3H2ZA

The crystal structure of mannitol-1-phosphate dehydrogenase from shigella flexneri
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
382
structure length
377
Chain Sequence
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTVSGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIACENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPNDPLEVTVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQISGLDANSEVVSEAVTAYKAMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of mannitol-1-phosphate dehydrogenase from Shigella flexneri
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Oxidoreductase
molecule keywords Mannitol-1-phosphate 5-dehydrogenase
total genus 130
structure length 377
sequence length 382
ec nomenclature ec 1.1.1.17: Mannitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain
A PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3h2zA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h2zA01
3WYEA 2GZ1A 4XQGA 1L1FA 1DC6A 4Z9YA 1MFPA 2PZKA 1ISHA 2X5JO 1ZXBA 1LRKA 4E12A 1Q0QA 5A9RA 1V3VA 4JBHA 4Q39A 4NH4A 3WIEA 4BNIA 2C2XA 1B8UA 1C1DB 1BDBA 2WD7A 5KVSA 3WIDA 2VHYA 1A9YA 1EK5A 1ZK0A 2V6GA 4WLEA 5JAMA 1CEQA 4Z3DA 2GDZA 5CEEA 4XYEA 1X0XA 3TNLA 3OMLA 4F6CA 2RBEA 1F8GA 1M66A 4AL4A 5K0ZA 3CKYA 4UVDA 1I30A 4WLFA 3UN1A 5JY1A 1WVGA 1ADCA 3MTGA 1SEVA 4LRSB 3TRIA 5F5NA 4NJOA 3U9LA 4U0JA 2FHSA 1HDZA 3WNVA 3GNTA 4W99A 1VC2A 2Q1UA 3ETGA 4YAIA 2FR8A 3HFSA 1B3BA 1LDBA 3JD4A 4JROA 2V7PA 3H6KA 5T8KC 3VPSA 2E82A 1Z73A 4I1IA 3KSDO 1IULA 3DAPA 4H7PA 3SEFA 3QIVA 4DMLA 2C2YA 3BHJA 3ZNNA 1XGKA 5KJ1A 1O8CA 2GN8A 1UP6A 4AG3A 1N9GB 2VZ0A 1HLPA 3I9NA 2HMUA 7MDHA 3M2PA 1YWGO 1O9BA 4FBGA 1GUYA 1ZK2A 2VHWA 3FBGA 4N18A 1LC0A 5DOVA 1TI7A 1F17A 2G76A 1I36A 2Z95A 3AWDA 3BMNB 4XQCA 3ZWBA 1BSVA 5IXYA 1BRMA 3QQPA 3WDSA 4YQYA 3VH4A 1I8TA 3AOGA 3HB4X 3OBBA 1A4UA 1PZGA 2DFDA 2BD0A 3I1JA 2VRCD 4Y6RA 4NFHA 4AJLA 1P1IA 3AOEA 3GN1A 5I7VA 5JDIC 3HDYA 3V2UA 5AVOA 4YRBA 3L4SO 3MCVA 1I24A 5JBIA 2GASA 4BHTA 3NJ8A 1V8BA 4R1UA 4R68A 4AFNA 2ZKLA 3B20A 4IXWA 1TLTA 4EI2A 3IJPA 4J1NA 3OHSX 3JSAA 2PZMA 3EYWA 5L7YA 1ZIDA 3DOCA 1KVSA 4IDCA 3D3EA 4ZD6A 2JKVA 1DJQA 3GEGA 4I5FA 5G0WA 3WSWA 3DAFA 2XPCA 1X15A 4B4VA 3WBFA 1UDAA 3HJAA 3FNFA 3H4VA 3KYCB 4KZPA 4YB8A 5ER9A 5KJ6A 5CPFA 4IPTA 3V8BA 4D43A 5DBIA 2QRJA 4MVJI 1VJ1A 5EINA 2D0IA 1NBOA 1U2GA 3TZQA 5JC1A 1C0LA 4D0RA 1LQUA 3WICA 5F21A 5TLSA 2HDHA 3WGGA 1VI2A 3U4HA 3F5QA 1DDOA 1RM3A 3DB2A 1IHXA 3H9GA 4P4GA 1RYDA 3PFFA 3HDJA 1UZMA 4D45A 3X2EA 2Q99A 2Y99A 6ADHA 2D4AA 4GPD1 4R51A 2EV9A 4YQZA 2Z5LA 1DB3A 2POQX 2FSSA 1LDYA 2X5OA 4I9UA 2GNAA 4CR6A 4RZIA 1LC3A 4XJSA 4D3SA 1G0NA 3C8MA 1MUUA 1KYQA 4ALIA 3DDNA 1Y8RA 1CETA 1M6WA 2JJYA 1EFKA 4HXYA 5I8ZA 3V1YA 2IXBA 2BGLA 1Y5RA 2FR0A 1U1IA 3IMFA 2IXAA 3CUKA 3WQSB 2EP5A 4IDDA 4BB6A 4W82A 3ONDA 4J91A 1OC2A 1UZLA 1Q0HA 3CINA 3FR7A 1LLUA 4PFJA 2EGGA 1H6DA 2ZB8A 3ICCA 1J0XO 5CDYA 4CUJA 1U3WA 1U3UA 1E92A 1EBFA 5L95A 4D3FA 3L4BC 3F5SA 2PWZA 2DAPA 3MEQA 5TIIA 3DXFA 1E6EA 2O3QA 3ZHXA 2PLAA 2ILTA 3OA0A 4Y67A 4S1VA 3E9NA 3PHJA 5I7EA 4BNMA 4M89A 3F1LA 2HJRA 4WEQA 4I5DA 3RKUA 1NP3A 1O95A 2VTEA 1I5RA 3ROKA 1QKIA 4N54A 3ZWCA 1HWYA 1E3IA 2X0NA 5EPOA 4QEDA 3G0OA 3FPLA 4PG7A 4R01A 3PQEA 3FHLA 3MZ0A 4YYZA 3ETDA 3R6DA 4UULA 3H8VA 5G4KB 1EDOA 1UXHA 3GDOA 5A05A 3TZ6A 3FTNA 2O3JA 4IDGA 4FSHA 1Y9AA 3W4IA 1YBMA 5BSHA 1UXJA 1VKOA 5BSEA 3ZU2A 1GD1O 1DBVO 1EVJA 1L7DA 1P1HA 1ZVMA 1Y8QA 2YHIA 3LC1O 4JK3A 5AOVA 3GLQA 4FR5A 4ONEA 3F46A 4RPHA 2WEKA 4OOFA 4J0FA 2J3IA 5GZ3A 4NG5A 3W4JA 3JQCA 1H93A 1D4FA 1H6BA 4GX1A 2TMGA 2Y0EA 5JMPA 1N9GA 3WLEA 1F0YA 3IKTA 5DDIP 4MIEA 2O2SA 1B8PA 1DHRA 5GMOA 1JN0A 4HBGA 2DU8A 4BUCA 3WSVA 4RL6A 1ISJA 3IL2A 1M2WA 1QXSA 3JTMA 1R4NA 3L4BA 3M1AA 4EYEA 1JAYA 1SAYA 5L4SA 3OA2A 3DC2A 1DRUA 4CQMB 4E5NA 3BXXA 1YOVA 4J7XA 4LVCA 1Y5MA 4GKVA 3EC7A 3V2GA 1PL7A 1NYTA 1UP4A 4R5MA 1PQUA 1E3LA 4QFCA 1HE3A 4DC1A 2X0IA 2H9IA 3PQFA 2ET6A 4XQEA 3GFBA 3QVTA 2QZ9A 1PR9A 1DEHA 5COQA 4BNHA 4ZHSA 4NPCA 5KKAA 4GSLA 5IN5A 1P31A 1GYQA 3DZBA 3IC5A 3S2FA 2ZCUA 5DCWA 3B1FA 5TX7A 3EW7A 1JU9A 3BTVA 2WSBA 4BKPA 2I5PO 3C85A 5DNAA 3W6UA 1AXGA 3M1LA 4E3ZA 3JQDA 1GQ2A 1PS9A 3MOIA 4R16A 3PXXA 4M86A 3JD1A 1N1EA 5JMWA 3E5RA 2X9GA 3CTMA 1DHTA 3WB9A 1WZIA 1E5QA 5LDHA 3B1JA 2I99A 4YT2A 1QYCA 4DGSA 2JHGA 4DBVO 1Y81A 3NTOA 4JN6B 3RWBA 2BFMA 2CDAA 4WKGA 3VC7A 4DYVA 5C7LO 4TZKA 2Z1NA 1ZEJA 4MP3A 1NHWA 2H63A 3CH6A 3VH2A 1YJ8A 4OAQA 4X54A 4LGVA 1NPDA 1IE3A 1VL6A 1CERA 3PIIA 1E7WA 3ZN2A 2C82A 3DOOA 5B12A 1NWHA 2CMDA 2RCYA 2JL1A 2PV7A 2QYTA 4FGSA 5KKCA 4RORA 4JP3A 3RD5A 3L9XA 5A9TA 3G1UA 3MWEB 2JFFA 2HK7A 4PLWA 1BWSA 2GF2A 4RF3A 1WXDA 3GY0A 1OAAA 2O3UA 2D8AA 1B3RA 3PGXA 4E2WA 5BNTA 2JD1A 4BO3A 3F9IA 1QYXA 1ZMTA 3GG2A 1NVTA 4D0SA 3LYLA 2YDYA 4WEOA 5HTOA 1F14A 2OUIA 3U5TA 4HWKA 4E0BA 3I4CA 2Q1WA 2VT2A 2GZ2A 3WGYA 5T64A 4FW8A 2EWMA 2VUUA 2P5UA 3FNGA 1T2DA 1AHIA 1HSOA 4WNIA 2DFVA 1W6UA 3MJVA 4TKMA 3BMOA 3VKUA 3RBZA 5IDQA 1KC1A 1Y7TA 4LK3A 4TWRA 1PGOA 3BMCB 4NIMA 3JYLA 5IG2A 1XHLA 4AJPA 4DVJA 1YDEA 4LRTB 5DZSA 2J3JA 4CV0A 1KVUA 3PHGA 4UEJA 2G1UA 4NR0A 3HSKA 4RDIA 4ZQEA 1FMCA 