3H3GA

Crystal structure of the extracellular domain of the human parathyroid hormone receptor (pth1r) in complex with parathyroid hormone-related protein (pthrp)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
520
structure length
471
Chain Sequence
AKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAVMTKEEQIFLLHRAQAQCEKRLKEVLRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor and design of conformation-selective peptides.
pubmed doi rcsb
molecule keywords Fusion protein of Maltose-binding periplasmic domain and hum
molecule tags Membrane protein
source organism Escherichia coli
total genus 150
structure length 471
sequence length 520
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h3gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h3gA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3h3gA03
4RPNA 1P1WA 3QIMA 1DSNA 4OFOA 1LSTA 5AA3A 3SEUA 1SYIA 3CG3A 3PMVA 3V5AA 2O84X 1B2HA 5TU0A 4P0GA 3CR9A 3E3KA 4U4SA 3OENA 3LR1A 2NUVA 2Y7WA 2XXXA 5L8DA 2PBWA 3KSXA 1M5CA 5JTYA 1VFEA 1R1NA 3DELB 3O2AA 3F11A 4HW8A 2I58A 4JBZA 3MZ9A 5DTBA 4H8IA 3KOTA 4OENA 4LZ5A 1UTHA 2UVHA 2OCUA 1EH3A 5CI5A 1B3GA 2P1SA 2YPNA 3PU5A 1XHYA 3TODA 1TFAA 2H98A 1DPPA 4BLAA 3E9XA 4LP2B 2REJA 4YZZA 2DE4A 4QSDA 2PVUA 4EQ7A 2OJTA 4YICA 3FASA 5CC2A 3C59A 2WKYA 1MY1A 4G68A 2ONKE 1FQEA 3MC2A 5JTYB 4KCDA 4DDDA 2DQVA 2Z8EA 2O1LA 3T9UA 4C1TA 1FTMA 2RC8A 3TQLA 5IAIA 1VE4A 3OELA 3H3GA 3SETA 4IO5A 4LZ8A 5I2NB 4ZZEA 3SDFA 4K3FA 5II0A 4EUOA 2QPQA 2Q2AA 4DZ1A 4QFPA 1N3WA 5AA2A 2AYSA 1BTJA 2XX9A 1ELJA 2DE3A 1BKAA 4I1DA 2ANJA 4F19A 2OWSA 4DCXA 1B40A 3CSGA 3IAZA 4BDNA 3PMWA 1A7LA 4IO7A 1JEVA 3HHFA 3FXQA 1QKBA 3FUZA 4U22A 1DTZA 4DCYA 4R2BA 3TCFA 4FEBA 1H43A 1UIUA 2OLBA 3K6XA 1I6AA 2I4BA 2IA4A 3N7PA 3FXUA 3FJGA 4FAJA 1QKAA 5EYFA 4OESA 1NNTA 3RN8A 5H8QA 1LCFA 1D9VA 4ESXA 1N0TA 1S50A 4ZDMA 5HPQA 4RK2A 4NF5A 2H4IA 3H6WA 4YAHX 3R7XA 2QMXA 2IEEA 3A09A 1N04A 3EHTA 1B9JA 1OQHA 4MLVA 4QFKA 1IZ1A 1NH7A 4PETA 4F1VA 2OZZA 4F3GA 4GWOA 2VGQA 2XXYA 3MVYA 1Q1KA 2F35A 5CBRA 3OSRA 4R73A 4FECA 2ONSA 4XKPA 4ZE9A 4OYVA 4JWXA 3FIRA 2QS1A 3U72A 2OBGA 5H8QB 4LVQA 4BDLA 4KFQA 4GLIA 1XS5A 1Y20A 2VP1A 3H03A 3RTWB 5DEXA 2QKHA 4OFLA 4NF5B 1ZMGA 4QHQA 3G3GA 4JWOA 4F39A 1MQGA 3PPOA 5LOMA 2DXRA 2UVGA 3MVWA 3ZSFA 1UQWA 3THIA 2FA7A 4OMBA 1OLCA 1AOVA 1POTA 5ELVA 4HCWA 3MAMA 2AIXA 4I8CA 2RINA 4NF4A 3S2VA 4YKJA 1ZIUA 3MUQA 3SESA 4N6PA 1NNKA 2JNCA 2P2AA 3K4UA 4BDQA 4LATA 3EQ1A 4ZGMA 5AA4A 1JQFA 5DYHA 1ZKBA 5KDTA 2X26A 3W9WA 1NKXA 5DEXB 4F31B 1Y1MA 1MXVA 3IJXB 3IOTA 2O51A 4TLMB 2XHDA 3LUYA 1B7HA 3L6GA 2VOZA 2QS3A 1LAXA 2KLFA 4RJZA 1ZU0A 2HCAA 3T93B 4ZECA 1MPCA 3TELA 2V84A 2Q8JA 2O69A 4NF4B 4G8HA 3IORA 3K1PA 2ABHA 1ATGA 4FATA 4YMBA 1OMPA 3HV1A 4KYEA 4GXSB 1NMUA 4FJPA 4PQJA 4X9TA 4OQOA 1JETA 1YCJA 3GBAA 1AH5A 3V83A 4U1OA 5KDTB 4KI0E 1OQGA 4HS7A 1FW0A 2UYEA 4G8NA 2I0BA 2L27A 3KOSA 2F34A 3C9HA 2JODA 2F97A 1T0KA 4Q30B 1LFIA 1IXIA 2E0SA 3AXFA 3FVOA 4YB5A 1AIVA 4AB6A 3MVZA 3M3KA 3SEYA 2I4CA 3RLFE 4R6HA 3O6IA 3FVGA 2BJJX 1B7UA 3FGSA 1MH3A 2ZMBA 1FCKA 4F22A 4KYDA 1MRPA 4EXKA 2F6PA 3CIJA 1FQDA 3OEKA 3CI8A 1SW1A 3KN7A 2HAVA 4Q8RA 2R9JA 2HEUA 3IOVA 3FVNA 5CBSA 3IB1A 2RCBA 3QUFA 2QS2A 2QL3A 3TYHA 3VLWA 3T66A 1N7XA 1TT1A 3GLBA 3PD8A 3VVDA 1US5A 1A54A 3MJNA 3TMGA 4WEDA 5I58A 2VD2A 1Y3QA 1LAGE 4DLOA 1MS7A 4H0WA 3GZGA 2NXOA 3MW0A 4ZZAA 3BKIB 4FIMA 4R9GA 3B6QA 2O6AA 3G3JA 2B65A 3G3KA 1QUJA 1N7WA 4F3SA 2CZLA 4R9FA 3KGCA 1SVXB 3W15C 1NL5A 1USYH 3K6WA 4ELRA 1PB7A 5FTIA 5M2VA 1NNFA 3S9LC 4JXIA 3C35A 4F1YA 1II5A 3U1OA 3EF7A 3DP4A 2F8DA 1MQJA 5CMCA 3OSQA 4THIA 3CRBA 4GXAA 3IK6B 3WAFA 4EQ9A 2VHAA 5I58B 4X1BA 1Y4TA 5HBCA 2HXWA 4Z0IA 3N7RA 2DWAA 3V89B 4ONYA 5K2YA 4TQUQ 1JW5A 3PPQA 2Y7PA 4RA1A 3OXNA 4LA9A 3TQWA 3LC8A 4XXUA 3IOWA 4R6YA 5F1QA 1MQHA 1MY0A 2ZNUA 2I3WA 2PT2A 5I2NA 2OWTA 1PB8A 3HHGA 2XX8A 1MPBA 1BLFA 3IR1A 4IO6A 2QS4A 4YB7A 4O3BA 3W9VA 1MXWA 1SW2A 2H25A 4KCCA 3ECRA 2XXHA 5DVFA 3SERA 1QUIA 3QXMA 4HJ0A 1JVYA 4POXA 2A5TA 5DT6A 3KZGA 1LFHA 4GQOA 1H45A 1M5BA 1NH8A 2O7UA 4PFTA 4YB6A 3DM0A 2V25A 2REGA 1UTBA 3N7SA 4YMAA 4X1DA 1JW4A 4ELOA 4X48A 4GIZA 2H99A 1B3FA 3CFLA 1SQYA 2PX1A 1HSEA 1AMFA 3ILTB 3T96B 2NOOA 3M3FA 1B58A 3A3CA 3K01A 5FHOA 3HN0A 3T22A 1RYOA 3UP9A 3TZAA 4F3PA 3K0VA 1LB9A 4H67A 2I6EA 3RPWA 2R71A 2DE2A 4NF6A 1B52A 2D5WA 2A5TB 2FNCA 5ITOA 1L5TA 3ODBA 3VVEA 1PDAA 1OIBA 4WXJA 1UTBB 1WODA 4F18A 2GHBA 1MG1A 3TTRA 3TAJA 4N13A 1M5DA 1LLSA 1MY4A 1QVSA 1OVBA 4IY5A 3E13X 1Y3PA 3U93A 2X7PA 1SI1A 2F7CA 5L9MA 4F3BA 4BDMA 1JVXA 3C36A 4NMYA 4LUBA 3TTNA 3K1NA 2OK2A 2ALUA 3RGYA 3BBRA 3WAEA 3LSWA 5L9OA 2DVCA 4NF6B 3GBBA 4IGTA 1B4ZA 4OEUA 4E0XA 4PFWA 5TP9B 3K00A 1JEUA 3S9EA 5EHSA 1LGBC 4EXLA 1IUDA 3U8QA 4H8JA 3K02A 3CFXA 4YKIA 3VLUA 2V3TA 3UGWA 4NEDA 1Y9UA 4Z7EA 1ANFA 1UIVA 4MF3A 1MDQA 3L6HA 2XD3A 3MPLA 4KYSA 1MM6A 1RYXA 5JK4A 2DWHA 2UYFA 3C34A 4QFNA 2DVZA 4H1XA 4FORA 1R6ZA 3H06B 3FD3A 4U2RA 3JV9A 4GL0A 4NWDA 3OO8A 5FHNA 4NE4A 2HAUA 4G8MA 1CE2A 1URGA 4O3AA 3EN3A 4I62A 4YU0A 1BP5A 1ZBMA 4MFIA 3Q28A 3ZKKA 2X7QA 3KN3A 3QSLA 4JSDA 3IOUA 1MY3A 3QAXA 5CMBA 4JWYA 3O28A 5AE4A 4C0RA 1B0LA 3TPAA 3CG1A 1B4HA 3AQFB 2PMSA 4Q5TA 1H3DA 3OO7A 1PB9A 4OETA 3TUSA 4OEVA 2Z8DA 1MQIA 4EDPA 4M4GA 2XXWA 5AA2D 2F36A 4ND9A 1QUKA 3MWBA 1MH4A 4PP0A 5H8NA 4JSOA 5B70A 1DTGA 3OOAA 3PUYE 1VR5A 1A8EA 4OFJA 1EZOA 2R6GE 3KJTA 4PE5B 2UVJA 4POWA 4G68C 4DLDA 4QSEA 3TTKA 2THIA 2DXYA 3C5TA 5ISUA 4JB7A 5DVJA 3PV0E 3CSBA 3TTMA 3BFTA 3D4CA 3IJOB 3LSXA 1I6BA 2ZYNA 3O97A 3TTLA 1S9TA 1R9LA 4QFLA 3VXCA 1HSJA 3JZJA 4GL8A 3IO6A 3ONMA 4RK9A 3N6TA 2ZNTA 3FV1A 4QF9A 3O9PA 1PBQA 1PEBA 5H8NB 2XXQA 1EZ9A 1U34A 2I48A 4ISUA 4KR5A 2Q2CA 1MXXA 4MBPA 3MZ1A 1GR2A 1D4NA 2V93A 4MH5A 5I57B 5I2KA 1B51A 4NTLA 1IXHA 4OERA 1YTVA 3IB0A 4E0WA 4DLQA 4RXLA 1QULA 2NWJA 1A8FA 1N76A 3OO6A 5L9SA 2O68A 5HM4B 3N26A 2UVIA 3G3IA 5F7VA 3IOLA 2XXPA 1DPEA 4G77A 2DP8A 2M8CA 3SEXA 4AB5A 4LQ2A 2F7AA 2XXIA 4ERSA 5AA1A 2ZYMA 3N6UA 4IB2A 4I9DA 4HCYA 4XKRA 5I84A 4AQ4A 2DOJA 1IXGA 3H6UA 3O29A 4NWCA 4QFOA 5FTHA 5I2KB 3PUXE 4DXBA 4MLQA 2CMOA 2F78A 5IKBA 2XXUA 4EQBA 4QRZA 1DOTA 2HZKA 1IXCA 2F7BA 2UXAA 1TWYA 3Q27A 3EHUA 4ELQA 2DWJA 3C33A 1WDNA 4BDRA 3K1MA 2W7YA 4IY6A 4YKPA 3U92A 4RNSA 3T9HB 3T9VA 1TXFA 2HFBA 1LB8A 3N5LA 3HPIA 3FV2A 3FZVA 3PUVE 3VE1B 1URDA 1AL3A 3OO9A 3VDFA 4BDOA 2ZYKA 3Q25A 4U21A 2XXTA 5J1DA 3B6WA 4ZEBA 4KHZE 3S9NC 3Q26A 4EF2A 2H9BA 4N07A 5H8SA 2Y7RA 3R6UA 4IO2A 2I0CA 2P0SA 3H6TA 3MZBA 4IO3A 4PFYA 1Y1ZA 1I6QA 3H7MA 2NVUB 4UA8A 2Q89A 2ONRA 1B1XA 1A40A 1SW5A 3O6GA 1FQCA 4EF1A 5CRYA 1B5JA 3UK4A 1SYHA 1N3XA 2Y7IA 3RY3A 1LBCA 4ECFA 1GV8A 4DXUA 3DP6A 4GVOA 3UN6A 2PYYA 1CB6A 1P1NA 1N84A 4XKQA 4P11A 3GXAA 1H76A 1VSOA 1Y3NA 2Y84A 1MY2A 1NNPA 3O6HA 1YPNA 2G93A 2HQ0A 3H4ZA 3PPPA 2ZYOA 3C4MA 1B5HA 2XDGA 4DIGA 4UACA 3L2JA 4XKNA 4F29A 4IGRA 1LBBA 2XXRA 5CMMA 2I49A 5CM6A 3DLNA 3FJ7A 3ILUB 4R74A 3TKDA 1ZTYA 4IO4A 5A5XA 4YKKA 5JEIA 5H8HA 2ZNSA 1I69A 1M5EA 2RC7A 1F9BA 2RC9A 3EPEA 3SEVA 1UTHB 1GGGA 2RF1A 3QYTA 4GRKA 4GOTA 4ZEKA 4HTGA 5KZTA 1D3KA 1R9QA 1QJMA 1VFDA 1SD3A 1XVXA 3D4GA 3MVXA 4OWDA 2XD2A 2YJPA 3LBSA 4L17A 5TP9A 4U23A 1XC1A 3TCHA 2AL5A 1NFTA 3M8UA 1PBPA 3TFLA 1POY1 4G68B 1XT8A 4OZ9A 2PT1A 1SBPA 1Q35A 5A5XB 1IQ7A 3K6VA 2QJEA 1EU8A 4M1VA 5H8HB 4OTEA 1GTKA 3OEMA 5I56A 2D3IA 5H8FA 2VD3A 5DVIA 3FATA 3PPRA 1FQAA 1FQFA 2YLNA 3S4UA 5CMKA 4ZEDA 4R75A 1H44A 2V3QA 3U94A 3VV5A 3JYRA 5AA2B 3MP8A 1P1UA 1A55A 5I59A 3C31A 3LSLA 2XX7A 1B3EA 2GRVA 4DXCA 3ZS6A 4P0IA 1ZLQA 3QK6A 1LAFE 2AL4A 4PFUA 4H5GA 1MXZA 4WEPA 3RUMA 5KCJA 1O63A 4LF3C 2H5YA 2V3UA 4LQ5A 4OXVA 1LFGA 5I56B 2JNDA 1P1QA 1KWHA 3K6UA 5H8FB 4XTCQ 3MQ9A 1SI0A 3UIFA 1FTJA 4F2QA 1P99A 3VXBA 3HO7A 4O3CA 1SDXA 1USYE 5I59B 4JDFA 1ZJLA 4H5FA 4RYAA 2ZXTA 1FTOA 4TLLB 1FQBA 4LONB 3G3HA 1RKMA 3I6VA 3KBRA 3K2DA 3LSFB 3USDA 3P7IA 3BFUA 3VLVA 1Z7ME 3TEPA 1MM7A 4NF8A 5KCJB 1B05A 3SKPA 3KEIA 3RQTA 4FEDA 3RT6B 4ESWA 2RKMA 4GFRA 4TOZA 4ZEIA 5K2XA 5B7DA 2DSFA 1MXUA 2GFEA 3PGFA 3KSJA 4OVJA 2F5XA 1YAEA 2Z23A 2B3FA 2Z22A 4F1UA 3EHSA 1JNFA 2HZLA 1B46A 1M5FA 4QSCA 1LAHE 2GHAA 3N94A 4ELPA 3O66A 1S7YA 2Z8FA 3UORA 5I57A 1J1NA 3E4RA 3TDJA 2D21A 4NF8B 4DE8A 4WKMA 3RT8A 2DS9A 1B3LA 3HSTA 5ITPA 3B7DA 1DMBA 3I3VA 2Y7KA 1EZPA 2B3BA 2LAOA 4KD5A 3MP1A 5TPAA 3FXRA 1IEJA 1PC3A 1B3HA 2E1SA 1B32A 4G2ZA 1BIYA 1OLAA 3PD9A 3VVFA 3OMBA 3VFJA 4U4XA 4FE8A 2QRYA 1MQDA 3MPKA 1O7TA 2QSXA 5AA4B 5ICTA 3MP6A 3RTFB 3MBPA 4LZ7A 1B7ZA 4GF8A 3M3LA 3TCGA 5EHMA 2DYXA 1XVYA 3PUZE 4ZEFA 3CFZA 4RPOA 2GH9A 2G29A 2FYIA 4R72A 5TPAB 3FJMA 3Q29A 3V8XB 3C32A 4ZE8A 3R26A 1MPDA 5ICQA 2DWIA 3S9MC 3G7WA 3PPNA 1D9YA 1QW0A 3RNNA 2RCAA 4R6KA 1TFDA 1MDP1 3HCQA 3OD7A 3KJ7A 3T9XB 3IX1A 3DP8A 2I3VA 3PUWE 3FVKA 4U1ZA 1OVTA 3SEWA 4OHNA 4XIGQ 1O64A 2XXVA 2QMWA 1XOCA 4R2FA 4C1UA 1B1HA 2O7IA 3KN8A 2Q9TA 4F2OA 4GD5A 5BUUA 1LCTA 1IIWA 1MXYA 4KPTA 3QUJA 2F6GA 1HSLA 2O1MA 3B6TA 4ZS9A 5BWJA 1P1OA 1WVJA 1URSA 3KG2A 3KFMA 1A99A 1FTKA 3IO4A 2Q88A 3PMXA 4H6DA 3I5OA 1B0HA 5FHMA 1SW4A 4KQPA 2A5SA 1B6HA 1FTLA 3IL1B 3ZKLA 3CVGA 4G4PA 1Z7NE 1GVCA 1US4A 1B5IA 1Y4CA 4RY1A 1JW1A 3A3UA 3G3FA 1IITA 4H65A 2ESNA 3UA8A 3H6VA 3IB2A 4Q0CA
