3H3FA

Rabbit muscle l-lactate dehydrogenase in complex with nadh and oxamate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
331
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Modeling of isotope effects on binding oxamate to lactic dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 107
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h3fA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3h3fA02
4CM5A 5L53A 1XSEA 1TT7A 4Q39A 1A5ZA 1HF3A 4QFCA 4YJHA 3K2EA 1BVRA 1H93A 3AOEA 2X4GA 5T6BA 4FOSA 1RKXA 2O2SA 4M49A 4NH4A 4MOWA 4BO0A 3IS3A 2PZMA 2C29D 4D43A 3VDQA 2Q49A 4BKPA 2NTNA 2P5YA 3GMDA 3LLVA 4WUVA 4PG7A 1F17A 2Q46A 4J3FA 4NBTA 4DC0A 3BTVA 4Y6SA 3PJGA 5B37A 3U5TA 4GKBA 3GUYA 1IY8A 1R12A 3TWOA 3MWEB 3M1AA 4MKRA 3S2EA 1KC3A 1KVSA 4F6LA 4AJPA 1UAGA 2RHCA 4LVUA 2X22A 4A7PA 4BMSA 3LQFA 1MGOA 2W90A 4YA6A 5KIAA 3PYXA 2DKNA 1ZVMA 2ZK7A 4K28A 2DBQA 3L9WA 3CKYA 1A71A 4IUYA 3E9MA 2AEJA 5G0VA 1LC3A 1GAEO 5F1OA 1X13A 1B8PA 3L4BA 4OJNA 3DHYA 4ID9A 3DBHB 2P68A 3AI2A 3ANLA 4PLVA 4UREA 4B8WA 3WYEA 2YJZA 4JJIA 3QVWA 5KVVA 1CQJA 2YHIB 3KM0A 3MOIA 5ILGA 4B4OA 5ADHA 5ER9A 5A4DA 1DRWA 1PZGA 1ZJYA 3JQFC 2VUUA 4Y6RA 3OMLA 4I5DA 1Y1PA 4LMRA 1NASA 1MXFA 3OEWA 4RDHA 3I83A 4N5NA 2DUUA 4KOAA 1SNYA 4J7XA 3GOHA 3NYWA 4JLWA 4OXYA 3PHGA 3QY9A 4MVJA 3TDKA 4W82A 3U4CA 2HU2A 3A4VA 4RPHA 1V6AA 2HMSA 1HYGA 4IQ0A 1JAYA 2EW2A 1U8XX 3JYOA 3Q6IA 5B1YA 3PLNA 4IMPA 1GZ3A 1AN9A 1LRKA 4NJMB 4NFHA 1Z82A 4NBRA 5GZ1A 4QTZA 3R3SA 3ENNA 3R6DA 4TWRA 3WMXA 5A3JA 3H9JA 4BGUA 2UUPA 1PQUA 4UVDA 5A04A 2G1UA 1PQWA 1OC2A 3KEQA 4BOYA 3NDIA 2Q2QA 3AFMA 2HAEA 3EYWA 2OGUA 3TZ6A 5EESA 1I5RA 3H6KA 3L6EA 4L8VA 5ITWA 2J5QA 3OETA 2FP4A 4XKJA 4A03A 3DEYX 4YRDA 1V35A 3C7CB 3GAZA 3JQBA 3TPCA 4ALJA 4I8XA 3V2GA 1EFLA 3H7AA 3K73O 3MCVA 1U9JA 2VHYA 3I9JA 1HE3A 2VZ0A 1U3UA 3IP1A 1V3VA 3HG7A 4TRMA 5CHEA 1V0JA 3E03A 3VVBA 2Y93A 5G4KB 3CSDA 1NQ5A 1YQDA 3KLPX 4YR9A 4J9UE 3RUAA 3UKOA 5IZCA 1HE4A 3GPDG 1T1RA 2J8ZA 1HDYA 1O6ZA 4GVXA 2Q1WA 4DRYA 3CZRA 3S8MA 4I1IA 1E3WB 2IXBA 3ZDFA 4DLLA 4DTIA 4XQGA 4R1UA 1Q7GA 1X0VA 4IQGA 2WYVA 3IP3A 1FXSA 4R1SA 1OOEA 2RCYA 4BNIA 1ENZA 1NXQA 1PX0A 5LCXA 5JDIC 3DBRB 5IXYA 4IS3A 2GDZA 4PRLA 5K0ZA 1IZ0A 3E8XA 1VSUA 1DIGA 5F21A 5A9SA 5JY6A 4TZKA 1H6BA 1Q1NA 3TRIA 3ZWPA 3SC6A 1DC4A 3PJDA 4P4NA 2OUIA 3G17A 1Q0QA 3FNEA 2WMDA 3GGPA 3TNLA 5BSFA 3WTBA 4NBUA 3GFGA 2YQ4A 1PJTA 4YJGA 3F4LA 3I9NA 2BELA 3PZBA 4OMUA 5LDGA 2GASA 5CDGA 4HBGA 3I23A 4UUPA 4J43A 3WWYA 4TRNA 1PR9A 3KRTA 6ADHA 3ENKA 2VTEA 2HMTA 2PKQO 3ZW9A 2LDXA 4IJWA 2HSDA 4UUOA 3VPHA 4BNKA 4PVDA 2DTEA 3GMSA 1EUDA 3BMNA 3AM4A 3PJEA 3B6ZA 1GTMA 5KVQA 4R1NA 4A0SA 1VLLA 3NEPX 3BZUA 1U5AA 4OQZA 3L07A 1QXSA 3WFJA 5F1KA 5CDYA 4OAQA 4E2WA 2GCGA 3EZLA 1U4SA 2EG9A 3HHPA 4CM4A 3CMCO 3D0OA 4OKIA 1HDGO 1XWFA 4II3A 4WASA 1H6CA 2NU6A 2RH8A 4W7IA 5JO0A 3WLFA 4FIZA 4J16A 2JCYA 4HP8A 4CUKA 2QG4A 4KQWA 5KVSA 4FCCA 4WPGA 4LK3A 5FEUA 2B5VA 3G0OA 3HSKA 1QYVA 1IE3A 1DLJA 3VTFA 4GVLA 4UEJA 2CVQA 3PQEA 1LC0A 2O4UX 4I5GA 1EK6A 4KUGA 3QSGA 3VH1A 1MC4A 2Y0DA 3DC2A 3K30A 5KKCA 4RVFA 3RUFA 5AXDA 4J0EA 5H81A 1SZJG 4RF4A 1P31A 4PLTA 2VZ9A 5IG2A 4M8SA 4J1QA 1A7AA 4FFRA 4JBHA 3LLSA 2H5LA 1H2BA 1E7SA 1EVZA 3D3WB 1GEGA 3C7DB 1IL0A 4BNVA 1S7CA 3VTZA 3STHA 4DIFA 5JAMA 4XX0A 3SLKA 1HL3A 2IEBA 1T2CA 1NP3A 2UV8A 4Z9FA 3VH4A 3L4SO 1GUZA 3DBLB 4E2ZA 2X9VA 4L75A 4M86A 5JAZA 5BR7A 4DGSA 1KVQA 3OBBA 1R66A 1UAYA 2EGGA 5I7FA 1SPXA 4CLRB 1Y5MA 2YY7A 3U0BA 4G5HA 4QX6A 5KJEA 3W8DA 4YJFA 3W4KA 4EJMA 5BNTA 1WLYA 3JQAA 4ROSA 5C7IO 1PZHA 1JU9A 3T7CA 2DFVA 1X14A 2P4HX 3NDRA 3HE3A 2RBEA 2V6FA 1D1TA 5JCJA 4CJXA 1LQUA 4OL9A 2CD9A 1UDBA 2ET6A 1P1RA 3R3JA 4XQEA 3UGKA 1HETA 3QVXA 1TT5B 3H5RA 2B0JA 4K1LA 3GVCA 1I2BA 3PGJA 1CWUA 1I30A 1LDGA 1O95A 3U4HA 1KY5A 1HEUA 1U5CA 3ZZNA 1W6UA 3GZNB 3KYCB 5GY7A 3QWHA 3ZNOA 3D5QA 1XEAA 2X8LA 3UUWA 2PH5A 3FBTA 2QRJA 5TRTA 1R4MA 1JAXA 1KBZA 5JDCC 1K0UA 4D3FA 2GD1O 1VJTA 4YRAA 3ANNA 1GZ6A 2CUKA 3HUDA 3NTRA 5KCZA 3JYNA 1Y8RA 1F8FA 2VUTA 3FN4A 2DPHA 4NJMA 4DL9A 5IN4A 2AHRA 4XQCA 1PR3A 5L51A 1UJMA 2Q99A 4PZEA 4EJ6A 1QSGA 4J6FA 1O94A 2O3JA 1I3MA 1OBFO 2QQ5A 3C8MA 3FF4A 4TROA 5GZ6A 4BO9A 2G5CA 3HDQA 1BDBA 3WGZA 3INTA 5A3VA 1R0LA 2CDAA 5EIOA 3UN1A 5L45A 3UCFA 2FMUA 4PVCA 3PEFA 4RV9A 1T2DA 5ICMA 1U3TA 4WEQA 2J3KA 1E1NA 1B26A 2I5PO 4RF3A 4DPMA 1ZMOA 3FNHA 5KJCA 1EQUA 2Q1UA 3WNQA 2NNLD 3H2SA 1CERA 1QYWA 2D0IA 4ND4A 3AI3A 1P0FA 2BRUA 3CE6A 5GMOA 3WQRA 3DZBA 4E13A 1ULUA 3EC7A 2XXBA 5F5NA 5G4KA 2IZZA 1HTBA 1T4DA 4DLBA 3H8VA 4B4VA 2FSSA 4ZQEA 4GWKA 2NU9A 4XB1A 1PJBA 2WDZA 2PGLA 2C82A 4GX2A 1NR7A 1W73A 2OHXA 4NG5A 4D3DA 1HZZA 1NNUA 3ZNPA 3GN1A 4A26A 5F1PA 3GHHA 2GYYA 3E5RA 4LN1A 1N5DA 1E3WA 3ITKA 3L9XA 4FOOA 4DQXA 5DN9A 3BTUA 4J7UA 1GPDG 2X9GA 3WSWA 1IYZA 2XF8A 1ZK4A 3U09A 4YVFA 5A02A 4IIUA 1VJ0A 3KVOA 4ZA2A 2X0RA 2VHWA 3RBXA 4CLHA 3TQHA 3BMQB 4PLPA 2VZ8A 3D4PA 1C3VA 4I5EA 3IMFA 2EV9A 3PGXA 4HUJA 4CMEC 3CH6A 4MVJM 4OO3A 1F8GA 4M1QA 4ESOA 1HKUA 1HT0A 3GY0A 3QA9A 1C0IA 4FB5A 5IDWA 1MP0A 1N7GA 3K6JA 4MVJI 2FSVA 4DUPA 4PLHA 1WWKA 5DULA 