3H3FA

Rabbit muscle l-lactate dehydrogenase in complex with nadh and oxamate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
331
Chain Sequence
b'AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Modeling of isotope effects on binding oxamate to lactic dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 107
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h3fA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3h3fA02
4KUGA 3P19A 4CUZA 1H5QA 5KJ1A 3V8BA 4DYVA 3GRPA 2OGUA 4FGSA 1SB9A 3GG2A 1LLQA 2X4GA 5HM8A 1DIGA 1U3WA 3WYBA 4BGEA 1VC2A 3QW2A 3GMSA 2AHRA 3NV9A 2BRUA 1PEDA 2NUAA 3PYMA 4CV0A 3ZGYA 4BNMA 2CVZA 4NK4A 4B7XA 2W2KB 1FJHA 2JJYA 3EZLA 4D43A 2VHYA 4CR6A 1LLDA 4IGEA 4RQUA 1XQ1A 4OAQA 3RWBA 2FR1A 1WW8A 5TJ9A 3F3SA 3CZRA 3OIFA 4NG5A 4MKRA 2NM0A 2OL4A 3M2PA 4DC1A 2A94A 1LRJA 3E9NA 4TZKA 1ZKMA 3I9OA 4MOWA 1A5ZA 2PH5A 4L74A 2YFQA 4P8RA 2DC1A 3JYOA 4J1NA 4UVEA 3VKUA 4CMEC 1HEUA 1R16A 1MG0A 1BMDA 3T4XA 1P77A 1NR7A 1N92A 4AJ1A 3Q11A 2HRZA 1GU7A 4XYEA 1CQJA 1SBYA 4MVJF 3WWZA 1PGNA 1B0AA 3KM0A 2Y1DA 4F45A 1JQBA 3KVOA 4E5YA 1I0ZA 3KB6A 5JMPA 4J16A 3VAZA 3LLSA 3I9LA 3L07A 5COAA 4YTEA 4MVJD 2PA3A 1GCOA 3CTMA 5CHEA 3QE3A 3U62A 4WASA 2C2YA 3I5MA 1PJBA 2PZJA 4PZEA 5ICSA 2EV9A 2PLAA 5IDXA 3BTOA 1MC4A 2V7PA 3I9JA 3C8MA 4R3WA 1HT0A 3FHLA 3TF5A 3GVXA 2X5OA 4Z3KA 3I3OA 2ZKLA 3DTYA 1YVEI 1CF2O 2AMFA 4GPD1 3V1TC 4BIIA 4NFHA 5IZCC 5L4NA 5FI5A 3ETDA 3FWNA 1P1KA 1PS0A 1IULA 1G1AA 4FR5A 3RJ5A 2YQ4A 1E5LA 4IQGA 4YT8A 4EZBA 2I3GA 3GDOA 3F47A 3RC9A 1XGKA 3OQBA 4CM6A 2P5YA 3ZWBA 5ILGA 2H5LA 4BO0A 3KEOA 3UF0A 2OP1A 2D59A 2W2LD 2DBQA 4YRBA 1BDMA 1T1SA 3H7AA 2A92A 5DULA 1DLIA 4LMRA 2HRBA 5BR7A 3MJCA 1W6UA 3QWHA 3JQBA 5K6AC 4MVJH 5ICMA 3DTTA 3EY4A 4M49A 2EP5A 2I3AA 3ADOA 2JD2A 4CM1A 4DA9A 2PKQP 2J8ZA 2Y99A 3JQCA 1FF9A 4ND1A 2GERA 3TFQA 1EQ2A 2EW8A 3U49A 2GSDA 2V6BA 3PTZA 5TIIA 4IJKA 1GD1O 3E03A 3MEQA 3F5QA 3HG7A 4FCCA 3DAFA 2YUTA 1YXMA 2HK7A 3DOOA 3FNFA 4M54A 1X7HA 1L1FA 4MVJE 4IDFA 3PLRA 4HFNA 2CDAA 1GUYA 4G2NA 4RPKA 4ZQEA 1XIVA 4OQYA 4RPGA 4W9NC 1U3UA 5A5FA 1H6CA 1FXSA 2AQIA 1ZK0A 4Y98A 1PU2A 1YONA 3C7DB 4AJHA 1YO6A 3D4NA 4QUKA 5A06A 1LA2A 1VKOA 3EAGA 3AM5A 4WLVA 5TGDA 4J90A 2JFGA 5DCWA 2RH8A 3OIDA 1IOLA 5JAZA 3JQ9C 3RC2A 2VYND 4IZHA 4GQAA 4UVHA 2AW5A 1GYPA 4DXHA 1O5IA 2LDXA 4H15A 1NPYA 4Z0TA 4PRLA 3WYCA 3L6EA 1ZMTA 2P4QA 5HBRA 1JN0A 3CMCO 1PWXA 4PLGA 4BNKA 4XYBA 4FW8A 1WMAA 4YAGA 5GZ6A 4NBVA 5CEJA 1DAPA 1NPDA 3VZRA 3DMTC 2C54A 2E37A 4GWKA 3ST7A 3NT4A 9LDTA 4OXKA 1HXHA 3WGIA 1DLJA 2OFPA 1ENOA 1CEQA 1SMKA 1U5AA 1YL6A 4BB6A 3D3WA 2H6EA 1OMOA 1I10A 1PZEA 3JQGB 2R00A 1BDBA 1H0KA 4ZQBA 5EQFA 5KKCA 2C5EA 2DU8A 3ON5A 3WDSA 4GVLA 4NHEA 4OXNA 3HDJA 5F1OA 4A5OA 1A4UA 4BKUA 3DBHB 4P4NA 4K6CA 4RF4A 4UAGA 2JCVA 2FN7A 5TX7A 1UAYA 4JX8A 3LT4A 1JVSA 4CMIA 1NVGA 5JBIA 1PQWA 1UXHA 1WAMA 4XGKA 2CF5A 2PK3A 3BZUA 2O3QA 4HKTA 4YJGA 3OSUA 1GUFA 3WGZA 3PGXA 3OJ0A 2O2YA 4RLSA 3GAFA 3GRKA 3RKUA 3ZWNA 1XSEA 4J9UE 4MVJP 2PD6A 3O4RA 3AOEC 3WG9A 3ZWWA 5CEFA 2VZ0A 3GNQA 5T5QA 4RZIA 4IINA 5DCYA 1I36A 2VWGA 3NJ8A 4CM3A 2O3UA 1DIRA 3D64A 1D4FA 4YQZA 3ONFA 2Y0EA 3DFUA 3PVZA 4MPDA 1P1RA 4WEOA 1B16A 3IL2A 2BFAA 3K5PA 3K2EA 4JJFA 4CJXA 4BNXA 1K6JA 4N18A 5CDUA 1IPFA 3GFGA 4J91A 5KNLA 1MP0A 4BO3A 2B5VA 3EZYA 5IG2A 4CL3A 5JW6A 1TB4A 2R2GA 2AEJA 2YV1A 5U9CA 2EEZA 2X0RA 3L4BA 3WFJA 5COBA 1U5CA 4N5MA 3DO5A 4FD3A 5ENVA 4J49A 3UGKA 1P1JA 1YL7A 3G49A 3TL3A 1I3KA 1DFHA 3RC7A 1O95A 1KY4A 3EGOA 1KEPA 4BO5A 1LDYA 5KKAA 4ONEA 1SEPA 3E5RA 2ET6A 1BXGA 5HTOA 3HB5X 3ETGA 3B20A 3QA9A 2TMGA 1YBVA 4XJSA 4OL9A 4CM4B 1GPDG 4U6SA 1B15A 1SC6A 4E4YA 3JQFC 3LU1A 4YJHA 4QO8A 4CMKA 4QSMA 5A3JA 2XF8A 1BWSA 3WJ7A 1PTJA 2ZCUA 1C0PA 3M6IA 4UEOA 1KEWA 1CETA 4CUJA 1EFLA 5L95A 4U7WA 1J0XO 3C85A 1NYTA 4Y6PA 5EN4A 1F12A 4MP3A 3WGGA 4PLZA 5I9NA 3S55A 1Q7CA 1FDUA 4ALKA 2CF6A 4BO4A 4J1SA 1SZJG 2QYTA 3ZU5A 3GVPA 4YJFA 3LDHA 1PJ4A 4EW6A 3GH3A 2PZMA 3JYQA 1ZJYA 4XDYA 4MVJI 5JSFA 3AY3A 3ITKA 5DN9A 3QVTA 1UXKA 3LC2O 1K3TA 3DBLB 2DPGA 1YL5A 4IS3A 4KDFA 1H93A 4F46A 5T67A 1N9GB 2DBVO 1DSSG 5CG1A 5A9SB 2SCUA 3ZH2A 5B4UA 5JMWA 3JQ7A 4PLHA 4EJMA 3GEDA 2J3JA 1E7WA 1PS8A 2VRBA 5JFOA 3E48A 3PHGA 3E8XA 4OOFA 3MOIA 5KJFA 2GR9A 4TKMA 4ND5A 3PZBA 1E3IA 4CMHA 1PZHA 1QR6A 1PGJA 1ZH8A 3SJ7A 1C0KA 4OO3A 4LK3A 1EDZA 1RM4A 3I9NA 4AJEA 1XHLA 2CD9A 4MIEA 3V1YA 2CMDA 5IXYA 1XLTA 5TF4A 1HL3A 3STHA 2OO5A 4EEXA 5ITVA 4CR8A 3H9JA 1BXKA 3DOCA 2ZQYA 3Q9NA 3RCBA 4EUFA 4WLUA 1JVBA 3QWIA 2EKPA 4WCFB 2BGMA 3GNTA 1YS4A 1J4AA 1GADO 4CL8A 1U28A 3MJTA 1MB4A 1ZUD1 1VM6A 3Q2IA 1LBEA 1LSOA 4R3NA 5LDGA 4E3ZA 2PGJA 4GBJA 2A35A 1EVJA 1QSGA 2G82A 4XCVA 2DBZA 2EW2A 4B7UA 4C4OA 4MVJA 1Z7BA 3I1JA 2PKQO 4LVUA 3A06A 1GV0A 2Y1CA 4OXYA 4BNLA 2VRCA 2OZPA 4NJMB 4DPLA 5L45A 4ZICA 5MDHA 3DZJA 4IJVA 4YWJA 4I9HA 2BELA 1BW9B 2V65A 3PEFA 2C29D 4D3FA 4PLFA 3ENKA 2YHIA 4ZVVA 3VH2A 1AGNA 5C7LO 1R4NA 3ENNA 4A03A 3Q6IA 3C24A 3OIGA 2R6JA 2D5AA 1TT5B 1G0OA 1DIBA 1K0UA 3D0OA 1YKFA 3Q1LA 1VL6A 2FR8A 2X0NA 3C7CB 4U5QA 4BO9A 2X9NA 1DRUA 2WD7B 2Y1FA 1LLCA 4O59O 2DFVA 1LRKA 