chains in the Genus database with same CATH superfamily
4RPNA 1P1WA 3QIMA 4XEQA 5EQ8A 1DSNA 4OFOA 3ROJA 1LSTA 5AA3A 3SEUA 1SYIA 3CG3A 3PMVA 3V5AA 2O84X 1B2HA 5TU0A 4P0GA 3CR9A 4PDHA 3E3KA 4U4SA 3OENA 3LR1A 2NUVA 2Y7WA 2XXXA 5L8DA 2PBWA 1FBCA 3KSXA 1M5CA 5JTYA 3MSTA 1VFEA 1R1NA 3DELB 3O2AA 3F11A 4MNIA 2I58A 4JBZA 4HW8A 4DI3D 3MZ9A 5DTBA 4H8IA 3KOTA 1LBYA 4OENA 4LZ5A 1UTHA 2UVHA 2OCUA 1EH3A 2XWIA 4MNCA 5CI5A 1IMCA 1B3GA 2P1SA 1AWBA 2YPNA 4N91A 2CEXA 3PU5A 1XHYA 3LUZA 3TODA 1TFAA 2H98A 1DPPA 4BLAA 3E9XA 4LP2B 2REJA 4GWUA 4YZZA 2DE4A 4QSDA 2PVUA 4EQ7A 2OJTA 4YICA 3FASA 5CC2A 3C59A 2WKYA 1MY1A 4G68A 2ONKE 1FQEA 3MC2A 5JTYB 5IZZA 4KCDA 4DDDA 1KA0A 2DQVA 3PTYA 2PFYA 2Z8EA 2O1LA 3E79A 3T9UA 4PFBA 4C1TA 1FTMA 1NUWA 2RC8A 3BIHA 4PBHA 3TQLA 5IAIA 1VE4A 3OELA 2FBPA 4GWXA 3H3GA 3SETA 4IO5A 4LZ8A 5I2NB 4ZZEA 3SDFA 3BIGA 4K3FA 4N81A 5II0A 4EUOA 2QPQA 2Q2AA 2B4LA 4DZ1A 4QFPA 1N3WA 1EYKA 2AYSA 5AA2A 1BTJA 4N15A 2XX9A 1ELJA 1INPA 2DE3A 1BKAA 4I1DA 2ANJA 4F19A 1QGXA 2CZKA 2OWSA 4DCXA 3ISPA 1B40A 3CSGA 3IAZA 4BDNA 3PMWA 1A7LA 4IO7A 5EYGA 1JEVA 3HHFA 3FXQA 1QKBA 3FUZA 4XFEA 4U22A 1DTZA 4DCYA 4R2BA 3TCFA 4FEBA 1H43A 1UIUA 2OLBA 3K6XA 1I6AA 2I4BA 2IA4A 3N7PA 4H46A 3FXUA 1FPGA 3FJGA 4FAJA 1QKAA 5EYFA 4OESA 1NNTA 2XXKA 3RN8A 5H8QA 1LCFA 1D9VA 4ESXA 4O7MA 1N0TA 1S50A 4ZDMA 5HPQA 4RK2A 4NF5A 2H4IA 3H6WA 4YAHX 3R7XA 2QMXA 2IEEA 3A09A 1N04A 3EHTA 1B9JA 1OQHA 4MLVA 1KZ8A 4QFKA 1IZ1A 1NH7A 4PETA 4F1VA 2OZZA 4F3GA 4GWOA 2VGQA 3E78A 3T0JA 2XXYA 1LBZA 3MVYA 1Q1KA 2F35A 5CBRA 3OSRA 4R73A 4FECA 2ONSA 4XKPA 1LBVA 4ZE9A 4OYVA 4JWXA 3FIRA 2QS1A 3U72A 2OBGA 2QFLA 5H8QB 3A29A 4LVQA 4BDLA 4KFQA 4GLIA 1XS5A 1Y20A 2VP1A 3H03A 3RTWB 5DEXA 2QKHA 4GWYA 4OFLA 4NF5B 1ZMGA 4QHQA 3G3GA 4JWOA 4F39A 1MQGA 3PPOA 5LOMA 2QVRA 2DXRA 2UVGA 1FBGA 1G0HA 3MVWA 1DK4A 3ZSFA 1UQWA 3THIA 2FA7A 2WBDA 4OMBA 1OLCA 1AOVA 1POTA 5ELVA 4HCWA 3MAMA 2AIXA 4I8CA 2RINA 4PC9A 4NF4A 3S2VA 4YKJA 1ZIUA 3MUQA 3SESA 4N6PA 1NNKA 2JNCA 2P2AA 3K4UA 4BDQA 4LATA 3EQ1A 4ZGMA 5AA4A 1JQFA 5DYHA 1ZKBA 5KDTA 2X26A 3W9WA 1NKXA 5DEXB 4F31B 1Y1MA 1MXVA 4JVCA 3IJXB 3IOTA 2O51A 4TLMB 2XHDA 3LUYA 1B7HA 3L6GA 2VOZA 2QS3A 1LAXA 2KLFA 4RJZA 1ZU0A 2CEYA 4UABA 5IGAA 2HCAA 3T93B 4ZECA 1YXIA 1MPCA 3TELA 2V84A 4NN3A 4NHBA 1Q9DA 3T1BA 2Q8JA 2Y5KA 2O69A 4NF4B 4G8HA 4OVPA 4PCDA 3IORA 3K1PA 2ABHA 1ATGA 3HV1A 1OMPA 4FATA 4YMBA 4KYEA 4GXSB 1NMUA 4FJPA 4PQJA 4X9TA 4OQOA 1JETA 1YCJA 3GBAA 1AH5A 3V83A 5ESYA 4U1OA 5KDTB 4KI0E 1OQGA 4HS7A 1FW0A 2PCRA 2UYEA 4N4UA 4X8RA 4G8NA 2I0BA 4FBPA 1VDWA 2L27A 4P8BA 5IZ3A 3KOSA 2F34A 3C9HA 2JODA 4PAIA 2F97A 4DI4B 1T0KA 4Q30B 1EYJA 2OX3A 1LFIA 1IXIA 2E0SA 3AXFA 3FVOA 4YB5A 1FJ6A 1AIVA 4AB6A 3MVZA 3M3KA 1IMEA 3SEYA 2I4CA 3RLFE 4R6HA 3O6IA 3FVGA 1KA1A 2BJJX 1B7UA 3FGSA 1NV5A 1MH3A 2ZMBA 1FCKA 3RYDA 4F22A 4KYDA 1MRPA 3NOHA 4EXKA 2F6PA 3CIJA 1FQDA 3OEKA 2HPGA 3CI8A 1D9QA 1SW1A 3KN7A 5I7IA 2HAVA 4Q8RA 2VPNA 2R9JA 2HEUA 2BJIA 1JP4A 3IOVA 2Q74A 3FVNA 1NV6A 5CBSA 3IB1A 2RCBA 3QUFA 2QS2A 2QL3A 3TYHA 3VLWA 3T66A 3HFUA 1YYZA 1N7XA 4GBVA 1TT1A 1CNQA 3GLBA 3PD8A 1LBXA 3VVDA 1US5A 1A54A 3MJNA 3TMGA 4WEDA 5I58A 2VD2A 1Y3QA 1LAGE 4DLOA 1MS7A 4H0WA 3GZGA 2NXOA 3MW0A 4ZZAA 3BKIB 4FIMA 4R9GA 3B6QA 2O6AA 3G3JA 2B65A 3G3KA 1QUJA 1N7WA 2XWKA 4F3SA 2CZLA 4R9FA 4PAKA 3KGCA 1SVXB 3W15C 1NL5A 3B50A 1USYH 3K6WA 4ELRA 3KC0A 1PB7A 5FTIA 5M2VA 1NNFA 3S9LC 4JXIA 3C35A 4F1YA 1II5A 3U1OA 2QVVA 3EF7A 3DP4A 2F8DA 1MQJA 5CMCA 3OSQA 4THIA 3CRBA 4GXAA 3IK6B 3WAFA 4EQ9A 4PGNA 2VHAA 5I58B 4AS4A 4X1BA 4GX3A 1NI9A 1DCUA 1Y4TA 5HBCA 2HXWA 4Z0IA 3N7RA 2DWAA 3V89B 4ONYA 5K2YA 2QVUA 4TQUQ 1JW5A 3PPQA 2Y7PA 4RA1A 2HXRA 3OXNA 4LA9A 3TQWA 3LC8A 4XXUA 3IOWA 4R6YA 5F1QA 1MQHA 1FBHA 1MY0A 2ZNUA 2I3WA 5LDZA 2PT2A 5I2NA 2OWTA 1PB8A 3HHGA 2XX8A 1MPBA 1FBPA 1BLFA 3IR1A 4IO6A 2QS4A 4YB7A 4O3BA 4NX1A 3W9VA 1MXWA 1SW2A 1NV3A 1G0IA 2H25A 4KCCA 3ECRA 2XXHA 5DVFA 3SERA 1QUIA 3QXMA 4HJ0A 1JVYA 4POXA 2A5TA 5DT6A 3KZGA 1LFHA 4GQOA 4JVDA 1H45A 1M5BA 1NH8A 2O7UA 4PFTA 4YB6A 1IMBA 3DM0A 2V25A 2P3VA 2REGA 1UTBA 3N7SA 4YMAA 4X1DA 1JW4A 4ELOA 4X48A 1FTAA 4GIZA 2H99A 4OVQA 1B3FA 3KC1A 3CFLA 1SQYA 2PX1A 1IMDA 1HSEA 4GBWA 1AMFA 3ILTB 2DDKA 3T96B 2NOOA 4PDDA 3M3FA 1B58A 3A3CA 3K01A 5FHOA 3HN0A 3T22A 1RYOA 3UP9A 3TZAA 4F3PA 3K0VA 1LB9A 4H67A 2I6EA 4QBAA 3RPWA 2R71A 4IR8A 2DE2A 4NF6A 1B52A 2D5WA 2A5TB 2FNCA 5ITOA 1L5TA 3ODBA 3VVEA 1PDAA 4MAGA 1OIBA 4I3EA 4WXJA 1UTBB 1WODA 4F18A 2GHBA 1MG1A 3TTRA 4XF5A 3TAJA 4N13A 1M5DA 1LLSA 1MY4A 1QVSA 1OVBA 4H45A 4IY5A 3E13X 1Y3PA 3U93A 2X7PA 1NUXA 1SI1A 2F7CA 5L9MA 4F3BA 5EYHA 4BDMA 1JVXA 3C36A 4NMYA 4LUBA 3TTNA 4PE3A 3IFCA 3K1NA 2OK2A 2ALUA 3RGYA 3BBRA 3WAEA 3LSWA 5L9OA 2DVCA 4NF6B 3GBBA 3FBPA 4IGTA 1B4ZA 4OEUA 4E0XA 4PFWA 5TP9B 3U65A 3K00A 1JEUA 3S9EA 5EHSA 1LGBC 4EXLA 1IUDA 3U8QA 4H8JA 2P3NA 3K02A 3CFXA 4YKIA 3VLUA 2V3TA 3UGWA 4NEDA 1FBDA 1Y9UA 4Z7EA 4MCOA 1ANFA 1UIVA 4MF3A 1MDQA 3L6HA 2XD3A 3MPLA 4OVRA 4KYSA 2MKZA 5A5LA 1MM6A 1RYXA 5JK4A 1IMFA 4MJOA 2DWHA 1DBZA 2UYFA 2FVZA 3C34A 4QFNA 2DVZA 4H1XA 4FORA 1R6ZA 3H06B 3FD3A 4U2RA 3JV9A 4GL0A 1SPIA 2HHMA 4NWDA 3OO8A 5FHNA 4NE4A 2HAUA 4G8MA 1CE2A 1URGA 4O3AA 3EN3A 4I62A 4YU0A 4PFIA 1BP5A 1ZBMA 1FPLA 4MFIA 3Q28A 3ZKKA 2X7QA 3KN3A 3QSLA 4JSDA 3IOUA 1MY3A 3QAXA 5CMBA 4JWYA 3O28A 5AE4A 4C0RA 1B0LA 3TPAA 2ZZXA 3CG1A 1B4HA 4O8MA 3AQFB 2PMSA 4Q5TA 1H3DA 3OO7A 1PB9A 4OETA 3TUSA 4OEVA 2Z8DA 1MQIA 4EDPA 4M4GA 4I40A 2XXWA 3GYYA 2F36A 5AA2D 4ND9A 1QUKA 3MWBA 1MH4A 4PP0A 5H8NA 4JSOA 5B70A 1DTGA 3OOAA 3PUYE 1VR5A 1A8EA 4OFJA 1EZOA 3EKIA 2R6GE 3KJTA 4PE5B 2UVJA 4POWA 1NUZA 4P1EA 1FPEA 4G68C 4P56A 4DLDA 4QSEA 3TTKA 4HE1A 2THIA 2DXYA 2XWOA 3C5TA 4GWWA 4JB7A 5ISUA 5DVJA 3PV0E 3CSBA 3TTMA 3BFTA 3D4CA 1LEVA 3IJOB 3LSXA 1I6BA 2ZYNA 3O97A 3TTLA 1S9TA 1R9LA 4QFLA 3VXCA 1HSJA 3JZJA 4GL8A 3IO6A 3ONMA 4RK9A 2FIEA 3N6TA 2ZNTA 3FV1A 4QF9A 3O9PA 1FPFA 1PBQA 1PEBA 5H8NB 2XXQA 1EZ9A 1U34A 2I48A 4ISUA 4KR5A 2Q2CA 1MXXA 1NV1A 4PF8A 5F24A 4HE0A 4MBPA 3MZ1A 1GR2A 1D4NA 2V93A 4MH5A 5I57B 5I2KA 2VPOA 1B51A 4NTLA 1IXHA 5EQAA 4OERA 1FPIA 1YTVA 3IB0A 4E0WA 4DLQA 4RXLA 4N6KA 4OVTA 2B4MA 1QULA 2NWJA 1A8FA 1N76A 3OO6A 5L9SA 2R8TA 2O68A 5HM4B 3N26A 2UVIA 3G3IA 2VT5A 5F7VA 3IOLA 2XXPA 1DPEA 4NGUA 4G77A 2DP8A 2M8CA 3SEXA 2CZIA 4GWSA 4HXVA 4AB5A 4LQ2A 2F7AA 2XXIA 4ERSA 5AA1A 2ZYMA 3N6UA 4IB2A 4I9DA 4HCYA 4XKRA 5I84A 4AQ4A 2DOJA 4PAFA 4PTKA 1IXGA 3H6UA 3O29A 1FSAA 4NWCA 4QFOA 5FTHA 5I2KB 3PUXE 4DXBA 4P1LA 4MLQA 2CMOA 2F78A 5IKBA 3CHGA 2XXUA 2XA5A 4EQBA 4QRZA 3FXBA 1DOTA 2HZKA 1IXCA 2F7BA 1NV2A 2UXAA 1TWYA 3Q27A 3EHUA 4ELQA 2DWJA 3C33A 1WDNA 4BDRA 3K1MA 2W7YA 4IY6A 4YKPA 3U92A 4RNSA 3T9HB 3T9VA 1TXFA 2HFBA 1LB8A 3N5LA 3HPIA 4PFRA 3FV2A 3FZVA 3PUVE 3VE1B 1URDA 1AL3A 3OO9A 3VDFA 4BDOA 5ET8A 2ZYKA 3Q25A 4U21A 2XXTA 5J1DA 3B6WA 4ZEBA 4KHZE 4P9KA 5EQ9A 3S9NC 3Q26A 4EF2A 5I5PA 2H9BA 4N07A 5H8SA 2Y7RA 3R6UA 4IO2A 2I0CA 2P0SA 3H6TA 3MZBA 4IO3A 2WX9A 4PFYA 1Y1ZA 1I6QA 3H7MA 2NVUB 4UA8A 2Q89A 2ONRA 3D1RA 1B1XA 1A40A 1SW5A 3O6GA 1FQCA 4EF1A 5CRYA 1B5JA 3UK4A 1SYHA 1N3XA 2FIXA 2Y7IA 3RY3A 1LBCA 4ECFA 1GV8A 4DXUA 3DP6A 4GVOA 1NV0A 3UN6A 2PYYA 4P3LA 1CB6A 1P1NA 1N84A 4XKQA 4P11A 3GXAA 1H76A 1VSOA 1Y3NA 2Y84A 5I3SA 1MY2A 1NNPA 3O6HA 1YPNA 2G93A 2HQ0A 3H4ZA 3PPPA 2ZYOA 3C4MA 1B5HA 2XDGA 4OANA 4DIGA 4UACA 3L2JA 4XKNA 4F29A 4IGRA 1RDZA 1LBBA 2XXRA 5CMMA 2I49A 4O7IA 5CM6A 2F3DA 2WEFA 1K9YA 3DLNA 3FJ7A 3ILUB 4R74A 3TKDA 1ZTYA 4IO4A 5A5XA 