2FPIA 3KRTA 3LF1A 3GNQA 1PJ2A 2EJVA 3Q3CA 4BNYA 4MVJP 5B1YA 4I5GA 1Q7CA 4YEDA 2WE8A 1B7GO 2NU9A 1TT5B 3DZGA 2GYYA 2YFHA 4CM4B 3JD0A 3AY7A 3HE3A 3KB6A 1BGVA 2A9FA 5BNFA 2IZ0A 5A04A 3HN7A 4WJZA 1C1DA 3JQ7B 2VZ9A 5AXDA 5IZCC 1K2WA 3AI2A 1R16A 4B8ZA 4IS3A 4WGGA 2XF8A 4IQGA 4MVJA 3IUSA 3OJ0A 5AXBA 1E1NA 4KDEA 3OEWA 4J6FA 4MO2A 4PN3A 3FRJA 4DXHA 1V6AA 5TT1A 3RUHA 4EJ0A 5KOIA 5IJZA 1YB1A 1E7YA 4FS3A 1LDNA 1S6YA 4P4LA 2PKQP 4GKBA 4KP7A 3WGZA 3V5NA 1R4NB 1YS4A 3AM3A 2DUWA 3EVNA 3UICA 5CDUA 2UDPA 1T24A 3VTFA 3W1VA 4CLEA 2DQ4A 2AA3A 4GL4A 1RYEA 4ALKA 3H2SA 4HKTA 3K8ZA 3INTA 1LSOA 1GAEO 1ADFA 5A9SA 1LNQA 2V6BA 3DL2A 4YJDA 4OQZA 4BNVA 4ZGWA 3ITDA 1R6DA 1R0LA 1DIGA 4PG6A 4ZICA 3H5AA 4MDHA 4IIVA 3G17A 3I23A 4E4YA 2GGSA 3JQAD 2F00A 1EUZA 4FQ8A 1XCBA 4I9NA 3GRKA 1ZK4A 1YB4A 1QMGA 1P9LA 3LT0A 1E5LA 3BMNA 1NAHA 3U4IA 4WK6A 2EW8A 4BB5A 1CF2O 1A72A 1K0UA 3VH3A 3ZWYA 5A5EA 4DBZA 1KETA 3I3OA 5JDCC 4FC6A 1B2LA 3WTCA 5JAIA 4DA9A 5EIOA 1A7AA 2CVOA 3MJEA 1MV8A 2PH5A 1GADO 1NAIA 3LU1A 3IQDB 3RUAA 2WD7B 5HA5A 1PQWA 1A27A 1IOLA 2X0JA 1J5PA 1IB6A 1LSSA 2OBNA 1M67A 2UAGA 1KEUA 1E3JA 4J4HA 4DPLA 2OL4A 1SNYA 3UF0A 1HDGO 5C5IA 4CLOB 3DQPA 1Q2XA 4MVJG 4BNZA 5IAAA 5JFOA 4PLHA 3GAFA 3H5NA 2IDZA 4IGFA 3SC4A 5EQFA 1HZZA 4TQGA 2ZATA 4OSOA 5DP1A 3ZV6A 4FCCA 1IUKA 3PLNA 3PI7A 2CVQA 3IJRA 2AEMA 2YY7A 4IMRA 1I32A 2NQTA 2EKPA 4FN4A 5I7SA 3ULKA 2Q1TA 1Z7BA 3GA0A 3RI3A 3RCBA 1PJSA 3FN4A 1P77A 1NQOA 4EGFA 1P1JA 1EQ2A 4RF5A 3HDHA 1B16A 4GAEA 1IY8A 1NHGA 2IRWA 2ZTMA 2AQHA 4UREA 1W0CA 3JD2A 4P38A 3FBTA 2CD9A 2GD1O 3NGXA 4MP8A 1FF9A 1P74A 3FD8A 4ZA2A 5TGDA 4MJLA 3DZFA 1I2ZA 1H94A 3TQHA 2CVZA 1T25A 4CM5A 2PGJA 1P1FA 3DOJA 2EIHA 3QW2A 4UUOA 1JWAB 3GG9A 5EESA 1EVZA 1PJ4A 4CM1A 1L7EA 1LUAA 2O23A 4PZEA 1WDLA 3C1OA 3TJRA 1KEPA 2OP0A 3DBHA 1F8FA 4HNHA 4FFNA 1K5HA 4EJMA 1DRWA 4QO8A 1XWFA 1ZNQO 2R2GA 2NLOA 3WTBA 2ZB4A 5IZCA 2C5AA 1E3SA 3PLRA 4WCDA 1DO8A 4YJGB 2Q49A 2X8LA 3DTTA 4H3VA 3R3SA 4A7PA 1BW9A 5DP2A 4E5PA 5J23A 1VRWA 4IDFA 3H9JA 1JTVA 1JVBA 4K6CA 5CG1A 3JQ7A 2UV8A 3GMSA 5A9SB 2DC1A 3DHEA 4NU6A 4CV1A 4YT4A 4OSPA 4F3YA 4NBVA 4FPXA 3SJ7A 1IZ9A 1WWKA 1I2CA 4R4JA 5AXCA 1S7CA 1R0KA 4Q3CA 3UVEA 4C4OA 1P1RA 1QP8A 3NT5A 2OBYA 3WR5A 5G4KA 3VDRA 5A5FA 4WLVA 3NDRA 4BNJA 5L45A 2NACA 4PZCA 2P4HX 5TC4A 5JYDA 5K6AC 4XQ9A 4LCJA 1E1KA 3PWKA 1PL6A 4BNGA 2DBZA 4J3FA 2EHDA 1JQBA 3DZHA 4YT5A 4RPKA 3MJ4A 3Q1LA 4J43A 5A02A 3HDQA 3I9LA 4JJGA 4DTIA 2P91A 4O1MA 5G0VA 1UAGA 2V6FA 3MJTA 1M75A 3GDFA 3UCFA 5A3JA 2Q45A 5JDIA 2E48A 1O94A 1ZKMA 2AEFA 5F5LA 2JD2A 4CM8A 1P1KA 3S8MA 2Y1FA 1LSUA 4D41A 5IFLA 3LSYA 2CY0A 1I10A 1R4MB 2I6TA 2VOJA 3DZKA 2IEBA 2VYND 3BTOA 1PJ3A 4AJOA 1MG5A 2J3HA 1C1XA 1LLQA 3ASVA 1AXEA 3D5TA 1E0DA 3GGGA 4BMNA 3ZV4A 5I7FA 5ITWA 5K9ZA 2PNFA 1ZK1A 3QWHA 4PLZA 4BOYA 1PZFA 3F47A 2VNSA 1MB4A 1RM0A 2VWPA 4OJNA 4MVJH 4W7IA 2QHXA 1XR3A 3NAQA 3QWIA 1LQTA 2JCXA 1EFLA 3VVBA 1N7HA 5JE8A 1ONNA 3ZWMA 4AVYA 4RQUA 2FSVA 4XB2A 3L0DA 1H6AA 2AW5A 1UXGA 4LSMA 1K6IA 1RKXA 4N5LA 4OO3A 1P33A 2VQ3A 3WGIA 3MJCA 1LDGA 4DL9A 3E1KA 3I5MA 3HUDA 3VZPA 2YZ7A 4OKNA 4RV9A 1GFSA 3UXYA 3HB5X 1E7RA 1HRDA 3LQFA 2YJZA 3H9QA 4XWYA 4CQLB 2CDCA 2YQ4A 4O5OA 1FK8A 2WMDA 2YHIB 2EEZA 1ID1A 1QLJA 2OMEA 2VNAA 4B3HA 2EKQA 2W2LD 4JGBA 5CDSA 1H2BA 5A4DA 2HK9A 2GN4A 2IZ1A 2JFGA 1W8DA 1SB9A 4PG4A 1KEVA 4HADA 1NR1A 4QT0A 3FWZA 2XOXA 1GZ6A 2G82A 4FFOA 1E3EA 2CZCA 4J7CA 5G4LA 2PD4A 3TPCA 3RFVA 4WCFA 2C0CA 4WOKA 4JIGA 1NVGA 1YXMA 3TL3A 1GY8A 4J49A 5EMHA 3ZV5A 3P2YA 4E32A 3ENNA 3Q6IA 3KYDA 3RKRA 3CZRA 4GLLA 1ZEMA 4HFJA 4LN1A 4E33A 2H6EA 5IDXA 2GSDA 2QQ5A 4PLVA 3RU7A 4YCAA 3BAZA 2PGDA 4BKQA 1EVYA 5DT9A 4LMRA 2A92A 3G1TA 4FOOA 5DOZA 4CV3A 3BMOB 4D46A 2B0JA 5TNXA 3MWDB 4TVOA 1R12A 3SXPA 2PKQO 4RJTA 4NI5A 4A2CA 1ZSNA 5JY6A 4CUKA 3PTZA 1LJ8A 1EBUA 2YDXA 4Z9XA 1YL7A 3ROQA 3QSGA 4NHEA 1QSGA 1Z45A 5TJ9A 3WGTA 2HLPA 2XAAA 2B35A 3VVCA 2FZWA 1U8XX 3TOZA 2H5LA 4K6FA 2DVMA 1XEAA 3UCEA 3ZH2A 3NKLA 1NFRA 4MKZA 3ANMA 1TT5A 3BTSA 4DREA 4JQCA 5JSFA 2CNBA 4WPGA 3PHHA 5H81A 3P2OA 4PLPA 3D3WB 4PG8A 1PJBA 1VKNA 1YQDA 3NYWA 4YA6A 5G0TA 4GWKA 3VZSA 1PGJA 4A0SA 3OQBA 3H2ZA 5FEUA 3T7EA 1KY4A 2X22A 4KTVE 5T8KA 4Z3KA 1LLCA 1A7KA 1A9ZA 3OIDA 4W4TA 1B8VA 3O8QB 4MKRA 4CMKA 2NSDA 1I33A 4R41A 3CMCO 1VL0A 1VSUA 4L73A 4ZQBA 4NFSA 3PDJA 2PK3A 3JQ9A 4ESOA 1HDOA 3ZDFA 5IDWA 2HK8A 3TZKA 4EEZA 4BQPA 3SC6A 1GPDG 1BVUA 4BO6A 2O7QA 2FWMX 4OYRA 5CFZA 2AEJA 4PLTA 4J7UA 2EJWA 2PZLA 4JNKA 4BNTA 4J16A 2D5AA 5TT0A 2JHFA 1UDCA 2C07A 5ENVA 3JD3A 2O7SA 4A5OA 4RVFA 5CEJA 4K26A 1VPDA 4JX8A 1GZ3A 4GBJA 1D1TA 4E30A 1UDBA 3L6DA 1ZUD1 5CDGA 4EBFA 2DTXA 4W9NC 4GQAA 4CM4A 2X86A 4GX2A 4O63O 2EKLA 1X0VA 3G3EA 4E5MA 4FFMA 3TF5A 1QYVA 1KOLA 4AJ4A 1XQ6A 1UUFA 3H7AA 4G81A 4GSKA 4D79A 4TRJA 1NR7A 3RC2A 4I5EA 3ETEA 2PGLA 4W9NA 5ER6A 2C5EA 3LC7O 5BSGA 2X0RA 2DUUA 3E18A 2C29D 4BKRA 2NQ8A 2ZQZA 3OICA 3GPDG 2NU8A 1EUDA 5JPIA 3TZCA 3NJ4A 1H5QA 4IM7A 3I83A 2FZEA 4YPOA 1NM5A 2E4AA 3BZUA 2AG5A 4OMUA 1R37A 3GFGA 2Y93A 4ND4A 2HCTA 3AM4A 4N5MA 5K6AA 1I3KA 3GF4A 1HDYA 3ROMA 2Q46A 4BO1A 3ICPA 5EN4A 2X6TA 1U4SA 5U1PA 2ZTLA 1SCUA 4XR9A 3WGHA 1HEUA 1FXSA 1E1MA 4J9VA 4XYLA 