4BNZA 1GYQA 1MA0A 2Q2VA 4J7UA 4W7IA 4B3HA 1JWAB 3ONDA 3ZHXA 1AXGA 5A04A 5KWEA 4II2A 1LXCA 1IL0A 4XWYA 3VVCA 4Z0HO 1Y5MA 5DNAA 2VWQA 4WCFC 3U0BA 3JD4A 4XQCA 1XELA 2ZB3A 3ZWOA 4DLLA 4ZRNA 4ZA2A 2W2LA 3G1UA 5G4KA 3WSVA 1RJWA 3UN1A 3ONEA 1EUDA 4XQGA 1PQPA 2B4TO 4C7KA 2C82A 2C0CA 5CDYA 4IQ8A 3U9LA 1HLPA 4IDEA 1KEUA 1P74A 2BH9A 2QRJA 2VWPA 4FOSA 4IDAA 4I9UA 1LDEA 3PWZA 3O8QB 2DFDA 1DJQA 2HSDA 3ETEA 2F1KA 3PDJA 4P22A 4TSKA 3V1UA 3R3SA 5G0WA 3NGLA 4BKQA 2I66A 3EK2A 1ULUA 3UFXA 3FPLA 5CPBA 4HV4A 4E0BA 1P3DA 1YWGO 1IUKA 3NT2A 1H6BA 3PGJA 3ASVA 3BMQA 3WICA 3SXPA 4ND3A 4E13A 4CLOB 4J0EA 4Y6RA 3NYWA 2B4QA 2HKIA 2HK9A 4Y9DA 3EYWA 4A0SA 2HMUA 1WVGA 4FFPA 3DZBA 3HDQA 3CUKA 2O3SA 3KYDB 1JU9A 2NADA 3BMNA 4BMSA 1Y6JA 3JD2A 4XQ9A 2J5RA 1UP4A 1YOVA 3GG9A 6LDHA 3C1TA 2P5UA 2VHVA 3CINA 1C3VA 2VYNA 4UUMA 4ESOA 2GO1A 2I5PO 2WMDA 5GMOA 4KWHA 3JV7A 4IDCA 3S2FA 4M55A 1N8KA 4ZQFA 4OYRA 2GN6A 1HE2A 2PNFA 1UR5A 2X0JA 3NDJA 4MIYA 1EK6A 5BSEA 4RQTA 3WJAA 2PZKA 4D0RA 5ITWA 5EERA 3TZHA 5TSDA 3ZWCA 3RD5A 5JCXA 1Q2XA 3JQAB 3GC6A 2UUPA 1NVMB 2PGDA 3AUUA 3D5TA 5BNTA 3ZU4A 4WEQA 4S3MA 3RUDA 2E6UX 5A03A 3GHHA 3EVTA 2CZCA 3HDHA 4R16A 5G0SA 2NU6A 1ISGA 1PR3A 3I4FA 1Z6ZA 1F14A 4DYDA 3WGOA 5KJCA 1NHGA 4B3IA 1ZEJA 1EFKA 2B36A 2C7VA 3M1AA 1LSJA 1LUAA 3GZNA 1NPTO 4AJJA 1DFIA 1F8GA 3IS3A 3PI7A 2YW9A 4CQMD 1Q0LA 4RZHA 4IZIA 3GVHA 3DZFA 4AICA 4IXTA 3ADPA 2RBEA 1Y8QA 4WK6A 3HB4X 1YBAA 2DBRA 3K31A 4E5PA 5CG2A 3AFMA 4DQVA 4FFMA 3P7MA 1PL8A 3WQQA 2ZTUA 5IDWA 4IBOA 3QVOA 4ZGWA 5T57A 3DBVO 3RUHA 4XYMA 1Q7GA 3MZ0A 2BF7A 5BSFA 2JKVA 3VZSA 3BTVA 4Z0PA 3ZU2A 1ENZA 4RVHA 2J6IA 4CM8A 3ZI0A 4RF5A 5B12A 1WMBA 3E9QA 1O6ZA 1W4ZA 1V3UA 1J5PA 3V2UA 1UXIA 1IE3A 3FF4A 4BUCA 1NVTA 4TRNA 4O0LA 4RDHA 1M76A 1U9JA 4HNGA 2I67A 4P4LA 5JXWA 3PYLA 4Q3AA 3EUWA 2EG9A 3D7LA 3C3XA 5F3RA 5FWNA 2BI8A 4MJLA 1B8PA 4AVYA 1ISFA 4PGFA 4EDFA 3OEYA 3MJ4A 5DCUA 4W82A 4NBRA 3VH3A 4PLCA 4FB5A 4YR9A 2EERA 4QQRA 3KSUA 5K0ZA 4W99A 4ZQGA 3TOZA 1T2CA 3OMLA 4JBHA 4H3VA 3PXXA 2QG4A 3EHEA 4FBGA 4HP8A 3SC4A 4DL9A 3GVIA 4XYGA 2C20A 4D45A 1V3TA 1T2AA 2CDBA 3GEMA 2YDYA 1G6KA 1HDRA 1SOWA 1SEVA 3I9KA 3W8FA 1BSVA 3DONA 4ZJUA 2NU9A 3ZNQA 4YBZA 5EINA 3ULKA 5LCXA 4LRTB 1PWZA 1FDTA 4NNJA 4BB5A 1T4DA 1HETA 2PGLA 1I8TA 4OSOA 3QVSA 2NTVA 3UUWA 4YT5A 1KC3A 3FNHA 3QSGA 2JL1A 3L4SO 3JQ8A 4JP2A 4HXYA 2D4AA 4IDGA 1JKIA 1P1FA 1K2WA 3H9QA 2XOXA 3DAGA 1HDCA 3OM9A 5IFLA 1VE9A 4FOOA 3L6DA 3OICA 4I1IA 4R9SA 2I6TA 4RO0A 1DRVA 3F46A 4ALLA 1GY8A 1I5RA 3TSCA 1E3SA 3UCEA 3U4IA 3BHMA 4AJKA 1EVYA 1MGOA 3H9EO 5HWSA 1CJCA 4YJDA 1DEHA 5IDQA 1X1EA 3A14A 5BQFA 4HY3A 2GZ2A 4DQXA 4PCVA 5JY1A 1OBFO 1GV1A 4NDNE 4N7RA 2HCTA 2VUTA 2J3KA 4BNYA 2JHFA 1A9YA 1LDGA 2B4RO 3OBBA 4R1UA 1M66A 2IZ0A 2B37A 1RWBA 5THQA 4ND2A 3JTMA 2PD4A 4BO1A 4KQXA 1UXJA 1DOHA 4J4TA 2HJRA 5DOVA 3VZQA 1O89A 3ZWMA 2O50A 4JP3A 3MWEB 1E77A 1Z73A 4AJNA 1H2HA 1T2FA 4A27A 3T4EA 1O0SA 1UUFA 5L9AA 5IXSA 4II3A 4BO8A 5EIOA 3UHAA 3NUGA 2WDZA 4CV3A 5JLAA 2FOIA 3ROPA 3PFFA 4IM7A 4Q3NA 2X23A 1E1MA 3WBFA 3VC7A 1AXEA 4R1SA 1SO8A 5JYEA 2ILTA 3GPDG 1GTMA 1ENPA 3LC1O 3NDRA 4PIVA 2VRCD 2FP4A 4JNKA 3VVBA 1ID1A 3PDUA 4GI2A 4FGWA 3L6OO 2ZJ0A 3PQDA 1IHYA 5L51A 3A4VA 3WTBA 3GR6A 2OBYA 4CMEA 4J7CA 1EBFA 1W8DA 2CSUA 3M1LA 1C1XA 3OQ1A 2GCGA 4TVBA 5ER9A 3ROQA 3NX4A 3AU9A 5CEEA 5JC1A 1P44A 4AJOA 3F5SA 3K9QO 4UREA 1Q0QA 1P9LA 4PG5A 1JLLA 1TT7A 4LW8A 3RUAA 1UDAA 2Y05A 4RVSA 4KMSA 4BNWA 4FFOA 2A9FA 1X0VA 3K92A 4LRSB 4Y67A 2FRDA 4L73A 1BHSA 5TRTA 2VHWA 1YQXA 4BGIA 3FRJA 2UV8A 3INRA 3LSYA 4TKLA 4BL5A 2PFGA 3PWSA 3KO8A 5DF1A 1NNUA 4RDIA 2ZIZA 2F00A 4YAIA 3BXXA 2BHLA 2FR0A 4BKOA 1E7QA 1R12A 4GX0A 2NSDA 5KOIA 1NTOA 1T4BA 2NQ8A 3GN1A 4XIJA 4B4VA 1NQAO 3QV1A 2B5WA 4XR9A 3F1KA 2GZ1A 4ALMA 2GUGA 1L7DA 3P5SA 1ZIDA 2IYOA 2H63A 3D3WB 5IZCA 2VNSA 4GAEA 4X54A 3AUAA 3HDYA 1I3MA 1F0YA 4U6QA 2BGLA 3BMCB 5A9TA 1HTBA 3LK7A 2PY6A 2YZ7A 4WLFA 1W0CA 1IHXA 2TMDA 1ULSA 1GZ3A 3N7UA 4H16A 4NMHA 4GKBA 4NZ9A 4PVCA 3TZCA 2JD1A 5TS3A 1LQTA 1Y9EA 3GA0A 1Y5RA 4CMIB 5L4LA 2JFHA 4J1TA 2QW8A 2BKAA 3VZPA 3L77A 4OKIA 3ANMA 1E5QA 1A9ZA 3H2ZA 5K6AA 3OA2A 2WYVA 5JNLA 2JD0A 3FNEA 1EDOA 2Y1EA 3WLEA 4GKVA 3DZGA 1N1EA 4WLEA 3VPGA 2PKRA 5AVOA 3LT2A 4E21A 3R1IA 5G2OA 5KVCA 3OEWA 1Y8RB 3WNVA 3KLMX 1ADBA 4ZHSA 1VJTA 1XR3A 3HZZA 1PL6A 5JYDA 2PH3A 1ZK2A 2WYUA 2D1YA 5A5EA 3B1KA 3ZHYA 2Z5LA 3DQPA 2HK8A 3HADA 4KUEA 3RSHA 2VYVD 1P1IA 2YQ5A 1HSZA 2EGGA 1O94A 3AW9A 4U0JA 4D42A 5JAIA 4FIZA 3RBXA 4W9NA 3IQDB 2NQTA 4IJUA 3ABIA 1GCUA 5TJHA 1U3TA 2R00C 2IXBA 4UVGA 3W8EA 3IUSA 3TNLA 4IPTA 3OJEA 2BMAA 1MFZA 1QG6A 5EPOA 2O23A 3OETA 1VSVA 1WZEA 4D79A 4IQ0A 3JQ9A 2D5CA 2W90A 3ZV3A 4CV2A 3CIFA 2NNLD 3MCVA 2EGHA 5A05A 1YB4A 3VH1A 1NWCA 2JCXA 3ZN2A 3KYCA 3E5MA 2UDPA 1XU7A 2H1SA 2OOSA 1YDWA 4JXKA 3RAJA 1E7MA 4L8VA 5ES3A 4U8GA 1R37A 1UXGA 2E49A 1ZW1A 3GNSA 1BXGB 1E6UA 2FSSA 4XDZA 4KP7A 5CDGA 4MP6A 4Z6KA 1U7TA 2YDXA 3BYZA 1R15A 4QECA 5KVSA 3DMTA 2QHXA 3W1VA 4WGGA 3RJ9A 1V35A 1GUZA 1MUUA 3I4CA 4DTIA 2IZZA 4XQEA 4FSHA 2HU2A 4RGBA 3WGYA 3HJAA 5BSGA 1EE2A 4CQMA 4LISA 3DOJA 3U4DA 1IY8A 2UYYA 