNNA 3JQ9C 3WHLA 3DW1X 5IJ9B 3U5ZB 4FWTA 4XA8A 1W2GA 2NT4A 3ASZA 3KAQA 2O2JA 3BB3A 3LMKA 3H9QA 1XN1A 4BN5A 4ZYTA 4R9UC 4ETIA 3L0PA 2C5EA 3IAAA 4TMFA 5HKKA 4R9SA 1B7GO 1T2EA 1L7DA 2PFSA 5EJIA 3LX6A 1FU4A 2AVDA 2XVZA 2O5EA 4OBXA 4PLPA 1CWUA 1SHZA 4RK1A 1EVQA 2WF9A 3IBYA 1N8NA 1RRPA 1XGKA 2YRFA 3QK7A 1PJ8A 4RKRA 4CLRA 4KR6A 3KKQA 4J0HA 3HXMA 2KBFA 4FUTA 1DNPA 2JHFA 3RJ9A 2H51A 5FORA 2OG1A 2NTNA 1LV7A 2R00C 2Z57A 3KKOA 4OXYA 1GA6A 5DULA 1P5HA 3MMPA 4GBGA 4K81B 4REQB 3O9VA 1JQEA 2NXCA 3HXQA 1ZIOA 1FSSA 1JMKC 3ZGYA 1TQ6A 2XCIA 1WD7A 2DWQA 1ZVKA 3PJEA 4LF4B 4JQSA 3PNYA 3S70A 4FS8A 3LBYA 3NHBA 3V8VA 3CVWA 2XBMA 3LZ6A 4XCXA 2ZQYA 2PMBA 2GLXA 3G2PA 3OZXA 2BBOA 2O8VA 3C70A 3B3JA 2WV7A 2OD9A 4R7ZA 4OO3A 5L40A 2C2ZA 1GY8A 1AQIA 1A5BB 3STTA 4DB4A 3LL7A 3IQEA 4E1AA 3I52A 1ISJA 3KSMA 4L0CA 4M4SA 1REQB 1FC0A 5AESA 3U6KA 5LQAA 4M76B 5EJAA 3T4XA 4O4HA 4DR6B 3IB3A 5C53B 3LUAA 4BNNA 5AHKA 5KNCD 4WZAA 4JDUA 4PRZA 3K7EA 1V7ZA 2QZZA 4A8HA 2V8OA 1IJKA 1MEEA 1MNQA 1FFSA 3BK1A 3I2FA 3DG9A 4LEIA 3MTIA 3F3YA 1SXIA 2H2AA 3NTRA 1K08A 1B0PA 2BZGA 3QU2A 4UEQA 5KI6A 3ZY6A 4ATNA 1RWMA 7MHTA 4MARA 2GCOB 1QANA 3A4IA 3BMCA 5KAPA 3HCFA 2HT1A 2BFFB 1SG6A 1TC2A 1YCDA 3E9YA 3PF8A 1QIDA 4QUHA 4G5YA 2X5KO 3TIVA 3AQIA 3ZCQA 2CJPA 3UAWA 4HQNA 4RDCA 1JIVA 3HXPA 4WGFA 4WSOA 1XKLA 3KKLA 1RQGA 3UJBA 3EGEA 4UCQA 4O4HF 1HC7A 4XXHA 1BIFA 4Q9IA 1X38A 3R3VA 4IIYA 1ZZEA 2ESRA 1JW9B 3C85A 1PHRA 1N6OA 1LXCA 4LSMA 1P2VA 4L22A 3THXA 2A9RA 1DPGA 3T0GA 2WMDA 3S8MA 3V3KA 4DIUA 5KJ1A 2YJ6A 3IPYA 3PI7A 3THOA 5AKXA 3B3FA 3NTQA 4LISA 4QO7A 1LFDB 3B6MA 4YP6A 4EHAA 3ZVNA 4IDCA 1TQ4A 3TAHA 5K9ZA 3S5JA 3S2EA 5KDOA 2JLUA 1VMEA 