3QJ5A 2NADA 1DIHA 2VNAA 1AHIA 2Y68A 3KUXA 2WYUA 4RLHA 4E33A 3RU9A 1ZXBA 4RQTA 1JKJA 1PU2A 5HS6A 3RSHA 1EDOA 4RGBA 2YQ5A 3I9LA 3LT4A 3RJ5A 3LC1O 2YUTA 3RFTA 1U7HA 2OZPA 1ZO8A 5A5FA 3LT2A 3OF2A 1XU9A 1N2SA 4D44A 3DR3A 2D1YA 4UEOA 3H65A 4D45A 1G1AA 3Q2KA 4PG8A 4RDIA 5L7WA 2DU8A 3KYDB 1UXIA 4R9RA 3F46A 2DLDA 4RVDA 3LSYA 3V2HA 5IZ4A 3GK3A 4HNHA 4PLCA 2VUSA 3JTMA 2J3HA 2O7QA 1KOLA 2RAFA 1GUYA 3QHAA 1L7EA 3I6IA 4W9NC 1UZLA 4CLOB 2ILTA 3EHEA 3D1LA 1EMDA 2IXAA 3OP4A 4XDZA 1GQQA 4TSKA 3CIFA 3INRA 3F1KA 2BMAA 1QLJA 4PLWA 4OH1A 4XRGA 3Q2IA 4DC1A 2Y1DA 2C2YA 2HKIA 4JP2A 2QIOA 3ROKA 3NT2A 3VPXA 4N5MA 4HWKA 2GR9A 2Y1EA 3DL2A 4BO8A 4JCOA 2PNFA 2DTXA 3FSRA 3EVTA 4FC6A 4R5HA 2JFFA 1ADFA 3HN2A 3QW2A 2NU8A 1E7RA 1GD1O 4WLVA 4AJNA 4BMVA 4DYDA 1GR0A 1HDOA 4YDRA 2Q2WA 4CL3A 3GNQA 2UAGA 3IQDB 4UUNA 1MC5A 1DO8A 1LDNA 1UXKA 1E1MA 1BXKA 2Q50A 3DHEA 3DMTC 4PFJA 3SJUA 1QMGA 4IQ8A 3P2YA 5AOVA 1MG5A 1WMAA 2PD6A 3Q9UA 5JMPA 3OIFA 5FI5A 4YT4A 4A5OA 4LSWA 4IM7A 1E77A 3HDHA 1Z7BA 3VPFA 2PZLA 4BHTA 3SVTA 1Q7BA 3OM9A 4X54A 1VM6A 4CM7A 2GPTA 1UXGA 4R3WA 5DOVA 2WYWA 4BNLA 2DT5A 2Y0CA 3OHSX 4FN4A 1BXZA 3QVTA 4XGKA 3RVDA 2O7SA 3PHLA 1ULSA 2WJPA 4NK5A 3GPIA 4FW8A 3EK2A 4N54A 1JKFA 1B0AA 3QWFA 3JQ8A 1A27A 3W6ZA 4E5NA 3WGYA 2P9CA 5A06A 4H7PA 5U1PA 1T24A 1CF2O 1LQTA 2QZ9A 3FWNA 3UHAA 4BNFA 4EUHA 4XEHA 3KYCA 2H63A 4GBJA 4P4LA 1I0ZA 4R51A 3AW9A 4BL5A 2BH9A 2FPGA 1VPDA 3FI9A 1YWGO 3ZWYA 1E92A 3TZHA 4TRRA 1KVRA 2GERA 3HWRA 3QWBA 4BKQA 4E3ZA 1RM0A 1RYDA 2ZB8A 1YL6A 2WM3A 3OSUA 1Z6ZA 2Y1GA 2ZTVA 4CV2A 4IGFA 5T5QA 4ZICA 4IGEA 2EIHA 1EUZA 5G0WA 1GV1A 1WPQA 1YDEA 3INGA 4INAA 1KEWA 5A05A 3RC7A 3JQ9A 2DPGA 3ZWNA 1E0DA 1R0KA 2OL4A 4K6CA 3GQVA 1H6AA 2FRDA 3G3EA 4IZIA 5COQA 3OA0A 4YYZA 5K6AA 2ZTMA 4QT0A 1OI7A 3KSUA 4AJJA 3CZMA 3WICA 4WLEA 1I3NA 1N1EA 3AI1A 2VWPA 1J49A 3UICA 1H5QA 1YL7A 4BO7A 3T7EA 5IDQA 3RUHA 4XA8A 3DFZA 1ISMA 4D3SA 3D5TA 1HYHA 1KYQA 2Q4BA 3ASUA 1Y8QA 3DO5A 1ARZA 4O63O 5JO9A 5HS4A 1TEHA 2X0JA 1MUUA 1U3VA 4ZGWA 2X7HA 2HCTA 1DC5A 1E1KA 3DXFA 1XIVA 4HY3A 1HYEA 3PTZA 2B4QA 1P45A 1PJ2A 4ZQGA 4L4SA 1SEVA 4GMFA 4QO8A 4Z3KA 3M2TA 4WOJA 4CMIB 2JHGA 4ILKA 3B70A 1VRWA 1BG6A 3KSZO 1XHLA 3EAGA 3PYLA 4GSKA 4OSOA 2GGSA 3K96A 3FBGA 4DLAA 4XYMA 1J4AA 4ZJUA 3HDJA 2B37A 3I9OA 5HRUA 2AEFA 2CF5A 2ZYGA 4A27A 5A9TA 2ZJ0A 5TNXA 4UULA 4PLFA 4FS3A 1GYPA 1R6DA 1YVEI 1ZXLA 2I76A 3W4JA 1LDYA 1OMOA 1HSOA 3PWKA 4PZDA 3BXXA 1E5LA 3E9QA 3GUCA 1PSDA 1X7HA 2QHXA 1KVTA 3OFSA 3A14A 1RJWA 3H9QA 2Z5LA 1I2ZA 1E6WA 2VRCA 5L4NA 2Y66A 1DOHA 3ZV3A 3PWSA 4PLGA 1DJQA 2EHDA 4WNIA 3VC7A 1NVMB 3BMOA 3IJRA 5IAAA 2QZZA 3BHJA 4FGWA 4UUMA 1LUAA 2Z95A 3Q9NA 2AW5A 5CPFA 3KYBA 1NHGA 3E48A 2GN9A 4RQUA 1RM4A 3FRJA 3KLMX 1T25A 5BQFA 3IUSA 2I3GA 3O8QA 3LC7O 2Q45A 3FNFA 5ILOA 1C1DB 1ISGA 2NWQA 4AJKA 4Q3EA 1BGVA 4RVSA 5HA5A 1DXYA 2AQIA 1DFHA 1NPYA 3BTOA 2HQ1A 3CTMA 5L3ZA 4YBZA 5EINA 1LBEA 3MWDB 4OXNA 5AVOA 4LRTB 1EE2A 2E82A 3FHLA 4NDNE 3GVHA 9LDTA 4R4JA 2DTDA 3MJSA 1R4NB 4XDYA 4AJ4A 4P22A 1K6XA 2DBZA 1ZKMA 3NX4A 2HMVA 1GQ2A 1JWAB 3IC5A 1NVTA 3P2OA 2NLOA 1TB4A 3RKRA 2HK8A 4U6SA 4AJOA 1ORRA 1EZ4A 5CP8A 1F06A 1HWYA 3OJEA 2PGDA 1S6YA 5F3RA 5J23A 1G6KA 2FOIA 4CR8A 1Q2XA 2HDHA 3F6YA 4BNZA 1HDCA 1UP4A 4KUHA 4GAEA 2R2GA 4L74A 3OQBA 4CQMA 2QYTA 3NUGA 3QVSA 2VYVD 1GY8A 4RORA 4O1MA 2OMEA 2IZ1A 3PJFA 1M66A 1BXGA 2GZ1A 4NFSA 4GLLA 4BMNA 2NQTA 1XQ1A 2BGLA 4GI2A 4KTVE 2B4TO 4CMAA 2VT3A 1JKIA 5G0TA 3RC2A 3VH3A 2HMWA 1T4BA 3JQFA 2R00C 3GF4A 4XWYA 1KEPA 1NAHA 4CQLA 3S2GA 4R9SA 4D41A 5B12A 2WE8A 3PWZA 2NV6A 2XAAA 5ES3A 2JHFA 3ZV5A 5AYVA 2PFGA 4MVJG 5HBRA 2W2KB 1DJNA 2X0IA 4Z9YA 2PK3A 2JAPA 1IB6A 1H0KA 3DB2A 3S2FA 3JQ6A 1XYGA 3G1TA 4Q3AA 2EGHA 4UVEA 1MXHA 3ROQA 3HB5X 4GMGA 1PGJA 1YOVB 2BI8A 4MIYA 3PPIA 5TX7A 2YHUA 3AWDA 2GNAA 4LISA 4DPKA 4EUEA 4HV4A 2O3RA 2WEKA 1XELA 2J5KA 1DIBA 3Q11A 4RPKA 4GX0A 1HE2A 1SC6A 1IZ9A 4B3HA 2IYOA 4FJ0A 4RF5A 1OZAA 1ZK0A 2WD7B 2X86A 3L77A 4FJ2A 4LSMA 3PQDA 4DPLA 4E2YA 2V6MA 3GFBA 2C07A 4FFOA 1BHSA 1NPTO 2YV1A 5DCWA 1R0SA 1BW9A 3ETEA 4CUJA 3LDHA 3O9ZA 1RWBA 1O9BA 4QUKA 3NJ4A 5TJ9A 4CV0A 4E4YA 4H16A 2BD0A 1A4UA 4WCFC 4FFPA 4AJ1A 2I65A 1CDOA 1U2GA 2AEMA 4ALMA 1IULA 1P1IA 2AMFA 3IIEA 4A10A 2ZB7A 4BGVA 3CXRA 3ZN2A 5DBFA 1U2DA 1N1GA 4JIGA 5FF9A 3E6AA 3JQGB 4OYRA 1H9BA 1SB8A 5T57A 5C5IA 1D8AA 2PY6A 4YAGA 4EEXA 5ENDA 3P7MA 4YT8A 3ON5A 7ADHA 2E6UX 1PWZA 4HFRA 4L4RA 2C2XA 4QEDA 1PS8A 5CPBA 1KS9A 3JSAA 4TMFA 1N9GB 3LVFO 3O4RA 4CMIA 4MVJD 3PFWO 1RPNA 3GLQA 1EK5A 4CR7A 1VJ1A 2JD1A 2O3QA 1V3TA 2X5OA 1NQTA 3SX2A 3A06A 3PHJA 4KUEA 1CETA 3PHIA 1R15A 1T2FA 1HSZA 4CM8B 2CSUA 3ADPA 1DBVO 1NVGA 3AUTA 1LA2A 1HDRA 3FPCA 4ALKA 2AXQA 4C7KA 5JDIA 2QRLA 4EI2A 4B4WA 1K2WA 3H4VA 5KTKA 4QQRA 3TZCA 4KWHA 4EEZA 3WBBA 4HFNA 2X5JO 1LSSA 4BNTA 3GC6A 3DZIA 3WDSA 4B79A 3K92A 3IDSA 1K6IA 1QV7A 2J5RA 1IUKA 1LLUA 1B14A 5JSFA 2BI7A 4FSHA 2C5AA 3F3SA 5A1TA 3HNPA 4EITA 2NVUB 3PFFA 5TS3A 1MV8A 3ORFA 1BDMA 4FBGA 2XPCA 5TT1A 1DFIA 2ZTUA 3DBHA 3WGGA 2VYNA 2TMDA 3QP9A 3RBZA 5CFZA 3WFIA 3OICA 4CR6A 3KEOA 3WMWA 5THQA 2GF2A 5IFLA 1ZSNA 5ENVA 5T8KC 3CPSA 