4R68A 2V6FA 4I5GA 3X2EA 3ZV6A 4N5LA 4R5HA 1UP7A 3VTZA 3DL2A 3MJSA 4I5DA 5IN5A 3O38A 1Q0HA 3O9ZA 1U8FO 4GSLA 3ZWPA 2EWMA 5LC1A 2Y66A 7ADHA 1DB3A 2E48A 3L4BC 4BQRA 1VJ1A 1NWHA 4YJFB 5JDIA 3DBRA 3PP8A 4EUEA 1C14A 3PWKA 5L53A 3GDGA 4IXWA 1ISJA 1P0FA 1BVUA 1E3LA 3SX2A 1X13A 3PQFA 2E82A 2G76A 3H3JA 1QV7A 3PIIA 5IDYA 4B8ZA 4M1QA 3K8ZA 1QMGA 2X9GA 1DDOA 3O03A 2AXQA 4ROSA 2WEKA 5TC4A 3F9IA 1I30A 4QXMA 4Q3BA 4JJIA 4OQZA 3JQ7B 4J6FA 4BNNA 1ZJZA 4NBTA 3ASUA 5I9LA 1Y1PA 3AOEA 4CQLA 2JCYA 4GH5A 1PL7A 4QTZA 1TA4A 5FI3A 5FFFA 1LEHA 1HE4A 3LT0A 4J4HA 2VTEA 3WTCA 5A3VA 2GZ3A 5DBGA 1ONNA 2AQHA 5H82A 1ISMA 3GHYA 4D7AA 2VWHA 4RVUA 4D46A 3DHEA 2Y1GA 4ALJA 4KUHA 3JQGA 2EF1A 2VTDA 2DTDA 4YACA 4YEDA 4XX0A 5I7SA 3G1TA 1E92A 4DPMA 3W8DA 1KEVA 2P4HX 3B1JA 4XR4A 5T8KC 1MXFA 1YRLA 4I9NA 2NU7A 2XXJA 3DWFA 4CODB 4XB1A 3ZWAA 3E18A 2I99A 5FF9A 4XYLA 2ZYDA 1B8VA 3TN7A 4I8XA 3QVXA 4CMCA 3ORFA 1PJQA 3OQ6A 1KY5A 3JYPA 1FK8A 1R4MB 4KZPA 1E1KA 1R0KA 1ZFNA 1IPEA 3ANLA 3PZRA 2OXIA 1QORA 2EIHA 3OJFA 4UEJA 2CY0A 3WIEA 4HADA 1P0CA 4JN6B 3JQFA 1DIHA 1P31A 1WXDA 4OSPA 1HE5A 4E5KA 2BI7A 2Q2QA 3B70A 4J1QA 4YCAA 5TLSA 1C0LA 4G5HA 2XPCA 1QLJA 1NFFA 4DC0A 1R6DA 4TMFA 2YHIB 1PS9A 1QYVA 5CDSA 1R4NB 5FEUA 4ND4A 2POQX 4FC6A 3F6YA 2D8AA 4E2ZA 1AHIA 4URFA 3IAHA 3UH1A 3BIOA 4CLEA 1DJNA 4M89A 5EL0A 5JPIA 3AJRA 4BVAA 4OGWA 2YYYA 2O4UX 2BD0A 3OHSX 4E5MA 1T2EA 1PR9A 3Q2KA 4R51A 1E1LA 4XZ3A 1GAEO 4BHTA 3WGTA 1EVIA 5BNFA 4BMNA 1QV6A 1RYEA 4J43A 2IYPA 3H2SA 4R41A 4G65A 1YDEA 4B8WA 1DXYA 2NVWA 1QRRA 2C07A 3NTQA 5G4KB 4A2CA 3C1OA 1CYDA 3TFOA 2EHDA 2GRAA 3MOGA 4GLLA 2RCYA 1BRMA 4Z9XA 1B2LA 3FR7A 3ZV5A 5ILOA 1K6XA 1DFGA 3JD1A 4GSKA 3DHNA 4J2OA 1ML3A 3H5NA 4ZD6A 1JKFA 1NAHA 4R4JA 2UAGA 4DLBA 4CV1A 3DDNA 2VUUA 4R1NA 4CLDA 5TQVA 2B0JA 1I2ZA 3ZZNA 1ENYA 4CLRA 3C7AA 5T64A 2Q2WA 3TDKA 3G3EA 3FBGA 3MTGA 4WNCA 3OJLA 2P9GA 4R5MA 4BGVA 1GL3A 1X1TA 4WCDA 1PQUA 4PLVA 1HZZA 3LLVA 1GDHA 3IKVA 3U4CA 3SLGA 2AQKA 5JO9A 3OH8A 3PQEA 5THKA 1QKIA 1YOVB 4TZTA 1IYZA 4WLOA 3JQEA 1WPQA 3RASA 3KZVA 2X6TA 1LSSA 1EQUA 2Q3EA 3QP9A 3NTOA 4GMFA 5A9SA 3RQSA 3C1AA 3GGOA 3FI9A 1O8CA 1T24A 2DQ4A 3OECA 4MDHA 1LLUA 1BG6A 1VL0A 4BNVA 2JFFA 4OHUA 1KVTA 1D8AA 4IIVA 4I5FA 1KYQA 1HDOA 2ZYGA 1M75A 2NLOA 5JAQA 4E33A 2PZLA 1M6HA 1NQOA 3NT5A 3U4HA 3M2TA 4DPKA 2G1UA 2YHUA 2QQ5A 3LZ6A 4RVDA 2B69A 1WLYA 4MO2A 4TRJA 1H6DA 4TRMA 1CDOA 3AY6A 3DZHA 1C1DB 2AG8A 3X2FA 1Q1NA 1XU9A 2WD8A 4J3FA 3ZV4A 3I9MA 4E5NA 2I9PA 3RBVA 2JAHA 3IP3A 3TZ6A 4HX5A 2NU8A 3WSWA 2VZ9A 1MLDA 1OOEA 3UCFA 4WCFA 1EUCA 4R01A 3RUFA 4E6PA 4J0FA 2VOEA 3ZHZA 1SNYA 4DMMA 4A7PA 1F17A 1Y8QB 5IJZA 4K28A 2HAEA 4IY1A 2QIOA 3H4VA 1V6AA 2IE0A 5DBIA 3ROMA 1PZGA 5ADHA 2C5AA 3GY0A 1HZJA 2IXAA 1LRLA 2GPTA 1VI2A 1YQDA 3IDSA 4EJ0A 2ZTMA 4CM8B 1UJMA 4D3SA 3HNPA 1B14A 1B3BA 1TI7A 5BNIA 1MFPA 3BMOA 1UDCA 4A26A 1QYWA 3D4PA 4K26A 4CMBA 4E2YA 1TEHA 4B4OA 2O7SA 2FPGA 4R69A 4D41A 2OHXA 3TPCA 4LN1A 1DHTA 4EEZA 5AQ1A 1E3WB 1XCBA 2VYVA 4FN4A 5CFZA 4CLXA 1JAXA 3MTJA 3COSA 1UAGA 4M87A 4IIUA 4QFCA 5DBFA 1N5DA 1NX6A 1QLHA 2FMUA 1ISHA 5H83A 3CMMA 3W4JA 4Q3CA 5AXBA 2W4QA 3K6JA 4FS3A 4F6CA 1HE3A 1KBZA 3EC7A 4EYEA 1Z82A 2WSBA 1QXSA 3HFSA 4KTTE 2EXXA 1E7SA 5JDCC 3L9WA 3VTFA 1CWUA 3T7EA 4RPJA 1KVSA 3GT0A 3KXDA 3WX0A 2B83A 3PHIA 2Y93A 4CMJA 4YYZA 5JAMA 5AXDA 4BGUA 1H6AA 3FWZA 2X5JO 3DEYX 4AJPA 3WYEA 3UXYA 1ZSYA 1QYDA 2NVUB 2X22A 2NTNA 3RFXA 4BNGA 4AG3A 5EQDA 3RUIA 4HFMA 3RKRA 1R66A 2DUWA 1JWBB 3O26A 4PG4A 5B4TA 4FJ1A 1QYCA 3HWRA 4DBVO 4H7PA 1SCUA 3EW7A 1DC4A 1PGQA 1H94A 1SOVA 3GUYA 1A71A 1KC1A 3KYBA 2Q1TA 1BVRA 3JQ8B 3GAZA 5IZ4A 1ZCJA 3WLFA 4J7XA 1QYXA 4QO7A 1ISIA 1OI7A 3IKTA 2QRKA 3KLPX 3RUEA 1EVZA 4O6VA 2VT2A 4OJNA 2VHZA 2WE8A 4ILKA 5JCJA 4CLOA 1PJCA 3GLQA 4TVOA 5A4DA 1ONPA 1ADGA 1U4SA 2IZ1A 4BMVA 4NBUA 2VUSA 4ZN6A 4UUOA 1LI4A 1VL8A 1DIAA 1I3LA 3GDFA 4B3JA 4EGFA 2AG5A 3GFBA 4MIOA 2D3TA 4PLTA 5F1PA 2IDZA 2O4CA 1K6IA 4LCJA 5AXCA 5HA5A 1NASA 4AJIA 3GGPA 1PZFA 3P2OA 2Q1WA 2J3HA 3RU7A 3MJEA 4RF3A 3TRIA 4JBGA 2DTEA 2GN4A 2WM3A 2FPPA 5KIAA 4RJTA 1PJSA 4GX2A 4CPDA 5CP8A 4ZU3A 2P91A 3BA1A 4O1MA 2G0TA 5KJ6A 2V6GA 4AJ4A 1ZSNA 5G0VA 5HS4A 3GK3A 2VT3A 3DAPA 3JQAA 1R0SA 4Q3EA 3R6DA 3NGXA 4JJGA 2Y1OA 3ZWYA 2B35A 1XA0A 1XG5A 3AK4A 4YPOA 1NFRA 3KOUA 3PHLA 3ITDA 3JCZA 4DQUA 1H9BA 3ZHBA 2YJZA 2AEMA 3AM3A 4CUKA 4YRDA 1SAYA 1JW9B 2YFHA 3HN2A 1PSDA 3VPHA 5LDHA 5G0TA 3QIVA 3OF2A 2W98A 4ID9A 3GMDA 1T2DA 4NFSA 2X9VA 4LCEA 4P4GA 3IIEA 2QZ9A 3VPFA 3BTUA 3IUPA 2I65A 5DOZA 1UZNA 1V3VA 4IDDA 8ADHA 4GWGA 1SPXA 2Q45A 1C1XB 3S8MA 4PG7A 3UOGA 4Q39A 1I3NA 5DDIP 1PX0A 5TT1A 2Z1NA 2ZB8A 1V9LA 2C2XA 4NBWA 4WLNA 4P38A 3KSZO 4UUPA 3G0OA 1N7GA 2FZWA 1I2CA 5IAAA 5G0UA 5L7WA 4L76A 3FD8A 1WWKA 3HSKA 2VZ8A 3S1LA 4E31A 5JY6A 4WKGA 4DVJA 1LNQA 3W6ZA 1MV8A 5COQA 2GN8A 2H9IA 2Z1MA 3T7CA 3R0IA 1GFSA 2PWZA 5L7TA 3NJ4A 3AFNA 4D44A 3LQFA 3HHPA 1EE9A 4RVGA 2UUOA 4XGNA 3ZU3A 5HS6A 4F6LA 2ZJ1A 3INTA 2CFCA 4LVCA 4PLPA 1J49A 2DT5A 3WOHA 1P45A 4N54A 2HMTA 3NTRA 1LJ8A 2AE1A 1HYEA 4QT0A 5L4SA 3QWFA 4RORA 4JLWA 2WTBA 3FBTA 2HJSA 1VKNA 1Z7EA 1FDWA 2HMWA 