3CKLA 4C6TB 4AJHA 1XRQA 5EEGA 4LMRA 2VHQA 2X9QA 5EUQB 4HFJA 5KWEA 1K8XB 1IXYA 2R5FA 3FSJX 4OIMA 1VCIA 1DDOA 2PD3A 1MAWA 5ER6A 4QBFA 3DDOA 1ATZA 2AZTA 4DDWA 4NONA 1Y7PA 3DDCA 3CVJA 2RBKA 1LVHA 2QAGC 3I2JA 3OJ0A 4F7DA 3ZS8A 3DULA 2DH6A 4LJSA 4B2PA 5J5AA 5B1HA 2QTGA 5DRYA 3ZGXA 1E96A 3KWJA 3A2LA 2HBZA 5CFNA 1XE3A 2FOIA 2BBTA 2CXNA 3D3QA 4X95A 3RHSA 2P62A 3V4OA 2HV9A 1JDVA 1GPH1 4Q3KA 5BOVA 4EQZA 5HMLA 1Z2AA 4OXNA 4RJTA 4A8JA 1JECA 5IN5A 4AURA 3VO1A 4E7PA 3GCWA 3MWYW 1Y5IA 2ZKIA 2CKDA 3TR0A 4PBTA 3ISTA 1A5AB 2HWXA 3HGMA 1JLLB 3KJZA 4B76A 10MHA 5A0VA 1A72A 4JX8A 2GMWA 1L7QA 2DP4E 2FZ5A 1PR3A 4IFEA 4X94A 4GKKB 4DB2A 2IYLD 1Z37A 4H0NA 2OXFA 4JB0A 3FPBA 3UUFA 2WPDA 1MVOA 1RR6A 2X40A 3S27A 2FH5B 2CJXA 1Y6RA 2P1RA 1CS4C 2RI6A 1V2HE 1FYWA 2R11A 3I4LA 4MS3A 3P97A 4BCCA 4P86A 1X6VA 2IYWA 5FFMA 4TL8A 1TTHA 2VTDA 2Y6UA 5ES3A 4LOLA 2JCVA 4N7BA 3WYNA 4F21A 3VU0A 4D25A 3KQTA 1EBUA 3NVDA 4ZPXA 3ZHXA 2EYUA 1SOVA 2G77B 5CVCA 3COPA 3FWKA 2CUZA 3DMRA 3H8SA 4Q00A 4D8TA 5MDHA 2O5CA 3QTTA 3SS7X 1TE2A 2AC4A 1YZGA 1B73A 5TMEA 3CCFA 2FW9A 1G66A 3O47A 5F73A 2QLLA 2ZSHA 3P4YA 4M0FA 4G3XA 2QP9X 1USKA 4DCJA 1Z0IA 4BOYA 1FE8A 1PV2A 3OT1B 4FR0A 4IG4A 1T34A 4UW9A 4KBFA 3P71T 4KMSA 2EBHX 3AB3A 3B5IA 3OLQA 3PCXA 2R3SA 4QBHA 3U9TA 1FDUA 2FQWA 2ERYA 1SIWA 4GR5A 5CCEA 3IJRA 4MMYB 4TKUA 4Z4IA 1UBKS 1ESMA 1LNQA 1T3LA 4KX5A 4JOBA 2I3GA 2N1BA 5IFLA 1S2LA 2GPBA 2Z5LA 1YC2A 1Z2PX 3GC6A 3WP0A 1Q11A 2C0PA 1LW7A 2FG7C 4YECA 2PY6A 2LDXA 5DTQA 4MPPA 1UZNA 1G3UA 2Q6OA 1EINA 4G1FA 1CU1A 2ZDHA 1BE0A 1V8BA 5AIBA 4AZTA 1U0RA 1E4EA 4E1BA 4P5EA 4QU0A 1KYYA 2JD1A 4ZRNA 3EQ7A 3TRDA 2Q3FA 3WWDA 3HVRA 1JB9A 1HK7A 1ESCA 