1YB4A 2YHIA 3JD3A 3R1IA 1QR6A 4EUFA 4YJDA 3U62A 1P1KA 1U28A 1SBYA 1LLQA 2X23A 1ISIA 3GDFA 1F0YA 3EMKA 1FDUA 1E7QA 3PI7A 3UCEA 4Y9DA 3GT0A 4XCVA 3V1TC 4Z0TA 5BT9A 5JAIA 1FMCA 4YAIA 4LVCA 1XR3A 4BNUA 1X15A 1GQYA 3WQQA 2W2LA 1R16A 4AJEA 5EN4A 1C14A 3A9WA 3NT4A 1R4NA 3LF1A 1YB5A 4XGNA 1YRLA 2VOEA 2JFHA 3RIHA 3DTTA 4JQCA 3H2ZA 3MJCA 5IXSA 3WGTA 1B8UA 1IHYA 2OFPA 1EE9A 2AE1A 3H3JA 2YDYA 3A28A 3AFNA 2D59A 4D46A 4GWGA 2ZKLA 1MX3A 3F9IA 3RCBA 3ZU2A 1LNQA 1I8TA 1ZK3A 2E37A 1PWXA 1WDLA 1LX6A 1RYEA 4O6VA 2JJYA 1PTJA 1O8CA 4W99A 6LDHA 4R68A 5U4QA 3ST7A 3SBOA 3TZQA 4YWJA 1IPFA 2UUOA 2XOXA 4DYVA 3OIDA 3L6OO 4DXHA 4BQRA 2A94A 3H9GA 3VPGA 3VKUA 4MO2A 3NTQA 2HUNA 1ISJA 1IOLA 1FK8A 1XCBA 3ZCXA 2Y99A 3X2FA 3LU1A 3H9EO 4D79A 4YT5A 2FR1A 1G0NA 2PV7A 5A5EA 1E6EA 3HQ4O 3PXXA 3WIEA 1LDBA 1YH3A 3BMCB 5DNAA 1KEUA 4WLNA 1NHWA 5L95A 1DIAA 1XQ6A 5EMHA 4WE3A 4G81A 1X1TA 3OJ0A 2HRBA 4TRJA 4E21A 3BYZA 1DC6A 2V6GA 3C85A 4RLSA 1U7TA 2CVOA 2C54A 2PKRA 3C24A 3JQDA 5KKAA 3DHNA 4L76A 4CV1A 3NGLA 4IDAA 2B36A 4O59O 1QLHA 3MJ4A 4NBVA 4IDFA 1ZBQA 1DSSG 1LDMA 5A9RA 3H3FA 2H6EA 1LSUA 3QV1A 4CMHA 4RCVA 5I8WA 4CPDA 1EDZA 2BFMA 2IODA 3D64A 2YV3A 1PL7A 1H9AA 2EKPA 3DBRA 3VPSA 3O03A 1M6WA 4GGPA 3I6QA 5TJHA 2I67A 3K5PA 2P9EA 1NFRA 1YJQA 3GEMA 1B16A 3B1FA 3RUDA 1U8FO 1AUPA 2YYYA 1QP8A 5JLAA 5JCXA 2JCVA 2RIRA 5EQFA 3V1UA 4YJHB 1NX6A 3GHYA 4IIVA 4M87A 4DWVA 1KERA 1PL8A 4DREA 1I2CA 4WLFA 1CEQA 5G0UA 4MKZA 5IF3A 1LRJA 1UZMA 3OQ1A 5KJ6A 2CZCA 4YB8A 4DA9A 3ROMA 3WJAA 4CMKA 3LYLA 4HADA 3C1AA 4YRBA 4U0KA 4P8RA 3D4NA 2E49A 4XJTA 4TKMA 3W4IA 2B35A 2HMUA 1JQBA 3RU7A 2X9NA 4TKLA 1GFSA 4CUZA 1B3RA 3JQAD 1YB1A 1QKIA 3FR8A 5THKA 4L4XA 4CM3A 4G65A 2VCYA 1Y81A 3AM3A 1O5IA 5JCJD 1GYQA 1ZEJA 4Z0PA 2Q2VA 3EY4A 2BGKA 2Q4EA 1QV6A 3M2PA 1UXJA 1N9GA 4DIOA 1ZEMA 3OIGA 3B20A 3HFSA 5C3MA 2VOJA 1KY4A 4KWIA 1LLDA 4DVJA 2AQ8A 2OBNA 1WP4A 3M1LA 3GVIA 3DOJA 1YQXA 4D42A 4CM8A 3IJPA 2EF1A 3V2UA 4ZHSA 1PGNA 1Y9EA 4W4TA 2C7GA 2IRWA 3S1LA 1DB3A 3HN7A 4J7CA 2G17A 4HKTA 5DCUA 4R69A 1ENYA 4WNCA 4ZD6A 1D4FA 4CMJA 1PJSA 2V6BA 4CMEA 3QRWA 2PR2A 2Q1SA 4IDCA 3NV9A 3ZWAA 3GAFA 2NSDA 3IAHA 1SMKA 2Y1FA 4BNHA 4EW6A 2PKQP 2UYYA 3ZNNA 1AXEA 3D3WA 1PQPA 5CEEA 1ONNA 1Q0HA 1QRRA 4NNJA 2BFOA 3B1JA 1Y9AA 3FD8A 5ITVA 1HRDA 2ZYDA 3FR7A 3CUKA 2HO5A 3ZHXA 4CM1A 4PCVA 3NJ8A 3VZSA 2NVUA 2GRAA 1H6DA 3E18A 5LDHA 1UR5A 1K5HA 3WIDA 2GN4A 4PLYA 3TFOA 4RZHA 5G0SA 3DBLA 1D1SA 3K2BA 2POQX 2NU7A 2OP1A 1TI7A 3ULKA 3WGHA 1U4OA 2FWMX 2IYPA 1WZIA 1EVJA 1M6HA 3GNTA 2X5KO 3DAGA 2ZIZA 3WGOA 4CLRA 2VN8A 1NFFA 2X1HA 1MLDA 2G0TA 2ZYAA 4AG3A 5FFFA 1N7HA 2FPIA 4FDAA 4FJ1A 3UAGA 3AUSA 1OC4A 3FCOA 1NPDA 2FZEA 1PGPA 1DC3A 3KHUA 3ROPA 4BGEA 4DBZA 4YAKA 3BAZA 3DDNA 3KXDA 3GRKA 4J4HA 4QSMA 4AJLA 4BO6A 4LMPA 2EXXA 4MIOA 4UVHA 3UXYA 3IKTA 3QQPA 1TT5A 3WSVA 4Z6KA 4BB5A 3SLGA 1FDVA 2JAHA 1ZK1A 4W9NA 4WOKA 1XLTA 4JBGA 1I01A 3UF0A 2EERA 3MJTA 3GZNA 4I08A 1PJ3A 3NDJA 2D3TA 4FR5A 4GKVA 1U1IA 1MFZA 5L7TA 4ND3A 3F4BA 3MOGA 3TOXA 2JD2A 3CEAA 5IJZA 3DZKA 2X58A 4CLEA 1CIVA 4KTTE 3JD1A 3PLRA 3WTCA 4ALNA 1PZFA 4IDEA 2OP0A 4H15A 2V65A 2PWZA 1PL6A 3PK0A 4DMMA 1UDCA 3RKUA 1ADBA 2X6TA 4XZ3A 1UP7A 2FPPA 3JV7A 4YQZA 4BO2A 3I4CA 3AOEC 5I8ZA 4R01A 3ETGA 4LCEA 1XGKA 3DMTA 2C7VA 5L9AA 2NQ8A 2EEZA 3TN7A 3JYQA 1R37A 3C7AA 4J4BA 3WYCA 1IPEA 4G2NA 3QLJA 2FY8A 5DBIA 4J90A 5HM8A 2RHRA 3DZGA 1DFGA 3RQSA 5A9SB 1C1XB 4R1TA 1SOWA 1YBAA 1JWBB 4MIEA 3KO8A 3ZNQA 4Z9XA 3BHMA 3GRPA 4QO7A 3MTJA 4RVHA 1AHHA 1YS4A 4K6FA 2W98A 2PD3A 4TZTA 3PRJA 4YJGB 5B4VA 1P1JA 4WLOA 1PIWA 4AJIA 1GU7A 1QYXA 3L4BC 3EDMA 4EGFA 3P5SA 1BWSA 4WK6A 4PG5A 1GCUA 1P1FA 4PLZA 2PD4A 2Y1CA 3Q3CA 3GVXA 1NWHA 3NTOA 3K31A 1GYRA 2QYSA 3VZPA 1VL6A 1B8VA 3C1TA 1G0OA 2YDXA 4IS2A 1ISFA 4ZU3A 5L4LA 2I3AA 4NU5A 3FWZA 1JDJA 3OJOA 4IDDA 2D5AA 4NU6A 3KETA 1LSOA 4FGSA 3OH8A 4CM4B 1P33A 3MJEA 4XIJA 1T2EA 1A7KA 2IDZA 2AA3A 2P2SA 2W8ZA 1WW8A 3BMQA 2UVDA 1I33A 3OQ6A 1ZW1A 4E6PA 4YCAA 4LRSB 1LTHR 3O26A 3ONEA 1M67A 4W6ZA 4BNWA 1DPGA 1V9LA 4HNGA 3NAQA 4M89A 4AJ2A 3FTPA 1WZEA 1I36A 4ND2A 4RF2A 5AXAA 4CV3A 1C0LA 4Q3CA 1Q7CA 3U4IA 3RFXA 3JQCA 1SAYA 1WAMA 3VZQA 3SEFA 2G76A 5FYDA 1ZSYA 3DAFA 4NR0A 4XR9A 4E5KA 3D4OA 1M76A 3KOUA 1DEHA 3RC9A 1DAPA 1UUFA 4YQYA 1VC2A 3DBVO 4U5QA 2E48A 4IXTA 5C7OO 1VE9A 4WCFB 1VL0A 5CEFA 5H82A 1LSJA 4L0QA 4ND1A 3F5QA 3TOZA 3ZI0A 2V7PA 1B3BA 1GZ4A 2D5CA 2VHZA 1EUCA 4Y6PA 3B1KA 4Q3NA 1DHRA 1I32A 1WMBA 3LT1A 1B2LA 1EEHA 3AY7A 5K9ZA 3GDGA 3TL2A 1JN0A 2D4AA 3KYDA 5COBA 3GEGA 3N7UA 2VTDA 3WJ7A 2VRBA 3U49A 1E3JA 1EVYA 5IN5A 4MP3A 5BSHA 4XYGA 5MGBA 1V8BA 1CJCA 4XR4A 3RASA 3ETDA 2DBRA 8ADHA 1K89A 3OECA 4AVYA 3JQBC 5DF1A 4CLOA 1A9ZA 2FN7A 4K26A 1QORA 3MTGA 2YZ7A 2A92A 3QIVA 1GADO 3UW3A 4YJFB 4JGBA 5IDYA 3LC2O 1GL3A 3JQAB 5DCYA 5JPIA 3OA2A 1P77A 1NR1A 3ZHBA 4B3JA 8LDHA 4AJHA 5IZCC 4DIBA 2B4RO 4UEKA 1QG6A 2VWGA 3PDJA 4PZCA 4AICA 5KJFA 4FFLA 3OEYA 4FFNA 1YONA 4ZN6A 1NQAO 4URFA 5KWEA 5JE8A 1DLIA 5COAA 4MP8A 5L4SA 4WCDA 3KSDO 1ZSVA 2NVBA 4HXYA 3ASVA 3JQ7B 1ONOA 1FJHA 3I52A 1J0XO 1MB4A 1U3WA 3RAJA 3WGIA 3DONA 1A9YA 3BHIA 1A72A 