2FMUA 3DBLB 5B4UA 2GERA 3HWRA 3VDQA 1HYGA 4INAA 5CG2A 5FWNA 3RC7A 1LTHR 3S2IA 3U0BA 5ES3A 4Q3EA 1ORRA 4K1LA 3L07A 4CR8A 4AJHA 2WJPA 3PIDA 1UZNA 4J90A 1ISMA 3ZU3A 3O8QA 1HE2A 3P7MA 1OC4A 3I52A 4XRGA 1KS9A 3E6AA 3Q9NA 3C1TA 4H15A 4XYMA 1BXGB 1OI7A 1I3MA 2D3TA 3FSRA 4IJKA 1Q0LA 1PJQA 2W2KA 2B37A 4L75A 2C7GA 5I8WA 4N5NA 2X58A 3GZNB 5BQFA 3B70A 2YW9A 4D7AA 1VSVA 2AQKA 4IJWA 4NBUA 3VHRA 1BG6A 3D4PA 3QVWA 4TVBA 4OXYA 4CR7A 3ADPA 1JDJA 1ZMOA 3UH1A 4J2HA 4CLOA 4XR4A 4C7KA 1G6KA 1XLTA 1QR6A 3KOUA 5C7IO 4L4XA 3DHYA 9LDBA 3WS7A 4WLNA 1X7DA 3MOGA 4Q3NA 1NFQA 3NV9A 1N7GA 2X4GA 3PHIA 2IZZA 3GEDA 1LXCA 3GMDA 4JJIA 1ZSYA 4MIOA 1LU9A 4E2XA 4OIMA 3NRCA 4PCVA 1AUPA 5ENDA 3INGA 4AJEA 2OGUA 4FD3A 2Q50A 4YJGA 1LLDA 2VT3A 1U3TA 1C0PA 2I67A 4B79A 4W7HA 2AHRA 1DC3A 1Q1NA 1E6UA 1PJLA 4R1TA 3ZWOA 4BNXA 4P22A 4XB1A 1CQJA 1GZ4A 1TB4A 5L40A 2G5CA 1C3VA 2FRDA 3RBXA 4WECA 3P5SA 4CLRA 2O3RA 4ZQHA 2HQ1A 5EL0A 3O26A 1T4BA 1ZXLA 1XU9A 1U4OA 4QTZA 1YB5A 3AFMA 5G2OA 4RVGA 1T4DA 2PTGA 1RJWA 5ILOA 4BNNA 3DR3A 2Y1DA 2I66A 3DMTC 3LK7A 3UHAA 4HY3A 3UUWA 3STHA 5MDHA 1KVTA 5GZ6A 4L0QA 1GYPA 3FPCA 3HQ4O 5B4VA 2JAPA 2YYYA 2AQ8A 4J9UE 4BO0A 8LDHA 5TS3A 4P8RA 4NJMB 1VL8A 1XELA 1CRWG 3DZIA 3W6ZA 1CQIA 1T2CA 2NTJA 2NU6A 4PLYA 2QZZA 3BHMA 2NTVA 5FF9A 3VKVA 3KSZO 3GUCA 3SLGA 1GTMA 2HJSA 4L9RA 3NX4A 3ZV3A 4B8WA 2WM3A 4YJFA 4YAKA 3E9QA 4IJUA 4CM3A 2X7HA 4HFRA 4CJXA 3E03A 5FYDA 4YXFA 1JKJA 4RO0A 4HV4A 3WWYA 4FJ2A 4F46A 3M2TA 1FDVA 3PZBA 5JS6A 1TT7A 5HS4A 3SJUA 1UXKA 3QWFA 4L74A 4ZVVA 3N74A 2NV6A 3AW9A 3IAHA 4B4OA 5GZ1A 5L4LA 3B6ZA 3VOSA 2D59A 3RAJA 1RPNA 4EITA 5HBRA 2E6UX 3QV1A 5U9CA 1H6CA 3TFOA 4TRMA 4EUFA 3IOYA 3ZWXA 3ST7A 1SOVA 3FNEA 4J1TA 3H9UA 1QV7A 1A4IA 3UOGA 5EQDA 3DBRA 1YH3A 2NVUA 1P0CA 2FPGA 2HO5A 5JLAA 4CQLA 4BNFA 4ALLA 4EUEA 4DLLA 5H83A 1KBZA 1MFZA 3F6YA 4PVCA 2WYWA 3CIFA 5BSFA 1WW8A 5LCXA 5CDTA 4Q3BA 1HT0A 1NNUA 2EW2A 1XU7A 4YAGA 3A9WA 4XCVA 3PHLA 4F6LA 1RM5A 3OJLA 1QORA 3FCOA 4ZN6A 2B5VA 3A4VA 2ZQYA 4FOSA 4NFYA 2V6MA 4CLRB 4CV2A 5KJEA 3GVHA 3NT2A 2VZ8A 4XYBA 1GQYA 1P0FA 2B4RO 4RDHA 2IYPA 2Q2WA 4Q9NA 4WCFC 3AU9A 1TEHA 5THQA 4IZHA 4KWIA 1I3NA 4EEXA 2YUTA 3K6JA 4F45A 3ABIA 3D1LA 5KVCA 1ENZA 5GY7A 4JCOA 5BNIA 2W4QA 3LZ6A 4XGKA 4GI2A 1VE9A 3AOEC 5A06A 3UW3A 4Z6KA 2HUNA 2O50A 3QVOA 2CF5A 3ON5A 4UVEA 4BNUA 4OGWA 4U6SA 1J6UA 1EEHA 5DF1A 3ZZNA 2NWQA 5C3MA 5ICSA 5T5QA 5JDCA 1CWUA 3OEYA 4HNGA 1PS0A 4AICA 3NGLA 3D4NA 4BMSA 5CEFA 2DBVO 3FNHA 2B36A 3WFJA 1DRVA 2WYVA 1QYWA 5TJHA 3EAGA 4ND3A 4E6PA 4R9SA 3ZW9A 3EVTA 4G5HA 4RPJA 1SOWA 3FWNA 1YE3A 1OMOA 4EDFA 4TMFA 4J0EA 2I76A 3H5RA 2BFAA 1Y8QB 4UEOA 3LC2O 1I01A 1WMAA 4YAEA 3AY3A 4YT8A 3PVZA 4DRYA 3U4CA 1DIHA 3PWSA 1D7OA 4IINA 1QV6A 1ENOA 4JBGA 1HTBA 4J4TA 4CODB 1A5ZA 3OQ6A 3WWZA 4IQ8A 1KVQA 1O6ZA 4PLFA 3PEFA 2RHCA 2DPHA 5CAEA 3OQ1A 4BO5A 4EZBA 2J6IA 2BELA 1LI4A 3DMTA 3K2EA 5U4QA 2DTDA 4A26A 4XIYA 3RJ9A 2OORA 3QE3A 2ZIZA 1NPYA 3QRWA 3ONFA 3C7DB 4L4RA 3LLVA 2CFCA 4CMGA 2Y68A 1RM4A 2IE0A 3NTRA 3W8FA 3LDHA 2NADA 2OP1A 4CQMA 1T2FA 2HAEA 3RC1A 2ZJ1A 1DXYA 2Q3EA 1JA9A 1FDUA 1FDSA 5KVQA 3I6IA 1GV0A 3Q2IA 1ULUA 4HFNA 3U3XA 1EDZA 3AY6A 4GX5A 3RJ5A 5A1TA 4BO8A 4Z0PA 1HDXA 3VTZA 7ADHA 2I3GA 4WCFB 3AFNA 1X1TA 2G0TA 3OF2A 4URFA 3DAGA 1NXQA 3PP8A 1PWZA 3GZ4A 3GVCA 1UH5A 4PLGA 4NZ9A 1PEDA 2R00C 2ZCVA 4R9RA 1NQAO 1UXIA 5LC1A 1TVEA 2BGKA 4II2A 1XIVA 4HP8A 4DMMA 1D8AA 3TL2A 1NASA 2J3KA 3GGOA 5DBFA 4BNWA 4KQXA 5L9AA 3GK3A 4KMSA 1EVIA 4BV8A 4FDAA 5C7OO 4UVGA 1YL5A 4XRRA 5G0SA 2R00A 4Q3DA 3SBOA 4J2OA 1ONPA 4NU5A 2ZTVA 1YGYA 2DKNA 3EUWA 3VPHA 2AXQA 2I3AA 3PYXA 4XYGA 1DAPA 4LMPA 3BMQA 1DOHA 4R69A 1EUCA 1WNTA 5I9LA 1GUFA 1EMDA 2BI8A 2ZK7A 3DONA 2AG8A 4ZRMA 4TSKA 5KNLA 5JYEA 4MOWA 5JCJD 4ZQFA 3K5PA 1X13A 2WWRA 3RUEA 2GO1A 4GGOA 4BGVA 3GZNA 2CF6A 4FJ1A 4NQZA 3UAGA 1OFGA 1YRLA 2VHXA 1WMBA 4ITUA 3KXDA 3ZU5A 3JQ9C 4RLHA 1DIAA 4XX0A 3N7UA 2V65A 3GVIA 5THKA 1JLLA 5IZ4A 1MA0A 1F12A 5JAQA 3GN2A 4JP2A 1C0KA 3C24A 3COSA 3WLFA 4MVJF 5ICMA 4J1SA 1DC4A 4CLHA 4W6ZA 1LSJA 2WYUA 1OZAA 4RQTA 3WYCA 4B3IA 3WMXA 1KVRA 5COAA 2QYSA 3UKOA 1NWCA 2PY6A 1V35A 1PS8A 4PG5A 4PVDA 3V1UA 1LDEA 5AQ1A 3W4KA 3A28A 2BKAA 5A3VA 2W90A 1AN9A 5CHEA 2NVUB 3OFSA 2VRCA 3WFIA 5ILGA 4GX0A 4NBWA 4YR9A 1CIVA 1TA4A 3LT2A 4WASA 2UUPA 2A4KA 3WQRA 3A1NA 2HRZA 3LT4A 4JJFA 2Z1MA 3VAZA 4MPDA 3N58A 4I08A 4IBOA 2YHUA 1GCUA 2VHVA 2GPTA 1PR3A 2ZB3A 4IXTA 1HE5A 3EGOA 1ZSVA 1B0AA 3M6IA 4K9DA 1XG5A 4QFDA 1SPXA 3AI3A 1CYDA 3AUSA 1GV1A 3WGQA 4BO2A 3KUXA 1DFGA 4WOJA 1K6XA 3TOXA 4ID9A 4FGWA 4YJHB 3WOHA 4CMJA 5TSDA 3KEOA 3RIHA 1PWXA 3GVPA 1ONOA 4DQUA 4CUZA 9LDTA 1ZK3A 1ZW1A 3R0IA 2P9GA 3DFUA 3PRJA 2GN6A 3Q2KA 4QXMA 2JD0A 3FI9A 5CPBA 1E7QA 1T1RA 1BDMA 3ZNOA 5HM8A 1U7HA 1IYZA 4B4WA 2O48X 2W8ZA 3QY9A 2BGMA 2A35A 2VOEA 1YJQA 3OJOA 3H3FA 4DYDA 4U7WA 4XJTA 1IZ0A 1HSZA 1BMDA 3CPSA 3ASUA 3GH3A 3CXRA 3EZLA 3A14A 3WNQA 4AJJA 3SVTA 3E5MA 3PJDA 4B7CA 1Z7EA 1WZEA 2RH8A 4MVJM 1RWBA 4NNJA 4YRDA 3NUGA 4QX6A 1AGNA 4WE3A 3WBBA 1GYRA 1LRJA 1BXKA 4II3A 4Y98A 2Q2VA 2X5KO 1V3TA 4KTTE 4CM7A 2F1KA 3HHPA 4GMFA 1KIFA 1U9JA 3GAZA 4PLCA 3QJ5A 4XZ3A 3OECA 3Q11A 5I9MA 5IXSA 1GEGA 3O03A 5JC8A 4MIYA 3NTQA 