4PFJA 3NEPX 5U4QA 1ZO8A 5JE8A 1E0DA 3HQ4O 4NFYA 4YXFA 1XYGA 1X7DA 3FTPA 5DT9A 3F4LA 4Y8VA 4FFNA 3WBBA 2X8LA 2X0IA 4JIGA 2FY8A 3WGQA 4WOJA 1WNTA 5BSHA 1L7EA 4PZCA 2YV3A 1B26A 2NACA 3QWBA 3KUXA 1LC3A 1DO8A 4HNHA 4Y6SA 4CM5A 1MC5A 4L9RA 2X7HA 3ICCA 1NFQA 1CERA 4HFJA 3ZNNA 3Q9UA 1WDLA 5T6BA 1M2WA 3UCXA 4YT4A 5I8WA 1ONOA 2RIRA 2W2KA 2ZCVA 1C0IA 5L7YA 4A73A 5U1PA 5C5IA 3JQBC 4KOAA 2J5QA 1DPGA 3I6QA 4RPLA 4BNUA 3TQHA 4PLYA 1LDBA 1NQTA 3PK0A 4J9VA 4MVJG 1P1HA 3Q3CA 2BGKA 3SC6A 5I7VA 2ZTLA 3SLKA 3PJEA 2HDHA 1F8FA 1PJLA 3DXFA 1H9AA 2YV2A 3U09A 1T25A 1N7HA 3DMYA 2VHXA 1UP6A 3F1LA 1T1RA 3D3EA 4RF2A 3WXBA 3DR3A 3VH4A 3I83A 4BV8A 3HE3A 2O3RA 2W8ZA 3LYLA 1N1GA 4NIMA 5I7FA 5J23A 1XKQA 4DIOA 2HUNA 4EI2A 1ZBQA 3KYCB 4PVDA 1JTVA 1V8BA 4JGBA 3WFIA 4UUNA 1GEEA 4EJ6A 1X0XA 5I8ZA 4W6ZA 4D3DA 2ZYAA 5DP2A 2Y0CA 3AI3A 3BHIA 1BGVA 4L0QA 5IF3A 4F3YA 4GX1A 1IB6A 2EJVA 4JCOA 5A02A 4PLWA 4YJGB 3GOHA 1NBOA 4J2HA 3KHUA 3I6IA 4NU5A 1E7YA 1JAYA 1ZZEA 4Z3DA 4GX5A 1FMCA 1IZ9A 4LGVA 4CQMB 1XQ6A 3WR5A 2NTJA 4FJ2A 4K9DA 1I33A 3IC5A 1MXHA 4HFRA 3TJRA 2GDZA 4NQZA 1A7AA 1EEHA 1HDZA 3AI2A 4B7CA 4E12A 2CVQA 4IMRA 4YVFA 2ZB7A 1TVEA 3DBRB 3QQPA 4E32A 1AN9A 4Z9FA 5B4VA 5GZ3A 2GN9A 1Z75A 4PRKA 4WJZA 3OFSA 4YAKA 3GPIA 3LC7O 2P2SA 2QZZA 2DM6A 4QX6A 5F5LA 2FSVA 3P2YA 2NV6A 1DC5A 4UVDA 5AYVA 4WE3A 4XEHA 4I08A 1YGYA 3H9UA 5KVQA 3RVDA 2O3TA 2BLLA 3RBZA 4C7JA 5JO0A 2FHSA 2RHRA 4CQLB 4DWVA 1MG5A 2Q50A 2DKNA 2DLDA 3UW3A 1YBMA 4TROA 2GASA 3SBOA 3I23A 1EUZA 1JA9A 5EESA 1LTHR 1Y81A 5C7IO 1EZ4A 1GZ4A 4I5EA 4XA8A 3AUTA 2AE2A 1KS9A 3WWYA 2BFPA 4YJHB 3U5TA 4YAEA 3K2BA 1YB5A 4XIYA 3BMCA 4RCVA 4CR7A 2P68A 4GVXA 1CRWG 2CUKA 2DAPA 4MINA 1DAOA 1U7HA 3LF2A 2RHCA 2X1HA 3H3FA 2FZEA 1UZMA 2Q4EA 5JCJD 3PHHA 1PGOA 5JDIC 2VN8A 4R1TA 1GR0A 5KTKA 3JYNA 1LQUA 2GYYA 3PPIA 4E2XA 3TOXA 1YJ8A 2XXBA 2D2IA 3RROA 2CNBA 4CMGA 3CKYA 5AXAA 3TZKA 1LX6A 3FR8A 1D1TA 4K6FA 1Y8RA 3D1LA 1HDXA 2QYSA 4WPGA 5ENDA 5HRUA 3RFVA 1WDKA 1DC3A 1D3AA 4BQPA 2Q46A 4BKRA 4AJLA 4BNIA 4OMUA 2VQ3A 1RM0A 1ADCA 3G79A 1XDWA 3JQAD 3CXRA 3DFZA 4BO6A 1CQIA 4INAA 3VKVA 4CM9D 3H8VA 3E9MA 4XB2A 4ALNA 2Q1UA 4AFNA 4PG6A 4L4XA 1J6UA 5FYDA 1PJTA 4IDBA 1UZLA 3QRWA 3ZW9A 3IMFA 3PHJA 4BNHA 3OJOA 3OA0A 3ZW8A 3RI3A 5DZSA 4WNIA 4CM7A 4JBIA 1OC2A 2Q99A 4D0SA 4M86A 3WS7A 1PJ3A 1S6YA 5ER6A 4TRRA 5C3MA 5EJ2A 1UH5A 1PIWA 1LC0A 3VDRA 3DBHA 3NKLA 4XD2A 3ZWXA 3L9XA 2C59A 2GD1O 5KCZA 3ZDFA 4FDAA 4PZDA 1RPNA 2JAPA 4YA6A 2HMVA 1YH3A 3BAZA 1U3VA 5CAEA 1B3RA 3AWDA 1JDJA 1KOLA 1D7OA 4M8SA 3R3JA 3H65A 5EMHA 5GZ1A 4K1LA 3MJVA 1ZK1A 1KVQA 4YRAA 5G4LA 3V2HA 4CLRB 2OORA 4B79A 5KVVA 1ZXLA 2Q4BA 4DBZA 2I76A 1OAAA 3PIDA 4QFDA 4S1VA 4B4WA 3JQ6A 3KETA 2DPHA 2C7GA 2VCYA 4XKJA 5T8KA 1EK5A 1TLTA 1HRDA 4FQ8A 4G81A 1OZAA 2WE7A 2GGSA 4WOKA 5L40A 5C7OO 4PG8A 1E7RA 1R0LA 3NDIA 4E2WA 1NP3A 4NH4A 3VOSA 1HDYA 4L4RA 5F21A 3UAGA 3WNQA 2HO5A 1Z74A 4CLHA 2V6MA 3KSDO 5F5NA 3KV3O 3U3XA 4YQYA 2PR2A 3LF1A 2IEBA 2Q1SA 3SJUA 4KTVE 3PJDA 1GQQA 4O63O 1P33A 3DZIA 1I2BA 1E6WA 1WDMA 4LMPA 1VRWA 3H5RA 3W6UA 2EKLA 2LDBA 3B1FA 5B1YA 3GEGA 2VNAA 3GZ4A 2IEDA 4DIFA 1TXGA 4ZRMA 3WB9A 2X86A 1B7GO 1Y7TA 1GEGA 1ZVMA 4R54A 2E4AA 3ICPA 2QX7A 3WGHA 4EITA 3JQDA 3D5QA 4OH1A 1SB8A 1KETA 1KVRA 1QP8A 4R9RA 4CM4A 1FDVA 3VDQA 1VJ0A 3BHJA 1DRWA 3Q0EA 1NM5A 1KERA 1U8XX 1NHWA 3IJRA 3JD3A 3KRTA 4DLAA 4DRYA 5IN4A 4E30A 1HLDA 3GUCA 4NU6A 3TZQA 4XGIA 3UKOA 1NAIA 3PLNA 1O9BA 3UVEA 4DGSA 1M67A 3FSRA 3BMQB 3S2GA 2GNAA 3GN2A 4L75A 4ITUA 3HN7A 2NVBA 1VSUA 2EP7A 3VHRA 1YQGA 3K30A 2EJWA 2G17A 3CEAA 4OOEA 3CE6A 4MKXA 5C37A 4Z9YA 4BO7A 1OC4A 3F4BA 4BOYA 1R4MA 2X5KO 3INGA 3BMNB 3K96A 3PJGA 1FDSA 1K5HA 3G17A 4GL4A 3VPXA 2Y67A 2WYWA 3ZNOA 2QRLA 2P9CA 2HMSA 3CPSA 8LDHA 3DBLA 2HQ1A 4UVIA 2WWRA 2ZK7A 3FNGA 1N9GA 1A4IA 3ANNA 4Q3DA 1I24A 3BMOB 1G0NA 1U2GA 3CH6A 4RPHA 4EBFA 1HYHA 1V0JA 1NR1A 2RH4A 3RC1A 3E82A 2ZB4A 3A9WA 3AM4A 1S7CA 3BTSA 4B4UA 1YJQA 9LDBA 4BS9A 1ZK4A 3D4OA 5L3ZA 1Q7BA 5TT0A 3WMXA 3JSAA 2JHGA 1GZ6A 1LDNA 4XRRA 2BFMA 1YB1A 2PTGA 1E3JA 2IODA 1CIVA 4PN3A 1AE1A 3RU9A 2HLPA 5CPFA 4AJ2A 3A28A 1H2BA 4DMLA 4FFRA 3DZKA 3E6AA 3QY9A 3K73O 2GF2A 4FC7A 3GZNB 4IMPA 3AI1A 4HUJA 2DVMA 1EBUA 2NWQA 2Y0DA 2ZQZA 1D1SA 3DB2A 4GMGA 5TNXA 4ZQHA 3AY7A 1A27A 1HWYA 1KVUA 1MX3A 4JK3A 3HFGA 4L4SA 2OUIA 5A1TA 3FN4A 4XRGA 4YT2A 2Y68A 3I52A 1LDMA 1DBVO 3KBOA 4QEDA 2P9EA 3ZWVA 4NJMA 3B6ZA 5F1KA 4RVFA 1WZIA 1E3EA 4OIMA 3RIHA 1GQYA 1HYGA 1KIFA 1BW9A 5JC8A 1VLLA 3VPSA 2UVDA 1LU9A 4RV9A 4GGPA 2IRWA 1ZNQO 1ARZA 1HSOA 2Q49A 1B8UA 3IP1A 3PRJA 1X14A 1RM5A 2O48X 3RFTA 1TT5A 4NR0A 4ALIA 3EDMA 4IS2A 1NQ5A 3UICA 7MDHA 6ADHA 2EKQA 2G5CA 4BNTA 1DHRA 4KWIA 3QJ5A 4U0KA 3WIDA 2WD7A 1I32A 1X15A 3S2IA 3CSDA 1PGPA 4BNJA 3OP4A 2DUUA 3H5AA 4Q9NA 2GLXA 4KDEA 2OP0A 4W7HA 2YY7A 1A72A 1HF3A 1F06A 3AU8A 1ZMOA 1OFGA 3IJPA 4WECA 1RKXA 4N5NA 5I9MA 2DTXA 5GY7A 4MVJM 3ZCXA 3JD0A 3N58A 3ZNPA 1RM3A 4IJWA 4IGFA 1DC6A 1U4OA 3QVWA 3TWOA 2A4KA 4OM8A 1JKJA 1AHHA 1HKUA 1AUPA 1ZXBA 3H6KA 3PJFA 1GQ2A 3FCOA 4YB8A 3SEFA 2OBNA 1C1DA 1NXQA 1Y9AA 3O8QA 3GQVA 5AOVA 1U1IA 2J5KA 4MKZA 3LVFO 4RL6A 