1R4MB 2GLXA 1JW9B 2GN6A 4RZIA 4MDHA 5L7YA 5JC1A 3HZZA 4JX8A 3ZV6A 3SC4A 2EWMA 4NJOA 1ENOA 1GEEA 5B4TA 1D3AA 4WLUA 1Y8RB 3TSCA 3KBOA 4KDFA 4PIVA 4IDGA 2CDCA 1H94A 4TVBA 1MFPA 1BMDA 3WWZA 3ZWVA 1TXGA 4LW8A 2OO5A 3I1JA 1O89A 4F3YA 3ADOA 4DQVA 3BIOA 1TLTA 3ABIA 1FDSA 4HFMA 1W4ZA 3GGOA 3AUAA 3WYBA 4EDFA 3C1OA 1L7DA 4OM8A 4UVIA 3RI3A 3W1VA 3TL3A 2AQHA 3W8EA 1M2WA 3ZW8A 5DOZA 4CM9A 3PIDA 1VI2A 2C5EA 4IJVA 5TLSA 1ADCA 5CAEA 3GN2A 3WQSB 4J1NA 3ZHYA 3IOYA 2P4QA 3HJAA 4R41A 5AQ1A 3H5NA 3KTDA 4OXKA 2HK9A 2WE7A 1WDMA 3RUIA 4CLDA 2EJWA 1DAOA 3KV3O 3DOCA 5JC8A 4BIIA 3LK7A 1W0CA 5GZ3A 4XJSA 4ALIA 5L40A 3AY6A 3COSA 4N7RA 3GNSA 1E3SA 1WDKA 5AXBA 4FC7A 4B8ZA 4BNNA 2ZCUA 4BV8A 3FTNA 2VRCD 2PLAA 3P19A 4RJTA 2XXJA 2H1SA 1ZH8A 4JROA 4B7UA 4XQ9A 3W6UA 1N8KA 4F46A 2D2IA 5KNLA 5JYDA 3UFXA 4L73A 1EBUA 2AG5A 5KJ1A 1Y7TA 5CDSA 1MA0A 4OGWA 2JKVA 2I99A 4BO4A 4YT2A 1BTOA 4OOEA 4J2HA 5TQVA 2GN8A 4MINA 1SCUA 2WSBA 4Q9NA 2C0CA 4N18A 2QRKA 1YXMA 2A35A 4J49A 3DOOA 1FDTA 4E30A 2ZQZA 4MVJH 4R5MA 5TSDA 3TZKA 1JA9A 4ONEA 1C1XA 1TVEA 3ZH2A 4W7HA 2AE2A 4BKUA 4S1VA 3GR6A 1M75A 1YKFA 1ADGA 3O38A 1NBOA 2A9FA 1QYDA 1WVGA 2RH4A 4CODB 3GG2A 4BQPA 2ZATA 2R00A 3WLEA 2PH3A 4I9UA 3TFQA 4XYLA 1V3UA 3RC1A 2IEDA 4IJKA 1KC1A 4BS9A 5ER6A 5BNIA 5IDXA 1PS9A 2O2YA 3L0DA 1PJ4A 2Q3EA 3GA0A 4YPOA 2ZB4A 4RPJA 5CG1A 5EQDA 4O0LA 5JMWA 1DRUA 1JLLA 2E4AA 3DZJA 2WTBA 4CMCA 4E12A 1C0KA 4NIMA 4M54A 2OOSA 4XGIA 4S3MA 3AOGA 3SJ7A 3Q0EA 2HRZA 5B4UA 4U7WA 2CNBA 2YFHA 1MG0A 3S55A 4EZBA 3AU9A 2GUGA 1JVSA 4U0JA 4NQZA 1YGYA 2CVZA 3V8BA 4WJZA 2BLLA 4OHUA 3UH1A 2HJRA 4JXKA 1I3LA 2O48X 2DQ4A 4IDBA 2O3UA 4OIMA 1ZMTA 3AY3A 4TQGA 4RVGA 4U6QA 3QVOA 5JS6A 5CG2A 1JVBA 4CQMD 4ZRNA 4GX5A 3PIIA 1VKOA 3GGGA 4K9DA 4E5MA 2AG8A 3EZYA 3EVNA 2HLPA 3ANMA 3JD2A 4XB2A 4YAJA 4BKRA 1HZJA 3VVCA 4J1TA 2PGJA 2FHSA 3RFVA 1SOVA 4WCFA 3PP8A 1OFGA 4PG4A 3K8ZA 3VOSA 3C3XA 4R54A 5DBGA 3SXPA 4D7AA 1TA4A 1UDAA 3ZWXA 5HWSA 1VSVA 3HFGA 4BO5A 2DC1A 2YFQA 3IKVA 2NTJA 1HXHA 4CM9D 2CFCA 4EJ0A 3MEQA 2B83A 3PYMA 1Z7EA 5KOIA 1FF9A 2AQKA 1Q0LA 3ONFA 1CQIA 1C1DA 3ZWWA 1XG5A 3VHRA 1WNTA 3ONDA 3WOHA 1T1SA 5BNFA 3AK4A 3E5MA 3RUEA 2VQ3A 4YTEA 1LLCA 4YEDA 5DP1A 1ZUD1 3JD0A 4J2OA 4NFYA 4XD2A 4E31A 2Y67A 2F1KA 1NAIA 3A1NA 4NHEA 2C59A 4CMGA 3VZRA 5I7SA 2BHLA 4QXMA 5A03A 3VAZA 5JFOA 3F1LA 2CMDA 5C7LO 4ITUA 3CMMA 1Z73A 4GQAA 4I9NA 1K6JA 4Y67A 1X1EA 4H3VA 4RPLA 2B5WA 1WXDA 3F5SA 3LT0A 3RJ9A 4E5PA 3PHHA 3AU8A 3WNVA 3V5NA 5TT0A 3K9QO 4DQUA 1UZNA 4II2A 4XYBA 3JQ8B 1X7GA 9LDBA 3ZWMA 4BNYA 4ZQBA 1I24A 5H83A 1ZZEA 2P5UA 4P38A 2YV2A 4NPCA 2B69A 3JQ7A 3U3XA 4F6CA 4BUCA 1BVUA 1CYDA 2NACA 4ZVVA 2DAPA 4U8GA 4JP3A 3PDUA 3N74A 3ICCA 4GSLA 4IJUA 3U9LA 3AM5A 1YO6A 5JNLA 1UP6A 2JD0A 2PZJA 3M6IA 2IZ0A 2GSDA 4N5LA 1E5QA 5JBIA 3WS7A 3DZFA 1XDWA 4R3NA 2EP7A 4UAGA 3U4DA 4OOFA 5T8KA 4P4GA 1A4IA 2FZWA 3RD5A 3I4FA 4IXWA 5EL0A 1LRLA 1GDHA 3JYLA 4NBWA 5FI3A 1CRWG 1PZEA 3IUPA 5U9CA 5DDIP 3V1YA 2Q1TA 4E5YA 1EQ2A 2J3IA 4IY1A 3ZGYA 1LI4A 1Z75A 1YQGA 4YXFA 4NZ9A 2ZQYA 5FWNA 1SO8A 4MJLA 3UCXA 2NTVA 2TMGA 2IE0A 4GX1A 1F14A 1E3EA 5G2OA 3LF2A 2BFAA 1E3IA 4KDEA 4WECA 2W2KA 3VH2A 1I3KA 3GDOA 2O3TA 4RVUA 3W8FA 1K3TA 1BRMA 3E82A 5JW6A 3WG9A 1SEPA 5T67A 5I9MA 1KETA 4A2CA 1O0SA 1Y8QB 4J1SA 3GG9A 3FNGA 1YOVA 1RM3A 1PGQA 3H9UA 5JDCA 5EERA 4J4TA 1UH5A 1VKNA 4IBOA 3DZHA 1ONPA 4GL4A 1YDWA 1DDOA 2Y1OA 4KP7A 1IHXA 5CDUA 2NM0A 1YBMA 3WXBA 5DP2A 4D0RA 1LEHA 1YJ8A 2YW9A 2J6IA 2W4QA 4F45A 2WD7A 3ZV4A 1PS0A 4IINA 4RO0A 1GUFA 4MVJF 3DQPA 5JY1A 2GZ2A 3WX0A 4JJGA 4XIYA 3GVPA 1PJCA 2VYND 1UXHA 2BFPA 2H9IA 3L6DA 1I10A 4PG6A 5AXCA 3G79A 5CEJA 4OSPA 4MVJP 4CMBA 2EW8A 2O50A 1NQOA 4IMRA 2GZ3A 2QW8A 3WB9A 3QWAA 5T64A 1ZJZA 4BO1A 1J5PA 2G82A 5LC1A 1VL8A 4BGIA 3JQGA 1P3DA 1KVUA 4B7CA 2ZCVA 1EFKA 4CLXA 4BNJA 4YACA 3JCZA 4ZRMA 5DT9A 4R16A 4HFJA 1ZFNA 5C37A 2O4CA 3G49A 3RROA 2C20A 3WBFA 1FDWA 5CDTA 3BMOB 4LCJA 3UOGA 1P74A 2DVMA 3DWFA 2W2LD 5G4LA 3ZU4A 3GEDA 3AJRA 5JYEA 4BNXA 1PJQA 4O5OA 2ZJ1A 1PEDA 2CDBA 2QX7A 1XA0A 3ZU5A 1NM5A 1HDZA 3TJRA 3BTSA 4BO3A 2OBYA 5KVCA 1Y6JA 3HDYA 1HE5A 3D3EA 1ENPA 3O8QB 1LXCA 1W8DA 4GH5A 1HDXA 3I3OA 4OQYA 4BVAA 1ISHA 3PVZA 1P1HA 4ZQFA 5TC4A 5TF4A 4A73A 1JTVA 1OAAA 2FR8A 4Y8VA 1F12A 2GO1A 3H5AA 2I66A 3AUUA 1LJ8A 4Y98A 1N92A 3ZWCA 1DHTA 3GH3A 3E9NA 2VT2A 1B15A 2HK7A 1E7YA 4CM6A 2EKQA 3ZHZA 2Y0EA 4Q3BA 4E2XA 2EP5A 4Z3DA 2ZB3A 1Z74A 4KZPA 1C0PA 3ITDA 1YE3A 5EPOA 3I5MA 4ALLA 3QWIA 2OORA 2WWRA 4UVGA 1ID1A 1XKQA 4M55A 4NI5A 4OKNA 5I7VA 4I5FA 4DMLA 1DIRA 4PN3A 5BSGA 5MDHA 4YAEA 1NFQA 2Z1NA 1QYCA 2DM6A 3E1KA 7MDHA 3Q1LA 2BKAA 4KQXA 4B7XA 4DBVO 4GLOA 4FQ8A 2P9GA 3N58A 4Z0HO 1YL5A 2JL1A 5I7EA 2A4KA 3JQ9C 1H2HA 3QE3A 1LU9A 4KMSA 4BNMA 4IPTA 4CQMB 1AE1A 5K6AC 1EVIA 2EJVA 1BSVA 4NMHA 5I9LA 4FFMA 4IZHA 3G1UA 1E1LA 2JFGA 4MKXA 3VDRA 3ZWOA 4BB6A 3NKLA 3GZ4A 3ZU3A 3IL2A 3TF5A 2ZTLA 4J91A 1KIFA 2DUWA 2DFDA 3T4EA 3X2EA 1PGOA 4XYEA 4CL8A 2P91A 4AFNA 3ZWBA 1BXGB 4L9RA 1NTOA 4GGOA 4ZQHA 4C4OA 2VWQA 2Z1MA 4FPXA 4PGFA 1X7DA 3NGXA 4MPDA 4D0SA 3JQEA 4ND5A 4BV9A 1X0XA 4CQLB 4B4UA 3WGQA 3FPLA 3NRCA 4JJFA 2O3SA 