4PGMA 1AO3A 1MOPA 2JGLA 4FHEA 1V43A 3HG7A 3N2GB 5K5EA 2VPPA 1LGYA 4QOGA 5DXAA 4E6EA 1ZMXA 1KYIA 3QFRA 2B7CA 4M1MA 2WHPA 4PIPA 2Z56A 3IBFA 4Q18A 4RL4A 4BNYA 2WVHA 1T4CA 1V6AA 2D00A 3AB7A 1ZUIA 1KJZA 3EJWA 1QF7A 3EOZA 2IVFA 2SBTA 4MVJE 3VKHA 4MCHA 1Z6AA 3QVVA 5ALGA 1TF7A 2OZVA 3A0UA 3NEJA 3UGKA 4PCUA 2Q7DA 3VGPA 4EPYA 1L5RA 4MV1A 4W1RA 5EUMA 3WHIA 3W1WA 4TT3A 1YZVA 4HH1A 4WWHA 4OY3A 5J1SB 1PYOA 4R6WA 3I1IA 4EI7A 4V1CB 1L5ZA 4YRIA 4YMWA 4FHZA 4ND8A 3A6EA 1YGPA 2XEXA 4I1PA 1ZUNB 3PQ3A 2EZ4A 4BNDB 4CCYB 4ENVA 1JQ3A 3LXUX 2P67A 4INZA 3RDPA 4AJ4A 1CQIA 5EEHA 4Y18A 3QLTA 4NEGA 4NABA 2XXAB 2RGNA 5FL7D 3IL2A 3KYCB 2Z5GA 3L6UA 4HATA 5EJ9A 1H8ED 3P45A 5IHPA 1G4HA 2B4RO 2RKBA 3EDMA 3NVAA 3WWOA 5KJ6A 2OCKA 2COUA 3FH0A 1Q0UA 2BTOA 2XD9A 3KWMA 4J29A 4U7TB 5CVJA 5M2QA 4AYTA 1D0IA 121PA 1EIZA 4RVFA 4CTKA 3F5DA 4EUHA 2GXAA 3IBSA 3H04A 4HP8A 1OLUB 3HVJA 4YJDA 1KIFA 1D2NA 1P19A 1OBFO 5A6VA 3EFOB 2JIRA 1GSOA 1Y7LA 3JQFA 5JPCA 1Y7HA 3EGIA 2WYIA 4KNWA 1NKSA 5EYPB 2J9XB 1Q7GA 2GEDA 3IT1A 2X9VA 2X0IA 1G8SA 4RV9A 1OWOA 4I55A 3GLIA 2QVYX 3BXZA 1NRWA 1KEEA 1IN8A 5C4MA 2D5CA 4L50A 1C9NA 5EI5A 2X2EA 3ILSA 5AI0A 1UAAA 1TEXA 4RHYA 3JQEA 5KX5B 2XJ4A 2GPNA 2XITA 2ISSD 4BBPA 5EAIA 3QLUA 3ZHVA 2IU4A 3U19A 1M1NB 5FH9A 3NYIA 2I2AA 3NRCA 1KF0A 1LI5A 3M83A 4M21A 1E3LA 2C7GA 2CHEA 3M6LA 4KBYA 4IZHA 5GOZA 2B2XA 4AG5A 3IKLA 1E4OA 4HH3C 2F9LA 2R60A 3ZHQA 1GU0A 4UU7A 1A9SA 1D2EA 3NALA 3KAKA 2VT3A 3Q87B 5CVDA 4JP3A 4I55F 5JXHA 3AW9A 4FS3A 3ZVRA 2OV2A 4A6PA 2PRIA 4GYJA 3ZGNA 1SUBA 1QZUA 4X1KB 1THZA 1RSZA 1W94A 3DFMA 3FCYA 4XD7D 5JCOA 5HM8A 2JCXA 3O0DA 4HOYA 3QKSA 4IAOA 1MU0A 3DZDA 5EPUA 3TL2A 3WDMA 