3OSUA 4IDBA 1U8FO 2LDBA 3DZJA 3D64A 4TZTA 3CZMA 1PIWA 1UR5A 3TN7A 3DTYA 4YACA 1YDWA 3GC6A 4CMIB 3GNSA 1R15A 3JYPA 4NJMA 3ZI0A 3L6EA 2HSDA 4XA8A 4U8GA 3KYBA 2X9VA 3SLKA 3ZHYA 1Y1PA 1IPEA 2C54A 1M6HA 3VZQA 5HWSA 2GR9A 4KUHA 3MTJA 3GQVA 2GLXA 4RVSA 4UAGA 3E9MA 5H82A 2HMTA 1UP7A 1PTJA 3TWOA 1Z82A 5T6BA 4BKUA 4JLWA 6LDHA 2TMDA 3Q9UA 1IHYA 1E3WB 2AE1A 3KEQA 3KVOA 4IDEA 2B4TO 2Q4BA 1DFHA 1GR0A 2O3SA 2DM6A 4XIJA 5JO0A 3DBRB 1LA2A 4LSWA 3RBVA 1E77A 4DUPA 4EW6A 1HYEA 2C20A 4PRLA 3IS3A 4RPGA 3TSCA 1LEHA 1GPJA 1GDHA 3KV3O 1YONA 3D3WA 1JWBB 4U0KA 1Q7GA 2PA3A 3CMMA 4BGIA 2FOIA 3JQFA 2GRAA 1NVMB 1KEWA 4DC0A 2Y1GA 4NMHA 4H16A 3G79A 3ITKA 4IIUA 2R6JA 1MC4A 1ZBQA 4U6QA 5KJCA 2Q1SA 3K73O 1SBYA 2CDBA 2WTBA 5DN9A 4BQRA 2LDXA 3NDJA 1ZFNA 2JCYA 3I4FA 4PIVA 4RGBA 3JQ8A 2PH3A 2B4QA 2BFPA 5FI5A 5IDYA 3KLPX 4CMAA 5F1OA 3I9OA 3WXBA 2RH4A 4CL3A 5JAZA 4DIBA 3JQFC 4QQRA 1ARZA 3WJAA 3WX0A 2B83A 4L4SA 5F3RA 4G2NA 3WMWA 4OL9A 1V9LA 5DBGA 2VWHA 3GEMA 4BV9A 3DBHB 1FJHA 1U28A 1HXHA 3H3JA 4ZU3A 4PRKA 4LISA 5F1PA 2DPGA 2J5KA 5L53A 2D5CA 3Q0EA 1B26A 3S55A 3RQSA 1PSDA 3PDUA 2OXIA 4D3DA 3O38A 3AK4A 1LBEA 1EQUA 1NFFA 3C7CB 4EJ6A 4XDZA 2O4UX 2QIOA 3AM5A 3JYQA 4FC7A 1PX0A 3UFXA 4KDFA 1JKIA 4RVUA 2P68A 2VRBA 3ONEA 1OBFO 3S2EA 1JVSA 3PWZA 3S2GA 3VPXA 3ZHBA 4OM8A 4CL8A 3ZCXA 2RIRA 3ZWNA 2NVBA 1PU2A 3EDMA 3EK2A 3PYLA 3HG7A 1YQGA 2XXBA 1HL3A 3CEAA 1GEEA 3LF2A 3OETA 3LLSA 4IS2A 3U49A 1XQ1A 4KWHA 5TF4A 1V3UA 4ND2A 3V1TC 4KUGA 1NQTA 3E82A 3QHAA 1H0KA 4J1QA 3H65A 2CSUA 4BGEA 3WJ7A 4UVHA 1GUZA 1MLDA 3AJRA 3NT4A 4I9HA 3GR6A 4S3MA 3KZVA 4ALJA 3PJFA 4LVUA 1WP4A 3V2HA 2HKIA 1CDOA 4GLOA 2DTEA 1ENYA 5KCZA 3DBLA 3BA1A 2YFQA 1X7GA 3MJSA 2J8ZA 5DULA 1HZJA 3C7AA 2AQIA 3ANLA 5KWEA 4OH1A 1J49A 4DIOA 3DEYX 3I9JA 3ZHZA 1J4AA 3ZWAA 4D42A 3I9KA 2NVWA 3DO5A 3PJEA 3GOHA 4L76A 2BHLA 1C0IA 3EY4A 2P2SA 2VWGA 2Y0CA 5AYVA 2Y05A 3EZYA 4A27A 2W2LA 1BXGA 1HDRA 1PZEA 3ZWPA 4BKOA 2BI7A 2NUAA 2HMVA 3EMKA 3DFZA 4IUYA 2VN8A 2G17A 5CP8A 1SB8A 1PJTA 1GU7A 1V0JA 4RVHA 3C3XA 4AJ2A 4RF4A 4IY1A 3ZNQA 4ALNA 3A06A 5EERA 2P4QA 3KETA 1YVEI 4FFPA 3U62A 3NEPX 4WNCA 4CMCA 4UEKA 3CE6A 3PFWO 3E8XA 1VJTA 2ZYDA 2BMAA 4BS9A 4CM9D 1O0SA 2QRLA 3BHIA 4XDYA 1Z74A 1ZH8A 2HMSA 1MXHA 4FJ0A 3LVFO 1N2SA 4YRAA 3GDGA 4G65A 4YBZA 3IP3A 3RC9A 1YBAA 3KSUA 3PJGA 1PL8A 3PYMA 1Z75A 3ZU4A 3JQBC 4GMGA 3C1AA 1U5AA 3QWAA 1EE2A 1FDTA 3RFTA 3KO8A 5JCJA 4BIIA 4IGEA 5MGBA 3AUAA 3BMCA 4UVIA 1ADBA 5HS6A 5JW6A 2EF1A 2HMWA 4QECA 4M1QA 3PGJA 2CUKA 1DAOA 2C59A 3ZW8A 4BL5A 1T1SA 4ND1A 2HU2A 2UUOA 3O9ZA 4GGPA 4J4BA 1ISFA 4MVJD 4WLOA 3IUPA 4UUNA 4A10A 3KYCA 4B7UA 5BR7A 1GL3A 3KHUA 3RASA 4MINA 4HX5A 3JQ8B 4DLBA 1YL6A 4RVDA 4P4NA 2IEDA 1N92A 3F1KA 4ROSA 1IL0A 3HN2A 2Y66A 1SMKA 1E7SA 1D3AA 4Y8VA 1Q7BA 4AJ1A 1YO6A 1PZHA 2UVDA 1AHHA 1U3VA 2OOSA 5TRTA 1ZJZA 2NM0A 1PJCA 2YV3A 1KERA 3GGPA 1N1GA 3JQGB 4AJNA 3K2BA 1NPTO 2DT5A 3EHEA 1MC5A 4OOEA 4N7RA 2E37A 4BNKA 4I8XA 1U2DA 2JCVA 1P45A 4OHUA 4M8SA 3WG9A 1VLLA 1YQXA 5JCXA 2VCYA 3GRPA 5G0UA 1EK6A 1HKUA 1HE4A 2WD8A 4QO7A 2YQ5A 4MP6A 1BXZA 4QUKA 4BO9A 1K89A 4FB5A 4QSMA 1DPGA 3OM9A 3PPIA 2DBQA 1DSSG 3F3SA 1NTOA 1DJNA 2FP4A 3JQAA 4NBRA 4D44A 4M49A 3OJEA 4R5HA 4DWVA 1EZ4A 2Y1EA 4ZJUA 3DMYA 4RZHA 8ADHA 3KTDA 1G0OA 1E1LA 1LDMA 3ZWWA 5C37A 5L7WA 1WPQA 4IQ0A 3KLMX 2BF7A 1HETA 3D0OA 5JO9A 4E2YA 4JBIA 1SEPA 4RCVA 4K28A 4UUMA 4O6VA 5HRUA 4LCEA 2OHXA 1O89A 1ENPA 3DBVO 3IKVA 3VPFA 1DFIA 3JQ6A 4A03A 4B4UA 3BIOA 4CMEA 4MVJE 4XKJA 5KTKA 1ISGA 3KBOA 5A03A 1QYDA 2RAFA 4NK4A 4R3WA 5TQVA 3D5QA 4CM6A 4A73A 4ALMA 1QG6A 5DCYA 2I9PA 3OIGA 1ADGA 3OIFA 4JXKA 3G49A 1JW9B 2Y1OA 2VUSA 4XEHA 3RROA 4MKXA 4FFRA 4O0LA 4TRRA 3OH8A 4DPKA 2HRBA 4BMVA 2JAHA 3GUYA 1YKFA 3F4BA 3VH1A 2ZJ0A 4YJHA 4E2ZA 2VUTA 5T67A 1XDWA 3BTUA 4YAJA 1DC5A 4ZQGA 3ENKA 2OO5A 3PK0A 3OP4A 3R1IA 1VJ0A 2Y67A 4FIZA 1K3TA 4CLXA 2ZYAA 3FF4A 4FFLA 4EUHA 1MX3A 1U5CA 4TKLA 4Z0TA 1B15A 3ZGYA 3JQEA 3KYDB 2UYYA 3BMQB 3W8DA 3ADOA 1G1AA 4U5QA 5DCUA 4DQVA 2PFGA 1ZJYA 1SZJG 2X9NA 4Z9FA 2SCUA 2VWQA 4OXNA 1Y6JA 1DLJA 1AE1A 1WDKA 2IYOA 2B5WA 4DQXA 1C14A 1BHSA 3IIEA 4IMPA 4B7XA 2OFPA 2ZYGA 1MG0A 1I0ZA 3RUFA 2PD6A 4R54A 3VZRA 4CMHA 2Y1CA 2Y0DA 4XD2A 3RVDA 3JQGA 4IDAA 4XGNA 2O2YA 2BH9A 2J5QA 3QA9A 1P44A 3CSDA 1XKQA 3JV7A 2ZB7A 2DLDA 4TRNA 4CMEC 3JYOA 3O4RA 4WUVA 4YJFB 1Y8RB 1W73A 2EGHA 5F1KA 4E31A 1WDMA 2GUGA 4R3NA 2WE7A 4NK5A 3F4LA 3RUIA 4NBTA 4GVLA 1ZO8A 4IJVA 4M54A 3R3JA 5L51A 1T26A 1N8KA 2YV2A 1N5DA 3WYBA 5L4NA 3D4OA 3T4EA 4CMBA 1SC6A 4RLSA 3AUTA 4UUPA 2RHRA 1UAYA 2WDZA 3AI1A 2GCGA 5KIAA 4KOAA 4CQMD 1E3WA 2X1HA 2C7VA 1H2HA 2A94A 3L77A 4M55A 1PQPA 3K92A 2W98A 2O3TA 3NDIA 1H9AA 3HADA 1HYHA 3RFXA 2VYVD 3T7CA 1M76A 2QG4A 4ZRNA 3PQDA 1XA0A 1SO8A 1Z6ZA 4DIFA 4Z0HO 1MXFA 3GVXA 1PGQA 2J5RA 2E49A 3VPGA 2BRUA 2XXJA 1DIRA 3JYNA 2ZTUA 3OJFA 1GCOA 2QX7A 1BW9B 4BVAA 3FR8A 4GWGA 1W4ZA 2P5YA 1PGPA 4WLUA 4XGIA 3TDKA 2B69A 1X1EA 4M87A 2AE2A 4L8VA 3QWBA 4CMIA 1HLDA 1YBVA 1QRRA 5LDGA 5BT9A 1KC3A 4CPDA 2JFHA 3QVXA 2FY8A 4YTEA 3L9WA 2PR2A 4ILKA 2P9CA 1OOEA 2P9EA 5JNLA 3UGKA 3H9EO 1T2AA 3DWFA 1DLIA 2I65A 5I9NA 1WLYA 1HF3A 3K96A 2GN9A 3QP9A 1I3LA 2FPPA 5L7TA 5FI3A 1YOVB 5B37A 