1IMAA 4YKKA 5JEIA 5H8HA 2ZNSA 1I69A 1M5EA 2RC7A 1F9BA 2RC9A 3EPEA 3SEVA 1UTHB 2V4CA 1GGGA 2RF1A 3QYTA 4GRKA 4GOTA 4ZEKA 4HTGA 3RPLA 4N17A 5KZTA 1D3KA 1FBFA 1R9QA 1QJMA 1VFDA 2FHYA 1SD3A 1XVXA 2WYPA 3D4GA 3MVXA 4OWDA 2XD2A 2YJPA 3LBSA 4L17A 5TP9A 4N8YA 4U23A 1XC1A 3TCHA 5T3JA 2AL5A 4P47A 1NFTA 3M8UA 1PBPA 3TFLA 1POY1 1FPDA 4G68B 1XT8A 1BK4A 4PGPA 1XI6A 4OZ9A 4LN5A 2PT1A 1SBPA 5IZ1A 4O94A 1Q35A 5A5XB 1IQ7A 4NG7A 3K6VA 1NUYA 2QJEA 1EU8A 4M1VA 5H8HB 4OTEA 1GTKA 2Q8MA 3OEMA 5I56A 2D3IA 4MMPA 5H8FA 4PBQA 2VD3A 4NQ8A 5DVIA 1NV7A 3FATA 3PPRA 1FQAA 3RPLB 1FQFA 4N6DA 2YLNA 3S4UA 5CMKA 4ZEDA 2KQZA 4R75A 1H44A 2V3QA 3U94A 3VV5A 3JYRA 5AA2B 3MP8A 1LBWA 1P1UA 1A55A 5I59A 3C31A 3LSLA 2XX7A 1B3EA 4QXDA 2GRVA 4GWZA 4DXCA 2KR0A 3ZS6A 4P0IA 1ZLQA 3QK6A 1LAFE 1EYIA 2AL4A 4PFUA 3QMFA 4H5GA 1MXZA 2JJKA 4WEPA 3RUMA 5KCJA 1O63A 4LF3C 2H5YA 4MNPA 2V3UA 4LQ5A 4OXVA 1LFGA 5I56B 2JNDA 1P1QA 1KWHA 3K6UA 5H8FB 4XTCQ 1FPKA 3MQ9A 1SI0A 3UIFA 1FTJA 4F2QA 1P99A 3VXBA 3HO7A 4N8GA 4O3CA 1SDXA 1USYE 5I59B 4JDFA 1ZJLA 4H5FA 4RYAA 2ZXTA 1RDXA 1FTOA 4TLLB 4X04A 1FQBA 4LONB 3G3HA 1RKMA 3I6VA 5ET6A 3KBRA 4KXPA 3K2DA 3LSFB 1FRPA 3USDA 3P7IA 3BFUA 3VLVA 1Z7ME 3TEPA 1MM7A 4NF8A 5KCJB 1B05A 3SKPA 3KEIA 3RQTA 4FEDA 3RT6B 4GX6A 4ESWA 2RKMA 4GFRA 4TOZA 4ZEIA 5K2XA 5B7DA 2DSFA 1MXUA 2GFEA 3PGFA 3KSJA 4OVJA 2F5XA 5ET5A 1YAEA 2Z23A 2B3FA 2Z22A 4F1UA 3EHSA 2WYKA 1JNFA 2HZLA 1B46A 1M5FA 4QSCA 4NF0A 1LAHE 2GHAA 3MYUA 1K9ZA 3N94A 4ELPA 1FPBA 3O66A 1S7YA 2Z8FA 1FJ9A 3UORA 3LV0A 5I57A 1J1NA 5IM2A 3E4RA 3TDJA 4OA4A 2D21A 4NF8B 4DE8A 4WKMA 3RT8A 2DS9A 1B3LA 3HSTA 5ITPA 3B7DA 1DMBA 4I3YA 4MX6A 3I3VA 4NAPA 2Y7KA 1EZPA 2B3BA 3SZPA 2LAOA 4KD5A 3MP1A 5FBPA 5TPAA 3FXRA 1IEJA 1PC3A 1B3HA 3IFAA 2E1SA 1B32A 4G2ZA 2F3BA 1BIYA 1OLAA 3PD9A 3VVFA 3OMBA 3VFJA 4U4XA 4FE8A 2QRYA 1MQDA 3MPKA 1O7TA 2QSXA 5AA4B 5ICTA 1RDYA 3MP6A 3RTFB 3MBPA 4LZ7A 1B7ZA 5LTCA 2ZZVA 4GF8A 3M3LA 3TCGA 1FBEA 5EHMA 2DYXA 1XVYA 3PUZE 4ZEFA 3CFZA 4RPOA 2GH9A 2G29A 2FYIA 4R72A 4G61A 5TPAB 3FJMA 3Q29A 3V8XB 3C32A 4ZE8A 1YZ0A 3R26A 1MPDA 4PF6A 5ICQA 2DWIA 3S9MC 3G7WA 3PPNA 1D9YA 1QW0A 3RNNA 3B8BA 5ET7A 2RCAA 4R6KA 5DW8A 1TFDA 1MDP1 3HCQA 3OD7A 5J16A 3KJ7A 2GQ1A 3IX1A 3T9XB 3DP8A 2I3VA 3PUWE 3FVKA 2WBBA 2OWZA 1NV4A 4MHFA 2XWVA 4U1ZA 1OVTA 3SEWA 4OHNA 4HE2A 4XIGQ 1O64A 1FPJA 5IZ3B 4JVIA 2XXVA 2QMWA 1XOCA 4MIJA 4R2FA 4C1UA 1B1HA 2O7IA 3KN8A 2Q9TA 4F2OA 4GD5A 5BUUA 1LCTA 1IIWA 1MXYA 4KPTA 3QUJA 2F6GA 1HSLA 2O1MA 3B6TA 4GX4A 4ZS9A 5BWJA 1P1OA 1WVJA 1URSA 3KG2A 3KFMA 1A99A 1FTKA 2CZHA 3IO4A 2Q88A 4OVSA 3PMXA 4H6DA 3I5OA 1B0HA 5FHMA 2ZZWA 1SW4A 2PFZA 2A5SA 4KQPA 1B6HA 1FTLA 3IL1B 3ZKLA 3CVGA 4G4PA 1Z7NE 4AS5A 5EQ7A 1GVCA 4MEVA 1US4A 1B5IA 1Y4CA 4RY1A 1JW1A 2Y5LA 3A3UA 2L5VA 3G3FA 1IITA 4H65A 2ESNA 3UA8A 3KBZA 3H6VA 3IB2A 4Q0CA
chains in the Genus database with same CATH topology
4RPNA 1P1WA 3QIMA 1DSNA 4OFOA 1LSTA 5AA3A 3SEUA 1SYIA 3CG3A 3PMVA 3V5AA 2O84X 1B2HA 5TU0A 4P0GA 3CR9A 3E3KA 4U4SA 3OENA 3LR1A 2NUVA 2Y7WA 2XXXA 5L8DA 2PBWA 3KSXA 1M5CA 5JTYA 1VFEA 1R1NA 3DELB 3O2AA 3F11A 4HW8A 2I58A 4JBZA 3MZ9A 5DTBA 4H8IA 3KOTA 4OENA 4LZ5A 1UTHA 2UVHA 2OCUA 1EH3A 5CI5A 1B3GA 2P1SA 2YPNA 3PU5A 1XHYA 3TODA 1TFAA 2H98A 1DPPA 4BLAA 3E9XA 4LP2B 2REJA 4YZZA 2DE4A 4QSDA 2PVUA 4EQ7A 2OJTA 4YICA 3FASA 5CC2A 3C59A 2WKYA 1MY1A 4G68A 2ONKE 1FQEA 3MC2A 5JTYB 4KCDA 4DDDA 2DQVA 2Z8EA 2O1LA 3T9UA 4C1TA 1FTMA 2RC8A 3TQLA 5IAIA 1VE4A 3OELA 3H3GA 3SETA 4IO5A 4LZ8A 5I2NB 4ZZEA 3SDFA 4K3FA 5II0A 4EUOA 2QPQA 2Q2AA 4DZ1A 4QFPA 1N3WA 5AA2A 2AYSA 1BTJA 2XX9A 1ELJA 2DE3A 1BKAA 4I1DA 2ANJA 4F19A 2OWSA 4DCXA 1B40A 3CSGA 3IAZA 4BDNA 3PMWA 1A7LA 4IO7A 1JEVA 3HHFA 3FXQA 1QKBA 3FUZA 4U22A 1DTZA 4DCYA 4R2BA 3TCFA 4FEBA 1H43A 1UIUA 2OLBA 3K6XA 1I6AA 2I4BA 2IA4A 3N7PA 3FXUA 3FJGA 4FAJA 1QKAA 5EYFA 4OESA 1NNTA 3RN8A 5H8QA 1LCFA 1D9VA 4ESXA 1N0TA 1S50A 4ZDMA 5HPQA 4RK2A 4NF5A 2H4IA 3H6WA 4YAHX 3R7XA 2QMXA 2IEEA 3A09A 1N04A 3EHTA 1B9JA 1OQHA 4MLVA 4QFKA 1IZ1A 1NH7A 4PETA 4F1VA 2OZZA 4F3GA 4GWOA 2VGQA 2XXYA 3MVYA 1Q1KA 2F35A 5CBRA 3OSRA 4R73A 4FECA 2ONSA 4XKPA 4ZE9A 4OYVA 4JWXA 3FIRA 2QS1A 3U72A 2OBGA 5H8QB 4LVQA 4BDLA 4KFQA 4GLIA 1XS5A 1Y20A 2VP1A 3H03A 3RTWB 5DEXA 2QKHA 4OFLA 4NF5B 1ZMGA 4QHQA 3G3GA 4JWOA 4F39A 1MQGA 3PPOA 5LOMA 2DXRA 2UVGA 3MVWA 3ZSFA 1UQWA 3THIA 2FA7A 4OMBA 1OLCA 1AOVA 1POTA 5ELVA 4HCWA 3MAMA 2AIXA 4I8CA 2RINA 4NF4A 3S2VA 4YKJA 1ZIUA 3MUQA 3SESA 4N6PA 1NNKA 2JNCA 2P2AA 3K4UA 4BDQA 4LATA 3EQ1A 4ZGMA 5AA4A 1JQFA 5DYHA 1ZKBA 5KDTA 2X26A 3W9WA 1NKXA 5DEXB 4F31B 1Y1MA 1MXVA 3IJXB 3IOTA 2O51A 4TLMB 2XHDA 3LUYA 1B7HA 3L6GA 2VOZA 2QS3A 1LAXA 2KLFA 4RJZA 1ZU0A 2HCAA 3T93B 4ZECA 1MPCA 3TELA 2V84A 2Q8JA 2O69A 4NF4B 4G8HA 3IORA 3K1PA 2ABHA 1ATGA 4FATA 4YMBA 1OMPA 3HV1A 4KYEA 4GXSB 1NMUA 4FJPA 4PQJA 4X9TA 4OQOA 1JETA 1YCJA 3GBAA 1AH5A 3V83A 4U1OA 5KDTB 4KI0E 1OQGA 4HS7A 1FW0A 2UYEA 4G8NA 2I0BA 2L27A 3KOSA 2F34A 3C9HA 2JODA 2F97A 1T0KA 4Q30B 1LFIA 1IXIA 2E0SA 3AXFA 3FVOA 4YB5A 1AIVA 4AB6A 3MVZA 3M3KA 3SEYA 2I4CA 3RLFE 4R6HA 3O6IA 3FVGA 2BJJX 1B7UA 3FGSA 1MH3A 2ZMBA 1FCKA 4F22A 4KYDA 1MRPA 4EXKA 2F6PA 3CIJA 1FQDA 3OEKA 3CI8A 1SW1A 3KN7A 2HAVA 4Q8RA 2R9JA 2HEUA 3IOVA 3FVNA 5CBSA 3IB1A 2RCBA 3QUFA 2QS2A 2QL3A 3TYHA 3VLWA 3T66A 1N7XA 1TT1A 3GLBA 3PD8A 3VVDA 1US5A 1A54A 3MJNA 3TMGA 4WEDA 5I58A 2VD2A 1Y3QA 1LAGE 4DLOA 1MS7A 4H0WA 3GZGA 2NXOA 3MW0A 4ZZAA 3BKIB 4FIMA 4R9GA 3B6QA 2O6AA 3G3JA 2B65A 3G3KA 1QUJA 1N7WA 4F3SA 2CZLA 4R9FA 3KGCA 1SVXB 3W15C 1NL5A 1USYH 3K6WA 4ELRA 1PB7A 5FTIA 5M2VA 1NNFA 3S9LC 4JXIA 3C35A 4F1YA 1II5A 3U1OA 3EF7A 3DP4A 2F8DA 1MQJA 5CMCA 3OSQA 4THIA 3CRBA 4GXAA 3IK6B 3WAFA 4EQ9A 2VHAA 5I58B 4X1BA 1Y4TA 5HBCA 2HXWA 4Z0IA 3N7RA 2DWAA 3V89B 4ONYA 5K2YA 4TQUQ 1JW5A 3PPQA 2Y7PA 4RA1A 3OXNA 4LA9A 3TQWA 3LC8A 4XXUA 3IOWA 4R6YA 5F1QA 1MQHA 1MY0A 2ZNUA 2I3WA 2PT2A 5I2NA 2OWTA 1PB8A 3HHGA 2XX8A 1MPBA 1BLFA 3IR1A 4IO6A 2QS4A 4YB7A 4O3BA 3W9VA 1MXWA 1SW2A 2H25A 4KCCA 3ECRA 2XXHA 5DVFA 3SERA 1QUIA 3QXMA 4HJ0A 1JVYA 4POXA 2A5TA 5DT6A 3KZGA 1LFHA 4GQOA 1H45A 1M5BA 1NH8A 2O7UA 4PFTA 4YB6A 3DM0A 2V25A 2REGA 1UTBA 3N7SA 4YMAA 4X1DA 1JW4A 4ELOA 4X48A 4GIZA 2H99A 1B3FA 3CFLA 1SQYA 2PX1A 1HSEA 1AMFA 3ILTB 3T96B 2NOOA 3M3FA 1B58A 3A3CA 3K01A 5FHOA 3HN0A 3T22A 1RYOA 3UP9A 3TZAA 4F3PA 3K0VA 1LB9A 4H67A 2I6EA 3RPWA 2R71A 2DE2A 4NF6A 1B52A 2D5WA 2A5TB 2FNCA 5ITOA 1L5TA 3ODBA 3VVEA 1PDAA 1OIBA 4WXJA 1UTBB 1WODA 4F18A 2GHBA 1MG1A 3TTRA 3TAJA 4N13A 1M5DA 1LLSA 1MY4A 1QVSA 1OVBA 4IY5A 3E13X 1Y3PA 3U93A 2X7PA 1SI1A 2F7CA 5L9MA 4F3BA 4BDMA 1JVXA 3C36A 4NMYA 4LUBA 3TTNA 3K1NA 2OK2A 2ALUA 3RGYA 3BBRA 3WAEA 3LSWA 5L9OA 2DVCA 4NF6B 3GBBA 4IGTA 1B4ZA 4OEUA 4E0XA 4PFWA 5TP9B 3K00A 1JEUA 3S9EA 5EHSA 1LGBC 4EXLA 1IUDA 3U8QA 4H8JA 3K02A 3CFXA 4YKIA 3VLUA 2V3TA 3UGWA 4NEDA 1Y9UA 4Z7EA 1ANFA 1UIVA 4MF3A 1MDQA 3L6HA 2XD3A 3MPLA 4KYSA 1MM6A 1RYXA 5JK4A 2DWHA 2UYFA 3C34A 4QFNA 2DVZA 4H1XA 4FORA 1R6ZA 3H06B 3FD3A 4U2RA 3JV9A 4GL0A 4NWDA 3OO8A 5FHNA 4NE4A 2HAUA 4G8MA 1CE2A 1URGA 4O3AA 3EN3A 4I62A 4YU0A 1BP5A 1ZBMA 4MFIA 3Q28A 3ZKKA 2X7QA 3KN3A 3QSLA 4JSDA 3IOUA 1MY3A 3QAXA 5CMBA 4JWYA 3O28A 5AE4A 4C0RA 1B0LA 3TPAA 3CG1A 1B4HA 3AQFB 2PMSA 4Q5TA 1H3DA 3OO7A 1PB9A 4OETA 3TUSA 4OEVA 2Z8DA 1MQIA 4EDPA 4M4GA 2XXWA 5AA2D 2F36A 4ND9A 1QUKA 3MWBA 1MH4A 4PP0A 5H8NA 4JSOA 5B70A 1DTGA 3OOAA 3PUYE 1VR5A 1A8EA 4OFJA 1EZOA 2R6GE 3KJTA 4PE5B 2UVJA 4POWA 4G68C 4DLDA 4QSEA 3TTKA 2THIA 2DXYA 3C5TA 5ISUA 4JB7A 5DVJA 3PV0E 3CSBA 3TTMA 3BFTA 3D4CA 3IJOB 3LSXA 1I6BA 2ZYNA 3O97A 3TTLA 1S9TA 1R9LA 4QFLA 3VXCA 1HSJA 3JZJA 4GL8A 3IO6A 3ONMA 4RK9A 3N6TA 2ZNTA 3FV1A 4QF9A 3O9PA 1PBQA 1PEBA 5H8NB 2XXQA 1EZ9A 1U34A 2I48A 4ISUA 4KR5A 2Q2CA 1MXXA 4MBPA 3MZ1A 1GR2A 1D4NA 2V93A 4MH5A 5I57B 5I2KA 1B51A 4NTLA 1IXHA 4OERA 1YTVA 3IB0A 4E0WA 4DLQA 4RXLA 1QULA 2NWJA 1A8FA 1N76A 3OO6A 5L9SA 2O68A 5HM4B 3N26A 2UVIA 3G3IA 5F7VA 3IOLA 2XXPA 1DPEA 4G77A 2DP8A 2M8CA 3SEXA 4AB5A 4LQ2A 2F7AA 2XXIA 4ERSA 5AA1A 2ZYMA 3N6UA 4IB2A 4I9DA 4HCYA 4XKRA 5I84A 4AQ4A 2DOJA 1IXGA 3H6UA 3O29A 4NWCA 4QFOA 5FTHA 5I2KB 3PUXE 4DXBA 4MLQA 2CMOA 2F78A 5IKBA 2XXUA 4EQBA 4QRZA 1DOTA 2HZKA 1IXCA 2F7BA 2UXAA 1TWYA 3Q27A 3EHUA 4ELQA 2DWJA 3C33A 1WDNA 4BDRA 3K1MA 2W7YA 4IY6A 4YKPA 3U92A 4RNSA 3T9HB 3T9VA 1TXFA 2HFBA 1LB8A 3N5LA 3HPIA 3FV2A 3FZVA 3PUVE 