1SC9A 2F4VB 4QVIA 4NMXB 4URXR 3UHOA 2EIHA 2CEKA 1KDOA 3KEOA 4N3NA 4WERA 5FPQA 5SY4A 3A9CA 5DTEA 5IC5A 1XFAA 2ZPUA 4NCXA 4WVLA 3L8YA 4J6FA 4MGYR 4HN4B 4DIEA 1W25A 6GPBA 2HAEA 5BOSA 2FA9A 3J7TA 1PRYA 4JN6B 5DHUA 5DLPA 2OHGA 3K5HA 3FLMA 2B8NA 1QAMA 1KORA 4JJAA 4CN8A 1DLJA 3T3IA 3KJFA 3H5OA 3QE3A 4WFKA 4RTRA 1WPQA 3BMNA 5CGQB 2QBYA 5KPDA 4TQGA 1QGDA 1L5OA 3VTZA 4RMHA 2Z5FA 4LZWA 4N5LA 1SUIA 1XEWY 1GOTA 1DTWB 5A6SB 1Z6QA 3H2KA 3S2YA 3U3DA 3VBEA 1Y3DE 4IUCS 5EWMB 5JWHA 5KVSA 3RVPA 3OJXA 3ED5A 4X6LA 3TRFA 3WGUA 4ZTZB 3LDFA 2RBEA 4ETMA 3DBRB 2W48A 5DXFA 5IW8A 3VM6A 4BUJA 4ROSA 3DWEX 2JCGA 1RCUA 5FBHA 3T99A 3SOZA 3EN0A 2YC2C 3NAQA 4UHKA 1V3TA 2ZVQX 3OM8A 1O4WA 2V7TA 2VP9A 2OPBA 1NP3A 1E1RD 1CX9B 5EJFA 3HRHA 1QO0D 1OPXA 2QTRA 3MCWA 4KIGA 4N5DA 3NQ41 3VFDA 1Y42X 3DTVB 4TMWA 4Q7KA 1NLUA 3D31A 2RC5A 2OAQ1 2X1HA 3N2KB 4C3ZA 1IK4A 3LJKA 3VOTA 1UUFA 5LMUB 1V26A 3NAZA 3NCTA 3HFSA 1YRYE 3IDQA 2GOYA 3EIFA 3L7LA 2BC9A 3GLQA 4NPCA 4QLOA 3ST7A 1TT5B 8LDHA 2WKRA 1C8BA 2WOJA 1Q5PA 1CHDA 1LJLA 3AM3A 3CZ9A 1C8LA 3HYSA 1ZIXA 4MGIR 1Z4KA 4RPJA 4OQZA 5ICFA 4EZEA 2BGWA 3FVRA 3IMFA 4R3NA 5EP4A 3QBJA 3JQ6A 3LPMA 3VGJA 3A9TA 8AT1A 3PU6A 3UB2A 2BHLA 1DWPA 3TS1A 3Q3HA 3AR8A 1RYNA 3ZUGA 2AV6A 4CIVA 4DILA 4FFWA 1CIVA 3ZTTA 2XNCA 5LP6F 1PBTA 2FKAA 1CEEA 4B4UA 4I19A 2PA0A 5E4FA 1AQLA 1CY0A 4J90A 1EX7A 4C5BA 5JOQA 3TTSA 5CA1B 1UXGA 1L7PA 4G5SA 3UWOA 2RG1A 1CUDA 3ZDBA 1I7QB 4AI6A 5HBRA 4BMSA 1CY7A 2ZDGA 1CJUC 5ARBA 1YS9A 3H11B 2G4VA 4MS4A 2ACKA 1DJOA 2JI4A 4RKEA 5F7OA 1EUCB 1GL7A 1MA3A 2R7MA 3FDIA 4Q0MA 3RU2A 4C5CA 4YY3B 2H2FA 3PR3A 3QE2A 1LPPA 2ZBUA 2ZPAA 3T54A 1Q19A 4RFSB 3RG8A 2HA5A 3EXHC 1JEAA 