3B1KA 3PZRA 1O5IA 1LX6A 2NU7A 3IP1A 2QRKA 3WGOA 4LW8A 4E21A 4BGUA 1PGNA 4CM8B 3JQBA 1ISIA 4KUEA 2FR1A 1U7TA 4GH5A 1WAMA 1ZZEA 3AUUA 3L6OO 4ND5A 4OKIA 2QW8A 3T4XA 3K9QO 4BNLA 1Y9EA 5JXWA 1E7MA 5T57A 2NNLD 5ITVA 1D1SA 3W8EA 2Q4EA 2EERA 3TFQA 4Y6PA 4Y9DA 4E5KA 4YVFA 5KVVA 4AJIA 4E13A 1JAXA 3WQQA 1XYGA 2Q2QA 1B14A 3TZHA 1HDCA 4OQYA 2BLLA 2DBRA 4BO7A 3E48A 3RSHA 1VM6A 4R1NA 1BTOA 3INRA 3HZZA 3HNPA 2VYNA 1R4MA 2PKRA 1X14A 3X2FA 1JKFA 4Y6SA 3ZNPA 4B3JA 5KJFA 1MP0A 1QLHA 3UCXA 4DLAA 2OZPA 1C1XB 3QVSA 1K6JA 2H1SA 1NX6A 3JQAB 2GZ3A 4CLDA 4BO4A 4PZDA 5B4TA 4OXKA 2D1YA 2D2IA 3GHYA 1KY5A 2EXXA 1EE9A 5L3ZA 5EJ2A 1LRLA 2VTDA 3K30A 3U09A 1GQQA 2EG9A 1MGOA 1FDWA 4HUJA 2VYVA 3ROPA 1DIBA 3BYZA 3DHNA 3ANNA 1NQ5A 4PGFA 5COBA 5FFFA 3I9MA 1F06A 5AXAA 4NDNE 3I6QA 4YDRA 2YV1A 4GVXA 4YWJA 1R0SA 3IDSA 2PZJA 1UJMA 2W2KB 3D7LA 3ORFA 4KQWA 2O4CA 1T2EA 3U4DA 4O59O 3RUCA 4TROA 3JCZA 3LT1A 2EP7A 4DPMA 2AMFA 1CJCA 2BFOA 1IPFA 4RPLA 1ML3A 3ZWVA 1P3DA 1A71A 4Q3AA 2FN7A 1BVRA 1X7HA 3S1LA 5IN4A 4CM9A 3P19A 1I2BA 3RU9A 3AU8A 1ZCJA 2PD3A 2VHZA 4E5YA 1H9BA 4IZIA 2IODA 5IF3A 2NTNA 3QLJA 1TXGA 1E6WA 3GHHA 4AJKA 3FTPA 3GT0A 3GPIA 3KM0A 5ADHA 4C7JA 3K31A 3CTVA 2X23A 3SX2A 1R66A 4R1SA 1ULSA 4HFMA 1XSEA 4RF2A 3HFGA 3RUDA
chains in the Genus database with same CATH superfamily
2GZ1A 1FNSA 1QH9A 2OHHA 1DIOB 3CNNA 1DC6A 1NKVA 3G8YA 3PC4A 2JKYA 1ZGJA 3U17A 3CO0S 2A7QA 4DMKA 3D0QA 3HBAA 2G77B 1ZXBA 1Q0QA 2BCJQ 2EHJA 4FYPA 4HLDA 4DCGA 2LKDA 3I2GA 1KFEB 3WIEA 4QQ8A 3S7ZA 1YJCA 1B8UA 4DTCA 5AJZA 3PF8A 1FCJA 2WD7A 2R5FA 3E2MA 4F5EA 2J31A 1QU2A 1CTQA 2AFRA 2X3FA 1ZK0A 3OVMA 4IHJA 1YKGA 3TLMA 1CEQA 3TNFA 3VO9A 2C9MA 5LZ2A 1VHDA 2IHJA 4QYIA 3QFCA 3U80A 1J9ZA 2AZDA 4XYEA 2VXCA 4NSNA 4NFLA 3K4HA 4F6CA 2F9MA 2BBSA 3S44A 4AL4A 1I30A 2XIQA 3UAWA 1RPZA 1E2HA 4YLYA 2C7PA 4LS3A 4J3JA 2RAPA 4ZPJA 1JXAA 2PCLA 3RC8A 2HWWA 2J9RA 3SZGA 1OFUA 3U9LA 1DX4A 2FJ0A 1OXUA 2FHSA 2H0AA 3R9WA 1KEEB 1JF8A 1F5SA 1UKCA 3KCQA 3P2KA 4UASA 3FTQA 3MJFA 1P4GA 1YMUA 1NVDA 3ETGA 5FOSA 1OUMA 1YR6A 3AF3A 3VYUB 2FR8A 3PE6A 4B09A 2QJWA 4L8FA 3HFSA 4D25A 3JD4A 5CVDA 3IT2A 2V7PA 2X8WA 1GRVA 3H6KA 5T8KC 4QE3A 4GKAA 2E82A 1Z73A 4DM7A 1L7AA 3NHYA 4NG4A 2XIJA 1VHWA 2WB4A 3PUZA 3QIVA 3ZD6A 4LF4B 1XZBA 2IUSA 3JASA 2C2YA 3ZNNA 1N5KA 1C80A 4BLPA 2XTMA 2GN8A 3AT1A 3URKA 1E9RA 4JEHA 2PU7A 2JI7A 1J90A 1Y3HA 4RTLA 2FEPA 1T91A 1RYHA 1TIKA 1W93A 3GYBA 1HORA 4YCLA 3CW9A 2CEKA 2I4LA 2C78A 1ZK2A 3FBGA 4OLJA 4QD3A 2W2NA 2R84A 3E81A 3FTEA 2YWFA 1K4MA 4MGYR 2GKSA 1SC4A 1KJ8A 2GAOA 2ZIFA 4DM4A 2JKZA 3WDSA 4YQYA 2QBYA 1SCJA 3DEHA 3BERA 1EWTA 3OBBA 1CUDA 3HNOA 1OVMA 4WXRA 2WYOA 2IHKA 4AJLA 1VKJA 3GN1A 4Y6OA 3TQFA 5JDIC 5AHRA 3IV9A 3OQJA 5EVCA 1CJKC 2V0NA 4P84A 2A57A 3K72B 4W1QA 1I24A 3LZDA 4BHTA 3NJ8A 3AEZA 3GEBA 3MLBA 4LV5B 1SJ9A 3DP7A 4X7PA 3KJIA 3TVDA 5KI6A 5AVZA 4M0MA 2GDJA 3QEAZ 2HK6A 3B20A 3L0SA 1TLTA 4KQHA 1CIJA 2KX7A 3IJPA 4HYQA 4RY2A 1L6IA 3OHSX 4ZANA 4S35A 4FYJA 3EYWA 1ZDMA 3OD1A 3D3EA 1HMPA 2ACVA 5CRIA 4I5FA 5G0WA 4CKBA 1ORIA 3KQKA 2YY5A 1WPRA 5BSUA 4TYYA 2XXAA 3WBFA 3HJAA 2B1GA 1KWKA 2PANA 1GZHB 5KJ6A 3OCJA 5I7VA 3THXB 1SCAA 1SXPA 3AETA 2I4OA 5DBIA 2Y9PB 3H0KA 5LBTA 4FEGA 4AZWA 1KI6A 1XB2A 1DT3A 1JH9A 3KDPA 2D0IA 4UE6A 5JC1A 3QVUA 1C0LA 3L2OB 1LQUA 1ZIXA 4NVRA 4DR3B 3GMTA 3AKZA 4UMDA 1PL0A 1N33B 2Z08A 1R8QA 5CNJA 2OENG 4O4JA 5TLSA 1QGUB 4ZAFA 3RNOA 1GARA 1LBTA 3WJ2A 1DDOA 5FOVA 3H9GA 3JVVA 3T5CA 2FJUA 1HE8B 1UMBB 1XEXA 3PFFA 5K3EA 3ME5A 3AHHA 1Z5UA 4GRIA 1JFSA 2Q99A 1SU4A 1MAHA 2Y99A 3OMXA 1T0JB 1Y6ZA 3SKYA 2D4AA 3LCVB 2P2LA 3Q72A 1PG0A 2BISA 1IY9A 3GCXA 4L5JA 4N8EA 4BMZA 3ONWA 3R3WA 2POQX 5JBNA 1LDYA 2H5EA 4CR6A 2QMUA 3DAYA 3ONVA 5F3WB 4L57A 1EHIA 2QVCA 3LBHA 1M1YE 2BPOA 4RZ2A 1U2QA 5KPDA 1XCOA 1OU0A 2W4MA 3LIPA 2VQDA 4LY6A 1ZI8A 1LB1B 3AEYA 1W5EA 4F5ZA 1SCNE 3LL7A 4AN0A 3AERB 1EFKA 2VSNA 4K88A 5C1OA 5FWXB 4KIGA 3RVBA 4P2BA 3THOA 4KYIB 1C8LA 1AU9A 1G60A 1WP9A 1V26A 4IDDA 1FX1A 3I39X 3NEAA 4BB6A 1VE6A 1CNFA 4W82A 3ONDA 4Q6BA 1OC2A 1HFKA 2IKQA 4MLZA 1Q0HA 1FRFS 4PFJA 4ZVNA 1H6DA 2ZB8A 3KPJA 3T7KA 3CUYA 3I8XA 1SZDA 1VMKA 1XA3A 1FSSA 4RMNA 3GRVA 3K5WA 5L95A 5DJ5A 5SV2A 4NICA 1ZVJA 3HJRA 4QC2A 2VK2A 1E6EA 1C2TA 1XZKA 2O3QA 1QF6A 4WBNA 3ORRA 2WP0A 3II6X 5DYGA 4O4LA 3KQYA 3O3NB 4QVGA 5EIAA 4ZVUA 3SR0A 5I7EA 3C8HA 2UXCB 3FZQA 1CJMA 1WEHA 1T5SA 1E1RA 1Q5PA 3ZCUA 1O95A 5IJ9A 1A8IA 4V1CA 4U7GA 4HWRA 3SQDA 2AMVA 1A8PA 1HWYA 4JUBA 4M0LA 5SICE 5EPOA 1DV2A 2GCEA 4O02B 4C4TA 5E8RA 1Y7HA 3MZ0A 4UULA 4F46A 4BVKA 3H8VA 3DFFA 3ZDDA 3DEIA 4G8DA 5CIYA 2ISSD 3T7SA 1Y9AA 3W4IA 1NLFA 1G4HA 1VE7A 3KVYA 3MTBA 4L6IA 5AUQA 5BSHA 1E4EB 1V9SA 2WOJA 3IX7A 1XAGA 2F3UA 5EJMA 1U2DC 1KZ6A 3VXKA 1ZVMA 1SQ0A 2YHIA 5E4JA 4M1KA 3WIUA 4BQSA 5BURA 4WADA 2PVCA 2KBFA 2QV7A 4FR5A 4ONEA 4ID3A 4QUEA 3OTOB 1MZPA 4UJ5A 2QN8A 2I1VB 4GMDA 1E9EA 3FNBA 2J3IA 2W2MA 4B17A 3H0EA 1W30A 3VVLA 4WJLA 5LIPA 2BTQB 2W58A 3E5HA 4AQYB 2WWGA 3R0QA 1W44A 1XMXA 3IT0A 5ALHA 1HX7A 3WKAA 4UBNA 1XJ5A 2PWBA 3U4QB 3ER8A 1HUQA 1Y98A 1F0YA 1ZGCA 2IPLA 2VLIA 2ZI9A 4OFWA 2CN1A 4PW0A 4D92A 2G5TA 2O54A 3S1SA 3QPDA 4XVQA 1J8MF 4QBIA 1Y80A 5EYPA 2E5WA 4HR7A 