3VE1B 1URDA 1AL3A 3OO9A 3VDFA 4BDOA 2ZYKA 3Q25A 4U21A 2XXTA 5J1DA 3B6WA 4ZEBA 4KHZE 3S9NC 3Q26A 4EF2A 2H9BA 4N07A 5H8SA 2Y7RA 3R6UA 4IO2A 2I0CA 2P0SA 3H6TA 3MZBA 4IO3A 4PFYA 1Y1ZA 1I6QA 3H7MA 2NVUB 4UA8A 2Q89A 2ONRA 1B1XA 1A40A 1SW5A 3O6GA 1FQCA 4EF1A 5CRYA 1B5JA 3UK4A 1SYHA 1N3XA 2Y7IA 3RY3A 1LBCA 4ECFA 1GV8A 4DXUA 3DP6A 4GVOA 3UN6A 2PYYA 1CB6A 1P1NA 1N84A 4XKQA 4P11A 3GXAA 1H76A 1VSOA 1Y3NA 2Y84A 1MY2A 1NNPA 3O6HA 1YPNA 2G93A 2HQ0A 3H4ZA 3PPPA 2ZYOA 3C4MA 1B5HA 2XDGA 4DIGA 4UACA 3L2JA 4XKNA 4F29A 4IGRA 1LBBA 2XXRA 5CMMA 2I49A 5CM6A 3DLNA 3FJ7A 3ILUB 4R74A 3TKDA 1ZTYA 4IO4A 5A5XA 4YKKA 5JEIA 5H8HA 2ZNSA 1I69A 1M5EA 2RC7A 1F9BA 2RC9A 3EPEA 3SEVA 1UTHB 1GGGA 2RF1A 3QYTA 4GRKA 4GOTA 4ZEKA 4HTGA 5KZTA 1D3KA 1R9QA 1QJMA 1VFDA 1SD3A 1XVXA 3D4GA 3MVXA 4OWDA 2XD2A 2YJPA 3LBSA 4L17A 5TP9A 4U23A 1XC1A 3TCHA 2AL5A 1NFTA 3M8UA 1PBPA 3TFLA 1POY1 4G68B 1XT8A 4OZ9A 2PT1A 1SBPA 1Q35A 5A5XB 1IQ7A 3K6VA 2QJEA 1EU8A 4M1VA 5H8HB 4OTEA 1GTKA 3OEMA 5I56A 2D3IA 5H8FA 2VD3A 5DVIA 3FATA 3PPRA 1FQAA 1FQFA 2YLNA 3S4UA 5CMKA 4ZEDA 4R75A 1H44A 2V3QA 3U94A 3VV5A 3JYRA 5AA2B 3MP8A 1P1UA 1A55A 5I59A 3C31A 3LSLA 2XX7A 1B3EA 2GRVA 4DXCA 3ZS6A 4P0IA 1ZLQA 3QK6A 1LAFE 2AL4A 4PFUA 4H5GA 1MXZA 4WEPA 3RUMA 5KCJA 1O63A 4LF3C 2H5YA 2V3UA 4LQ5A 4OXVA 1LFGA 5I56B 2JNDA 1P1QA 1KWHA 3K6UA 5H8FB 4XTCQ 3MQ9A 1SI0A 3UIFA 1FTJA 4F2QA 1P99A 3VXBA 3HO7A 4O3CA 1SDXA 1USYE 5I59B 4JDFA 1ZJLA 4H5FA 4RYAA 2ZXTA 1FTOA 4TLLB 1FQBA 4LONB 3G3HA 1RKMA 3I6VA 3KBRA 3K2DA 3LSFB 3USDA 3P7IA 3BFUA 3VLVA 1Z7ME 3TEPA 1MM7A 4NF8A 5KCJB 1B05A 3SKPA 3KEIA 3RQTA 4FEDA 3RT6B 4ESWA 2RKMA 4GFRA 4TOZA 4ZEIA 5K2XA 5B7DA 2DSFA 1MXUA 2GFEA 3PGFA 3KSJA 4OVJA 2F5XA 1YAEA 2Z23A 2B3FA 2Z22A 4F1UA 3EHSA 1JNFA 2HZLA 1B46A 1M5FA 4QSCA 1LAHE 2GHAA 3N94A 4ELPA 3O66A 1S7YA 2Z8FA 3UORA 5I57A 1J1NA 3E4RA 3TDJA 2D21A 4NF8B 4DE8A 4WKMA 3RT8A 2DS9A 1B3LA 3HSTA 5ITPA 3B7DA 1DMBA 3I3VA 2Y7KA 1EZPA 2B3BA 2LAOA 4KD5A 3MP1A 5TPAA 3FXRA 1IEJA 1PC3A 1B3HA 2E1SA 1B32A 4G2ZA 1BIYA 1OLAA 3PD9A 3VVFA 3OMBA 3VFJA 4U4XA 4FE8A 2QRYA 1MQDA 3MPKA 1O7TA 2QSXA 5AA4B 5ICTA 3MP6A 3RTFB 3MBPA 4LZ7A 1B7ZA 4GF8A 3M3LA 3TCGA 5EHMA 2DYXA 1XVYA 3PUZE 4ZEFA 3CFZA 4RPOA 2GH9A 2G29A 2FYIA 4R72A 5TPAB 3FJMA 3Q29A 3V8XB 3C32A 4ZE8A 3R26A 1MPDA 5ICQA 2DWIA 3S9MC 3G7WA 3PPNA 1D9YA 1QW0A 3RNNA 2RCAA 4R6KA 1TFDA 1MDP1 3HCQA 3OD7A 3KJ7A 3T9XB 3IX1A 3DP8A 2I3VA 3PUWE 3FVKA 4U1ZA 1OVTA 3SEWA 4OHNA 4XIGQ 1O64A 2XXVA 2QMWA 1XOCA 4R2FA 4C1UA 1B1HA 2O7IA 3KN8A 2Q9TA 4F2OA 4GD5A 5BUUA 1LCTA 1IIWA 1MXYA 4KPTA 3QUJA 2F6GA 1HSLA 2O1MA 3B6TA 4ZS9A 5BWJA 1P1OA 1WVJA 1URSA 3KG2A 3KFMA 1A99A 1FTKA 3IO4A 2Q88A 3PMXA 4H6DA 3I5OA 1B0HA 5FHMA 1SW4A 4KQPA 2A5SA 1B6HA 1FTLA 3IL1B 3ZKLA 3CVGA 4G4PA 1Z7NE 1GVCA 1US4A 1B5IA 1Y4CA 4RY1A 1JW1A 3A3UA 3G3FA 1IITA 4H65A 2ESNA 3UA8A 3H6VA 3IB2A 4Q0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPN A;  1P1W A;  3QIM A;  1DSN A;  4OFO A;  1LST A;  5AA3 A;  3SEU A;  1SYI A;  3CG3 A;  3PMV A;  3V5A A;  2O84 X;  1B2H A;  5TU0 A;  4P0G A;  3CR9 A;  3E3K A;  4U4S A;  3OEN A;  3LR1 A;  2NUV A;  2Y7W A;  2XXX A;  5L8D A;  2PBW A;  3KSX A;  1M5C A;  5JTY A;  1VFE A;  1R1N A;  3DEL B;  3O2A A;  3F11 A;  4HW8 A;  2I58 A;  4JBZ A;  3MZ9 A;  5DTB A;  4H8I A;  3KOT A;  4OEN A;  4LZ5 A;  1UTH A;  2UVH A;  2OCU A;  1EH3 A;  5CI5 A;  1B3G A;  2P1S A;  2YPN A;  3PU5 A;  1XHY A;  3TOD A;  1TFA A;  2H98 A;  1DPP A;  4BLA A;  3E9X A;  4LP2 B;  2REJ A;  4YZZ A;  2DE4 A;  4QSD A;  2PVU A;  4EQ7 A;  2OJT A;  4YIC A;  3FAS A;  5CC2 A;  3C59 A;  2WKY A;  1MY1 A;  4G68 A;  2ONK E;  1FQE A;  3MC2 A;  5JTY B;  4KCD A;  4DDD A;  2DQV A;  2Z8E A;  2O1L A;  3T9U A;  4C1T A;  1FTM A;  2RC8 A;  3TQL A;  5IAI A;  1VE4 A;  3OEL A;  3H3G A;  3SET A;  4IO5 A;  4LZ8 A;  5I2N B;  4ZZE A;  3SDF A;  4K3F A;  5II0 A;  4EUO A;  2QPQ A;  2Q2A A;  4DZ1 A;  4QFP A;  1N3W A;  5AA2 A;  2AYS A;  1BTJ A;  2XX9 A;  1ELJ A;  2DE3 A;  1BKA A;  4I1D A;  2ANJ A;  4F19 A;  2OWS A;  4DCX A;  1B40 A;  3CSG A;  3IAZ A;  4BDN A;  3PMW A;  1A7L A;  4IO7 A;  1JEV A;  3HHF A;  3FXQ A;  1QKB A;  3FUZ A;  4U22 A;  1DTZ A;  4DCY A;  4R2B A;  3TCF A;  4FEB A;  1H43 A;  1UIU A;  2OLB A;  3K6X A;  1I6A A;  2I4B A;  2IA4 A;  3N7P A;  3FXU A;  3FJG A;  4FAJ A;  1QKA A;  5EYF A;  4OES A;  1NNT A;  3RN8 A;  5H8Q A;  1LCF A;  1D9V A;  4ESX A;  1N0T A;  1S50 A;  4ZDM A;  5HPQ A;  4RK2 A;  4NF5 A;  2H4I A;  3H6W A;  4YAH X;  3R7X A;  2QMX A;  2IEE A;  3A09 A;  1N04 A;  3EHT A;  1B9J A;  1OQH A;  4MLV A;  4QFK A;  1IZ1 A;  1NH7 A;  4PET A;  4F1V A;  2OZZ A;  4F3G A;  4GWO A;  2VGQ A;  2XXY A;  3MVY A;  1Q1K A;  2F35 A;  5CBR A;  3OSR A;  4R73 A;  4FEC A;  2ONS A;  4XKP A;  4ZE9 A;  4OYV A;  4JWX A;  3FIR A;  2QS1 A;  3U72 A;  2OBG A;  5H8Q B;  4LVQ A;  4BDL A;  4KFQ A;  4GLI A;  1XS5 A;  1Y20 A;  2VP1 A;  3H03 A;  3RTW B;  5DEX A;  2QKH A;  4OFL A;  4NF5 B;  1ZMG A;  4QHQ A;  3G3G A;  4JWO A;  4F39 A;  1MQG A;  3PPO A;  5LOM A;  2DXR A;  2UVG A;  3MVW A;  3ZSF A;  1UQW A;  3THI A;  2FA7 A;  4OMB A;  1OLC A;  1AOV A;  1POT A;  5ELV A;  4HCW A;  3MAM A;  2AIX A;  4I8C A;  2RIN A;  4NF4 A;  3S2V A;  4YKJ A;  1ZIU A;  3MUQ A;  3SES A;  4N6P A;  1NNK A;  2JNC A;  2P2A A;  3K4U A;  4BDQ A;  4LAT A;  3EQ1 A;  4ZGM A;  5AA4 A;  1JQF A;  5DYH A;  1ZKB A;  5KDT A;  2X26 A;  3W9W A;  1NKX A;  5DEX B;  4F31 B;  1Y1M A;  1MXV A;  3IJX B;  3IOT A;  2O51 A;  4TLM B;  2XHD A;  3LUY A;  1B7H A;  3L6G A;  2VOZ A;  2QS3 A;  1LAX A;  2KLF A;  4RJZ A;  1ZU0 A;  2HCA A;  3T93 B;  4ZEC A;  1MPC A;  3TEL A;  2V84 A;  2Q8J A;  2O69 A;  4NF4 B;  4G8H A;  3IOR A;  3K1P A;  2ABH A;  1ATG A;  4FAT A;  4YMB A;  1OMP A;  3HV1 A;  4KYE A;  4GXS B;  1NMU A;  4FJP A;  4PQJ A;  4X9T A;  4OQO A;  1JET A;  1YCJ A;  3GBA A;  1AH5 A;  3V83 A;  4U1O A;  5KDT B;  4KI0 E;  1OQG A;  4HS7 A;  1FW0 A;  2UYE A;  4G8N A;  2I0B A;  2L27 A;  3KOS A;  2F34 A;  3C9H A;  2JOD A;  2F97 A;  1T0K A;  4Q30 B;  1LFI A;  1IXI A;  2E0S A;  3AXF A;  3FVO A;  4YB5 A;  1AIV A;  4AB6 A;  3MVZ A;  3M3K A;  3SEY A;  2I4C A;  3RLF E;  4R6H A;  3O6I A;  3FVG A;  2BJJ X;  1B7U A;  3FGS A;  1MH3 A;  2ZMB A;  1FCK A;  4F22 A;  4KYD A;  1MRP A;  4EXK A;  2F6P A;  3CIJ A;  1FQD A;  3OEK A;  3CI8 A;  1SW1 A;  3KN7 A;  2HAV A;  4Q8R A;  2R9J A;  2HEU A;  3IOV A;  3FVN A;  5CBS A;  3IB1 A;  2RCB A;  3QUF A;  2QS2 A;  2QL3 A;  3TYH A;  3VLW A;  3T66 A;  1N7X A;  1TT1 A;  3GLB A;  3PD8 A;  3VVD A;  1US5 A;  1A54 A;  3MJN A;  3TMG A;  4WED A;  5I58 A;  2VD2 A;  1Y3Q A;  1LAG E;  4DLO A;  1MS7 A;  4H0W A;  3GZG A;  2NXO A;  3MW0 A;  4ZZA A;  3BKI B;  4FIM A;  4R9G A;  3B6Q A;  2O6A A;  3G3J A;  2B65 A;  3G3K A;  1QUJ A;  1N7W A;  4F3S A;  2CZL A;  4R9F A;  3KGC A;  1SVX B;  3W15 C;  1NL5 A;  1USY H;  3K6W A;  4ELR A;  1PB7 A;  5FTI A;  5M2V A;  1NNF A;  3S9L C;  4JXI A;  3C35 A;  4F1Y A;  1II5 A;  3U1O A;  3EF7 A;  3DP4 A;  2F8D A;  1MQJ A;  5CMC A;  3OSQ A;  4THI A;  3CRB A;  4GXA A;  3IK6 B;  3WAF A;  4EQ9 A;  2VHA A;  5I58 B;  4X1B A;  1Y4T A;  5HBC A;  2HXW A;  4Z0I A;  3N7R A;  2DWA A;  3V89 B;  4ONY A;  5K2Y A;  4TQU Q;  1JW5 A;  3PPQ A;  2Y7P A;  4RA1 A;  3OXN A;  4LA9 A;  3TQW A;  3LC8 A;  4XXU A;  3IOW A;  4R6Y A;  5F1Q A;  1MQH A;  1MY0 A;  2ZNU A;  2I3W A;  2PT2 A;  5I2N A;  2OWT A;  1PB8 A;  3HHG A;  2XX8 A;  1MPB A;  1BLF A;  3IR1 A;  4IO6 A;  2QS4 A;  4YB7 A;  4O3B A;  3W9V A;  1MXW A;  1SW2 A;  2H25 A;  4KCC A;  3ECR A;  2XXH A;  5DVF A;  3SER A;  1QUI A;  3QXM A;  4HJ0 A;  1JVY A;  4POX A;  2A5T A;  5DT6 A;  3KZG A;  1LFH A;  4GQO A;  1H45 A;  1M5B A;  1NH8 A;  2O7U A;  4PFT A;  4YB6 A;  3DM0 A;  2V25 A;  2REG A;  1UTB A;  3N7S A;  4YMA A;  4X1D A;  1JW4 A;  4ELO A;  4X48 A;  4GIZ A;  2H99 A;  1B3F A;  3CFL A;  1SQY A;  2PX1 A;  1HSE A;  1AMF A;  3ILT B;  3T96 B;  2NOO A;  3M3F A;  1B58 A;  3A3C A;  3K01 A;  5FHO A;  3HN0 A;  3T22 A;  1RYO A;  3UP9 A;  3TZA A;  4F3P A;  3K0V A;  1LB9 A;  4H67 A;  2I6E A;  3RPW A;  2R71 A;  2DE2 A;  4NF6 A;  1B52 A;  2D5W A;  2A5T B;  2FNC A;  5ITO A;  1L5T A;  3ODB A;  3VVE A;  1PDA A;  1OIB A;  4WXJ A;  1UTB B;  1WOD A;  4F18 A;  2GHB A;  1MG1 A;  3TTR A;  3TAJ A;  4N13 A;  1M5D A;  1LLS A;  1MY4 A;  1QVS