1GPJA 4O5OA 5KJEA 2XAAA 1E1NA 2O3JA 5DP1A 3CZMA 3JYLA 4NJOA 3TL2A 5JDCA 5I7EA 3L0DA 3QWAA 3EVNA 4NI5A 1IZ0A 1N2SA 2D0IA 3WMWA 1ZEMA 4WUVA 4LSWA 2OMEA 1K89A 1VPDA 2O2SA 3LT1A 2AQ8A 2PV7A 2FPIA 4HWKA 4KQWA 4CMAA 1WP4A 4EUHA 3KYDA 1M6WA 3GF4A 4BNFA 1LSUA 2X58A 3H9GA 3GGGA 4W4TA 4YAJA 4JQCA 3IOYA 2WJPA 4FJ0A 1BXZA 3QLJA 4BO2A 3KEQA 4NPCA 3S2EA 5H81A 1X7GA 5K9ZA 2Z95A 2CVOA 4J4BA 2PD3A 4GLOA 4UULA 1I01A 3RUCA 2ZTVA 3WQSB 3W4IA 1UDBA 4IUYA 1E3WA 4YDRA 3N74A 3AUSA 2BFOA 4CM9A 3A1NA 1ZK3A 3QHAA 1GYRA 3AOGA 3FTNA 4DREA 4FFLA 3KTDA 4LSMA 4A10A 1A7KA 1HDGO 3HUDA 3PYXA 4MP8A 5A9RA 1EMDA 4OKNA 2RAFA 3ROKA 5CDTA 1U2DA 1W73A 4DIBA 1T26A 3V5NA 1YE3A 4BKPA 4DUPA 1ZSVA 2FWMX 1PJ2A 4GGOA 5BT9A 1Z45A 1BTOA 3E1KA 1XWFA 1E6EA 3MWDB 4RLHA 3W4KA 3GVCA 2O7QA 2VOJA 4UEKA 3V2GA 2ZATA 4HBGA 4NK5A 3WQRA 5MGBA 2NVUA 1ADFA 4BV9A 4TQGA 1XEAA 3NRCA 3DC2A 3NAQA 4JROA 1RYDA 3SVTA 2AA3A 3FPCA 5B37A 1ORRA 2CDCA 3EMKA 4AL4A 5JS6A 2J3IA 3DHYA 2AEFA 3PFWO 4TWRA 4XJTA 4FPXA
chains in the Genus database with same CATH superfamily
3FJOA 2OA0A 4KUGA 1XXHE 3P19A 3OIUA 3FFAA 5CH8A 4WJLA 1FJXA 4CUZA 3H75A 4FI3F 4RM3A 3NWEA 3UG6A 3QUTA 1QPBA 1Y34E 2IPXA 4YCLA 4DYVA 3HYSA 2EP8A 4JYZA 3TAUA 3OZFA 1LLQA 4PZUA 3BK1A 5HM8A 3F5MA 2KLHA 3QW2A 3GMSA 3KPVA 3WP1B 2JH8A 1Z0ZA 3O4VA 2GNPA 3OZEA 4FOTA 3ZG6A 4XPIB 2GM3A 3HXTA 1PV4A 1VE5A 2PSDA 2W2KB 3EZLA 5JHHB 1XC7A 2RGBA 2JJ1D 5HFJA 3EPLA 1IUOA 1JJAA 3GV0A 3RVPA 3T0GA 1TGVA 4YMVA 2IZ5A 5ALGA 1ESCA 3DE3X 3LW8A 2VLBA 1FSPA 2B7LA 3NB0A 4O2AA 1JB9A 4BFUA 4D0LB 4ZMRA 4W5NA 3UB3A 2J41A 4MI6A 1Y7HA 4DLZA 3FPFA 1ZITA 3OIFA 2SHKA 2CB0A 4NG5A 5CLQA 3PDIB 1P61B 1A8UA 2OL4A 3AESA 5A4KA 2P2NA 3E0QA 3OUUA 3PC3A 4GFDA 4QASA 1ZKMA 2BSQA 3F6EX 2Z83A 4B6JA 2GILA 2YNMD 2YFQA 4MS4A 2OQVA 2RCNA 4FLMA 3U39A 2DC1A 4H77A 1E9AA 2P2GA 3GJQA 3IUMA 4M8KA 3LH5A 1W1UA 4CMEC 1XMSA 2DX7A 3D3JA 3E7WA 3ENZA 3KQTA 5E2AA 4V0OA 2IYRA 2N9UA 2QVYX 1EKXA 1Z13A 3TLKA 3L92A 3CH4B 5J5VA 1GU7A 4XYEA 4F8YA 3G2IA 421PA 3PSHA 2KX7A 3MNFA 2IXTA 2Y1DA 1FL9A 1TJNA 1JQBA 2PLFA 2E0IA 3N5CA 1EDBA 3U1BA 1I0ZA 3B53X 3T7IA 1QRTA 1N5LA 2IPLA 2RGNA 5JSKA 3VAZA 1WDTA 2C78A 3LLSA 5EZSA 4DLWA 4F5DA 1EA7A 1W34A 2YZ2A 2QD1A 3CTMA 3CVWA 1KSFX 3VQTA 4WASA 2IS6A 4JX9A 2F62A 1VE6A 2OHHA 5HF8A 1PJBA 3W9BA 2NVOA 3SGLA 1YZTA 2PL1A 4G36A 4YMSA 2XEDA 1GZHB 3GLFB 1YR8A 2J32A 2CFOA 2D1SA 4YRRA 1JR3D 3VX4A 4P7GA 2LKDA 5JBQA 1RI1A 3I3OA 4Y6LA 3SF8A 3TX6A 3IBSA 3T3EA 2Q3DA 2P40A 2AMFA 4GPD1 2MCFA 1N6NA 4X3CA 4C3UA 1R50A 5CXUA 5HX7A 2BH2A 1C7IA 2PSSA 4BIIA 2J3LA 3A9CA 4NFHA 2WG2A 2P6NA 2C0QA 5FI5A 1W5SA 1P1KA 2B25A 3FWNA 3IRVA 2Q5EA 3SXUB 2CL6X 13PKA 1F7UA 3AG6A 3B3AA 2A5FA 2Q07A 4KLNA 4LDRA 3GDOA 3V32A 4K2AA 1XK6A 3U37A 5IAKA 3VYVA 3HB0A 1Z6PA 1JA0A 1MH1A 4RIFA 1U1DA 1CJKC 2MR5A 5ENZA 5ILGA 1ZINA 1FU7A 2H5LA 2XCOA 4BO0A 1AHPA 5K3OA 2W2LD 1BDMA 1DKOA 1T1SA 4BBJA 1YJ5A 2A92A 2ZVJA 1G4AE 4FYJA 4R7GA 4MYTA 1A82A 2V7TA 2CXUA 4O4IB 1W6UA 2JHPA 1DJOA 1YSCA 3IAXA 1OIVA 2R8ZA 1FP2A 3MWEA 5K0LA 4G8CA 4DWJA 2H51A 5ICMA 1JAZA 3EY4A 1JLMA 2LKCA 2Q4DA 4TKUB 4UXHA 4DTCA 5D6NA 2JD2A 5KYKA 1T8WA 4EFNA 4CM1A 1UJBA 2HHLA 3DF9A 1ECGA 3VXKA 1RRPA 1OIXA 4GI7A 2A86A 2Y99A 3I0NA 4RABA 4UNIA 4EPVA 3TFQA 1A8IA 3ROZA 3U49A 4ZKDA 3EUFA 3G5TA 3LGSA 3AP1A 3INYA 1ST3A 4MUYA 4IJKA 3U7HB 1F8XA 2O6HA 1X7YA 3U56A 3PNSA 4D6YA 3HG7A 3EWSA 4GGMX 4LFBB 3I5AA 3DAFA 4TKVB 3IDZA 3Q41A 1UK7A 3DMFA 3FNFA 4B43A 1X7HA 5J2UF 4MVJE 4IZ6A 3BGVA 4HFNA 3KJZA 5ICFA 4RPKA 4FNAA 2Z6AA 2AVNA 3L1HA 4IVPA 5A5FA 4XUCA 1H6CA 1PHRA 2J46A 4OL0A 1FXSA 2AQIA 1J90A 1ZK0A 4Y98A 1PU2A 2PKYX 3C7DB 5CVVA 1VKZA 5BV7A 3D4NA 5A06A 1VI5A 1ZOPA 2H85A 1UQRA 2FEKA 3AM5A 1KYWA 3TXAA 5DCWA 2RIPA 4RKQA 5K8IA 4NMMA 1WCXA 4K0KB 3KEMA 4HMPA 1LBQA 3ZW8A 4GQAA 2AW5A 1GYPA 3Q15C 2FI1A 1N2ZA 3DXZA 4DXHA 4H15A 3K4QA 2QX8A 4FMCF 2O8EB 1JNXX 4TTJA 4KQMA 1ZH0A 2A3NA 1WKVA 2IU3A 1QF7A 3PUVA 4JOBA 4PRLA 1ABEA 4RA9B 3FOZA 5H3CA 3THWA 3EARA 4B2IA 5TGTA 3C98A 1P7PA 2C2GA 2QU8A 5HBRA 3KLNA 4A8PA 1ZVJA 3CR8A 4LXIA 2QJRA 3C3MA 3KCNA 4PLGA 4XYBA 4BNKA 4MDEA 1JJBA 4H17A 1E4YA 5GZ6A 1MENA 4NNPA 3DZCA 1D2RA 2A0KA 1DAPA 4PX9A 3VZRA 2BE9A 1QV9A 2E37A 4UQPA 4DIKA 4YROA 5FV7A 9LDTA 1SD2A 3P9KA 5JS2A 1E9RA 1ENOA 3M6UA 5JSYA 1SMKA 1YL6A 2RK6A 4JH0A 1Z5UA 3O75A 1DVRA 1X7XB 1I10A 2VP9A 1Z2CA 3D2AA 3EFHA 2BFCA 1Z4IA 1BDBA 3KJIA 4JJ4A 4R84A 5ERXA 4HDSA 5KKCA 1GT91 3SY8A 4G84A 3K1TA 4GVLA 2QN3A 4NHEA 4P3YA 4RFSA 3VV3A 4DMKA 4IDQA 1N33B 3O8NA 1SR8A 1WXEA 3DD1A 1Q7RA 3DBHB 2O0KA 1NVBA 1UWLA 1KI6B 3B1XA 1YFKA 1C30B 5SZIA 3WLTA 3NETA 4UAGA 2FN7A 1ZNWA 4JX8A 2BEVB 1JVSA 1Y3IA 2J0EA 4NATA 2AMVA 5FNVB 1TMOA 1JEQB 5LWHA 2AG0A 1XDGA 2WM9B 4XGKA 2DR2A 2CF5A 4V1CB 3GFPA 1GG2A 1ZH2A 3GT4A 3EBPA 3LPMA 1NXWA 1QFXA 4HKTA 3EGDA 5AJWA 4WDQA 1E99A 5GQSA 5KAMA 3PGXA 4PAGA 2HWWA 3SQXA 2I8LA 4PQYA 4PEVA 5ILQA 3RKUA 3RRYA 3ZWNA 1XSEA 4MVJP 3NIFB 2PD6A 1XHFA 1S3SA 5DE3A 1SBCA 2GXSA 3D0KA 1VCOA 3R5JA 1O5TA 1RAFA 4JMPA 3AL2A 4OK3A 5CJPA 3TRHA 5CEFA 1DDGA 1DT5A 1J7JA 2WVAA 3NJ8A 1JILA 2D4HA 2BF4A 1D4FA 2J30A 3ONFA 2B3DA 4O3FA 4MPDA 