1LDEA 4I9HA 1XU7A 1HLDA 3RBVA 4AL4A 4LGVA 4EBFA 3D7LA 2I6TA 1GPJA 3WR5A 4WKGA 1HLPA 2R6JA 1NYTA 2BGMA 4JBIA 4RPGA 3CINA 5TGDA 3PZRA 5F5LA 4JK3A 1P9LA 1PJLA 1D7OA 2VNSA 2WD8A 3R0IA 4PRKA 4WEOA 2LDBA 2UDPA 3HADA 2Y05A 1T26A 3JYPA 4GPD1 4RL6A 3DMYA 5ICSA 1KEVA 5TIIA 1EBFA 4TVOA 4WGGA 4BNGA 3S2IA 1AXGA 5JXWA 2CF6A 2PZKA 3I9MA 4J9VA 3BA1A 3EGOA 1E6UA 2NVWA 2PTGA 3F47A 4MVJE 3DAPA 4NK4A 1P0CA 2J3JA 3BMCA 3LZ6A 4QECA 1SB9A 1B7GO 3HB4X 2X0NA 5HTOA 2NUAA 3RUCA 5I9NA 1Z45A 4EYEA 4HX5A 4C7JA 1E7MA 4B3IA 1BW9B 1J6UA 3DFUA 1AGNA 1E3LA 2PA3A 4E0BA 3EW7A 2SCUA 4BKOA 1NWCA 5DZSA 1RM5A 2F00A 2FR0A 1P44A 2VYVA 3PQFA 3T4XA 3VKVA 2CY0A 5BSEA 4E32A 1L1FA 2VWHA 4FD3A 3DTYA 2OXIA 3RWBA 2D8AA 5JAQA 3BMNB 1ZK2A 3OJFA 1DRVA 2BF7A 4Q3DA 1E7WA 1ZNQO 3NT5A 2HJSA 1YBVA 1ML3A 4J0FA 2DBVO 2VHXA 2VHVA 3ICPA 3MJVA 2EKLA 1ZCJA 3OJLA 3KB6A 1ZIDA 3JD4A 4XRRA 4JN6B 5EJ2A 4JNKA 2I9PA 3EUWA 3KZVA 3MZ0A 2JCXA 1GCOA 1GV0A 1Y5RA 4MP6A 4QFDA 3UVEA 3I9KA 2O23A 1T2AA
chains in the Genus database with same CATH superfamily
3PEVA 1U02A 1T1JA 2EU8A 3LVQE 1W85A 2AYZA 2E0IA 2O14A 2QN9A 2XF2A 1CK4A 4IEEA 4MUFA 2HY7A 3GLRA 1J8QA 3F8TA 3AOEA 3EH1A 2ZJ7A 5T6BA 4ER6A 2GJ9A 2HHJA 4NH4A 1Y8AA 1XJQA 3OFJA 3KT0A 2VT6A 4Y6LA 3BRSA 3IS3A 1GILA 2QUIA 4FXPA 1E2IA 1JFFB 3I58A 4R7TA 3VDQA 4BKPA 1OWLA 5LDDC 3KP1A 4HYQA 4D8YA 4KSCA 1F2DA 2NTNA 3GMDA 4WUVA 4PG7A 1F17A 3FI0A 4J3FA 1QNLA 5B37A 1U7UA 2HLHA 4BN0A 1CUSA 3GUYA 3Q85A 4PO3X 3R9KA 2BGWA 2VJCA 4OL0A 1E6CA 2QRHA 1X3SA 2ATEA 2BP7B 4C4PA 4UBJA 5A4FS 2FVYA 4YQFA 4KQ6A 3LBHA 1T13A 1ZWKA 4HAZA 3G59A 4M8IA 4DLTA 2G8NA 1UAGA 1NJ6A 3T12A 3FUVA 4EPYA 2W90A 4LDRA 3D4BA 1KSFX 1G6OA 4YA6A 3K9CA 2IV2X 1OLSA 2XLCA 1JX6A 1Q16A 3B6IA 3L9WA 4ME6A 3P4YA 2P3OA 3ADBA 3OC6A 1QBGA 4L78A 4D80A 1BN7A 2AEJA 3VPCA 3T3GA 1GAEO 4B33A 5A7HA 2B6NA 4ZZ3A 3ENZA 2J31A 5IJ9A 2AXEA 3TBFA 1GAJA 4ID9A 2ETVA 5AIBA 4BNDA 2WLSA 4B8WA 1B0UA 1I6LA 3DULA 4QSMA 4WESB 2XUKA 3UHPA 2Q3BA 2ZSBA 1E1DA 1NQUA 2Q3CA 4B4OA 3G5LA 5ADHA 4HHEA 3BXHA 1WRBA 2XVYA 4L9WA 1PZGA 3DOUA 3V00A 5A4DA 4MI6A 4IHJA 1RQRA 2VUHB 4P7FA 5EKXA 3GBSA 3OMLA 1T1EA 2BKXA 1KJWA 2JLWA 2FKNA 2QVXX 3LGAA 3MT8A 3TKAA 1AB5A 1WMFA 2G5TA 1LBIA 1XDSA 3AKEA 1MXFA 2VHQA 4X7RA 5CBPA 2Q5LA 1Z22A 1N8NA 4ZVMA 1FS6A 5JD6A 2AN4A 4OP2A 3OTOB 4G67A 1RZUA 2OZLA 3EYAA 2R7NA 3OPXA 4OXYA 4JLWA 1JA0A 4MVJA 4RELA 1WXFA 2ZYRA 3O95A 4ZQEA 1QBKC 1V16A 5K09A 3HRIA 1NW7A 4H7EA 5ITZB 3GCDA 2CXRA 2HMSA 1THMA 3LD9A 3N6XA 1VGVA 4IQ0A 1JAYA 4NYJQ 2A0KA 3SDBA 3IRUA 5I3CA 3QJGA 3ETNA 5C37A 1FNDA 1FPMA 2GEFA 3MNFA 1N5OX 2DHRA 2EHJA 2VRWA 5JI3E 2ZJOA 1ECCA 3IKJA 3FOZA 3OWHA 2JI9A 5JPDA 2X9QA 2FCRA 2A6PA 3JWPA 1JPNA 4IHKA 5KYVA 4ENWA 3K0AB 5CCBA 2PJRA 2JBAA 1Q15A 1E2QA 4CF4A 5FWXA 4TWRA 3WMXA 1ETUA 3CRZA 2UUPA 2Q3DA 5AK6A 1L4NA 5ERYA 1SBHA 4UVDA 3AGPA 1K7EB 3IPLA 3R3ZA 2G1UA 3ES9A 5ALXA 5ED0A 3KEQA 2C3PA 2QSJA 2F43B 3AFMA 2HAEA 2G7ZA 2OGUA 3EYWA 1YZYA 1WU7A 3G82C 4OHRA 4TL7A 2FW6A 3C74A 5EESA 2QBYA 1HQDA 2ODBA 3PT9A 2NUTA 3OETA 2FP4A 5DGDA 4H59A 4WN9B 5IH3A 5E3HA 3DEYX 3BFVA 1XTVA 4TV8A 3X2SA 3L8HA 1KFCB 2Q7XA 3C7CB 4C03A 1X1QA 3TPCA 4V0ME 1US8B 3E2MA 3V2GA 3K9BA 1EFLA 2YHBA 3H7AA 2FUEA 2CJPA 1XQVA 1AZWA 1XO1A 2PRYA 1B0PA 3I9JA 3LV8A 3MTDA 4O1HA 1J0DA 3CPHA 4U7HA 1AQJA 2BYTA 3N2IA 2Z6UA 3DXZA 5KC8A 1DTSA 1UPAA 4KNYA 1KY3A 1XXHB 3EISA 3E23A 1KI6B 1HE4A 1V5GA 2VF4X 5EJMA 2OYCA 4TSRA 3RUAA 6REQB 5IZCA 1O2DA 3O1IC 5I8PA 3RVLA 4F86A 3WSTA 2V7QA 4EB0A 2AIRA 3WK8A 1EYZA 3R09A 2OY0A 3T41A 1KO1A 2V9PA 4XWAA 3R0JA 1GDTA 3FWKA 2WRZA 4DRYA 1FU4A 2O9JA 4F2GA 3CZRA 3H13A 4KQ9A 4DTIA 2PU5A 1A8QA 1GG8A 2HLDA 3C70A 3IAUA 3AV0B 4PX9A 7REQB 4J29A 1KI1A 2W37A 5DM1A 1NKVA 5DLPA 1EWYA 2XT9A 1ZNXA 2GHIA 2IKSA 3A1WA 4IQGA 4B6RA 1E18A 1OOEA 4HCJA 4P4UA 3RC3A 3H16A 4X91A 5JDIC 5FX2A 1GQRA 1JEQA 3SDSA 5IXYA 2I7VA 4D9KA 1GU0A 3VNVA 4AY2A 1XRRA 3AF3A 5MN5A 1IZ0A 1JHMA 2I6QA 3OMWA 3EQ7A 1VSUA 3I42A 3RVNA 1JAIA 3O83A 4QZVA 4U2GA 1PUJA 1NLYA 3IB3A 3OOWA 1Q1NA 4I4TF 3DGEC 2XUOA 1RU3A 2Q28A 5TVKA 3E1GA 3OAAA 3OLQA 3TLXA 4E46A 5H9WA 3GGPA 5FBQB 5BSFA 5CCXA 2DPXA 1PJTA 1PT6A 1E5DA 3H1BA 5KVAA 5KTTA 1MJNA 2OD2A 4OMUA 3SC2B 5T4FA 4UTXA 1IIBA 4HBGA 1DOAA 1AKYA 2F1IA 2QP4A 1Y9ZA 2VEDA 1P7VA 1Q0ZA 3FGZA 3KRTA 3AB7A 4QEZA 4QPCA 4EQ6B 6ADHA 5TGTA 2B98A 3HVIA 4F2PA 5BR4A 1Z2NX 5E4YA 1PR2A 1NLUA 1NVWQ 4RA6B 1LV7A 1GPYA 3ND8A 2H2WA 3AM4A 3QITA 2JCBA 1Z36A 2ZS9A 2X5NA 3BZUA 4J75A 3AJAA 4WVLA 5F1KA 3WFJA 5FUBA 1M2OA 1QGYA 3HHPA 1ODTC 3LWNA 4EPTA 1XZEA 3CX6A 3WLFA 5HKBA 4P5EA 4DBLE 1CUWA 1FYXA 1TYCA 2QGFA 3E53A 3P9XA 3HBNA 2B61A 4HP8A 1UAAA 4PBSA 3GL9A 2QG4A 2NZUG 1JS1X 4KQWA 4RIIA 1EUQA 5F9FA 4GNRA 3H1EA 4NU0A 5EIXA 1JPUA 2IXFA 1TAHA 1ORDA 1RAAA 3G0OA 4DJEC 1CJMA 3FCYA 5T4HA 1QG2A 4MQFB 1DLJA 2FYTA 2ZAOA 3JZFA 4Y2VA 4GVLA 2XQVA 4I2NA 3H1FA 2GKSA 2CNNA 2ETXA 1SBCA 2O4UX 3QI7A 4Z1MD 3WWCA 1XEWX 1B1CA 1SC3A 3UJCA 3I0MA 2XDWA 1U90A 3N0WA 2IQ5A 2YJ4A 4ZDKA 1BVYF 3VH1A 2Y0DA 4JMPA 4Q7QA 3IBYA 5KQPA 3TUIC 4E4RA 2EGUA 4EMSA 1B6GA 1PDWA 1Q7EA 3HYTA 4O4IB 2PAAA 3C3JA 3M6VA 4HB0A 5CIWA 5FNVF 