3KB2A 3VZDA 3CIOA 4NCKA 3T4UA 4DKXA 3LWBA 3PXAA 1KI2A 3M9WA 1WPRA 1H93A 1VC2A 2YQ4A 2PZ8A 2PEZA 4W1SA 2PJZA 4CWAA 3JQCA 3KZCA 2XGMA 3ZXSA 3EOAI 2I9KA 3ANTA 3LP5A 4PNEA 4GO1A 1GPNA 1P81A 3E1KA 4Y67A 3H97A 4P53A 1DKNA 4UOZA 2BBWA 1ENYA 2NSHA 4TTIA 5AOAA 3ESRA 3MJFA 3NFYA 2GCPA 2GYWA 4UVHA 5JBIA 4NQZA 1XCLA 3NKVA 1QV7A 4H08A 1X1TA 1SUCA 3AUJB 1FRVA 4GG1A 2R6GA 3KDAA 2I7DA 4HGZA 3HMQA 2XDAA 1WTAA 1NBMD 1X7HA 3VDRA 4E30A 2ZQ5A 3MT0A 4P4GA 4TYQA 3NHMA 4JI3B 2CJYA 2VJAA 3I32A 1R8YA 2EJUA 5A4JA 2H1SA 2VNKA 2W37A 4BO0A 3ETNA 1U2EA 3JWIA 4PVDA 1Q50A 2YOHA 3O73A 4Q9NA 4QJ5A 1L1FA 4QUGA 1WIWA 2CVFA 3C1UA 4FFLA 3ZWOA 4TV9B 4UEWA 3OEEA 3SICE 1XPJA 3BMOA 3HZOA 4JIMA 2JLXA 1PW7A 2PV7A 3CRRA 4JP5A 1UPCA 2MYNA 4IF6A 3HYCA 4M46A 5IK2A 2ZUTA 5K09A 3EA4A 3IVXA 2RE8A 1S5PA 3SZLA 3K6KA 1ZCAA 4JI0B 1SKBA 2AR7A 1KMHA 1TAHA 5L3SA 1X15A 1Z34A 2IOYA 4MV4A 1K7CA 4ZAXA 4D9GA 1U9JA 2W90A 1J42A 2H2HA 2QSJA 2XOKD 1E18A 3DHWC 4Z7OB 1L5WA 3IDSA 1WPGA 2M2IA 4EJ6A 2F2TA 3W5SA 1PVVA 1E1YA 3LT1A 3H0EA 1YQQA 2CHUA 3OVMA 4IDOA 5HFNA 3V1MA 4BVHA 3ORYA 4CLOB 1FB5A 5EJ7A 2KYRA 1YBVA 1IMOA 2NSYA 4II2A 4S1NA 1SKUA 1HT2E 3OM0A 3U48A 1E9BA 1EMDA 3OOSA 2C1ZA 1LLUA 3F71A 1USGA 2VA8A 1DXOA 4PNZA 3J7AC 1Y6FA 3FAKA 1M7BA 4P0QB 5CBPB 5CFLA 1HA3A 4O5AA 4BPRA 3FI9A 3K09C 1QP4A 3NHUA 5A9TA 1TVEA 1TYEB 1WVIA 4R6XA 4QYSA 3I8OA 2LE0A 2Y9PB 2D5BA 4LQDA 1ETHA 1DIRA 3TXAA 1CUEA 1NRJB 4MXDA 1NUTA 3DZIA 5SYNA 3RYIB 2PL1A 4CR7A 3DT9A 4CR6A 2DG2A 4E7OA 1FX1A 4DR4B 3H42B 4W9NC 3VYVA 1YBAA 3VR2A 2P27A 5ULLA 1V1JA 2OZLB 4H1HA 1C80A 2P3OA 3QFTA 3REQB 1YF3A 1MABB 4ERXA 4R5MA 5TB5A 5FKJA 4RVNA 2PQ2A 5JJBA 2PZLA 3DB1A 1DXYA 4LJ7A