1W46A 4L3WA 4AQ7A 1B16A 1ZGGA 2QORA 1GGMA 1AMOA 3MAAC 3K2EA 4UZFA 4CJXA 3MYRA 4IHKA 3UJAA 3HXMA 1OZGA 1I51A 3SVZA 4ZZ1A 1VL2A 2QJTA 1SQSA 4FP9A 2I6SA 3TSAA 2F3QA 3PGA1 5JW6A 3UAWA 2QM0A 5DNWA 1TGYA 2AEJA 5U9CA 2G1PA 3JARA 3FG9A 4P4TA 4BUJA 3H4MA 3WFJA 2XJ9A 4FD3A 3UC9A 2QLFA 3UGKA 5EJ8A 2H11A 4TTPA 2OLEA 3H42B 3RTAA 2ZT6A 1YL7A 4URYR 3G49A 3R5KA 4BRWA 3C5WP 3TCNA 4EW1A 4BZQA 1T5SA 1QOZA 5GIOE 1I3KA 3P27A 3CLTC 3H86A 3R40A 1BJKA 5A5DA 3L0PA 4NYMR 2GM5A 5T3YA 1EJ6A 5AW9A 2IHJA 4EWLA 3JWPA 3PDWA 4FEYA 3KXKA 4CIDA 1QIKA 5KKAA 2HSZA 4EJSA 5AVWA 2KMLA 4RTLA 1SEPA 1KMNA 2C4VA 1BXGA 3E5RA 2AJBA 3IX7A 4CG1A 5HTOA 5EJMA 2IBSA 4XJSA 4TSFA 2I2CA 2O8BA 4CM4B 1GPDG 4U6SA 5KYWB 4GT1A 3LX4A 4MB2A 1SC6A 4E4YA 5B2EA 2VZEA 1QNFA 3JSXA 1C0PA 1H2FA 3VR2D 4C87A 3EMVA 4IOMA 5JSZB 4BJ5A 1NNLA 4R7ZA 3VZBA 4ZV9A 1EFLA 2PVCA 2BEJA 1FU4A 2JC3A 2HRRA 3IXQA 4B6OA 1VIYA 4HPXB 4RKEA 1F12A 1V5GA 2P6UA 3BDVA 4BAGA 3AR7A 1U63A 2WWVD 5I9NA 1BQEA 2ZWMA 1FDUA 3E9ZA 3I04A 1TD9A 4L85A 3FGPA 4MQFA 3BL5A 1R6AA 3GVPA 2CNWD 1PJ4A 2IHKA 3IB6A 2O2EA 3NEYA 4IDHA 2PZMA 3V1KA 1ZJYA 3P32A 3TPZA 3WYFA 1Z22A 3R9IA 2Q9UA 1OBHA 1XTSA 2A9VA 3HU3A 4U7GA 1UXKA 2VJPA 5DN9A 1K3TA 3BGIA 1Y5LA 5G3YA 3K4HA 1OW3B 2KBEA 1DSSG 4JUIA 1R8JA 5IUKC 2WPNA 5B4UA 1GUBA 2XNJA 1UL1X 3RF7A 3QF4B 1P0MA 2J3JA 1E7WA 2E9SA 3Q8XB 5JFOA 1WL8A 4OOFA 3KKEA 1SVSA 3QE2A 3OZGA 1KJZA 3HR8A 4O4HF 1ECCA 4PZPA 4QU5A 2BZ0A 3NR2A 4RKFA 2ZR9A 4WTOA 4ZHQB 2HWYA 3GT3A 1HPLA 1F2DA 4CMHA 1PZHA 4C01A 5LSAA 1QR6A 4MW7A 8MHTA 1PGJA 1ZH8A 2G5PA 3ESQA 3SJ7A 4LK3A 3PF9A 3QLUC 2SKCA 1TYCA 4I66A 2RGUA 4EKNB 2W83A 5AUQA 4MIEA 5IXYA 5TMDA 2CMDA 2P79A 3HB7A 1AGPA 2EFEB 3VMMA 1GT6A 4PYKA 3UANA 3VNUA 4RD3A 4EEXA 3FZNA 4CR8A 3QXJA 4ZOBA 1HNNA 3ZJVA 1C4WA 1W5AA 3HYCA 5DK4A 5ERGB 3R76A 3GLIB 3T54A 2ZQYA 4KDCA 4P98A 1SXJC 4WLUA 2VHQA 4IIJF 2EKPA 5TMPA 3NM4A 1P4SA 2FU5C 4ZVSA 1NY5A 1EUCB 4Q4AA 1KDYA 4DEXA 3W1EA 1VB5A 1HZZC 4DNXA 1I94B 1XZQA 1M10A 1YS4A 3BEDA 4YJ3B 1U28A 1DQZA 4KXFB 3WNBA 1M74A 2WIKA 4F6RA 5HSGA 5LDGA 4GBJA 1EA5A 5T4HA 1J2YA 1QSGA 1TK3A 2OV4A 4XCVA 3OCWA 4Z2YA 4G86A 2G28A 4YJ2B 1Q50A 2PKQO 4LVUA 4OXYA 2Y1CA 2VRCA 3EIFA 4NJMB 5F52A 2JZNA 3UK6A 1EVQA 4DM7A 4ZICA 2XTJA 1LY1A 3TGLA 4KRFA 2DULA 3DZJA 2O8FB 3IQIX 2I4MA 1WMFA 4YWJA 4ZEMA 4C76A 3DE2X 1BW9B 4UBJA 2CLCX 4CE6A 2ZE8A 3ZBQA 4D3FA 5IBCA 1MOSA 4PLFA 1YF3A 1ZDMA 3TR5A 1ZR2A 2ZT5A 2YHIA 3ENKA 4ZVVA 3PV0A 1Z6XA 1R4NA 1G63A 2FPGB 5F2KA 4Z3OA 1XMOB 3OKCA 3SN6A 2G9ZA 3T5AA 3SS8A 1K0UA 2UYOA 1QWSA 5E38A 3AHJA 4AN0A 3ELWA 1Z12A 2FR8A 3E15A 2BKVA 4R9UC 3W5BA 1GKLA 1GJRA 1E2QA 2WD7B 2Y1FA 2OOKA 2DFVA 4MITA 2AZTA 1LRKA 4W7IA 3PX3A 5TQ0A 2D2XA 3PFCA 1KYYA 3AJDA 1U0EA 1KDRA 1E1RA 1KDTA 5HKAA 1TIBA 2W11A 4II2A 3LKDA 1LXCA 1IL0A 1M2JA 2Q8QA 3H0KA 1AD2A 2WJJA 3BFVA 1ABFA 4KLCA 3RO7A 3VHQA 2VKTA 3CBQA 3AVYA 1REQA 1L3IA 5TGZA 2B92A 3JD4A 2BPOA 2ZB3A 4Q4DA 1WBJB 2L0XA 4ZA2A 3G1UA 4HAUA 1OFHA 3UN1A 1RMQA 2GWHA 3QHQA 4HGOA 4JI5B 4X1KB 3BF7A 3UW1A 2XITA 1PQPA 2WFMA 4CTNA 5KYNA 4C7KA 5HCNA 4TMTA 1JFFA 2ZSKA 2ZVPX 3JALA 1HLPA 3ORQA 3OZRA 1NDQA 4HDNA 4IDEA 4LYDA 2A9KA 3JVEA 4FOSA 1P74A 2REQA 2VXCA 1GTJ1 2NX2A 4MLDA 3M6LA 4R2WA 1M2VA 5EWJB 5JJCA 10MHA 1LDEA 4MAMA 1Z2DA 4BY9E 4BMOB 3ETEA 4KHZA 2LGJA 4H4EA 3IOMA 5CFOA 2JEZA 4TSKA 1JHVA 4IO0A 5JNRA 3R3SA 3HA7A 3WHLA 1M1UA 4ARCA 4R0NA 1OXBB 1H1LB 4PC2A 3WNCA 2PJZA 1NJ8A 1W9MA 1XVAA 2IXGA 3FPLA 4LBZA 5CK5A 4I14A 3T94A 3GCGA 1KY2A 2V96A 1YWGO 1IUKA 2J48A 2P90A 2QR2A 3BDIA 3LO5A 2OD9A 1ZCBA 4LJ8A 5C80A 2CCKA 5IT0A 4TUYA 3BMQA 4ZXFA 3WICA 3TLGA 5C1OA 3ETLA 4AYTA 2A3RA 1BH6A 1SVNA 3CRRA 4CLOB 3PEUA 2FSIA 2XQKA 4X1OA 4G1MB 4J0EA 3G8CA 1WUJS 5B1SA 1TYZA 3MS2A 4KE6A 4Y6RA 2YMPA 1GPYA 4PTZA 1W36C 2HKIA 5FLEX 4RAQA 5FTWA 4A0SA 4DSUA 1ZM7A 2HMUA 1WVGA 4Y2GA 5FO0A 3KYDB 3CUKA 1M2FA 2O3SA 2DKFA 3R44A 1QUEA 5HZGA 3RADC 821PA 5KHLB 3U4MA 5IBQA 1V16A 2R65A 2ZSFA 1UP4A 2HA6A 3RABA 6LDHA 3LMKA 1QTRA 4QUIA 5IAOA 1Z2PX 5BORA 5DHUA 1V7PC 3WGMA 5FAXA 2HU8A 3D8UA 5K0FA 1MRZA 4ESOA 4HS4A 4RVCA 2X2FA 5GMOA 2EZUA 4L4ZA 4M55A 3B5EA 1QO9A 4JC5A 4QDTA 1N8KA 4Q47A 1DU4A 2WP0A 2B0CA 1DCMA 2GN6A 5DHRA 3ZTTA 4ETWA 2Y6UA 3WIVA 4HS9A 5KDOA 2PS3A 3UG7A 5BSEA 5DM0A 2HB6A 4K9MA 1FXWF 5K0TA 2FJUA 3HI4A 1VHDA 1UPUA 2QIPA 2R68A 5ESWA 3RJ9A 4REQB 1KNQA 1NI4A 3JQAB 2XQFA 3G7NA 4H31A 4WGFA 1Z07A 3D5TA 4HDCA 3OUTA 3VDNB 1OR8A 4D8VA 4WZAE 5BNTA 2D1QA 4S3MA 3RUDA 5KNCD 2VBIA 3BZWA 3KQQA 3RNLA 3G7SA 2TMYA 1PNTA 2CZCA 4M2LA 2C0PA 3Q2OA 4GRDA 3T3GA 1GXSA 2BTQA 1JG4A 5IDVA 2NU6A 3OSZA 3Q8MA 4KBYA 2EBUA 1Z6ZA 3CFYA 3I4FA 1DZ3A 3FUXA 3R75A 2GWRA 1CBUA 4F06A 5JAPA 2H29A 5KJCA 4BE4A 3S5JA 2PEZA 4AMUA 4BVKA 4A8JA 4D26A 2VDUE 3C5CA 3M1AA 3ZE6A 3GZNA 4AXBA 1NPTO 1PKXA 1F8UA 1DFIA 3TUZC 2ZJ3A 3CT4A 3N8DA 5DGHA 4B1FA 2YW9A 4CQMD 3BUSA 4RZHA 3HTXA 2XAUA 3GVHA 4NBSA 2AS0A 3NHLA 3PD7A 4AICA 3EW9A 4BX8A 3DV0B 4QJ3A 3UT5A 2Q3CA 4NZMA 1PKEA 2A6PA 4OQEA 4KR7A 1B00A 4UHHA 5HIMA 2WG0A 4WK6A 1Q2UA 2EAUA 3MVEA 5E9JA 5EKXA 5LMCA 4NENB 3AFMA 2AFIE 4U02A 4FFMA 3H1AA 1FYEA 1RSZA 1G21A 1PL8A 1BFUA 3P7MA 2ZTUA 