3WRXA 1Q17A 4CE6A 2V0NA 4EB6B 1AT1A 1W1UA 2C3OA 1A7AA 4NAHA 4OHCA 2CFSA 2H52A 5IH7A 2W5UA 1Y98A 4YCMA 1NR5A 4HZUB 1EVZA 4BEWA 2OC9A 2QG9A 1GN9A 1GEGA 3C7DB 3ESDA 1EFPB 5DSZA 1W76A 4EO9A 1E2DA 3RQIA 1PTJC 2B8TA 4V0MA 4DDKA 2I3BA 4DIFA 2DETA 2DQSA 4XX0A 3EEQA 2Y1WA 3WKAA 2OFFA 2FN9A 1NP3A 1IJKA 2UV8A 2VFAA 3H1TA 3L7OA 2HRDA 1AQ6A 2OB2A 3AR9A 4QPDA 1GUZA 3DBLB 2GS9A 3VMMA 2NU7B 4LXTA 4E2ZA 2X9VA 1VYUA 3T7JA 4EL5A 5CB0A 2AG6A 2PRIA 2H29A 3OBBA 4RLFA 5ALGA 1J2UA 4ENSA 1UAYA 5IMSA 5JJKA 5AKJA 1U9IC 3IQIX 4MK4A 3PUVA 4G5HA 1C1HA 2QT0A 4FHGA 5KJEA 1DU4A 4Q1AA 1LKZA 1P2DA 4OEHA 1L4MA 4EJMA 3JQAA 5C7IO 5JEDA 1TCAA 2BFEB 2IGBA 2VYFA 5DGTA 2JZCA 2DFVA 1RWKA 1W35A 2P4HX 3WMEA 2RMKA 3NHWA 2O8DA 1F8YA 1QIIA 2EZ9A 2WT8A 2BHSA 4JWTA 4NENB 4NPHA 4X3CA 3WXMA 3LH5A 4OB8A 4UTPA 2P90A 4KLNA 1JIIA 1KR5A 3R3JA 4D25A 1HETA 2QTWB 1TT5B 3BIJA 3H99A 2VA8A 4LYAA 2M6LA 4AK9A 4E5VA 1FP4A 3NRBA 1CWUA 1R6XA 3GCGA 3QX9A 3U4HA 3ZS9A 1KY5A 5JNTA 3ZH9B 1GRVA 3GZNB 5GY7A 3UWKA 4OLHA 1S9DA 4NV1A 3ZZNA 4PNEA 5HXAA 3UUWA 1MA3A 3AETA 5ESRA 1GZ7A 1WDWB 1YFKA 3FBTA 4G6ZA 3RRNA 4ZTBA 1SVWA 1R4MA 4AP6A 1RBZA 5AK4A 2GJ8A 1KBZA 3WL8A 1K0UA 3A1FA 1M74A 2WF7A 4NE9A 4YRAA 1XEXB 1T6ZA 1FRZA 1NJGA 2Z08A 3D0QA 3JYNA 1BWPA 3DMNA 4OGLA 1F8FA 1E1CB 1G8JA 1VXRA 4ZAWA 3A3KA 2M98A 4UUBA 3ZZUA 2AHRA 1QJCA 4V2IA 1CKEA 3RHZA 2PS1A 2IYXA 1RMYA 4EKDA 2W6JA 2Q99A 3G7UA 4JDUA 3J80A 2ZWPA 5LUBA 3VV3A 1QSGA 2FPPB 1O94A 2A14A 3FF4A 5ESWA 3ZE6A 4BO9A 3ISTA 3TKLA 2GBPA 3QU9A 1FUYB 4NLLA 1H05A 3Q3IA 3INTA 1NMYA 3P4XA 3REQB 1G8KA 2XMPA 2OCAA 3B1YA 2BFBB 4LZWA 4RK5A 1XZIA 3A32A 3UN1A 5L45A 3AKZA 4PVCA 4IZ6A 1P8AA 3PEFA 4RV9A 3HDGA 3Q5DA 2OILA 5EIWA 2NXWA 1KNQA 2D74A 2HBRA 2RGNC 4B4DA 4B3TB 2WABA 4YP9A 4GDFA 5KQMA 1N7JA 2XWSA 3H8WA 2FN4A 4YRZA 2P65A 3D4IA 1OFUX 1II0A 2NNLD 4ND4A 4R6WA 2C3UA 3L8YA 4UBKA 3DOFA 4EA9A 3UMSA 5GMOA 2GUWA 3T0FA 1P2TA 2W93A 3OO1A 1E4YA 1YB2A 3EC7A 3LWDA 3QV2A 4DXDA 3BXFA 2I55A 3PFIA 2C42A 2SECE 1S5PA 3KDSE 4B81A 3ER8A 2WDZA 4EG4A 4F4HA 4RIHA 4D3DA 4X1YB 1JU4A 4JUFA 1Z9BA 3EASA 2ALJA 3DNPA 4H35A 1IN7A 3W2GA 3L0PA 4K40A 1P4RA 2HSEA 3ZNPA 2I7CA 3GN1A 3GHHA 3K53A 1IUOA 1OWNA 2OFOA 3GV0A 1BHO1 1GXSB 1FTYA 1REQB 1XYVA 3ITKA 3L9XA 3M4NA 3PKJA 3R0ZA 4GM4A 3NBKA 2H2GA 2BFFA 3PFCA 2H1FA 4RCYA 1QQAA 3WSWA 1IYZA 5MFZA 1ZK4A 5A02A 1IG3A 3QEMA 4NTZA 2XQKA 4HNTA 4IIUA 1PDOA 4YIKA 1KWGA 3T1YB 1GGVA 2WJHA 3P0IA 4ZA2A 1QQ6A 3E61A 1NULA 1BAPA 1B41A 1EX6A 3M4YA 4RTKA 3ZK7A 2BDEA 4YHBA 3CUYA 4HUJA 1FP7A 3RADC 2QSYA 4S04A 4MVJM 4LBYA 2C77A 6NULA 1F8GA 3RO7A 1G5PA 3QA9A 4K88A 4N5IX 3WB2A 2C94A 5D3MA 1AHPA 3ADKA 3K6JA 1C3XA 4MVJI 2OHHA 4MS3A 1NXTA 2CUTA 3DF9A 3F3YA 2V1XA 3OM8A 2HW8A 5DULA 3QJ5A 2NADA 5J5CA 1V1MB 4KO8A 5C1DA 3L0SA 5FL7A 3ZJ4A 4BY9E 2ODPA 3HCFA 4DQKA 5FOVA 4ZAXA 2TMKA 5E1OA 4K86A 1RJEA 2QE7D 1DGQA 5BOSA 4F0JA 5KNBD 1PU2A 5HS6A 2OM2A 4KK3A 4G09A 4RGBA 3I9LA 3LT4A 1V47A 2WIGA 1EUCB 2RFLA 3ELYA 3OIWA 1SZDA 4MS1A 2OZPA 3HGQA 4CEJA 3PKZA 1PLKA 1UDRA 3KKKA 1OLUA 1N2SA 2BZ1A 3VR4A 4UEOA 3ZIDA 7AT1A 1UJBA 5LKAA 3ANTA 5L7WA 4GF5A 3A6GA 4EW1A 2QV7A 5TARA 3B9RA 3ML1A 3PITA 4IDCA 2DLDA 3IBGA 3WWEA 4RVDA 5JYCA 4PZYA 3ZKWB 3V2HA 5MN4A 4IIGA 4HGPA 3UMRA 3Q3VA 4Z53A 4F3KA 1GVHA 2R4TA 3CSSA 3DQQA 4JGGA 2B1RA 3RIYA 1WQ3A 2Q62A 4E14A 5I4IA 3TFWA 2QXTA 1KOLA 5IC4A 1XL1A 1GUYA 2RAFA 1Z7YA 4TLBA 2XWBF 4DR4B 1C9KA 1ORHA 1UEJA 3W5VA 3CLSC 1YACA 4LF8B 3EHEA 3BSFA 3MCAA 3SYLA 1W4RA 2HIGA 2IE8A 5FT9A 3QX8A 3KFLA 3M6MD 5M29A 2YJ5A 3R6GA 3B12A 1F1JA 3TH5A 2WR8A 3SX4A 3CW8X 4R9VA 4YUZA 4XRGA 5CVVA 4DC1A 3TCNA 1H9CA 4OU5A 2TRSB 1N2ZA 3KD2A 4JP2A 3KLBA 4M8LA 1TUEA 3DNMA 2HJGA 3ROKA 4W8GA 1M34A 5DHRA 2IS1A 3HY3A 4BO8A 4EATA 3GJRA 1GPMA 3O92A 4FC6A 3EVTA 2XUGA 1Z47A 2JFFA 2CCKA 2NU8A 2HQBA 1GR0A 1VLVA 3A9CA 2E4VA 4B32A 1FFYA 1CS0B 4Q4DA 1XXLA 3UT0A 3COWA 3QEAZ 4UUNA 2JAWA 1LDNA 2Q50A 3DMTC 3BJMA 1BXKA 1MRZA 3DHEA 3V7NA 4C6HA 4YUAA 1CHDA 3KL2A 3GIWA 1P4JA 4IQ8A 1AU9A 3GXBA 4N82A 3PUKA 1L4YA 1T0HB 2YIJA 1ECGA 1JHPA 1R18A 2GVNA 2PD6A 3Q9UA 4KR9A 5KO2A 3TRFA 1WW3A 4D26A 2NYVA 4A5OA 1IDOA 5A3RA 3FTEA 3VPFA 1CZRA 3V46A 3SSMA 3J81A 2OSVA 3OM9A 1VM6A 4UXJA 1A88A 3TR5A 2VTBB 4DANA 2ZSKA 3CJTA 2QNIA 2WYWA 2BMFA 4OLFA 1Z4MA 5JH7F 5AVZA 4JGIA 5FBHA 2O7SA 2CXPA 1AGRA 4J3JA 4ZCMA 1HEIA 1CZLA 2R44A 3GA7A 3I9V1 4NK5A 1XRSB 5CAEB 3ZHTA 1I4EB 1G20B 2X4IA 4CHGA 5BVHA 1LK5A 2P4EA 3EK2A 1B0AA 4N54A 3W6ZA 1A27A 2HB6A 2VO1A 4L28A 4DM7A 1H2FA 4E5NA 1GLVA 2P9CA 5A06A 2BEUB 5AOAA 3MT0A 1M2KA 4MIKA 4QODA 3NOOA 1ILEA 4PWZA 5K8CA 2P9FA 1Q95A 4URZR 1GCIA 2CLHB 2OAEA 1RPAA 2PBRA 2FXIA 4ITRC 4JITA 3BFKA 1EG2A 1ZLYA 2JH3A 3K2IA 4C30A 3MUFA 3TK1A 3ZXSA 4NULA 4RK1A 1J0CA 1H5UA 4BL5A 5C1PA 2BH9A 1K3FA 3K70C 4TTAA 1X77A 1Z5NA 3SYMA 4RFVA 3TZHA 1XTZA 1YQEA 4TRRA 3LWZA 3DKIA 4BKQA 2Q41A 4INOA 4OUKX 3RYIA 2ZB8A 2PSSA 2WAYA 2WM3A 3OSUA 3VU3A 1T8RA 3W6OA 1Z6ZA 3U81A 2Y1GA 3Q5GA 2OV6A 4W9MC 4TZ0A 3U7FB 3X3HA 5BV8A 1VL1A 2Z09A 1I7NA 3PXUA 4FDTA 1EP2B 3GD7A 2H1OA 3PFBA 4D8WA 1KEWA 3GP5A 3EG9B 4KPEC 1WKVA 1XD9A 3RC7A 3EXG2 3EW9A 3E22B 4ZVLA 5JALA 