2O2SA 2P1DA 5IW8A 3V4LA 3AR2A 3TZBA 2O2JA 5GMOA 1JN0A 2WHQA 5TQJA 3T06B 1SHLA 1T3TA 4JBXA 4RL6A 5A3RA 5HRCA 3TH5A 3ILSA 1LZKA 4NZOA 5L4SA 4R1LA 3CB2A 3FZYA 5CB8A 1DRUA 3UC5A 4CQMB 3GRCA 4PO9A 3MS4A 1KMNA 2CUNA 1J8YF 4LVCA 1CEYA 4GKVA 5IS2A 1X19A 1PL7A 1O0CA 3ESAA 1A82A 1ZITA 3V9AA 4R5MA 1PQUA 1X8JA 3TIFA 2QL7A 2F3RA 2GKOA 4MYTA 1UM9A 4XW2A 3UHPA 1QS0B 1ZJ6A 4D97A 1YA6A 5KKNB 1R0CA 5I51A 5D86A 1KI8A 2VNHA 3ZJUA 1Z0ZA 1KEEA 4CCYA 2ZJ3A 3DFKA 1T4MA 1N2BA 2NN3C 3FMVA 1CZHA 1EFVA 1LK7A 2GTPA 2H0QA 4RD0A 1K4KA 5IN5A 3CEMA 5FV4A 1H2AS 4RHTA 3JAWB 5FUBA 3LA8A 2ZCUA 2H0RA 5EWJA 4JI7B 3PF9A 4GW3A 2ZZKA 5LZ8A 1KSGA 4RESA 3UHFA 3ZHCA 2AYZA 5TX7A 3N7TA 4F9FA 3UPUA 4ADSG 4BKPA 1JA1A 2QR2A 1ZOOA 4G1CA 2FE1A 1ZINA 5IP5A 3RE1A 5B6JA 1X1BA 5IFKA 1ECLA 2P0EA 2H00A 4L4YA 1FW6A 1IC6A 3MWJA 2IU6A 1RYBA 3KVRA 2XQKA 4K7JA 2X9GA 1FTNA 3CTMA 3ROZA 4EMBA 1E5QA 4B48A 4FMBB 4U2EA 1WMDA 2I33A 1QYCA 2QUJA 2JHGA 4QFBA 2K2WA 1Y81A 1K0FA 2ZT6A 5GJBA 3VC7A 4IIDA 4QUIA 3PFGA 2Z1NA 3KLOA 5K09A 1KOJA 1NHWA 3UJNA 5AW8A 3VH2A 1YJ8A 2YHAA 4DF3A 1ZNYA 2XCOA 1MJHA 1NBEA 3LL4A 1XXHA 5ED0A 3INYA 2PUGA 3KT8A 2X2PA 3BGSA 1UINA 1C7EA 5KYKA 1XMQB 1NPDA 3ABOB 4E14A 1UBTS 1VL6A 4DR6B 4GPEA 4BE9A 3PIIA 2ORED 4BMXA 1E7WA 2O52A 3D8BA 3H83A 2GCOB 3I0MA 4YCDA 3RGGA 3UMSA 1NWHA 3VV3A 1V1MA 4E5SA 2PUCA 2JL1A 2WZDA 2ZI6A 4RORA 2VTVA 4IXMA 2QX4A 3TBHA 1PKEA 2A6PA 3F3KA 4BWGA 4PLWA 3A3KA 3WYGA 3RHFA 1AK2A 7AT1A 1B3RA 5CD9A 2H08A 1BA3A 2XA9A 3GFTA 5H3CA 3KZOA 1FVHA 1QYXA 1ZMTA 3M4JA 2VSFA 2ETXA 4YRJA 3UM9A 2YDYA 3C8DA 5A5GA 3EBPA 2HIHA 5A3SA 5EHXA 5HTOA 4HWKA 1BYIA 3I4CA 3TBKA 3H1PA 3U7QB 1R5OA 1KQPA 2GZ2A 1NYRA 3QKRB 2IYAA 3DZ8A 4QDJA 4EYGA 2YW2A 4MGEA 2VIIA 2EWMA 1NUQA 3F6PA 3OFNA 1GLGA 1AHIA 1HSOA 3WRXC 1JPNA 3BXGA 4S1NA 3I2JA 1W6UA 5CT4A 2LRHA 2R3SA 1RQ2A 1XX6A 3BMOA 2OILA 1II8A 1QAQA 4WINA 4FFVA 4H1UA 3SYLA 3NXSA 3QVMA 3VKUA 4TWRA 3RSSA 4NIMA 1EFHA 1OAOA 1R6UA 1XHLA 3I04M 5AW5A 4DVJA 4NF2A 5IG2A 1YDEA 5DZSA 3OEED 2J3JA 4FE4A 1KVUA 3O4FA 4GEKA 4UEJA 3RTAA 4WVLA 2GETA 2X7JA 3STWA 1WA5A 3HDTA 3GNQA 3JATB 3RHSA 4BNYA 1UPBA 3Q10A 4MVJP 4RXUA 4ZKEA 5B1YA 4C2BA 2XUZA 3ILVA 2PXCA 1U9IC 2WSMA 4HDSB 3DLAA 3M81A 4D99A 4YASA 1AK9A 1SIOA 2Y0BA 1D4ZA 4Z86A 2YFHA 3G8CA 4CM4B 3JD0A 1LWOA 3KB6A 5I9BA 2QTTA 4PCAA 5ARBA 5A04A 5U9CA 3QOFA 3M6AA 4JB8A 3WL3A 3URMA 2P62A 3E3NA 2VYQA 5KYVA 1ZM4A 3DDUA 3QX3A 5GJVC 4B87A 1K2WA 4ZU1X 4ZOLF 1R16A 4B8ZA 2IBSA 2QXYA 2ORVA 3PVSA 1EJ6A 1P2SA 3ODGA 1JHPA 4YP5A 5A2QA 3JQQA 5AESA 3SC3A 2PT9A 4F4FA 3PXBA 3BGIA 5TT1A 3RUHA 1U2SA 1MBZA 4EPVA 5SZHB 1ULBA 1E7YA 2FG7C 4TMWA 3AF2A 2W6PA 5ADUS 4O4LB 3A1WA 2HA0A 2VUIB 3W2FA 2V7QD 4LOIA 1X1DA 4KP7A 2CNDA 3AM3A 2O07A 4GHWA 5AQEA 3SSAA 1GR1A 4WBSA 1NMEA 1UZAA 3MMXA 5KTYA 4QU9A 2CJYA 3WL5A 2JH9A 3A4IA 4GD3Q 5LMUB 3VTFA 3EW9A 4QHTA 3PL5A 1KJWA 4FHCA 3M83A 4BRSA 4B7ZA 2P3OA 3H2SA 4EJ2A 3ESDA 5J2TA 1LSOA 3NBZC 4LMBA 2FQYA 1LNQA 1WBJB 2ALJA 1KRWA 4YROA 3BQ9A 1P2GA 2QJRA 4BNVA 4IDNA 1MTZA 3HM9A 3KSRA 3HCOA 4A8JC 1AKEA 1GGJA 4MDHA 1EA7A 2RI6A 3KAPA 4E4YA 2GGSA 1GTRA 1DJPA 1BDJA 2CXRA 3JQAD 1GIAA 3EQZA 1XCBA 3ICOA 2RJOA 3GRKA 5FWDA 5TMEA 2YMLA 1P9LA 3I01A 1HE1C 2Z9BA 4OCZA 4BTVA 1XD2A 3ZU6A 1XJ0A 4JUAA 5T4BA 1J5EB 2FUKA 1A72A 4KWTA 3WDMA 4TM7A 5ALYA 1T8YA 3VH3A 3NTXA 5A5EA 4ZAYA 3I3OA 1TD1A 1E96A 4M0KA 5JXJA 1A7AA 2PYDA 4J03A 3MJEA 3WLRA 4CEIB 1V3QE 4DANA 3IQDB 4L8GA 2CV2A 2J3DA 1IEXA 1FPMA 2CFIA 3IE0A 3W3ZB 1C7ZA 5DFAA 3INNA 5LIRA 1LSSA 1PBNA 3NHJA 2O2CA 1E3JA 1MRNA 1SFRA 2J9YB 4HEJA 1G2OA 1PJAA 3BXHA 1XTQA 2JG3A 1KI7A 5FUVA 1HDGO 1S3SA 5C5IA 3DQPA 2WIKA 1QIDA 3L6BA 3EXFA 4J1TC 5JFOA 1CEEA 1VE5A 2GJAA 3H5NA 4IGFA 3ICWA 3SC4A 5H3LA 1JQ3A 2VF2A 3A3NA 4OX9Y 4KVZA 5AW0A 2ZATA 4LVNA 1XPRA 5LQRA 2H2HA 1OFCX 5A4MS 4GXRA 1KI3A 4Z3OA 1FRZA 3LHKA 1FFSA 1YNSA 4Z7QB 1T9HA 4AXBA 1YUBA 2PL5A 5CT8A 2C95A 2FPUA 2Q7OE 3T3DA 1SVNA 1PW7A 5DGDA 4C0AC 1OZ0A 1YK0A 2EKPA 2XVAA 4IF6A 3SS8A 3L40A 2WQZA 5M2QA 2YWBA 4W8HA 3ULKA 2EG5A 3JALB 3D3KA 3D54D 1OY1A 4G01B 3HWWA 2QVBA 1KI1A 1C4OA 2R6HA 1ZISA 2PLRA 1V11B 1PRYA 1RXUA 3AQ4A 4H17A 5F3DA 4EM6A 4GAEA 4KN5A 2IL1A 4YJ3F 4YY3B 1X6VA 3W7BA 5JWRA 1W0CA 3A27A 1YIDA 4J0QA 4P38A 2HMYB 3FBTA 4ZVSA 2IHVA 4N1AA 1W47A 4MP8A 1G9TA 1VFPA 1Z3CA 1J7KA 1M1UA 1S2MA 3OQVA 3Q98A 1Z18A 4JB0A 4JJEA 4II7A 4REMA 1JJ7A 5J9FA 3TQHA 5AHXA 2CVZA 1LW7A 3ZX4A 1WU8A 2XTNA 3KR0A 1EIWA 3QI7A 2V7QA 3QW2A 2FPRA 1JSRA 1JWAB 3GA5A 3GG9A 4O4IF 2EFEB 2VPPA 4UUOA 3SXJA 3UXMA 3LY7A 4AO6A 1LUAA 4DY6A 1VIVA 1WDLA 2ZBRA 3TJRA 1TYDE 5DM0A 2OP0A 5F12A 3M3HA 4K3UA 3M33A 1Q20A 1PWHA 4C3UA 2WWHA 2RB4A 4MUKA 4OMCA 3U7FB 1GLVA 1ZJ4A 4DAEA 4EJMA 1GKLA 4A8JB 2YBDA 4W5QA 3B2QA 5HZKA 1E3SA 2W70A 4ZZIA 1UC9A 2PUAA 2Z9CA 2Q49A 2R25B 1L8QA 3R3SA 3DV9A 3EFHA 1BW9A 3IP5A 1EJBA 5DP2A 3W06A 1VRWA 4E5PA 4IDFA 5J59A 4JEIA 3NNSA 2CNWD 3T99A 3EVCA 4BBZA 3F7MA 3X44A 1E4EA 1OYVA 5A9SB 3CX3A 3MJRA 4HAOA 1FSPA 2RKOA 3MHTA 1AB5A 3ZQ6A 4OSPA 3IBTA 1NC1A 1NY5A 5CT9A 2C2GA 5LXTF 2CDRA 3OPQA 2AZXA 1IZ9A 1LWNA 3RIGA 6GPBA 4CG2A 1S7CA 2JNWA 4N41A 2OBYA 4DIDA 1QG0A 2QTAA 1FYFA 1NBME 1UEJA 4QGGA 5EJ5A 4ZTBA 3VDRA 3C3DA 1FP7A 4MQLA 2O0LA 