A;  1OVB A;  4IY5 A;  3E13 X;  1Y3P A;  3U93 A;  2X7P A;  1SI1 A;  2F7C A;  5L9M A;  4F3B A;  4BDM A;  1JVX A;  3C36 A;  4NMY A;  4LUB A;  3TTN A;  3K1N A;  2OK2 A;  2ALU A;  3RGY A;  3BBR A;  3WAE A;  3LSW A;  5L9O A;  2DVC A;  4NF6 B;  3GBB A;  4IGT A;  1B4Z A;  4OEU A;  4E0X A;  4PFW A;  5TP9 B;  3K00 A;  1JEU A;  3S9E A;  5EHS A;  1LGB C;  4EXL A;  1IUD A;  3U8Q A;  4H8J A;  3K02 A;  3CFX A;  4YKI A;  3VLU A;  2V3T A;  3UGW A;  4NED A;  1Y9U A;  4Z7E A;  1ANF A;  1UIV A;  4MF3 A;  1MDQ A;  3L6H A;  2XD3 A;  3MPL A;  4KYS A;  1MM6 A;  1RYX A;  5JK4 A;  2DWH A;  2UYF A;  3C34 A;  4QFN A;  2DVZ A;  4H1X A;  4FOR A;  1R6Z A;  3H06 B;  3FD3 A;  4U2R A;  3JV9 A;  4GL0 A;  4NWD A;  3OO8 A;  5FHN A;  4NE4 A;  2HAU A;  4G8M A;  1CE2 A;  1URG A;  4O3A A;  3EN3 A;  4I62 A;  4YU0 A;  1BP5 A;  1ZBM A;  4MFI A;  3Q28 A;  3ZKK A;  2X7Q A;  3KN3 A;  3QSL A;  4JSD A;  3IOU A;  1MY3 A;  3QAX A;  5CMB A;  4JWY A;  3O28 A;  5AE4 A;  4C0R A;  1B0L A;  3TPA A;  3CG1 A;  1B4H A;  3AQF B;  2PMS A;  4Q5T A;  1H3D A;  3OO7 A;  1PB9 A;  4OET A;  3TUS A;  4OEV A;  2Z8D A;  1MQI A;  4EDP A;  4M4G A;  2XXW A;  5AA2 D;  2F36 A;  4ND9 A;  1QUK A;  3MWB A;  1MH4 A;  4PP0 A;  5H8N A;  4JSO A;  5B70 A;  1DTG A;  3OOA A;  3PUY E;  1VR5 A;  1A8E A;  4OFJ A;  1EZO A;  2R6G E;  3KJT A;  4PE5 B;  2UVJ A;  4POW A;  4G68 C;  4DLD A;  4QSE A;  3TTK A;  2THI A;  2DXY A;  3C5T A;  5ISU A;  4JB7 A;  5DVJ A;  3PV0 E;  3CSB A;  3TTM A;  3BFT A;  3D4C A;  3IJO B;  3LSX A;  1I6B A;  2ZYN A;  3O97 A;  3TTL A;  1S9T A;  1R9L A;  4QFL A;  3VXC A;  1HSJ A;  3JZJ A;  4GL8 A;  3IO6 A;  3ONM A;  4RK9 A;  3N6T A;  2ZNT A;  3FV1 A;  4QF9 A;  3O9P A;  1PBQ A;  1PEB A;  5H8N B;  2XXQ A;  1EZ9 A;  1U34 A;  2I48 A;  4ISU A;  4KR5 A;  2Q2C A;  1MXX A;  4MBP A;  3MZ1 A;  1GR2 A;  1D4N A;  2V93 A;  4MH5 A;  5I57 B;  5I2K A;  1B51 A;  4NTL A;  1IXH A;  4OER A;  1YTV A;  3IB0 A;  4E0W A;  4DLQ A;  4RXL A;  1QUL A;  2NWJ A;  1A8F A;  1N76 A;  3OO6 A;  5L9S A;  2O68 A;  5HM4 B;  3N26 A;  2UVI A;  3G3I A;  5F7V A;  3IOL A;  2XXP A;  1DPE A;  4G77 A;  2DP8 A;  2M8C A;  3SEX A;  4AB5 A;  4LQ2 A;  2F7A A;  2XXI A;  4ERS A;  5AA1 A;  2ZYM A;  3N6U A;  4IB2 A;  4I9D A;  4HCY A;  4XKR A;  5I84 A;  4AQ4 A;  2DOJ A;  1IXG A;  3H6U A;  3O29 A;  4NWC A;  4QFO A;  5FTH A;  5I2K B;  3PUX E;  4DXB A;  4MLQ A;  2CMO A;  2F78 A;  5IKB A;  2XXU A;  4EQB A;  4QRZ A;  1DOT A;  2HZK A;  1IXC A;  2F7B A;  2UXA A;  1TWY A;  3Q27 A;  3EHU A;  4ELQ A;  2DWJ A;  3C33 A;  1WDN A;  4BDR A;  3K1M A;  2W7Y A;  4IY6 A;  4YKP A;  3U92 A;  4RNS A;  3T9H B;  3T9V A;  1TXF A;  2HFB A;  1LB8 A;  3N5L A;  3HPI A;  3FV2 A;  3FZV A;  3PUV E;  3VE1 B;  1URD A;  1AL3 A;  3OO9 A;  3VDF A;  4BDO A;  2ZYK A;  3Q25 A;  4U21 A;  2XXT A;  5J1D A;  3B6W A;  4ZEB A;  4KHZ E;  3S9N C;  3Q26 A;  4EF2 A;  2H9B A;  4N07 A;  5H8S A;  2Y7R A;  3R6U A;  4IO2 A;  2I0C A;  2P0S A;  3H6T A;  3MZB A;  4IO3 A;  4PFY A;  1Y1Z A;  1I6Q A;  3H7M A;  2NVU B;  4UA8 A;  2Q89 A;  2ONR A;  1B1X A;  1A40 A;  1SW5 A;  3O6G A;  1FQC A;  4EF1 A;  5CRY A;  1B5J A;  3UK4 A;  1SYH A;  1N3X A;  2Y7I A;  3RY3 A;  1LBC A;  4ECF A;  1GV8 A;  4DXU A;  3DP6 A;  4GVO A;  3UN6 A;  2PYY A;  1CB6 A;  1P1N A;  1N84 A;  4XKQ A;  4P11 A;  3GXA A;  1H76 A;  1VSO A;  1Y3N A;  2Y84 A;  1MY2 A;  1NNP A;  3O6H A;  1YPN A;  2G93 A;  2HQ0 A;  3H4Z A;  3PPP A;  2ZYO A;  3C4M A;  1B5H A;  2XDG A;  4DIG A;  4UAC A;  3L2J A;  4XKN A;  4F29 A;  4IGR A;  1LBB A;  2XXR A;  5CMM A;  2I49 A;  5CM6 A;  3DLN A;  3FJ7 A;  3ILU B;  4R74 A;  3TKD A;  1ZTY A;  4IO4 A;  5A5X A;  4YKK A;  5JEI A;  5H8H A;  2ZNS A;  1I69 A;  1M5E A;  2RC7 A;  1F9B A;  2RC9 A;  3EPE A;  3SEV A;  1UTH B;  1GGG A;  2RF1 A;  3QYT A;  4GRK A;  4GOT A;  4ZEK A;  4HTG A;  5KZT A;  1D3K A;  1R9Q A;  1QJM A;  1VFD A;  1SD3 A;  1XVX A;  3D4G A;  3MVX A;  4OWD A;  2XD2 A;  2YJP A;  3LBS A;  4L17 A;  5TP9 A;  4U23 A;  1XC1 A;  3TCH A;  2AL5 A;  1NFT A;  3M8U A;  1PBP A;  3TFL A;  1POY 1;  4G68 B;  1XT8 A;  4OZ9 A;  2PT1 A;  1SBP A;  1Q35 A;  5A5X B;  1IQ7 A;  3K6V A;  2QJE A;  1EU8 A;  4M1V A;  5H8H B;  4OTE A;  1GTK A;  3OEM A;  5I56 A;  2D3I A;  5H8F A;  2VD3 A;  5DVI A;  3FAT A;  3PPR A;  1FQA A;  1FQF A;  2YLN A;  3S4U A;  5CMK A;  4ZED A;  4R75 A;  1H44 A;  2V3Q A;  3U94 A;  3VV5 A;  3JYR A;  5AA2 B;  3MP8 A;  1P1U A;  1A55 A;  5I59 A;  3C31 A;  3LSL A;  2XX7 A;  1B3E A;  2GRV A;  4DXC A;  3ZS6 A;  4P0I A;  1ZLQ A;  3QK6 A;  1LAF E;  2AL4 A;  4PFU A;  4H5G A;  1MXZ A;  4WEP A;  3RUM A;  5KCJ A;  1O63 A;  4LF3 C;  2H5Y A;  2V3U A;  4LQ5 A;  4OXV A;  1LFG A;  5I56 B;  2JND A;  1P1Q A;  1KWH A;  3K6U A;  5H8F B;  4XTC Q;  3MQ9 A;  1SI0 A;  3UIF A;  1FTJ A;  4F2Q A;  1P99 A;  3VXB A;  3HO7 A;  4O3C A;  1SDX A;  1USY E;  5I59 B;  4JDF A;  1ZJL A;  4H5F A;  4RYA A;  2ZXT A;  1FTO A;  4TLL B;  1FQB A;  4LON B;  3G3H A;  1RKM A;  3I6V A;  3KBR A;  3K2D A;  3LSF B;  3USD A;  3P7I A;  3BFU A;  3VLV A;  1Z7M E;  3TEP A;  1MM7 A;  4NF8 A;  5KCJ B;  1B05 A;  3SKP A;  3KEI A;  3RQT A;  4FED A;  3RT6 B;  4ESW A;  2RKM A;  4GFR A;  4TOZ A;  4ZEI A;  5K2X A;  5B7D A;  2DSF A;  1MXU A;  2GFE A;  3PGF A;  3KSJ A;  4OVJ A;  2F5X A;  1YAE A;  2Z23 A;  2B3F A;  2Z22 A;  4F1U A;  3EHS A;  1JNF A;  2HZL A;  1B46 A;  1M5F A;  4QSC A;  1LAH E;  2GHA A;  3N94 A;  4ELP A;  3O66 A;  1S7Y A;  2Z8F A;  3UOR A;  5I57 A;  1J1N A;  3E4R A;  3TDJ A;  2D21 A;  4NF8 B;  4DE8 A;  4WKM A;  3RT8 A;  2DS9 A;  1B3L A;  3HST A;  5ITP A;  3B7D A;  1DMB A;  3I3V A;  2Y7K A;  1EZP A;  2B3B A;  2LAO A;  4KD5 A;  3MP1 A;  5TPA A;  3FXR A;  1IEJ A;  1PC3 A;  1B3H A;  2E1S A;  1B32 A;  4G2Z A;  1BIY A;  1OLA A;  3PD9 A;  3VVF A;  3OMB A;  3VFJ A;  4U4X A;  4FE8 A;  2QRY A;  1MQD A;  3MPK A;  1O7T A;  2QSX A;  5AA4 B;  5ICT A;  3MP6 A;  3RTF B;  3MBP A;  4LZ7 A;  1B7Z A;  4GF8 A;  3M3L A;  3TCG A;  5EHM A;  2DYX A;  1XVY A;  3PUZ E;  4ZEF A;  3CFZ A;  4RPO A;  2GH9 A;  2G29 A;  2FYI A;  4R72 A;  5TPA B;  3FJM A;  3Q29 A;  3V8X B;  3C32 A;  4ZE8 A;  3R26 A;  1MPD A;  5ICQ A;  2DWI A;  3S9M C;  3G7W A;  3PPN A;  1D9Y A;  1QW0 A;  3RNN A;  2RCA A;  4R6K A;  1TFD A;  1MDP 1;  3HCQ A;  3OD7 A;  3KJ7 A;  3T9X B;  3IX1 A;  3DP8 A;  2I3V A;  3PUW E;  3FVK A;  4U1Z A;  1OVT A;  3SEW A;  4OHN A;  4XIG Q;  1O64 A;  2XXV A;  2QMW A;  1XOC A;  4R2F A;  4C1U A;  1B1H A;  2O7I A;  3KN8 A;  2Q9T A;  4F2O A;  4GD5 A;  5BUU A;  1LCT A;  1IIW A;  1MXY A;  4KPT A;  3QUJ A;  2F6G A;  1HSL A;  2O1M A;  3B6T A;  4ZS9 A;  5BWJ A;  1P1O A;  1WVJ A;  1URS A;  3KG2 A;  3KFM A;  1A99 A;  1FTK A;  3IO4 A;  2Q88 A;  3PMX A;  4H6D A;  3I5O A;  1B0H A;  5FHM A;  1SW4 A;  4KQP A;  2A5S A;  1B6H A;  1FTL A;  3IL1 B;  3ZKL A;  3CVG A;  4G4P A;  1Z7N E;  1GVC A;  1US4 A;  1B5I A;  1Y4C A;  4RY1 A;  1JW1 A;  3A3U A;  3G3F A;  1IIT A;  4H65 A;  2ESN A;  3UA8 A;  3H6V A;  3IB2 A;  4Q0C A; 
#chains in the Genus database with same CATH topology