2NYUA 1QP4A 4E88A 3UTDA 4QM6A 4K6CA 1FNSA 2OL4A 4BP8A 4EA7A 5MDHA 4GR9A 3FHCB 3OA0A 5DYYA 2A5GA 1WEHA 2YV5A 5F7OA 4WXMA 3KSUA 2J7PA 5I5EA 1SCUB 4RHFA 3NKVA 3RSLA 5EXDA 4WLEA 3R8CA 3TMAA 2WUDA 4OP1A 3MRVA 5DLEA 4UTRA 1I6WA 3HA5A 1I4OA 3NH9A 5C31A 4RA9B 1H5QA 5AVVA 4FZRA 5JTUA 1MX9A 3QOYA 1IQUA 3T7EA 3RUHA 1T3ZA 3LKZA 5KTPA 5MGNA 2OKGA 3DFZA 4AECA 1GZVA 3D02A 4UNPA 3D5TA 2Q4BA 3LL7A 2IOFK 5AKXA 4D98A 1Y8QA 5KMGB 4NE2A 5HS4A 1XFDA 1NMXA 1TEHA 5EMNA 4TYWA 3I73A 4EF5A 3K4QA 4UNRA 1IY1A 1KI8A 2GK7A 2OHIA 1LPMA 2WPNA 4Q7KA 4I1OA 3V6MA 1E1KA 3FOEC 3MFQA 3PTZA 4HS4A 1JIVA 2B4QA 5CTJA 4ARUA 2NXEA 4L4SA 1NE7A 3TMYA 4GMFA 4CU2A 1LF5A 4IW3B 1G21E 1FL9A 1SCBA 4D99A 4TQAA 4CMIB 2JHGA 3E70C 1D4ZA 1V48A 3B70A 2G4CA 1BG6A 4ON9A 1XHLA 3ASYA 3EAGA 2BSXA 3JQPA 2GGSA 3K96A 3QQ5A 4RFLA 3VR6D 4DLAA 4JYZA 1N3BA 2EQBA 4TWJA 4XYMA 4LFBB 3F7NA 1HTWA 5HRUA 1E8NA 2QX6A 3PICA 4YMIA 4A27A 3IBCA 3A26A 1NKSA 2ZJ0A 4Q93A 1NSFA 2H31A 4PLFA 4JL8A 1GRQA 2G71A 1R6DA 1ZXLA 2I76A 2VLBA 4FS3A 2HYDA 5DW3A 3FOFC 2QTVA 4TTQA 4IG4A 4DIEA 3PKIA 3PI6A 4PO8A 3IILA 2RGYA 4HDSB 5ALQA 1WMEA 3LJKA 4OQXA 2E5FA 4Q1CA 4BYGA 4PZDA 4DSZA 1E5LA 2RG1A 5KYNA 3GUCA 4G86A 1PSDA 1X7HA 1RDFA 2ZRDA 2QTTA 4U8HA 4IGAA 3T3IA 3AEKA 4GZ5A 4HVCA 5AVTA 1JE0A 5IKEA 1H1TA 3OFSA 2YXDA 5EIEA 4W5TA 1RJWA 1G5TA 3H9QA 2VRCA 2YJNA 2WM8A 3A2LA 4JL5A 1W5FA 1PEAA 4EEKA 1K68A 3K3PA 2JGIA 5FNZA 3TIFA 3IAEA 4RFSA 4BFXA 2IF0A 1G291 1XMJA 2FUNB 2V7WA 2Y66A 1N2EA 4RHCA 4F2WA 1H23A 1U94A 1IXYA 3N2LA 1U11A 4IFBA 2PRJA 5KX5B 1PJ8A 4UJ5A 5JNUA 1MPTA 5DTJA 2PGAA 2FB9A 1BS9A 3JRXA 1MPXA 4JODA 5FA5A 4Z54A 1XZNA 4FGWA 4EG3A 1L5FA 2VTVA 1KQFA 2BFCA 3DH0A 3RYFA 4Q4HB 1NHGA 1XAHA 4DG8A 3E48A 2IS4A 4O29A 4K9KA 4RQUA 1G41A 1M3SA 4LPKA 1EVQA 2RKBA 1BX0A 2GXQA 2WA2A 3FRJA 2YWXA 3G02A 3HSSA 3KLMX 2OV1A 2PQMA 2H11A 1C7QA 2HJVA 1FQWA 1MRSA 3S44A 4HEHA 3SWWA 1O9HA 5BQFA 1U04A 2I3GA 3WWDA 3W34A 2QUZA 3UMFA 2GK3A 3E5HA 3FNFA 4Z7NB 5ILOA 1L5VA 1J2TA 1K63A 3ET5A 2NWQA 4AJKA 2VCEA 1BGVA 4LY0A 4RVSA 1DXYA 5LZ8A 1DFHA 1Q57A 1RVDA 2QVYX 4XFJA 1OBOA 4DLYA 4BFTA 4RTQA 3WK7A 1OTHA 2H16A 3MELA 5B6PA 5L3ZA 1F2TA 5JJBA 4YBZA 2GZAA 2REXB 4KE9A 1SXJE 4S2UA 5BN5B 3WLHA 2P0EA 5FOTA 3FHLA 3TVDA 3VBEA 1RP1A 1GLGA 5LLSA 2DTDA 4XDYA 4CTKA 4GPTA 4BVFA 3FUXA 2DQKA 4QPNA 2FW0A 1K6XA 1EB9A 1SVUA 3RTBA 2DWOA 4WXYB 3DDZX 4GVPA 2AOUA 3NX4A 2GAOA 1VRVA 4JJ7A 2GHQA 3FDIA 1JWAB 1QHHB 5LWQA 1QAMA 2NLOA 2R0QC 4ERXA 5GONA 3GUVA 4F1KA 5K8IA 2HK8A 2OLEA 1R5JA 5CIQA 1ORRA 2WU0A 5LOVB 3LL4A 1WB4A 1CPYA 3WLAA 5CP8A 5F3RA 2VRNA 2PGDA 2X4LA 5J23A 1YBHA 3KQVA 1QWOA 1QG0A 1WG8A 2XZOA 1JJVA 2WHYA 3M6WA 5C8DA 1ZVVA 4JOBA 4L15A 1K6MA 1UP4A 1XTRA 3EG5A 4BAGA 3SLRA 2AWOA 2JHPA 2HADA 2GBGA 2D1RA 3TGPA 2VS1A 3LHDA 4JU9A 2FN8A 1E99A 4GSYA 4OLBA 4X9XA 3RODA 2Z5FA 3BERA 2G67A 4HTFA 4C89A 3DM5A 4FMDB 1EX1A 4O1MA 1UBJS 2P79A 4RW0A 2OBFA 2ZS8A 1X80B 3UGQA 1TTQB 1TW2A 4HXEB 2JS7A 2R65A 2JAUA 5CA0A 1ECBA 2IZ1A 3HYLA 1M66A 1BXGA 2JIZD 4BMNA 5JD5A 2BR3A 4KTVE 3ZVRA 1WV0A 1BKSB 4UCWA 1HLFA 3EX7C 4LXQA 1E94E 2B4TO 1Y6QA 1KDTA 3KAKA 3RC2A 5BV0A 1TU0A 4IJMA 2PRKA 1IEVA 3MTBA 2O8EB 4AP9A 1P61B 4Z8YA 1MV5A 5JARA 3MD0A 2K87A 2P9HA 4B3FX 1P7ZA 1KEPA 3L1HA 1J8MF 3FPHA 2YV4A 4BXOA 3TZLA 5CUQA 1VHQA 1QVWA 4BQNA 1S2LA 2XAAA 3F6BX 5C18A 2JHFA 3N0VA 3A6KA 3K7EA 5AYVA 4PPGA 4PXAA 5HEKA 2D13A 4C6RA 2D5BA 2PFGA 4CF7A 1XMOB 4MVJG 1D9ZA 4MV9A 4UMFA 2Q0SA 5HBRA 2W2KB 1V96A 3SR4A 3AVUA 2X0IA 4Z9YA 1FTWA 2HZBA 2J3DA 2JAPA 2NZXA 4WX2B 1C7JA 1F3OA 5CNMA 4YP1A 3EFOB 3IDFA 3OTIA 4Q3AA 4RTPA 1YUNA 1CUDA 1BE0A 2VDRB 4X20B 3MXOA 3PUJA 3ROQA 1VMDA 4OY3A 5J9FA 4GMXA 5TX7A 2YHUA 4NICA 4F7WA 4M9XA 5KNDH 3KQUA 2VQSA 3A05A 4NSNA 4LISA 3V7YA 2YMMA 1P17A 1KZGB 2BT4A 3C3WA 4EUEA 2JIOA 4HV4A 1W48A 3T9FA 3PR1A 2J5KA 1IFXA 2JFBA 1F2UB 1TJ3A 4O4IF 2XAUA 4B3HA 3HBLA 3ZLTA 2IYOA 3QHQA 3H86A 2PEYA 4V0RA 3DMHA 3E3NA 1BOFA 1ZK0A 4NZNA 3LUPA 3ESXA 4ZV9A 3VHXA 4C0QC 1IN8A 2LWIA 2V6MA 1Z3CA 4Y2XA 3RR2A 2AYXA 3PEWA 1XZCA 3A9VA 5LNK6 1RCFA 1BW9A 3DC7A 1J8YF 3O9ZA 5E6UA 1O9BA 2GHTA 4UPDA 1A3CA 1USUA 3ADDA 4MR8B 1R5NA 2CJWB 2BD0A 1L4UA 3ZQ6A 4UQOA 4YUVA 4ZZ0A 6Q21A 4YMWA 2A1IA 2QUBA 3OOSA 4FFPA 3GUHA 3IB6A 5EP3A 1EZZA 1U2GA 4ZDIA 2IY9A 3RK0A 5I48A 4WA8A 1ZU5A 4PTLA 2AMFA 3IIEA 1QR2A 4M9CA 3O84A 5DTMA 2ZB7A 3R7WB 3SQDA 2W8BA 4GRIA 4HDOB 1SXJA 4OYRA 4HOYA 5T57A 3N70A 2Y9MB 2FSUA 4TL6A 4EEXA 1HG0A 3P7MA 4YT8A 3AR4A 3RB8A 3TM5A 4ACAA 2E6UX 5CLGA 7ADHA 5KBYA 3F6SA 1K66A 4UAJA 2F8TA 5DNCA 4PYLA 1QIDA 2JGLA 5CPBA 1Q0TA 5C51B 1JDTA 3OY7A 3DW3X 5JTTA 3H97A 1CE8B 2A9KA 4AZ3A 4CEIA 3FPKA 4I1PA 5HCNA 1Z8HA 3DVRX 4ZI7B 4JXJA 2ZBEA 4KBGA 2EKDA 1Z6TA 4LDAA 3SX2A 2QF7A 3E2PA 1DQSA 4PX2A 4X97A 1RXVA 3JASB 4MW5A 5E0KB 3DE4X 3O8NA 4P7JA 1Y3HA 4TTPA 3PHIA 3OLYA 3T7KA 3BC1A 3TRJA 3ADPA 3E27A 1OT3A 3FPCA 1R0YA 4ZO7A 1W25A 2NO9A 4QU9A 2XB6A 1Y5NA 2AXQA 4C7KA 2BZ0A 2DGDA 4ZAVA 2J45A 2YXPX 1KJJA 4EI2A 1GZSA 1UJ4A 2B25A 3H8JA 3QKRB 3HO6A 4LHXA 4EGJA 5AW2A 4DV5B 1RRMA 2P1DA 1KEEB 2LV8A 5JT1A 1M8JA 2WNSA 1RXSA 1L6RA 3DZDA 2FWPA 4M36A 4ZOAA 2F4VB 2FUG1 