3KJHA 4R40A 2ZYRA 4ZO7A 4BNJA 5L45A 4IUDS 4R2HA 2V3VA 3CJQA 4LCJA 1NXPA 1E1KA 5DYNA 1QRDA 2KBEA 2Y9MB 3KWLA 3TYXA 3OIUA 3PITA 1IQUA 1JQBA 1TO6A 5HRAA 4RPKA 3MJ4A 5BN1A 4HDNA 5G0VA 4D9CA 3NDPA 2V6FA 3FWKA 1XD9A 4K6HA 2O8BA 5JDIA 1QCYA 5JH7F 4CM8A 1FYWA 1SUWA 3LGSA 1LSUA 3DKKA 5AHOA 5IFLA 1ISRA 2CY0A 2VBGA 3AO0B 4Q1VA 2YJ4A 5D3MA 1J2YA 2IEBA 2I29A 3LM8A 2XUPA 4WDQA 4EP1A 1MG5A 4BMOB 1C1XA 3CVYA 1JLMA 3KQUA 4GOKA 4KMMA 1EA5A 2AOVA 1AV6A 1XVUA 2G9UA 1UWLA 3RT9A 3PKJA 1HR0B 1MAWA 2WT4A 2EJCA 5KYUA 3GGGA 4BMNA 3IKJA 4YP7A 1SHTX 4O4HA 1M5RA 4TSRA 5ITWA 2PNFA 2QPOA 4LC1A 1EI9A 4OMFG 1E3TA 3F47A 2D62A 1DBRA 4RZXA 1ESNA 4OJNA 3VO1A 4CQJA 5LA6B 4ETWA 2V4UA 2ZAOA 4LGCA 4EA9A 3FMFA 2PRZA 5LYJA 1U7OA 1LCIA 3BWEA 2ASEA 4WZZA 5ENZA 3ZWMA 1SH7A 1ZCBA 2VH5R 4LXQA 4RQUA 4Q47A 2WTNA 1QCCA 4ZRDA 5K6RA 4TLMB 1H6AA 2J9FA 2LCIA 2YWJA 3NWBA 5E1BA 4HYEA 1K92A 4FI3F 1EXMA 2NOGA 4IZOA 4PHCA 2UYOA 4I4NA 1RT9A 3AG5A 3D6NB 1CFZA 4B2LA 3OQOA 3NI2A 1V9CA 3OF3A 2DPLA 2PXAA 2R7LA 4MDEA 1WXFA 2CV1A 3WGIA 2QLNA 2DULA 5HKKA 1LDGA 4DLPA 2QTWB 3E1KA 5AW6A 2J32A 2PH1A 2OO3A 2Q6LA 1DADA 2NZ2A 2VPYA 2XWJI 3C3EA 3GXBA 1V1RB 3M7IA 2YZ7A 1GFSA 2DUNA 1SHZA 3HB5X 3LQFA 1M1ZA 4CQLB 2YJZA 3H9QA 4CTMA 1GGHA 4IR7A 1XTIA 4PX9A 3WHPA 4LFAB 1XP5A 4U7DA 1FK8A 2WMDA 5AKEA 1U7UA 3VOAA 1F0KA 2N1BA 1ID1A 2Q1XA 3VDMA 5FUQA 2COUA 4DSOA 2DPMA 5DH9A 1CQPA 4BBAA 3W2TA 4LOHA 2OQIA 2W2LD 4JGBA 2C2BA 3F6BX 4UCXA 4EYOA 4G8CA 1H2BA 1OFHA 4L5IA 1VJDA 3DVSX 2JCGA 4UNRA 2R8OA 2HK9A 2GN4A 2IZ1A 1ATZA 2F8SA 3X2SA 3FHCB 4MCJA 4HADA 2WAAA 4NENB 1PFQA 3FWZA 4J7CA 3SC2A 3HTXA 2ZROA 5B7PA 4H6XA 4HQOA 1YRYE 2QVGA 3B5JA 3AVYA 1UKEA 4YNBA 4OQNA 2ZTHA 4WCFA 4PBSA 3T0GA 4GXTA 3MWYW 2AB0A 3NASA 4HUTA 1KZ4A 5JQGA 2HF9A 2WILA 1GY8A 1L7PA 1M5TA 4KXNA 5BP7A 1TVMA 1RSZA 3DUFA 2WJZB 1P4JA 3H5TA 4LZNA 5HPYB 1RZRA 1PEKE 3KYDA 4GLLA 2GBLC 4MI9A 4TL6A 2PUBA 1MX9A 4OU5A 1TEZA 4X1OA 1FTYA 4KBGA 1WZCA 2PGDA 2H1IA 3GIWA 5A0VA 3S68A 1EVYA 2WM8A 1GXSA 2OHOA 5DT9A 3WXMA 3G1TA 3ZIDA 3BMOB 2B0JA 2OLEA 3COZA 2GBIA 4PQEA 3MWDB 5AOCA 2AUTA 4TVOA 2RKWA 3GD7A 4TYMA 3SQMA 4ZCMA 1SOMA 2POCA 4XI9A 1HMYA 1PG2A 4PSUA 2AEEA 2BHTA 3QSGA 1QSGA 1DG1G 1VG0B 3LC0A 2XAAA 3MIIA 1APBA 3CY6A 3QYAA 2XZPA 2FZWA 4LNAA 3RVOA 4H1HA 4BLSA 3PCTA 1CLUA 4K6FA 2DVMA 3WLQA 4U63A 3T3IA 1P4RA 3HI4A 2AN1A 1NUPA 1DAFA 3GP5A 4FFBA 4BJ6A 4H77A 4DREA 5JSFA 2CNBA 3JZDA 1RKQA 2HN9A 1EXVA 3NAZA 4U7HA 3MFQA 4URVR 2C96A 4PG8A 5CA0B 1YQDA 4LRXA 3NYWA 3Q85A 1YRQA 3AUKA 3OQBA 3H2ZA 3H5VA 3HXLA 4KTVE 5E9QA 4AO7A 4DJJA 3PXGA 1XDZA 1N36B 4TKUA 5DM2A 1A7KA 2Q9UA 2KQUA 4OXIA 4LE0A 4DN6A 4WQMA 1T8UA 2XNHA 2NGRA 4I1OA 4CMKA 3V6MA 1EKXA 4M60A 1VL0A 1PG5A 2A5FA 1M2OA 1QGAA 1OXKB 2ZPTX 2QLBA 1GN9A 4PLPA 5BQ5A 1OTYA 3DF9A 5AVVA 4ESOA 1JQDA 3EDOA 3HMKA 2J7PD 1HDOA 1XEXB 1F2TB 3A1EA 2HK8A 3LX8A 4EUNA 2AJLI 4EEZA 4NJEA 3SC6A 1GPDG 4PNZA 5IT9A 4OYRA 1GDDA 1RWMA 5KQRA 3Q3JB 2AEJA 2XQJA 5FO1A 2QUHA 1Q50A 4JC5A 1XK6A 2RGNA 1X3SA 1SVLA 2FPXA 4AO8A 4A16A 3WYFA 3RAEC 2O8CB 4MGZR 2CLOB 1N5IA 1JDSA 4UXJA 4K26A 4HGZA 1S0UA 1JSXA 1RRPA 1VGQA 1ZOPA 2PRJA 5JJBA 1GZ3A 4JV5B 3ITEA 4NONA 2CCJA 4GBED 4KRXA 2RD2A 3T3OA 4FONA 1T6YA 4GOMD 2AWOA 4WT7A 5TVGA 2VDUE 3C3CA 4N40A 1E5VA 1G6OA 4KMOA 5DPMA 4UM5A 4AWXA 4Z1MA 2GFIA 1WD5A 2PA0A 4LJ9A 4YH1A 5KYXB 1KEKA 1YQ9A 3KELA 3CIOA 3TF5A 4KKVA 4CZ2A 3N3BC 3OZWA 3OLVA 1OU4A 2Z6AA 1IU9A 4GI1A 3ANXA 4OQLA 3H7AA 4G81A 4WZBA 4GSKA 3W9BA 4D79A 4RJ2A 1T4CB 5DX0A 1FSFA 2QMYA 4I5EA 3SZMA 1NG1A 5ER6A 3R20A 3LC7O 5BSGA 1JFRA 2H1LA 3IVMA 2XB9A 1W76A 4BKRA 2NSLA 1X92A 4JLOA 4XWKA 1K88A 4N8DA 4Q66C 3NJ4A 1H5QA 4RJJA 3I83A 2HHCA 4I3GA 4EW1A 2I91A 3BZUA 4NCKA 4N6NA 1NV8A 1G7TA 7ABPA 1KDPA 1L5ZA 1RI4A 1O96B 1E9CA 1L0BA 3RS8A 5FADA 5JAUA 5K6AA 3ELBA 2FKNA 4IF4A 4QDOA 2BSAA 1FLDA 4QHSA 4HAUA 2IF0A 3GLSA 2ENWA 1IY2A 1TKAA 3E2IA 3K9NA 3MINB 1YDGA 4ETNA 2XMPA 1XLWA 2AIRA 4UE2A 3HNRA 2WU1A 5CG2A 1H1DA 4I6JA 2C83A 3RC7A 1X80B 4GO1A 5ESWA 3S2IA 1UEXC 3U0BA 5ES3A 1ZU5A 3SDSA 121PA 1XZFA 4Q3EA 5FR2A 2QN9A 2VBIA 2YIDA 1CJSA 4UOEA 2VHQA 1HE2A 1RRFA 1RQXA 2AI3A 3M3PA 3ZD8A 5LYJB 2A9KA 3I52A 4DVGA 3R9KA 4HX9A 1VFNA 4QGSA 4HAVA 1QB8A 1OXSC 3U40A 4D9JA 4NAHA 1SK8A 1EM8B 3W05A 3C1TA 2WHYA 4C7MA 1I3MA 2D3TA 1HLFA 4IJKA 1Q0LA 1RFLA 2QF7A 2PZBA 2W2KA 2B37A 5K0LA 1SIUA 1X9GA 2C7GA 3X43A 5FTMA 5I8WA 1DAMA 2X58A 3KFVA 2BZSA 5DHUA 3C5HA 5BQFA 4RTPA 1YRBA 2DCMA 4G37A 4Q9HA 1OI2A 1VSVA 2AQKA 1QFSA 3ROEA 3WRXA 1Z47A 3FMOB 4LWZA 1CZLA 1BG6A 3PEWA 2VDMB 3OQPA 1SHKA 4MI6A 2PX0A 2WYHA 3DT9A 3L18A 3VR4D 1P7ZA 1JAZA 2OB1A 2P6UA 1N0UA 2FWJA 2XB4A 4CR7A 5FTLA 1XMVA 5LZ9A 1ZOIA 2HJHA 2A33A 2ZXEA 4ZU6X 4MXDA 2GXAA 2Y4OA 4WXMA 4XR4A 1XBTA 1DBWA 4W9RA 1DCKA 1V6CA 2VT7A 3DP9A 3IH5A 3MOGA 1X8XA 2ZRIA 4WLNA 3K0CC 1NFQA 1Y5LA 1SA0A 4DDUA 1NATA 2ZE6A 3R0JA 3ZUGA 1XA4A 4KH0A 3U4AA 1T5DX 5L3SB 2FUNB 4MIOA 1WX1A 1EB9A 1M73E 1DWPA 4OIMA 1ZJWA 3NRCA 3QELB 3AHDA 4KRGA 1PZNA 4GR9A 5ENDA 3CNOA 5KSOA 1XUOA 2HT6A 2OGUA 3ZK9A 1TQ6A 1Z83A 5C8ZA 4KE8A 1LLDA 1FE8A 5BRAA 3GU3A 4N9QA 2C0PA 4DJDC 2WINI 4Z1MD 5JQGB 4Q02A 3VR5D 4DEYA 4R1TA 3NS7A 4P22A 1QKKA 3RRBA 1PEYA 4XB1A 1SU8A 3FCAA 1FP4B 