4JMLA 5CHYA 4Z9AA 1RYFA 3TJZA 4EHIA 3NJRA 5IDWA 2EZ8A 1XPJA 4YP9A 4BJ1A 5BSFA 1Z0JA 2WI8A 4Z0PA 2MYPA 4I9GA 4CM8A 2Q8NA 3IBTA 3KJGA 2CDNA 4MVWA 2ZXFA 2QMUA 4RYLA 4RF5A 2UZ3A 3ZZ1A 1G5HA 4H4CA 5B12A 3EVBA 4RTMA 4X24A 2R66A 5JVDF 1JRLA 3A10A 4X61A 1GPH1 3EEQA 3TCXB 4JKOA 4BUCA 5CM8B 2P11A 2HRDA 3ODGA 4NABA 5E3HA 4CTMA 5JI3E 3HA5A 5KNCH 2JFVA 1Z33A 2Z2XA 1CUHA 1SXIA 3H04A 3WRYC 3HH8A 2F8SA 1N9KA 4Q3AA 4Q19A 3A9VA 3NPAA 3FOWA 1X7ZA 4O2AB 2D7CA 4MUFA 1YOBA 4DV3B 4QGBA 3O8DA 2V5AA 2ZIFA 2X8JB 3VYWA 2YXEA 4PGFA 1YAJA 5DCUA 3HCAA 3AESB 3G7UA 1RADA 3F71A 2R1VB 1EP2B 2EERA 4N3AA 4CKYA 3ZYZA 2JNWA 5F3DA 1A7UA 7ABPA 2CNOA 4W99A 4ZQGA 4E70A 3JWJA 1NSTA 1P81A 2Q0HA 3HCNA 4H3VA 2YRWA 3WISA 5H9WA 2QG4A 2H59A 4MS4B 1NW7A 4MS1B 1D0SA 2IH2A 3ZK7A 3TRJA 4H18A 1RFGE 3K32A 3S8YA 4GZMA 1YK1A 1OX5A 1XJ0A 4B48A 3WLAA 4DUYB 1E9SA 3AB7A 1V3TA 1T2AA 2GF0A 2CZGA 2Q7XA 5J63A 3GRFA 3WSTA 2NNWB 1IIRA 1OBVA 2ONCA 1SEVA 4ZJUA 1BSVA 1E79D 2NU9A 3EGVA 2R8BA 4M36A 2O8NA 3KHTA 2HGZA 4YRPA 1GGEA 5LCXA 5B2FA 2ZS8A 4LRTB 4BB5A 2WWXA 1T4DA 2IXDA 2OBXA 3QYAA 2ORWA 4OSOA 5I7WA 2HV8A 4QE3A 5I7RA 1UWCA 2YFYA 2EGUA 3JU3A 2E85A 3A9RA 1KC3A 3BSFA 1W25A 2JL1A 1MW9X 4EVQA 1Q6YA 2H1WA 3OT4A 3AR9A 4P5EA 4HXYA 4IDGA 2O2CA 1JKIA 2QDXA 3D7KA 2B21A 5HNKA 3DAGA 3ZY6A 1WE2A 1ZZGA 3N8GA 5B3AA 3I09A 1OLXA 4XIFA 4DM4A 2XZOA 1YDMA 3DBOB 3G2PA 4FE3A 1VL5A 2PRJA 2RHDA 3I30X 4FWIB 4I1IA 4J2TA 1DRVA 2YVUA 1ZG3A 3M4ZA 2Q6TA 4RO0A 4OU5A 3WKCA 4A0RA 2B1IA 3SF8B 3TSCA 1LK7A 1G3QA 2G6TA 3ZU6A 1EVYA 3PD0A 1MGOA 3H9EO 4RCYA 5HWSA 4BEJA 5DV9A 2A9PA 3H5VA 3NBXX 3TQRA 4QFBA 4YLYA 2GZ2A 1G4UR 1ZD9A 2WWTA 2DSTA 4GD3Q 3TTXA 2M6KA 4FCVA 1X19A 1A97A 1WSAA 1VHWA 2VUTA 2CLOB 4JJZA 3VOBA 4N0DA 3U3ZA 4D57A 4G07A 4ISCA 4DDUA 1VMDA 1ULBA 4KXWA 4BNYA 1TADA 3VNQA 5EGNA 1USVA 2HYIC 2G4VA 2GAJA 1VP3A 4R1UA 4LRWA 3WI7A 1AKVA 2VDVE 3C3YA 3FVQA 5BQXA 2B37A 3ZDZB 2C5LA 3ESCA 3JTMA 1NXTA 1DC8A 1JHDA 2BN4A 3M9WA 4O25A 3RSOA 5KQRA 1JH8A 3KTOA 1A5BB 1DOHA 2BM1A 2BGUA 1KH1A 1XRLA 4L4UA 3LKZA 4GOMD 1UPBA 4J4TA 2G1KA 3BT7A 4JI8B 4ZAYA 3O31A 1QBGA 1F1BA 3D6VA 2O50A 1JHAA 4QUAA 2WUGA 1VB3A 3LZDA 3MWEB 4AJNA 1H2HA 4J94A 1FPQA 4P0PB 4UMDA 5JCOC 1O0SA 3W5SA 3OX3A 4UPEA 4II3A 2Z4TA 3SPXA 3EGEA 3PKJA 1SHZA 1XRRA 3P0HA 5EIOA 1KGDA 2WDZA 3UHAA 2YWEA 4MCHA 2FLWA 4PC1A 1CEYA 1Z2EA 3T3PB 2ZE5A 1AXEA 3VC7A 1IBMB 2J7PD 3B78A 4K03A 1MO2A 3QPUA 2UXBB 2ODBA 3UYKA 2VJNA 2ZYSA 3HXKA 3FW1A 2O57A 2XF2A 2YWHA 2A2ZA 3NO4A 4KJZA 5BWBA 1VLQA 4JNKA 4QYXA 5C52B 2I1WA 1IXKA 1XLWA 3Q7TA 1RAGA 3R23A 1QM5A 4FGWA 3D54D 1L8OA 5FLKA 1S1CA 1LF5A 2C9MA 2N47A 2W9XA 3VJLA 2ODEA 1T9ZA 2OBBA 4TV8F 5IKOA 4CMEA 4IFEA 2FGJA 4FR0A 1NOJA 3W9YA 2R8YA 5LQAA 2AJCA 4G41A 3L04A 4GNRA 5MN6A 4X62B 4TVBA 1Z68A 3EVDA 3NX4A 4EHLA 2WFLA 1HMYA 1BFKA 2IYLD 1SC1A 4UAUA 3RSSA 1YFZA 3K9QO 4RY8A 4UREA 2C7QA 1D07A 3EDCA 2E18A 1RBMA 1QHEA 4YQFA 3F8TA 1TT7A 2FDRA 3STTA 2Y05A 3M9LA 4KMSA 2I7VA 4GKAA 1W48A 3HFJA 4JENA 3FYDA 3PKZA 3UJ9A 1APBA 3CVJA 1L3CA 4HAXA 5EHIA 1CRPA 2C98A 3P1JA 1BHSA 4HSEA 3IR7A 2RI6A 5TRTA 1CB7A 4R1QA 5EIBC 3FRJA 4Z1OA 2ZVDA 3A6LA 1ODJA 3LSYA 3HU2A 3CUTA 3KUKA 1D4ZA 1E2KA 3OTQA 4Q6BA 1M2NA 1OREA 5I01A 1A9SA 2F00A 2I7XA 4YAIA 4J0KA 5JALA 2XRYA 1U7XA 3OFVA 3C39A 1E7QA 5E9WA 1YS9A 2YWCA 2EBFX 2NMVA 2FX5A 2P3QA 3UM9A 3ZOZA 1O4VA 3QV1A 3VSEA 1IN5A 2CFRA 1AZLA 2ON6A 4OV6B 4QATA 3F1KA 4XR9A 4ALMA 2IDMA 5F7OA 1L7DA 1Z56C 4E07A 2FW8A 2IYOA 2PMWB 2O8CA 1FSGA 4E94A 4TMZA 3SG0A 2G4CA 4GAEA 1ZP6A 4HDSB 1F0YA 2QTLA 1CKEA 2BGLA 4HBZA 3VNBA 2BUAA 3GI1A 4RFSB 1TQ2A 5CK4A 4P32A 5ALLA 3UHFA 1PT9A 3JRNA 4GUAA 1P5FA 1ULSA 2H2DA 1GZ3A 3C74A 4N0MA 4NMHA 4GKBA 4N4AA 4NZ9A 4PC7A 1NBMD 3VGJA 2HQRA 1KMHB 1Y4AE 3OTIA 4QELA 4Q05A 5I9IA 1AZWA 1SC4A 3GA0A 4UBOA 3CKMA 5K3FB 1Y5RA 3G8BA 2X40A 4MGEA 4J3NA 4ZGBA 1TFUA 3PS9A 5ALPA 3T7JA 5L4LA 2HWKA 4M21A 1VSBA 2EG5A 4NXMB 5A6SA 3H2ZA 5DN6D 5JNLA 3IEIA 4FDUA 3SZ3A 1JMVA 2GKOA 3PFHA 2BLNA 4E09A 2I34A 3TNDA 1MAHA 1NMYA 3EGDB 5CA1F 2PSFA 4DYHA 4OB7A 5LJLA 1DJMA 3IA2A 4A5SA 4E15A 3WNVA 1Y8RB 4DCUA 3S5UA 2V4ZA 2FETA 1SG9A 4M0CA 4YAWA 1W44A 3BRQA 5F12A 1VJTA 2FG6C 1V1RA 4HEJA 3S2SA 5JUWA 2G67A 1EK0A 4MHOA 5FUVA 5CD9A 4FEEA 5HTKA 2IPNA 1DO0A 1KRHA 2I4NA 2PH3A 2PHZA 4IILA 4ZCRA 1XFDA 5KNDD 1E94E 3TX2A 1U7OA 3BGOS 1SHTX 1A9RA 5K4HA 5EC8A 4X71A 2CT8A 2IX9A 1C81A 3G02A 3IQDB 2FSPA 2NQTA 5AVYA 3ABIA 2QRZA 2XVAA 3ZD6A 2ATVA 2CJXA 4HGPA 1R9NA 4N7MA 1P7VA 1TC2A 2ZJZA 4Y9RA 2VSNA 3WDLA 3QEMB 4J0DA 3IUSA 3W8EA 3N8HA 1XTJA 3KJQA 3E4CA 3JARB 3OJEA 4L15A 4BCBA 1RPZA 3H2BA 4NZOA 2OXEA 4UD6A 1JBEA 3PPVA 4MR9A 2YRXA 3AKYA 4JDPA 3WZLA 4BKMA 4OGKA 3SM9A 4LBVA 2W90A 1FRZA 2MSKA 2A5JA 3CIFA 3GCWA 2EGHA 3P96A 4R0VA 1DINA 1KDOA 3FSEA 4HMOA 5A05A 3VH1A 3ZIUA 3KYCA 4HVTA 2UDPA 3H11A 3FFWA 5EHGA 3SSNA 3AM1A 1SCJA 1R37A 1C1YA 4L07A 4U8GA 3L8EA 2JBWA 1ZW1A 3GNSA 1BXGB 4MWSA 5C8YF 4F1KA 2BY4A 3R0ZA 4RKRA 4I55A 2FSSA 4KP7A 2QENA 1BA3A 1RCFA 3ER6A 3VAAA 4Z6KA 4BXOA 2O8BB 5CD1A 3BYZA 1IPHA 3B1VA 1SIWA 1U1CA 4QECA 2TMKA 4EHJA 4QXQA 5LUAA 1FY2A 4OHBA 4ZCQA 4LJYA 2PFKA 1EZZA 1G19A 