4HFNA 4KO1S 2X5JO 3TNJA 1LSSA 2CLFB 3INNA 4K9OA 3WDSA 1V5IA 3L1VA 1FTGA 3K92A 1K6IA 3ANSA 2YIVX 1QK4A 5DWVA 4EM6A 1VZ2A 4C2TA 3HYNA 4FSHA 2CEAA 4MMYB 3GI1A 3WNDA 5DYWA 1JSCA 3PA6A 4JB2A 2NVUB 4EITA 4UCQA 3WMFA 5BUQA 3DDSA 3FGNA 4RD3A 3B1ZA 3G13A 1T2VA 4LI0A 3OUUA 1DFIA 3VQTA 3T0GA 4CT4B 2JBHA 1T29A 2VYNA 3WGGA 1J2YA 2WMOB 3QXSA 2GNPA 4CF5A 3UOAB 3OICA 3WMWA 5THQA 2GF2A 2ZJ2A 4OQPA 1PNTA 4ETMA 2R97A 5DM4A 3HMKA 3RARA 4JB3A 4EUFA 2FLWA 4Z7JA 4ENPA 2HX1A 3HBAA 4R1MA 4MHTA 3TLYA 2Z9BA 1ZN7A 3SEQA 2PM8A 2DKFA 4XWTA 2JFPA 2X23A 3B82A 1Y34E 1GWNA 2OGWA 4M7PA 2D5LA 4K9SA 5JROA 3BJIC 3G88A 3LUHA 3AMVA 2ZPTX 3L1JA 4LQCA 3RRZA 1XR3A 2Q0XA 4B83A 5C2JB 2QDKA 4WMLA 4XVHA 4RJIA 2GRJA 1XWIA 4POAA 5C8YA 3THYB 4AJEA 3U44B 1C14A 3PQ8A 3GLHB 2CHUA 4DNFA 1BIFA 4JLPA 2VOEA 3B9BA 2IXTA 5T6MA 5K51A 2JFHA 1JH9A 3IQGX 1OFVA 1NRWA 1R74A 2H5EA 1WXXA 3HN6A 3LLMA 3N2GA 3MJCA 4AZ0B 1PK9A 4DY6A 1AH2A 1IHYA 5K8VA 2OFPA 1UWVA 1EE9A 3MCUA 4HAVA 1HMYA 2F3SA 3JR3A 1SVLA 4D81A 3MAAC 3W5UA 3N53A 1SN7A 2BEKA 1GARA 4FYYA 4GWGA 4KWCA 4INJA 4M9UA 5B58T 3RWOA 3F9IA 2ZW9A 1X3LA 2WWGA 3CLKA 2QAGB 1YQQA 3VSCA 1DL5A 1ZK3A 2XLBA 1PWXA 3HJCA 3AJ9A 1TAQA 1Z4NA 2FWRA 1QHEA 3RF6A 4GBMA 5ELMA 1L5MA 3MC1A 5HRCA 4CRWB 1RYEA 4O6VA 8ATCA 4KXFB 2VF5X 3HI6A 4R68A 3GQBB 5HX7A 4GR4A 3UWDA 4JSRA 1OH6A 1HK7A 4Y6QA 2ZRBA 1OYVA 2QLJA 4P83A 1VLZA 1ISJA 2HL6A 2BZSA 1VJ5A 4LYGA 4MR7B 1O97C 3ZCXA 5I7HA 4D79A 1M7HA 1Z2CA 3IPYA 4YT5A 4BP9A 4YPVA 3GGDA 4EYOA 1G0NA 4FXOA 3X1ZA 1E6EA 2REQA 3NTLA 3HQ4O 4HB2A 1NBME 2H08A 2D4HA 3A1VA 3OOYA 5GADl 5L95A 5DNAA 1SOUA 2I2WA 2LXNA 3L05A 3OCCA 1DIAA 4PQFA 2OB1A 5F35A 2QIPA 2XITA 1QP7A 4YAOA 3KQSA 1VMEA 3LY7A 3OJ0A 5CLQA 4C7BA 3BYZA 1CX9B 3Q7SA 1DC6A 1L9XA 3ZEAA 1VMIA 1JLRA 4DUGA 4YCLA 3AG5A 3OFKA 1NA5A 1XDZA 3LRXA 1U7TA 1IJFA 3T7SA 2XCLA 4YECA 3DHNA 2HT6A 4L76A 2A3RA 3C6QA 1Z17A 3BORA 3VHQA 3ZD9A 4CV1A 2B36A 3UUEA 2ORYA 3CLRC 1TUBA 4J0CA 2ZE5A 4NBVA 3TQOA 1M7BA 4RZUA 1DAGA 4QYWA 5JAQA 4YRNA 3SOPA 2AX4A 3T1QA 5ELLA 4CXMA 1TF7A 2HI0A 4CPDA 5I8WA 4FMBB 2O19A 3DBRA 3VPSA 5LZ2A 3O03A 1NYQA 2IU0A 1YZGA 1GTZA 2XMQA 1VSQA 2M9MA 2OECA 2FR8C 1ISRA 2I67A 2CZQA 3G8BA 3SYRA 4U39A 2F8SA 2P4UA 1B16A 1FSSA 3ROXA 1U8FO 4YRCA 4A15A 5FIUA 4A6DA 3I6ZA 2RIRA 5JSQA 4HH3C 1U0GA 4YJHB 3NM5A 3GHYA 1KKLA 2IS2A 4IIVA 3ZI7A 1D0SA 3U80A 1L7NA 2CJFA 4IFIA 4F11A 1QTRA 4DREA 3UHJA 2R751 1CEQA 2VK1A 3GLSA 1C9EA 5FR1A 3TSZA 4M1YA 3CGGA 4NY1A 3D5EA 2OORC 2ZUFA 3AVTA 1K8XB 1UMBA 1ADJA 3MD9A 3OQ1A 3QYAA 1Y80A 1IN4A 3CSUA 2J59A 1MQ9A 4JL6A 4NCIA 4INPA 3ROMA 1GM5A 3ERCA 2E49A 4XJTA 3VPAA 3FMFA 1ULTA 5CX1B 3D8NA 1JQBA 1Y7IA 3RU7A 3AERA 4UXIA 3RIEA 2O8CB 1MO5A 1RJFA 2IGTA 1PFVA 3UFBA 3WL7A 1YQUA 1SIWA 3IPXA 4JBNA 2OHJA 2VP4A 4C20A 1Z8FA 3E58A 5E3IA 1VL2A 3A3PA 2R8XA 3BGOS 2PL3A 1Y81A 2PPVA 2KWIA 1J1UA 3M6LA 4FSDA 1ZEJA 4Z0PA 5ARBA 2PA0A 3EY4A 1YV9A 1AA9A 3GNLA 2GD0A 1P29A 2A33A 4CHTA 3M2PA 1AKMA 1UODA 4U9IS 1N9GA 4LKOA 3H11A 4DIOA 3OLCX 3OIGA 3MINA 4I81A 5ABPA 3V97A 2VKTA 2YY6A 4F12A 2QD3A 2EZTA 2AOVA 5LZ5A 2YVQA 4KWIA 1K4YA 2JIQA 1Y9DA 3DYVA 5AVUA 2KLBA 2WIJA 4KNWA 4ZO6A 3LQ1A 3VVMA 3U7QB 1I9CA 4L85A 3I61A 4D42A 3Q72A 5L3SA 4CM8A 3IJPA 4PSVA 2EF1A 1BGWA 3GGSA 4Q7EA 1PGNA 4MS4B 3S1LA 1DB3A 2JAQA 5HW0A 1DG3A 3HN7A 2G17A 4HKTA 3C6XA 2W11A 5DCUA 4LSGA 2IPLA 4M6WA 2ZZKA 4FCWA 1NDUA 4EVQA 4S1NA 3HEBA 3BB3A 1D4FA 4ZXPA 4CMJA 1K88A 5DNEA 2PVSA 2OD7A 3UWOA 2ZR7A 3D6TB 3ZWAA 1IHUA 3MBKA 2NSDA 5C1IA 2A2ZA 4OK3A 1NLMA 5IKMA 1SUCA 2GEJA 2Y27A 4QGHA 4EW6A 2PKQP 4Z5XA 3KWLA 3KKNA 3VO9A 3PHCA 1AXEA 4S1PA 2V5AA 3D3WA 1RHMA 2QUJA 1PQPA 3C2QA 4W7SA 4LQLA 2ZI3A 3E35A 3NM4A 1Q0HA 1QRRA 3B1JA 4NCJA 1NBMA 1Y9AA 4RUKA 2ZYDA 3C0KA 3CUKA 3QVVA 4EKNB 3O75A 3PDIB 3VZSA 1N6NA 4NCBA 2GRAA 2XWQA 4TLCA 8MHTA 1B6SA 1UR5A 2QEQA 1BA2A 2PMFA 5D87A 1V25A 3WIDA 2B20A 1B00A 2A1TR 2W83A 1RZVA 4Q37A 3K2BA 2F3PA 4P98A 1KA9H 3URKA 3N8KA 1EVJA 1TU3A 2R48A 3GNTA 3ORRA 1U0TA 4G07A 4H1HA 2ZDHA 4MB0A 4GS5A 2CV2A 3WGOA 3GJQA 4PYRA 5AM1A 2R6R1 1FFXA 3LRPA 3DAOA 1R00A 4JOSA 2VDWB 5F9MA 4NATA 4AG3A 1SVKA 2ZPUA 3EXEB 2Z3ZA 1TEXA 1T43A 2ZRHA 2FPIA 3LG2A 1FYWA 4FJ1A 4B6QA 1XNGA 4OMDA 3I76A 1OC4A 3FCOA 1MOQA 3CUVA 3L02A 4LFCB 3W79A 4DAOA 3KHUA 2QVCA 1PW5A 2QP9X 3HCEA 1LTQA 3SE7A 3KXDA 3DDNA 3NAMA 1Z68A 1E8DA 2E1PA 2FQQA 1GPKA 2IEAA 3CUSA 3H17A 3OZEA 3N2KB 3DVAB 1TQ8A 2C8VA 1MEOA 3QQPA 1UFKA 4DA8A 3L0YA 1NV8A 1KQ3A 2BEWB 2G4LA 2JAHA 5EWJA 5UKDA 2YL2A 3UG7A 1G4UR 1JQLB 2ZZMA 1XLTA 3FJYA 3D7SA 1MOZA 2QXUA 2EERA 1BJKA 2CL0X 3UF0A 1PJ3A 3G2HA 2D3TA 3WIOA 3IQEA 2OK8A 3UY4A 4M1OA 4YREA 2Q9CA 3S2UA 3ONWA 3F4BA 3TOXA 1QANA 2A0UA 1P81A 2QVZX 2MMCA 3W2FA 2ZVDA 2D0PB 2PT5A 1MJFA 1XVAA 3O3MB 5IJZA 3ZJUA 2HSGA 2P5TB 2X58A 3MS2A 5A3SA 4UD6A 3HO8A 4GLFA 4WNYA 4WXPA 3LVRE 1NYLA 5IM5A 4DHWA 4CTMA 2NO0A 3QENA 5BUCA 1Z4JA 2GPWA 2J9XB 3PIRA 4H15A 4C06A 3V8EA 621PA 2F8LA 4EP1A 3RRYA 1DJMA 2JGJA 4OSEA 2R4QA 3L49A 4QYXA 3RU2A 4Q19A 5KYKA 1YC2A 4MCAA 4KIFA 4ZTZB 2W2OA 2ZIXA 3MWYW 3Q3JB 4R01A 4F38A 1J00A 5LPNA 2VBGA 1YS9A 3ETGA 3LCRA 2FZKA 1GTG1 3AJEA 3MPOA 4HS9A