2C61A 1TB4A 4IFEA 3R8CA 4I14A 3UHJA 3FSJX 5EUMA 2PX4A 1P9WA 3OPXA 2BZ0A 2IWRA 2XWQA 4BVBA 2KW5A 1PT9A 5U4XA 1MIOB 2OXRA 4DEVA 1XDBA 2GH1A 3RIEA 1UK6A 1T4BA 5FOWA 3IR5A 1JEOA 4ZT2A 2FMFA 3R9IA 3KYJB 4D0GA 5D5PA 3KB2A 1EXDA 4R84A 4G86A 4PZLA 3I0ZA 2F59A 1WB9A 2ZREA 1AKWA 1Z7WA 1BAPA 1RPTA 1RYYA 4KQEA 1QIFA 1LNZA 3DMTC 3OU7A 2QROA 4J9VA 3TW4A 4W7SA 3PKIA 1KVTA 2B1QA 2X8BA 3ZQ4A 3FFAA 2A0YA 4P0QB 1GYPA 3HRKA 4B3DA 1KAHA 8LDHA 2C97A 5F98A 4IO0A 1QJ4A 1W94A 1KRHA 1VG1A 2CFSA 1VL8A 1M0TA 2EKBA 2J7KA 1CRWG 3PC7A 1CQIA 1T2CA 4MWOA 4PX3A 1O6BA 2NTJA 2VDJA 2EQ5A 3ET5A 1JLSA 4GPBA 4PLYA 4CFSA 2QZZA 3VKVA 3FFTA 5FF9A 3SLGA 2VJCA 3SOPA 1Y1LA 2C2ZA 2J7PA 1WHSB 2WSIA 2FVYA 3OY7A 1BZYA 1ZD5A 4IJUA 1NN5A 2WAOA 5AKIA 1CY8A 1R9GA 3GARA 4CJXA 5AJHA 3E03A 1ZVVA 1U7WA 2ECKA 1S2OA 2ZG6A 1RWKA 2DQKA 2X7XA 1UPCA 2G9RA 2Y1KA 1X8LA 1JBEA 2L42A 1JGTA 3BB1A 3F6SA 1G3MA 3M2TA 3JAKB 3PZBA 3BN3A 4LDJA 5REQB 4WFJA 1KDRA 3QY0A 5IH7A 5JS6A 5HS4A 5JHGB 2W0MA 4DJEC 3KE9A 1JB1A 1M2FA 2NV6A 2JIBA 4MX8A 5HDBB 3MD9A 5GZ1A 1NDUA 4P08A 5L4LA 1JZSA 3DHVA 1F7VA 1R8JA 5K3FB 2MSNA 3FYSA 5CTAA 4B6JA 4M9CA 3EPPA 1HZZC 2QTFA 2Z04A 4FMDF 4MAMA 2OAGA 4FZRA 3AW8A 1PTKA 1H6CA 1HO3A 2OSBA 3IELA 4MS1B 4R8LA 5C46F 3TFOA 1SCDA 3E84A 4OJMX 3PNPA 3U4MA 4ZDKA 1PKXA 4Q4AB 4DE5A 3H9UA 3D8TA 1L7MA 1QV7A 4UKDA 5EQDA 4MVWA 4EL5A 3DBRA 1BFDA 3FAKA 3EFBA 5D87A 4IIEA 1J2RA 1PNTA 4EPXA 1GKKA 2H59A 4QTYA 5K7SA 3TK1A 1RADA 2EJTA 1R8YA 1KDZA 3MGKA 2JJ2A 2G40A 2IUUA 4H6WA 2VAMA 3GGDA 3KPYA 3RDPA 3GIDA 4PVCA 3CT4A 3K70D 3K15A 3JXEA 1KI6B 1SKBA 3AJ9A 1WW8A 1RWQA 1FX0A 2OMKA 2JVJA 2W6OA 5IJAA 4YAGA 3A9WA 4F6LA 5BW5A 5ETJA 2AG6A 4YQFA 1YF3A 3A4VA 1G20A 3GUVA 3LYUA 1BXRA 1YU9A 1Q95A 2ZI4A 3O2QB 5HK8A 3RS7A 4B34A 3HBLA 1U90A 5KJEA 4XYBA 1K5GA 4P81A 4RDHA 5AI5A 1U0LA 1G8YA 1L4EA 2JGJA 2Q2WA 3SE0A 1E4YA 3WLTA 5THQA 2VK8A 3D2AA 4KWIA 4R9NA 4TV8A 5FNVA 3WWOA 4BE7B 4Y0AA 2R79A 2H4HA 3W1WA 4R8MA 2I6XA 1J70A 4B6GA 5KVCA 4JCOA 3LZ6A 4XGKA 3RG8A 4YYZA 5BMVF 2R9VA 3IAFA 1XU4A 3UFXB 3BE5A 1P5HA 4EF4A 3IUBA 4YHHB 4YJ2A 1VBMA 3QVOA 3GUUA 3WSTA 4RSGA 1O96A 1EEHA 2G07A 5DF1A 4G0YA 3BWBA 3ZZNA 4L7VA 3ZC3A 4X3OA 5HJ7A 3AINA 4KR9A 1GL7A 4Y7CA 2B8WA 2C7OA 4AICA 3OTIA 4RFSB 3NWPA 3H11B 3R09A 3WFJA 1DRVA 4YALA 4LJSA 4W5RA 3OTQA 3ZW9A 4V0SA 4LXIA 4X44A 2BDTA 4NEQA 5ECDA 3EIXA 1BEEA 1SOWA 3FWNA 2HHJA 4D5GA 4UM7A 4JP8A 4EDFA 4OQMA 1C5KA 1P3JA 4J0EA 3DB1A 2I76A 2PUFA 5FTWA 3LC2O 3R6LA 1XD2B 2P77A 3ROFA 7GPBA 5KO2A 3AY3A 3IV7A 4DG9A 4AG6A 1IHOA 1TA0A 4UAJA 5DGHA 2FEAA 1NSTA 1T2VA 1CHDA 2R87A 3BGVA 1D7OA 3FFXA 3OT1B 4NOKA 4ER5A 1JR2A 1QV6A 1O2DA 2IXFA 4NHOA 1ENOA 1N4DA 1HTBA 2VS1A 3DKIA 3FPJA 1Z28A 1VECA 4OVKA 4CODB 2V7BA 3OQ6A 3G2QA 4IQ8A 3PNLA 1TJYA 3PEFA 1JT2A 4BCCA 3L1VA 4KV7A 4NLLA 4RTQA 3OQ1A 2AKAB 2VDRB 3PXDA 5LMNB 3ZCSA 1VL5A 2CKMA 5U4QA 2DTDA 2YIMA 2I3DA 1G18A 1I5EA 4RJKA 4UTVA 2ZUTA 1YFJA 3CFYA 1N2CA 1SCQA 5EIWA 1XKXA 5DWVA 5JBQA 4I6EA 3QUQA 4ARZA 3TQQA 2IXGA 1RM4A 4J7AA 1M1XB 1R74A 5KU7A 4RMHA 4K2HA 3A70A 3V3TA 3SX4A 1CUYA 3VYRB 4CQMA 5BV1A 3CLTD 2HAEA 3RC1A 1CVIA 4MEAA 4Z53A 2WU8A 3A6PC 2OCKA 1FDUA 2O5RA 3C8ZA 3OTGA 3ETHA 4J3NA 1FS5A 4HEA6 2Q62A 3VR6A 1E2NA 1TADA 3B8HA 2HF7A 1W36C 3QMVA 4QRDA 3AY6A 5IAEA 2FW7A 2HJVA 2LV8A 2VJNA 4H18A 2OE2A 3QKUA 3RJ5A 3DLTA 5LUBA 3RWOA 1HDXA 1T0UA 1LVUA 5KB3A 3KZCA 3HL4A 1JXOA 3TIVA 3MG9A 4A92A 3EJWA 5AW1A 3AL3A 4URFA 1L5HB 1PJZA 2FH5B 4U1RA 3HDVA 1TEVA 3S1AA 3DDOA 4MLCA 3GZ4A 3JAWA 1XDGA 1FXWA 5DO9A 4RULA 4NZ9A 1PEDA 4YMWA 2GTIA 2R00C 4K9LA 1NYLA 4NZPA 4TMXA 2X9QA 4UBLA 4AMBA 5LN1A 1YQWA 4AY5A 1BA2A 2J6CA 4HP8A 3NORA 1L7XA 1U3DA 1WXIA 4D9NA 3QLUC 3BCRA 3S6JA 4FNOA 1F60A 4LZWA 1PK9A 3ANTA 2G71A 1BRTA 3MMZA 3PPWA 1F48A 1YS1X 3M6MD 4IIBA 5DBFA 1UANA 2BONA 5TPZA 5HQ3B 5L9AA 3EN0A 1EK1A 1L4GA 2A1TS 1ZD3A 2P2GA 3GJ7A 4KMSA 1O7JA 4N0DA 4UVGA 1Y1TA 2GS9A 1YL5A 2Q8PA 4XRRA 3ZCTA 2L17A 1TJPB 2QMHA 4Q3DA 4C21A 3SBOA 4NMWA 3M5DA 4C4SA 2XSZD 3SMVA 1Z2DA 1FUUA 1F38A 1WCIB 3AVWA 2HYDA 4LNHA 2ZANA 1T9CA 3EFEA 2WJVA 3SEZA 1YGYA 3OQMA 2QQFA 2HX1A 2R8EA 3OO0A 3TCKA 4QIHA 3NVMB 5LOVF 3GEEA 5DEIA 5BUCA 4G0WA 3IPXA 4LMPA 1XWWA 2P2DA 1OWOA 3WNDA 1GUFA 1EMDA 2YFKA 2ZK7A 3O8OA 2AG8A 1KOGA 1QX4A 2RHHA 1NW4A 4UZSA 3HBNA 5JYEA 3SOZA 3W5CA 1UMKA 3ICVA 2MR5A 1X13A 2GFQA 1G21E 4G0OA 5IDVA 3M6LA 3L0OA 4CCAA 4E7OA 3E4CA 2Z4RA 1YR7A 4NQZA 1F2VA 1OFGA 3DVLA 2VHXA 1UOOA 3VPAA 2UVQA 5BO5A 4RLHA 1YNOA 3T1QA 4I5IA 3CX8A 2Q0QA 2JIZD 2QXTA 1GU0A 2QDXA 2WF5A 3A9CA 3KNZA 4L15A 1TA9A 2PXXA 1UFQA 1GTG1 1UL1X 4QYWA 2M1XA 3QW4B 1A9SA 1P5FA 2H1RA 4NDZA 5F33A 2PJRA 2GRUA 4EJSB 1WUYA 5KSWB 4DCSA 4R2JA 4LF6B 1E2IA 5ICMA 4NXMB 1DC4A 3QLVC 3M89A 1AZSC 3M6FA 1LSJA 1FSGA 1OZAA 2CE7A 2AJTA 2WYUA 4KCGA 3I5UA 2RJNA 4RQTA 3T0IA 3WYCA 4AK9A 4AZ3B 2FSHA 5JCOC 5COAA 1A5AB 2ZT8A 4GR4A 4ZYXA 1H5UA 3C7KA 4JHXA 4MO9A 5SYNA 3USZA 4HSGA 4OUDA 2NSHA 2PY6A 1EPUA 1JDNA 2BRUC 3PDCA 4PG5A 2C58A 1FMTA 3L0BA 1WOYA 2VJMA 3D6VA 2HQOA 4DR7B 2F4NA 4OQDA 2XDQA 2BKAA 3QVGB 5ALVA 3LSTA 2PRKA 4UMFA 1YJBA 2CEAA 1UK8A 1XZ8A 2W90A 1DJLA 2V7WA 4E2FA 4LTMA 4HNAB 4LX8A 4F8EA 1KTVA 2D3WA 5CHEA 5BXQC 1QQ5A 5JWOA 3EIQA 1RJEA