1HE1C 1MUUA 1NJFA 2LCIA 3FFXA 3K0HA 2QAJA 2JIBA 5IU6A 3I4CA 2X13A 3ET5A 3FUTA 4RYDA 2HU2A 3IVRA 3WGYA 4QWWA 2PX6A 3URMA 4QM6A 5JOQA 1WXXA 1YZGA 1BKYA 3DOJA 1C1HA 4WA7A 3U7FB 1CQWA 4U7FA 2UYYA 4QBGB 2ZDHA 4I5GA 5FL7D 3BAFA 3RJMA 3X2EA 4KNYA 3RRXA 3VTZA 4MKGA 1Q7EA 4S1WA 2H08A 3JAWA 5E4FA 2C3UA 5J9FA 3Q1KA 2BBWA 4GSLA 3WLIA 2CWWA 3QYFA 4MQFB 4NPHA 3L4BC 3KQVA 2GQ0A 5TEWA 3W78A 3WKBA 3MQ4A 4EUEA 1FOEB 3N53A 3I1IA 1ISJA 1QAMA 1E3LA 2ODAA 4QC2A 2ZB2A 4UZSA 4S1OA 5H16A 4DLSA 4OATA 3H3JA 5ALHA 4GEKA 4JXXA 2BP7A 1NVFA 4ROSA 3SD7A 1L7PA 3PQ5A 2KQUA 5L3VA 3E9EA 2F48A 1I30A 2FFJA 5AJUA 1A1VA 4QUBA 1AUOA 4JJIA 4OQZA 1R9GA 5CR9A 5K3DA 3N59A 4MV9A 4HATA 3O8BA 2Z6VA 1FMTA 3GIWA 4IIEA 4NBTA 4NONA 1NF3A 1U3FA 2Q29A 4CQLA 1M0TA 4INZA 4F21A 2XNKA 4D4JA 4RSRA 2BKEA 5HXAA 1PL7A 1UDRA 2R6HA 4QTZA 1A2QA 1UANA 4ZYTA 2E1PA 4LOKA 3V34A 5A4JA 2OG1A 3L6RA 5DU2A 3IBYA 4J4HA 3WK4A 2VTEA 4MAFA 2GZ3A 1Z06A 4YUXA 1BVHA 1KE1A 3AF4A 2BR4A 3ZHSA 2VWHA 2V7QD 4TLAA 3UMFA 4F38A 4KUHA 3IERA 2O07A 5CVJA 3C4QA 3SC2A 3E7DA 2RKWA 4GC9A 1Z4JA 1RPJA 5I7SA 3X1DA 5LVAA 2P75A 5TPZD 4C0QC 2ZS9A 1NUPA 4Q82A 3L7BA 1VHTA 1KEVA 3NIWA 5JJBA 1UADA 4V38A 2RGYA 1FTSA 3MCZA 1O54A 4U7DA 2GPJA 3PC8A 3LV8A 2IX3A 2WWGA 1DC7A 1Y4UA 2NU7A 1VHQA 2ZJAA 3JYHA 4FNOA 4Q4AB 2JGEA 3IOEA 4BJ6A 2FSGA 1QE3A 1XZ8A 1ID8A 4CODB 2J45A 3U17A 1KO8A 1VMEA 3E18A 1L1RA 1U2TA 1XEWX 1UJNA 5FF9A 4QZVA 2F1RA 2JATA 2A9JA 3OBIA 4MWBA 2AZMA 2PQ0A 3QVXA 4I8XA 4AYWA 3ORFA 1PJQA 4F6RB 4ZCLA 1KY5A 2XUPA 1Z7YA 1R4MB 2WF9A 3JW8A 1ZFNA 1R0KA 3K3PA 1RYHA 3BN3A 3PZRA 4WBXC 2CC2A 5KPJA 2AR9A 3HLYA 2O20A 2EIHA 3A4LA 3IDQA 3NCTA 2IYTA 3KIPA 1JIIA 4FI3C 4HADA 4X20A 2WZCA 3TMKA 1K5PA 1ZM9A 3ZDEA 1MEEA 4J1QA 4YCAA 3WWPA 4BP1A 3L8DA 5LBUA 4YV2A 5GOTA 4GZ6A 1DGQA 1JIQA 3E3LA 1ZN7A 3LYUA 4HUTA 1O0CA 1KJIA 1NFFA 1BCSB 1C29B 3L7AA 2YHIB 5BYJA 5F35A 4DC0A 5IKPA 1HO3A 1R4NB 2CW5A 4JLJA 4ND4A 1R3DA 2LRHA 4FC6A 3DKIA 1V1MA 1K75A 5L3QB 3M70A 2ZBQA 3WL8A 3N70A 1XTVA 3P94A 4KSYA 3NG1A 2I29A 2JHAA 4M89A 4B9EA 1NM5C 2RHHA 4GLJA 1Z63A 4I2NA 1JPNA 1WPRA 3KT8A 2YYYA 5TQ0B 1VDZA 3CSUA 4YCJA 1PR9A 1G4HA 2X3YA 4XD7D 2X5XA 3NS7A 4AROA 2WIAA 1RTTA 4OX9Y 2XGSA 5IX8A 2NTEA 2EFDB 3EZ7A 1REQB 1XZIA 2OFOA 2XNHA 1RI3A 2C7RA 2NVWA 1D2NA 2ZRLA 5GM2A 3JZMA 3QEBZ 1TX4B 3T7DA 3HXLA 5CLJA 3EQ7A 4F8EA 5I4IA 1JFFB 2FQWA 2ZIUB 4HDNB 2REQB 3W3AA 1QIGA 3FRIA 1B2LA 4GMKA 1KQFA 5EIXA 2K5UA 2F4NA 5KNBA 1IOVA 4AZVA 5IMSA 4DMHA 4S35A 2O8DA 4GSKA 3DHNA 1WUHS 3IIJA 1JKFA 3B85A 3OZBA 5FYQA 4G0WA 2OXFA 4OPMA 3DDNA 3EIUA 2VUUA 4R1NA 3UNXA 2JFXA 1VIVA 3BQ9A 3HBFA 4C0BA 4HAOA 4C6SA 4CCYB 3BQMB 3D7MA 4CLRA 2VFAA 3C7AA 2C4MA 1X77A 3IQZA 4TUYB 3TDKA 4O2BB 5DKFA 3WWCA 3TLGB 3P9ZA 2V4MA 1XNJA 4Q15A 4ZIRA 3THRA 4IXDA 1O4WA 1MJHA 4WNCA 4KR6A 3GEPA 4R5MA 2XB9A 1N77A 3TO5A 1PYGA 4AY5A 1SXJA 4QL3A 3KJXA 1HORA 1X1TA 3IEMA 3WBJA 2PX3A 5TPWA 5KYTA 4W5RA 1HZZA 1T0JB 2R1UA 3PRYA 4G67A 3COPA 2WHEA 4XLLA 4ECEA 3IKVA 2Y2UA 3UXEA 1RWVA 3AUFA 4UEWA 1QZUA 1WPQA 3HCFA 1CE8A 3ZWKA 1K27A 2NO4A 2P0YA 3HY3A 4TWJA 1EX9A 4BAUA 2Q3EA 3QP9A 3CX8A 4GMFA 4MTCA 2ETXA 4R2JA 3RQSA 3C1AA 3GGOA 3VVLA 2CL5A 3P9SA 4B76A 4EG3A 2EBWA 5KTTA 4MDHA 2QRVA 1LLUA 3WRXC 4D4KA 4RNCA 4JITA 4Q66C 4FWBA 2PGIA 2QR5A 4OHFA 2P8JA 2DECA 2NO5A 2X3FA 1TAGA 2YJ6A 3R5TA 4URXR 5CFPA 1PF7E 2ZYGA 1AKTA 3CF6R 4F9TA 1SUSA 1BNCA 1RXCA 1LV7A 3E9RA 1KZ1A 4FLEA 1M6HA 1SULA 2BC9A 4LBYA 4C3OB 1L7VC 2G1UA 5AT1A 1UCFA 2AN5A 2YICA 5FA8A 4DY4A 4TRJA 4C7VA 9ABPA 3SKYA 5HHTA 1QWOA 3L0CA 1PT8A 1L5ZA 1H6DA 1CDOA 4OREX 5FUMA 3DZHA 2BTQB 1YASA 3L2OB 2GPYA 3ZHVA 2I9PA 4XIIA 4XWKA 4KJXA 4S05A 5K3CA 1O0BA 1LVGA 4A8JB 2VQEB 2NU8A 2DPMA 1R4AA 2VZ9A 4KXUA 3RTDA 2GD0A 3AFIA 2QNIA 1Q14A 1TAQA 1VA4A 3GJ4A 1FMLA 2HF7A 3A25A 3G2KA 5DHQA 2QUIA 1DMRA 2DJIA 3RUFA 1HLGA 4J0FA 3UMBA 2R79A 4XPZA 3WZ2A 4ZO7A 5HRCA 4IFBA 1M34A 1CVRA 4OLJA 5HIJA 2RAVA 5GIPE 1QF6A 1O7JA 1SN7A 3A6JA 3V9AA 1G21B 3DWIA 2H7XA 2HO4A 2J07A 3KEFA 1W52X 4LNUA 5T6MA 3H4VA 1O08A 3IR6A 2LP4Y 2IE0A 1IY0A 3PKIA 4JDUA 1LH0A 1LGYA 1SD5A 1PZGA 5T3UA 2C5AA 2GPTA 2O9JA 5HCUA 2WVHA 4GUDA 3IDSA 3OE5A 1OGYA 3IVXA 3UO8B 5JCZA 2Y6VA 4CM8B 3QQ5A 1ODIA 4JLOA 2VDWA 4D3SA 4QGGA 2PYDA 1L8XA 2XUGA 1QQBA 1QDLB 5BNIA 1B41A 1F6BA 3E58A 5B1HA 3VDXA 1UDCA 1UMBA 4O4IF 1QYWA 2QZPA 3IPLA 3R6TA 3OQJA 4BFVA 4EG6A 4WK0B 4JB3A 4E2YA 5BQPA 4BU1A 1KNXA 2BZSA 1WP9A 3QU2A 3VUEA 4LN1A 4EEZA 2JLWA 4KQEA 2BISA 1D7AA 1NJGA 2H3HA 5D00A 4Z53A 4LY6A 2VYVA 5CFZA 4MUAA 2MSLA 2VDLB 1D9XA 4B4KA 2FP3A 1AUVA 3COSA 4M87A 5EJAA 2WR8A 1X7ZB 3NANA 1QLHA 4I1VA 2FMUA 5LZ8A 4AZ3A 1PAUA 4RKYA 4F12A 3W4JA 5TS2A 3D2CA 4D02A 2ONJA 3HEAA 4FS3A 5KYYB 4A6XA 1KJ8A 1P72A 4H6XA 4RENA 4M1ZA 2EJBA 2WSBA 3PVSA 1IBKB 2G0NA 2LD4A 5JDCC 1CDDA 1LWOA 2NO1A 1W85A 3L0OA 2IYAA 3DNMA 5YASA 3ICWA 3UK7A 5DXAA 3COVA 1SCNE 3WX0A 3M4YA 4OK5A 2XWPA 2WTAA 1KAGA 2Y93A 4Q1FA 2OV3A 2VG8A 4OHXA 1NBAA 1UJ5A 4GVPA 4M0PA 1Q1GA 4AJPA 1J39A 3UXYA 1M6NA 5CM9C 2C2MA 1JSZA 1XDSA 1US8A 1XZCA 3ETHA 3HM2A 3N28A 4U8HA 2NVUB 3RRZA 4C0LA 2C99A 4HFMA 3HVIA 1CUCA 2G06A 2WFAA 3ADBA 1R66A 1P5JA