 4RPN A;  1P1W A;  3QIM A;  4XEQ A;  5EQ8 A;  1DSN A;  4OFO A;  3ROJ A;  1LST A;  5AA3 A;  3SEU A;  1SYI A;  3CG3 A;  3PMV A;  3V5A A;  2O84 X;  1B2H A;  5TU0 A;  4P0G A;  3CR9 A;  4PDH A;  3E3K A;  4U4S A;  3OEN A;  3LR1 A;  2NUV A;  2Y7W A;  2XXX A;  5L8D A;  2PBW A;  1FBC A;  3KSX A;  1M5C A;  5JTY A;  3MST A;  1VFE A;  1R1N A;  3DEL B;  3O2A A;  3F11 A;  4MNI A;  2I58 A;  4JBZ A;  4HW8 A;  4DI3 D;  3MZ9 A;  5DTB A;  4H8I A;  3KOT A;  1LBY A;  4OEN A;  4LZ5 A;  1UTH A;  2UVH A;  2OCU A;  1EH3 A;  2XWI A;  4MNC A;  5CI5 A;  1IMC A;  1B3G A;  2P1S A;  1AWB A;  2YPN A;  4N91 A;  2CEX A;  3PU5 A;  1XHY A;  3LUZ A;  3TOD A;  1TFA A;  2H98 A;  1DPP A;  4BLA A;  3E9X A;  4LP2 B;  2REJ A;  4GWU A;  4YZZ A;  2DE4 A;  4QSD A;  2PVU A;  4EQ7 A;  2OJT A;  4YIC A;  3FAS A;  5CC2 A;  3C59 A;  2WKY A;  1MY1 A;  4G68 A;  2ONK E;  1FQE A;  3MC2 A;  5JTY B;  5IZZ A;  4KCD A;  4DDD A;  1KA0 A;  2DQV A;  3PTY A;  2PFY A;  2Z8E A;  2O1L A;  3E79 A;  3T9U A;  4PFB A;  4C1T A;  1FTM A;  1NUW A;  2RC8 A;  3BIH A;  4PBH A;  3TQL A;  5IAI A;  1VE4 A;  3OEL A;  2FBP A;  4GWX A;  3H3G A;  3SET A;  4IO5 A;  4LZ8 A;  5I2N B;  4ZZE A;  3SDF A;  3BIG A;  4K3F A;  4N81 A;  5II0 A;  4EUO A;  2QPQ A;  2Q2A A;  2B4L A;  4DZ1 A;  4QFP A;  1N3W A;  1EYK A;  2AYS A;  5AA2 A;  1BTJ A;  4N15 A;  2XX9 A;  1ELJ A;  1INP A;  2DE3 A;  1BKA A;  4I1D A;  2ANJ A;  4F19 A;  1QGX A;  2CZK A;  2OWS A;  4DCX A;  3ISP A;  1B40 A;  3CSG A;  3IAZ A;  4BDN A;  3PMW A;  1A7L A;  4IO7 A;  5EYG A;  1JEV A;  3HHF A;  3FXQ A;  1QKB A;  3FUZ A;  4XFE A;  4U22 A;  1DTZ A;  4DCY A;  4R2B A;  3TCF A;  4FEB A;  1H43 A;  1UIU A;  2OLB A;  3K6X A;  1I6A A;  2I4B A;  2IA4 A;  3N7P A;  4H46 A;  3FXU A;  1FPG A;  3FJG A;  4FAJ A;  1QKA A;  5EYF A;  4OES A;  1NNT A;  2XXK A;  3RN8 A;  5H8Q A;  1LCF A;  1D9V A;  4ESX A;  4O7M A;  1N0T A;  1S50 A;  4ZDM A;  5HPQ A;  4RK2 A;  4NF5 A;  2H4I A;  3H6W A;  4YAH X;  3R7X A;  2QMX A;  2IEE A;  3A09 A;  1N04 A;  3EHT A;  1B9J A;  1OQH A;  4MLV A;  1KZ8 A;  4QFK A;  1IZ1 A;  1NH7 A;  4PET A;  4F1V A;  2OZZ A;  4F3G A;  4GWO A;  2VGQ A;  3E78 A;  3T0J A;  2XXY A;  1LBZ A;  3MVY A;  1Q1K A;  2F35 A;  5CBR A;  3OSR A;  4R73 A;  4FEC A;  2ONS A;  4XKP A;  1LBV A;  4ZE9 A;  4OYV A;  4JWX A;  3FIR A;  2QS1 A;  3U72 A;  2OBG A;  2QFL A;  5H8Q B;  3A29 A;  4LVQ A;  4BDL A;  4KFQ A;  4GLI A;  1XS5 A;  1Y20 A;  2VP1 A;  3H03 A;  3RTW B;  5DEX A;  2QKH A;  4GWY A;  4OFL A;  4NF5 B;  1ZMG A;  4QHQ A;  3G3G A;  4JWO A;  4F39 A;  1MQG A;  3PPO A;  5LOM A;  2QVR A;  2DXR A;  2UVG A;  1FBG A;  1G0H A;  3MVW A;  1DK4 A;  3ZSF A;  1UQW A;  3THI A;  2FA7 A;  2WBD A;  4OMB A;  1OLC A;  1AOV A;  1POT A;  5ELV A;  4HCW A;  3MAM A;  2AIX A;  4I8C A;  2RIN A;  4PC9 A;  4NF4 A;  3S2V A;  4YKJ A;  1ZIU A;  3MUQ A;  3SES A;  4N6P A;  1NNK A;  2JNC A;  2P2A A;  3K4U A;  4BDQ A;  4LAT A;  3EQ1 A;  4ZGM A;  5AA4 A;  1JQF A;  5DYH A;  1ZKB A;  5KDT A;  2X26 A;  3W9W A;  1NKX A;  5DEX B;  4F31 B;  1Y1M A;  1MXV A;  4JVC A;  3IJX B;  3IOT A;  2O51 A;  4TLM B;  2XHD A;  3LUY A;  1B7H A;  3L6G A;  2VOZ A;  2QS3 A;  1LAX A;  2KLF A;  4RJZ A;  1ZU0 A;  2CEY A;  4UAB A;  5IGA A;  2HCA A;  3T93 B;  4ZEC A;  1YXI A;  1MPC A;  3TEL A;  2V84 A;  4NN3 A;  4NHB A;  1Q9D A;  3T1B A;  2Q8J A;  2Y5K A;  2O69 A;  4NF4 B;  4G8H A;  4OVP A;  4PCD A;  3IOR A;  3K1P A;  2ABH A;  1ATG A;  3HV1 A;  1OMP A;  4FAT A;  4YMB A;  4KYE A;  4GXS B;  1NMU A;  4FJP A;  4PQJ A;  4X9T A;  4OQO A;  1JET A;  1YCJ A;  3GBA A;  1AH5 A;  3V83 A;  5ESY A;  4U1O A;  5KDT B;  4KI0 E;  1OQG A;  4HS7 A;  1FW0 A;  2PCR A;  2UYE A;  4N4U A;  4X8R A;  4G8N A;  2I0B A;  4FBP A;  1VDW A;  2L27 A;  4P8B A;  5IZ3 A;  3KOS A;  2F34 A;  3C9H A;  2JOD A;  4PAI A;  2F97 A;  4DI4 B;  1T0K A;  4Q30 B;  1EYJ A;  2OX3 A;  1LFI A;  1IXI A;  2E0S A;  3AXF A;  3FVO A;  4YB5 A;  1FJ6 A;  1AIV A;  4AB6 A;  3MVZ A;  3M3K A;  1IME A;  3SEY A;  2I4C A;  3RLF E;  4R6H A;  3O6I A;  3FVG A;  1KA1 A;  2BJJ X;  1B7U A;  3FGS A;  1NV5 A;  1MH3 A;  2ZMB A;  1FCK A;  3RYD A;  4F22 A;  4KYD A;  1MRP A;  3NOH A;  4EXK A;  2F6P A;  3CIJ A;  1FQD A;  3OEK A;  2HPG A;  3CI8 A;  1D9Q A;  1SW1 A;  3KN7 A;  5I7I A;  2HAV A;  4Q8R A;  2VPN A;  2R9J A;  2HEU A;  2BJI A;  1JP4 A;  3IOV A;  2Q74 A;  3FVN A;  1NV6 A;  5CBS A;  3IB1 A;  2RCB A;  3QUF A;  2QS2 A;  2QL3 A;  3TYH A;  3VLW A;  3T66 A;  3HFU A;  1YYZ A;  1N7X A;  4GBV A;  1TT1 A;  1CNQ A;  3GLB A;  3PD8 A;  1LBX A;  3VVD A;  1US5 A;  1A54 A;  3MJN A;  3TMG A;  4WED A;  5I58 A;  2VD2 A;  1Y3Q A;  1LAG E;  4DLO A;  1MS7 A;  4H0W A;  3GZG A;  2NXO A;  3MW0 A;  4ZZA A;  3BKI B;  4FIM A;  4R9G A;  3B6Q A;  2O6A A;  3G3J A;  2B65 A;  3G3K A;  1QUJ A;  1N7W A;  2XWK A;  4F3S A;  2CZL A;  4R9F A;  4PAK A;  3KGC A;  1SVX B;  3W15 C;  1NL5 A;  3B50 A;  1USY H;  3K6W A;  4ELR A;  3KC0 A;  1PB7 A;  5FTI A;  5M2V A;  1NNF A;  3S9L C;  4JXI A;  3C35 A;  4F1Y A;  1II5 A;  3U1O A;  2QVV A;  3EF7 A;  3DP4 A;  2F8D A;  1MQJ A;  5CMC A;  3OSQ A;  4THI A;  3CRB A;  4GXA A;  3IK6 B;  3WAF A;  4EQ9 A;  4PGN A;  2VHA A;  5I58 B;  4AS4 A;  4X1B A;  4GX3 A;  1NI9 A;  1DCU A;  1Y4T A;  5HBC A;  2HXW A;  4Z0I A;  3N7R A;  2DWA A;  3V89 B;  4ONY A;  5K2Y A;  2QVU A;  4TQU Q;  1JW5 A;  3PPQ A;  2Y7P A;  4RA1 A;  2HXR A;  3OXN A;  4LA9 A;  3TQW A;  3LC8 A;  4XXU A;  3IOW A;  4R6Y A;  5F1Q A;  1MQH A;  1FBH A;  1MY0 A;  2ZNU A;  2I3W A;  5LDZ A;  2PT2 A;  5I2N A;  2OWT A;  1PB8 A;  3HHG A;  2XX8 A;  1MPB A;  1FBP A;  1BLF A;  3IR1 A;  4IO6 A;  2QS4 A;  4YB7 A;  4O3B A;  4NX1 A;  3W9V A;  1MXW A;  1SW2 A;  1NV3 A;  1G0I A;  2H25 A;  4KCC A;  3ECR A;  2XXH A;  5DVF A;  3SER A;  1QUI A;  3QXM A;  4HJ0 A;  1JVY A;  4POX A;  2A5T A;  5DT6 A;  3KZG A;  1LFH A;  4GQO A;  4JVD A;  1H45 A;  1M5B A;  1NH8 A;  2O7U A;  4PFT A;  4YB6 A;  1IMB A;  3DM0 A;  2V25 A;  2P3V A;  2REG A;  1UTB A;  3N7S A;  4YMA A;  4X1D A;  1JW4 A;  4ELO A;  4X48 A;  1FTA A;  4GIZ A;  2H99 A;  4OVQ A;  1B3F A;  3KC1 A;  3CFL A;  1SQY A;  2PX1 A;  1IMD A;  1HSE A;  4GBW A;  1AMF A;  3ILT B;  2DDK A;  3T96 B;  2NOO A;  4PDD A;  3M3F A;  1B58 A;  3A3C A;  3K01 A;  5FHO A;  3HN0 A;  3T22 A;  1RYO A;  3UP9 A;  3TZA A;  4F3P A;  3K0V A;  1LB9 A;  4H67 A;  2I6E A;  4QBA A;  3RPW A;  2R71 A;  4IR8 A;  2DE2 A;  4NF6 A;  1B52 A;  2D5W A;  2A5T B;  2FNC A;  5ITO A;  1L5T A;  3ODB A;  3VVE A;  1PDA A;  4MAG A;  1OIB A;  4I3E A;  4WXJ A;  1UTB B;  1WOD A;  4F18 A;  2GHB A;  1MG1 A;  3TTR A;  4XF5 A;  3TAJ A;  4N13 A;  1M5D A;  1LLS A;  1MY4 A;  1QVS A;  1OVB A;  4H45 A;  4IY5 A;  3E13 X;  1Y3P A;  3U93 A;  2X7P A;  1NUX A;  1SI1 A;  2F7C A;  5L9M A;  4F3B A;  5EYH A;  4BDM A;  1JVX A;  3C36 A;  4NMY A;  4LUB A;  3TTN A;  4PE3 A;  3IFC A;  3K1N A;  2OK2 A;  2ALU A;  3RGY A;  3BBR A;  3WAE A;  3LSW A;  5L9O A;  2DVC A;  4NF6 B;  3GBB A;  3FBP A;  4IGT A;  1B4Z A;  4OEU A;  4E0X A;  4PFW A;  5TP9 B;  3U65 A;  3K00 A;  1JEU A;  3S9E A;  5EHS A;  1LGB C;  4EXL A;  1IUD A;  3U8Q A;  4H8J A;  2P3N A;  3K02 A;  3CFX A;  4YKI A;  3VLU A;  2V3T A;  3UGW A;  4NED A;  1FBD A;  1Y9U A;  4Z7E A;  4MCO A;  1ANF A;  1UIV A;  4MF3 A;  1MDQ A;  3L6H A;  2XD3 A;  3MPL A;  4OVR A;  4KYS A;  2MKZ A;  5A5L A;  1MM6 A;  1RYX A;  5JK4 A;  1IMF A;  4MJO A;  2DWH A;  1DBZ A;  2UYF A;  2FVZ A;  3C34 A;  4QFN A;  2DVZ A;  4H1X A;  4FOR A;  1R6Z A;  3H06 B;  3FD3 A;  4U2R A;  3JV9 A;  4GL0 A;  1SPI A;  2HHM A;  4NWD A;  3OO8 A;  5FHN A;  4NE4 A;  2HAU A;  4G8M A;  1CE2 A;  1URG A;  4O3A A;  3EN3 A;  4I62 A;  4YU0 A;  4PFI A;  1BP5 A;  1ZBM A;  1FPL A;  4MFI A;  3Q28 A;  3ZKK A;  2X7Q A;  3KN3 A;  3QSL A;  4JSD A;  3IOU A;  1MY3 A;  3QAX A;  5CMB A;  4JWY A;  3O28 A;  5AE4 A;  4C0R A;  1B0L A;  3TPA A;  2ZZX A;  3CG1 A;  1B4H A;  4O8M A;  3AQF B;  2PMS A;  4Q5T A;  1H3D A;  3OO7 A;  1PB9 A;  4OET A;  3TUS A;  4OEV A;  2Z8D A;  1MQI A;  4EDP A;  4M4G A;  4I40 A;  2XXW A;  3GYY A;  2F36 A;  5AA2 D;  4ND9 A;  1QUK A;  3MWB A;  1MH4 A;  4PP0 A;  5H8N A;  4JSO A;  5B70 A;  1DTG A;  3OOA A;  3PUY E;  1VR5 A;  1A8E A;  4OFJ A;  1EZO A;  3EKI A;  2R6G E;  3KJT A;  4PE5 B;  2UVJ A;  4POW A;  1NUZ A;  4P1E A;  1FPE A;  4G68 C;  4P56 A;  4DLD A;  4QSE A;  3TTK A;  4HE1 A;  2THI A;  2DXY A;  2XWO A;  3C5T A;  4GWW A;  4JB7 A;  5ISU A;  5DVJ A;  3PV0 E;  3CSB A;  3TTM A;  3BFT A;  3D4C A;  1LEV A;  3IJO B;  3LSX A;  1I6B A;  2ZYN A;  3O97 A;  3TTL A;  1S9T A;  1R9L A;  4QFL A;  3VXC A;  1HSJ A;  3JZJ A;  4GL8 A;  3IO6 A;  3ONM A;  4RK9 A;  2FIE A;  3N6T A;  2ZNT A;  3FV1 A;  4QF9 A;  3O9P A;  1FPF A;  1PBQ A;  1PEB A;  5H8N B;  2XXQ A;  1EZ9 A;  1U34 A;  2I48 A;  4ISU A;  4KR5 A;  2Q2C A;  1MXX A;  1NV1 A;  4PF8 A;  5F24 A;  4HE0 A;  4MBP A;  3MZ1 A;  1GR2 A;  1D4N A;  2V93 A;  4MH5 A;  5I57 B;  5I2K A;  2VPO A;  1B51 A;  4NTL A;  1IXH A;  5EQA A;  4OER A;  1FPI A;  1YTV A;  3IB0 A;  4E0W A;  4DLQ A;  4RXL A;  4N6K A;  4OVT A;  2B4M A;  1QUL A;  2NWJ A;  1A8F A;  1N76 A;  3OO6 A;  5L9S A;  2R8T A;  2O68 A;  5HM4 B;  3N26 A;  2UVI A;  3G3I A;  2VT5 A;  5F7V A;  3IOL A;  2XXP A;  1DPE A;  4NGU A;  4G77 A;  2DP8 A;  2M8C A;  3SEX A;  2CZI A;  4GWS A;  4HXV A;  4AB5 A;  4LQ2 A;  2F7A A;  2XXI A;  4ERS A;  5AA1 A;  2ZYM A;  3N6U A;  4IB2 A;  4I9D A;  4HCY A;  4XKR A;  5I84 A;  4AQ4 A;  2DOJ A;  4PAF A;  4PTK A;  1IXG A;  3H6U A;  3O29 A;  1FSA A;  4NWC A;  4QFO A;  5FTH A;  5I2K B;  3PUX E;  4DXB A;  4P1L A;  4MLQ A;  2CMO A;  2F78 A;  5IKB A;  3CHG A;  2XXU A;  2XA5 A;  4EQB A;  4QRZ A;  3FXB A;  1DOT A;  2HZK A;  1IXC A;  2F7B A;  1NV2 A;  2UXA A;  1TWY A;  3Q27 A;  3EHU A;  4ELQ A;  2DWJ A;  3C33 A;  1WDN A;  4BDR A;  3K1M A;  2W7Y A;  4IY6 A;  4YKP A;  3U92 A;  4RNS A;  3T9H B;  3T9V A;  1TXF A;  2HFB A;  1LB8 A;  3N5L A;  3HPI A;  4PFR A;  3FV2 A;  3FZV A;  3PUV E;  3VE1 B;  1URD A;  1AL3 A;  3OO9 A;  3VDF A;  4BDO A;  5ET8 A;  2ZYK A;  3Q25 A;  4U21 A;  2XXT A;  5J1D A;  3B6W A;  4ZEB A;  4KHZ E;  4P9K A;  5EQ9 A;  3S9N C;  3Q26 A;  4EF2 A;  5I5P A;  2H9B A;  4N07 A;  5H8S A;  2Y7R A;  3R6U A;  4IO2 A;  2I0C A;  2P0S A;  3H6T A;  3MZB A;  4IO3 A;  2WX9 A;  4PFY A;  1Y1Z A;  1I6Q A;  3H7M A;  2NVU B;  4UA8 A;  2Q89 A;  2ONR A;  3D1R A;  1B1X A;  1A40 A;  1SW5 A;  3O6G A;  1FQC A;  4EF1 A;  5CRY A;  1B5J A;  3UK4 A;  1SYH A;  1N3X A;  2FIX A;  2Y7I A;  3RY3 A;  1LBC A;  4ECF A;  1GV8 A;  4DXU A;  3DP6 A;  4GVO A;  1NV0 A;  3UN6 A;  2PYY A;  4P3L A;  1CB6 A;  1P1N A;  1N84 A;  4XKQ A;  4P11 A;  3GXA A;  1H76 A;  1VSO A;  1Y3N A;  2Y84 A;  5I3S A;  1MY2 A;  1NNP A;  3O6H A;  1YPN A;  2G93 A;  2HQ0 A;  3H4Z A;  3PPP A;  2ZYO A;  3C4M A;  1B5H A;  2XDG A;  4OAN A;  4DIG A;  4UAC A;  3L2J A;  4XKN A;  4F29 A;  4IGR A;  1RDZ A;  1LBB A;  2XXR A;  5CMM A;  2I49 A;  4O7I A;  5CM6 A;  2F3D A;  2WEF A;  1K9Y A;  3DLN A;  3FJ7 A;  3ILU B;  4R74 A;  3TKD A;  1ZTY A;  4IO4 A;  5A5X A;  1IMA A;  4YKK A;  5JEI A;  5H8H A;  2ZNS A;  1I69 A;  1M5E A;  2RC7 A;  1F9B A;  2RC9 A;  3EPE A;  3SEV A;  1UTH B;  2V4C A;  1GGG A;  2RF1 A;  3QYT A;  4GRK A;  4GOT A;  4ZEK A;  4HTG A;  3RPL A;  4N17 A;  5KZT A;  1D3K A;  1FBF A;  1R9Q A;  1QJM A;  1VFD A;  2FHY A;  1SD3 A;  1XVX A;  2WYP A;  3D4G A;  3MVX A;  4OWD A;  2XD2 A;  2YJP A;  3LBS A;  4L17 A;  5TP9 A;  4N8Y A;  4U23 A;  1XC1 A;  3TCH A;  5T3J A;  2AL5 A;  4P47 A;  1NFT A;  3M8U A;  1PBP A;  3TFL A;  1POY 1;  1FPD A;  4G68 B;  1XT8 A;  1BK4 A;  4PGP A;  1XI6 A;  4OZ9 A;  4LN5 A;  2PT1 A;  1SBP A;  5IZ1 A;  4O94 A;  1Q35 A;  5A5X B;  1IQ7 A;  4NG7 A;  3K6V A;  1NUY A;  2QJE A;  1EU8 A;  4M1V A;  5H8H B;  4OTE A;  1GTK A;  2Q8M A;  3OEM A;  5I56 A;  2D3I A;  4MMP A;  5H8F A;  4PBQ A;  2VD3 A;  4NQ8 A;  5DVI A;  1NV7 A;  3FAT A;  3PPR A;  1FQA A;  3RPL B;  1FQF A;  4N6D A;  2YLN A;  3S4U A;  5CMK A;  4ZED A;  2KQZ A;  4R75 A;  1H44 A;  2V3Q A;  3U94 A;  3VV5 A;  3JYR A;  5AA2 B;  3MP8 A;  1LBW A;  1P1U A;  1A55 A;  5I59 A;  3C31 A;  3LSL A;  2XX7 A;  1B3E A;  4QXD A;  2GRV A;  4GWZ A;  4DXC A;  2KR0 A;  3ZS6 A;  4P0I A;  1ZLQ A;  3QK6 A;  1LAF E;  1EYI A;  2AL4 A;  4PFU A;  3QMF A;  4H5G A;  1MXZ A;  2JJK A;  4WEP A;  3RUM A;  5KCJ A;  1O63 A;  4LF3 C;  2H5Y A;  4MNP A;  2V3U A;  4LQ5 A;  4OXV A;  1LFG A;  5I56 B;  2JND A;  1P1Q A;  1KWH A;  3K6U A;  5H8F B;  4XTC Q;  1FPK A;  3MQ9 A;  1SI0 A;  3UIF A;  1FTJ A;  4F2Q A;  1P99 A;  3VXB A;  3HO7 A;  4N8G A;  4O3C A;  1SDX A;  1USY E;  5I59 B;  4JDF A;  1ZJL A;  4H5F A;  4RYA A;  2ZXT A;  1RDX A;  1FTO A;  4TLL B;  4X04 A;  1FQB A;  4LON B;  3G3H A;  1RKM A;  3I6V A;  5ET6 A;  3KBR A;  4KXP A;  3K2D A;  3LSF B;  1FRP A;  3USD A;  3P7I A;  3BFU A;  3VLV A;  1Z7M E;  3TEP A;  1MM7 A;  4NF8 A;  5KCJ B;  1B05 A;  3SKP A;  3KEI A;  3RQT A;  4FED A;  3RT6 B;  4GX6 A;  4ESW A;  2RKM A;  4GFR A;  4TOZ A;  4ZEI A;  5K2X A;  5B7D A;  2DSF A;  1MXU A;  2GFE A;  3PGF A;  3KSJ A;  4OVJ A;  2F5X A;  5ET5 A;  1YAE A;  2Z23 A;  2B3F A;  2Z22 A;  4F1U A;  3EHS A;  2WYK A;  1JNF A;  2HZL A;  1B46 A;  1M5F A;  4QSC A;  4NF0 A;  1LAH E;  2GHA A;  3MYU A;  1K9Z A;  3N94 A;  4ELP A;  1FPB A;  3O66 A;  1S7Y A;  2Z8F A;  1FJ9 A;  3UOR A;  3LV0 A;  5I57 A;  1J1N A;  5IM2 A;  3E4R A;  3TDJ A;  4OA4 A;  2D21 A;  4NF8 B;  4DE8 A;  4WKM A;  3RT8 A;  2DS9 A;  1B3L A;  3HST A;  5ITP A;  3B7D A;  1DMB A;  4I3Y A;  4MX6 A;  3I3V A;  4NAP A;  2Y7K A;  1EZP A;  2B3B A;  3SZP A;  2LAO A;  4KD5 A;  3MP1 A;  5FBP A;  5TPA A;  3FXR A;  1IEJ A;  1PC3 A;  1B3H A;  3IFA A;  2E1S A;  1B32 A;  4G2Z A;  2F3B A;  1BIY A;  1OLA A;  3PD9 A;  3VVF A;  3OMB A;  3VFJ A;  4U4X A;  4FE8 A;  2QRY A;  1MQD A;  3MPK A;  1O7T A;  2QSX A;  5AA4 B;  5ICT A;  1RDY A;  3MP6 A;  3RTF B;  3MBP A;  4LZ7 A;  1B7Z A;  5LTC A;  2ZZV A;  4GF8 A;  3M3L A;  3TCG A;  1FBE A;  5EHM A;  2DYX A;  1XVY A;  3PUZ E;  4ZEF A;  3CFZ A;  4RPO A;  2GH9 A;  2G29 A;  2FYI A;  4R72 A;  4G61 A;  5TPA B;  3FJM A;  3Q29 A;  3V8X B;  3C32 A;  4ZE8 A;  1YZ0 A;  3R26 A;  1MPD A;  4PF6 A;  5ICQ A;  2DWI A;  3S9M C;  3G7W A;  3PPN A;  1D9Y A;  1QW0 A;  3RNN A;  3B8B A;  5ET7 A;  2RCA A;  4R6K A;  5DW8 A;  1TFD A;  1MDP 1;  3HCQ A;  3OD7 A;  5J16 A;  3KJ7 A;  2GQ1 A;  3IX1 A;  3T9X B;  3DP8 A;  2I3V A;  3PUW E;  3FVK A;  2WBB A;  2OWZ A;  1NV4 A;  4MHF A;  2XWV A;  4U1Z A;  1OVT A;  3SEW A;  4OHN A;  4HE2 A;  4XIG Q;  1O64 A;  1FPJ A;  5IZ3 B;  4JVI A;  2XXV A;  2QMW A;  1XOC A;  4MIJ A;  4R2F A;  4C1U A;  1B1H A;  2O7I A;  3KN8 A;  2Q9T A;  4F2O A;  4GD5 A;  5BUU A;  1LCT A;  1IIW A;  1MXY A;  4KPT A;  3QUJ A;  2F6G A;  1HSL A;  2O1M A;  3B6T A;  4GX4 A;  4ZS9 A;  5BWJ A;  1P1O A;  1WVJ A;  1URS A;  3KG2 A;  3KFM A;  1A99 A;  1FTK A;  2CZH A;  3IO4 A;  2Q88 A;  4OVS A;  3PMX A;  4H6D A;  3I5O A;  1B0H A;  5FHM A;  2ZZW A;  1SW4 A;  2PFZ A;  2A5S A;  4KQP A;  1B6H A;  1FTL A;  3IL1 B;  3ZKL A;  3CVG A;  4G4P A;  1Z7N E;  4AS5 A;  5EQ7 A;  1GVC A;  4MEV A;  1US4 A;  1B5I A;  1Y4C A;  4RY1 A;  1JW1 A;  2Y5L A;  3A3U A;  2L5V A;  3G3F A;  1IIT A;  4H65 A;  2ESN A;  3UA8 A;  3KBZ A;  3H6V A;  3IB2 A;  4Q0C A; 
#chains in the Genus database with same CATH homology
 4RPN A;  1P1W A;  3QIM A;  1DSN A;  4OFO A;  1LST A;  5AA3 A;  3SEU A;  1SYI A;  3CG3 A;  3PMV A;  3V5A A;  2O84 X;  1B2H A;  5TU0 A;  4P0G A;  3CR9 A;  3E3K A;  4U4S A;  3OEN A;  3LR1 A;  2NUV A;  2Y7W A;  2XXX A;  5L8D A;  2PBW A;  3KSX A;  1M5C A;  5JTY A;  1VFE A;  1R1N A;  3DEL B;  3O2A A;  3F11 A;  4HW8 A;  2I58 A;  4JBZ A;  3MZ9 A;  5DTB A;  4H8I A;  3KOT A;  4OEN A;  4LZ5 A;  1UTH A;  2UVH A;  2OCU A;  1EH3 A;  5CI5 A;  1B3G A;  2P1S A;  2YPN A;  3PU5 A;  1XHY A;  3TOD A;  1TFA A;  2H98 A;  1DPP A;  4BLA A;  3E9X A;  4LP2 B;  2REJ A;  4YZZ A;  2DE4 A;  4QSD A;  2PVU A;  4EQ7 A;  2OJT A;  4YIC A;  3FAS A;  5CC2 A;  3C59 A;  2WKY A;  1MY1 A;  4G68 A;  2ONK E;  1FQE A;  3MC2 A;  5JTY B;  4KCD A;  4DDD A;  2DQV A;  2Z8E A;  2O1L A;  3T9U A;  4C1T A;  1FTM A;  2RC8 A;  3TQL A;  5IAI A;  1VE4 A;  3OEL A;  3H3G A;  3SET A;  4IO5 A;  4LZ8 A;  5I2N B;  4ZZE A;  3SDF A;  4K3F A;  5II0 A;  4EUO A;  2QPQ A;  2Q2A A;  4DZ1 A;  4QFP A;  1N3W A;  5AA2 A;  2AYS A;  1BTJ A;  2XX9 A;  1ELJ A;  2DE3 A;  1BKA A;  4I1D A;  2ANJ A;  4F19 A;  2OWS A;  4DCX A;  1B40 A;  3CSG A;  3IAZ A;  4BDN A;  3PMW A;  1A7L A;  4IO7 A;  1JEV A;  3HHF A;  3FXQ A;  1QKB A;  3FUZ A;  4U22 A;  1DTZ A;  4DCY A;  4R2B A;  3TCF A;  4FEB A;  1H43 A;  1UIU A;  2OLB A;  3K6X A;  1I6A A;  2I4B A;  2IA4 A;  3N7P A;  3FXU A;  3FJG A;  4FAJ A;  1QKA A;  5EYF A;  4OES A;  1NNT A;  3RN8 A;  5H8Q A;  1LCF A;  1D9V A;  4ESX A;  1N0T A;  1S50 A;  4ZDM A;  5HPQ A;  4RK2 A;  4NF5 A;  2H4I A;  3H6W A;  4YAH X;  3R7X A;  2QMX A;  2IEE A;  3A09 A;  1N04 A;  3EHT A;  1B9J A;  1OQH A;  4MLV A;  4QFK A;  1IZ1 A;  1NH7 A;  4PET A;  4F1V A;  2OZZ A;  4F3G A;  4GWO A;  2VGQ A;  2XXY A;  3MVY A;  1Q1K A;  2F35 A;  5CBR A;  3OSR A;  4R73 A;  4FEC A;  2ONS A;  4XKP A;  4ZE9 A;  4OYV A;  4JWX A;  3FIR A;  2QS1 A;  3U72 A;  2OBG A;  5H8Q B;  4LVQ A;  4BDL A;  4KFQ A;  4GLI A;  1XS5 A;  1Y20 A;  2VP1 A;  3H03 A;  3RTW B;  5DEX A;  2QKH A;  4OFL A;  4NF5 B;  1ZMG A;  4QHQ A;  3G3G A;  4JWO A;  4F39 A;  1MQG A;  3PPO A;  5LOM A;  2DXR A;  2UVG A;  3MVW A;  3ZSF A;  1UQW A;  3THI A;  2FA7 A;  4OMB A;  1OLC A;  1AOV A;  1POT A;  5ELV A;  4HCW A;  3MAM A;  2AIX A;  4I8C A;  2RIN A;  4NF4 A;  3S2V A;  4YKJ A;  1ZIU A;  3MUQ A;  3SES A;  4N6P A;  1NNK A;  2JNC A;  2P2A A;  3K4U A;  4BDQ A;  4LAT A;  3EQ1 A;  4ZGM A;  5AA4 A;  1JQF A;  5DYH A;  1ZKB A;  5KDT A;  2X26 A;  3W9W A;  1NKX A;  5DEX B;  4F31 B;  1Y1M A;  1MXV A;  3IJX B;  3IOT A;  2O51 A;  4TLM B;  2XHD A;  3LUY A;  1B7H A;  3L6G A;  2VOZ A;  2QS3 A;  1LAX A;  2KLF A;  4RJZ A;  1ZU0 A;  2HCA A;  3T93 B;  4ZEC A;  1MPC A;  3TEL A;  2V84 A;  2Q8J A;  2O69 A;  4NF4 B;  4G8H A;  3IOR A;  3K1P A;  2ABH A;  1ATG A;  4FAT A;  4YMB A;  1OMP A;  3HV1 A;  4KYE A;  4GXS B;  1NMU A;  4FJP A;  4PQJ A;  4X9T A;  4OQO A;  1JET A;  1YCJ A;  3GBA A;  1AH5 A;  3V83 A;  4U1O A;  5KDT B;  4KI0 E;  1OQG A;  4HS7 A;  1FW0 A;  2UYE A;  4G8N A;  2I0B A;  2L27 A;  3KOS A;  2F34 A;  3C9H A;  2JOD A;  2F97 A;  1T0K A;  4Q30 B;  1LFI A;  1IXI A;  2E0S A;  3AXF A;  3FVO A;  4YB5 A;  1AIV A;  4AB6 A;  3MVZ A;  3M3K A;  3SEY A;  2I4C A;  3RLF E;  4R6H A;  3O6I A;  3FVG A;  2BJJ X;  1B7U A;  3FGS A;  1MH3 A;  2ZMB A;  1FCK A;  4F22 A;  4KYD A;  1MRP A;  4EXK A;  2F6P A;  3CIJ A;  1FQD A;  3OEK A;  3CI8 A;  1SW1 A;  3KN7 A;  2HAV A;  4Q8R A;  2R9J A;  2HEU A;  3IOV A;  3FVN A;  5CBS A;  3IB1 A;  2RCB A;  3QUF A;  2QS2 A;  2QL3 A;  3TYH A;  3VLW A;  3T66 A;  1N7X A;  1TT1 A;  3GLB A;  3PD8 A;  3VVD A;  1US5 A;  1A54 A;  3MJN A;  3TMG A;  4WED A;  5I58 A;  2VD2 A;  1Y3Q A;  1LAG E;  4DLO A;  1MS7 A;  4H0W A;  3GZG A;  2NXO A;  3MW0 A;  4ZZA A;  3BKI B;  4FIM A;  4R9G A;  3B6Q A;  2O6A A;  3G3J A;  2B65 A;  3G3K A;  1QUJ A;  1N7W A;  4F3S A;  2CZL A;  4R9F A;  3KGC A;  1SVX B;  3W15 C;  1NL5 A;  1USY H;  3K6W A;  4ELR A;  1PB7 A;  5FTI A;  5M2V A;  1NNF A;  3S9L C;  4JXI A;  3C35 A;  4F1Y A;  1II5 A;  3U1O A;  3EF7 A;  3DP4 A;  2F8D A;  1MQJ A;  5CMC A;  3OSQ A;  4THI A;  3CRB A;  4GXA A;  3IK6 B;  3WAF A;  4EQ9 A;  2VHA A;  5I58 B;  4X1B A;  1Y4T A;  5HBC A;  2HXW A;  4Z0I A;  3N7R A;  2DWA A;  3V89 B;  4ONY A;  5K2Y A;  4TQU Q;  1JW5 A;  3PPQ A;  2Y7P A;  4RA1 A;  3OXN A;  4LA9 A;  3TQW A;  3LC8 A;  4XXU A;  3IOW A;  4R6Y A;  5F1Q A;  1MQH A;  1MY0 A;  2ZNU A;  2I3W A;  2PT2 A;  5I2N A;  2OWT A;  1PB8 A;  3HHG A;  2XX8 A;  1MPB A;  1BLF A;  3IR1 A;  4IO6 A;  2QS4 A;  4YB7 A;  4O3B A;  3W9V A;  1MXW A;  1SW2 A;  2H25 A;  4KCC A;  3ECR A;  2XXH A;  5DVF A;  3SER A;  1QUI A;  3QXM A;  4HJ0 A;  1JVY A;  4POX A;  2A5T A;  5DT6 A;  3KZG A;  1LFH A;  4GQO A;  1H45 A;  1M5B A;  1NH8 A;  2O7U A;  4PFT A;  4YB6 A;  3DM0 A;  2V25 A;  2REG A;  1UTB A;  3N7S A;  4YMA A;  4X1D A;  1JW4 A;  4ELO A;  4X48 A;  4GIZ A;  2H99 A;  1B3F A;  3CFL A;  1SQY A;  2PX1 A;  1HSE A;  1AMF A;  3ILT B;  3T96 B;  2NOO A;  3M3F A;  1B58 A;  3A3C A;  3K01 A;  5FHO A;  3HN0 A;  3T22 A;  1RYO A;  3UP9 A;  3TZA A;  4F3P A;  3K0V A;  1LB9 A;  4H67 A;  2I6E A;  3RPW A;  2R71 A;  2DE2 A;  4NF6 A;  1B52 A;  2D5W A;  2A5T B;  2FNC A;  5ITO A;  1L5T A;  3ODB A;  3VVE A;  1PDA A;  1OIB A;  4WXJ A;  1UTB B;  1WOD A;  4F18 A;  2GHB A;  1MG1 A;  3TTR A;  3TAJ A;  4N13 A;  1M5D A;  1LLS A;  1MY4 A;  1QVS A;  1OVB A;  4IY5 A;  3E13 X;  1Y3P A;  3U93 A;  2X7P A;  1SI1 A;  2F7C A;  5L9M A;  4F3B A;  4BDM A;  1JVX A;  3C36 A;  4NMY A;  4LUB A;  3TTN A;  3K1N A;  2OK2 A;  2ALU A;  3RGY A;  3BBR A;  3WAE A;  3LSW A;  5L9O A;  2DVC A;  4NF6 B;  3GBB A;  4IGT A;  1B4Z A;  4OEU A;  4E0X A;  4PFW A;  5TP9 B;  3K00 A;  1JEU A;  3S9E A;  5EHS A;  1LGB C;  4EXL A;  1IUD A;  3U8Q A;  4H8J A;  3K02 A;  3CFX A;  4YKI A;  3VLU A;  2V3T A;  3UGW A;  4NED A;  1Y9U A;  4Z7E A;  1ANF A;  1UIV A;  4MF3 A;  1MDQ A;  3L6H A;  2XD3 A;  3MPL A;  4KYS A;  1MM6 A;  1RYX A;  5JK4 A;  2DWH A;  2UYF A;  3C34 A;  4QFN A;  2DVZ A;  4H1X A;  4FOR A;  1R6Z A;  3H06 B;  3FD3 A;  4U2R A;  3JV9 A;  4GL0 A;  4NWD A;  3OO8 A;  5FHN A;  4NE4 A;  2HAU A;  4G8M A;  1CE2 A;  1URG A;  4O3A A;  3EN3 A;  4I62 A;  4YU0 A;  1BP5 A;  1ZBM A;  4MFI A;  3Q28 A;  3ZKK A;  2X7Q A;  3KN3 A;  3QSL A;  4JSD A;  3IOU A;  1MY3 A;  3QAX A;  5CMB A;  4JWY A;  3O28 A;  5AE4 A;  4C0R A;  1B0L A;  3TPA A;  3CG1 A;  1B4H A;  3AQF B;  2PMS A;  4Q5T A;  1H3D A;  3OO7 A;  1PB9 A;  4OET A;  3TUS A;  4OEV A;  2Z8D A;  1MQI A;  4EDP A;  4M4G A;  2XXW A;  5AA2 D;  2F36 A;  4ND9 A;  1QUK A;  3MWB A;  1MH4 A;  4PP0 A;  5H8N A;  4JSO A;  5B70 A;  1DTG A;  3OOA A;  3PUY E;  1VR5 A;  1A8E A;  4OFJ A;  1EZO A;  2R6G E;  3KJT A;  4PE5 B;  2UVJ A;  4POW A;  4G68 C;  4DLD A;  4QSE A;  3TTK A;  2THI A;  2DXY A;  3C5T A;  5ISU A;  4JB7 A;  5DVJ A;  3PV0 E;  3CSB A;  3TTM A;  3BFT A;  3D4C A;  3IJO B;  3LSX A;  1I6B A;  2ZYN A;  3O97 A;  3TTL A;  1S9T A;  1R9L A;  4QFL A;  3VXC A;  1HSJ A;  3JZJ A;  4GL8 A;  3IO6 A;  3ONM A;  4RK9 A;  3N6T A;  2ZNT A;  3FV1 A;  4QF9 A;  3O9P A;  1PBQ A;  1PEB A;  5H8N B;  2XXQ A;  1EZ9 A;  1U34 A;  2I48 A;  4ISU A;  4KR5 A;  2Q2C A;  1MXX A;  4MBP A;  3MZ1 A;  1GR2 A;  1D4N A;  2V93 A;  4MH5 A;  5I57 B;  5I2K A;  1B51 A;  4NTL A;  1IXH A;  4OER A;  1YTV A;  3IB0 A;  4E0W A;  4DLQ A;  4RXL A;  1QUL A;  2NWJ A;  1A8F A;  1N76 A;  3OO6 A;  5L9S A;  2O68 A;  5HM4 B;  3N26 A;  2UVI A;  3G3I A;  5F7V A;  3IOL A;  2XXP A;  1DPE A;  4G77 A;  2DP8 A;  2M8C A;  3SEX A;  4AB5 A;  4LQ2 A;  2F7A A;  2XXI A;  4ERS A;  5AA1 A;  2ZYM A;  3N6U A;  4IB2 A;  4I9D A;  4HCY A;  4XKR A;  5I84 A;  4AQ4 A;  2DOJ A;  1IXG A;  3H6U A;  3O29 A;  4NWC A;  4QFO A;  5FTH A;  5I2K B;  3PUX E;  4DXB A;  4MLQ A;  2CMO A;  2F78 A;  5IKB A;  2XXU A;  4EQB A;  4QRZ A;  1DOT A;  2HZK A;  1IXC A;  2F7B A;  2UXA A;  1TWY A;  3Q27 A;  3EHU A;  4ELQ A;  2DWJ A;  3C33 A;  1WDN A;  4BDR A;  3K1M A;  2W7Y A;  4IY6 A;  4YKP A;  3U92 A;  4RNS A;  3T9H B;  3T9V A;  1TXF A;  2HFB A;  1LB8 A;  3N5L A;  3HPI A;  3FV2 A;  3FZV A;  3PUV E;  3VE1 B;  1URD A;  1AL3 A;  3OO9 A;  3VDF A;  4BDO A;  2ZYK A;  3Q25 A;  4U21 A;  2XXT A;  5J1D A;  3B6W A;  4ZEB A;  4KHZ E;  3S9N C;  3Q26 A;  4EF2 A;  2H9B A;  4N07 A;  5H8S A;  2Y7R A;  3R6U A;  4IO2 A;  2I0C A;  2P0S A;  3H6T A;  3MZB A;  4IO3 A;  4PFY A;  1Y1Z A;  1I6Q A;  3H7M A;  2NVU B;  4UA8 A;  2Q89 A;  2ONR A;  1B1X A;  1A40 A;  1SW5 A;  3O6G A;  1FQC A;  4EF1 A;  5CRY A;  1B5J A;  3UK4 A;  1SYH A;  1N3X A;  2Y7I A;  3RY3 A;  1LBC A;  4ECF A;  1GV8 A;  4DXU A;  3DP6 A;  4GVO A;  3UN6 A;  2PYY A;  1CB6 A;  1P1N A;  1N84 A;  4XKQ A;  4P11 A;  3GXA A;  1H76 A;  1VSO A;  1Y3N A;  2Y84 A;  1MY2 A;  1NNP A;  3O6H A;  1YPN A;  2G93 A;  2HQ0 A;  3H4Z A;  3PPP A;  2ZYO A;  3C4M A;  1B5H A;  2XDG A;  4DIG A;  4UAC A;  3L2J A;  4XKN A;  4F29 A;  4IGR A;  1LBB A;  2XXR A;  5CMM A;  2I49 A;  5CM6 A;  3DLN A;  3FJ7 A;  3ILU B;  4R74 A;  3TKD A;  1ZTY A;  4IO4 A;  5A5X A;  4YKK A;  5JEI A;  5H8H A;  2ZNS A;  1I69 A;  1M5E A;  2RC7 A;  1F9B A;  2RC9 A;  3EPE A;  3SEV A;  1UTH B;  1GGG A;  2RF1 A;  3QYT A;  4GRK A;  4GOT A;  4ZEK A;  4HTG A;  5KZT A;  1D3K A;  1R9Q A;  1QJM A;  1VFD A;  1SD3 A;  1XVX A;  3D4G A;  3MVX A;  4OWD A;  2XD2 A;  2YJP A;  3LBS A;  4L17 A;  5TP9 A;  4U23 A;  1XC1 A;  3TCH A;  2AL5 A;  1NFT A;  3M8U A;  1PBP A;  3TFL A;  1POY 1;  4G68 B;  1XT8 A;  4OZ9 A;  2PT1 A;  1SBP A;  1Q35 A;  5A5X B;  1IQ7 A;  3K6V A;  2QJE A;  1EU8 A;  4M1V A;  5H8H B;  4OTE A;  1GTK A;  3OEM A;  5I56 A;  2D3I A;  5H8F A;  2VD3 A;  5DVI A;  3FAT A;  3PPR A;  1FQA A;  1FQF A;  2YLN A;  3S4U A;  5CMK A;  4ZED A;  4R75 A;  1H44 A;  2V3Q A;  3U94 A;  3VV5 A;  3JYR A;  5AA2 B;  3MP8 A;  1P1U A;  1A55 A;  5I59 A;  3C31 A;  3LSL A;  2XX7 A;  1B3E A;  2GRV A;  4DXC A;  3ZS6 A;  4P0I A;  1ZLQ A;  3QK6 A;  1LAF E;  2AL4 A;  4PFU A;  4H5G A;  1MXZ A;  4WEP A;  3RUM A;  5KCJ A;  1O63 A;  4LF3 C;  2H5Y A;  2V3U A;  4LQ5 A;  4OXV A;  1LFG A;  5I56 B;  2JND A;  1P1Q A;  1KWH A;  3K6U A;  5H8F B;  4XTC Q;  3MQ9 A;  1SI0 A;  3UIF A;  1FTJ A;  4F2Q A;  1P99 A;  3VXB A;  3HO7 A;  4O3C A;  1SDX A;  1USY E;  5I59 B;  4JDF A;  1ZJL A;  4H5F A;  4RYA A;  2ZXT A;  1FTO A;  4TLL B;  1FQB A;  4LON B;  3G3H A;  1RKM A;  3I6V A;  3KBR A;  3K2D A;  3LSF B;  3USD A;  3P7I A;  3BFU A;  3VLV A;  1Z7M E;  3TEP A;  1MM7 A;  4NF8 A;  5KCJ B;  1B05 A;  3SKP A;  3KEI A;  3RQT A;  4FED A;  3RT6 B;  4ESW A;  2RKM A;  4GFR A;  4TOZ A;  4ZEI A;  5K2X A;  5B7D A;  2DSF A;  1MXU A;  2GFE A;  3PGF A;  3KSJ A;  4OVJ A;  2F5X A;  1YAE A;  2Z23 A;  2B3F A;  2Z22 A;  4F1U A;  3EHS A;  1JNF A;  2HZL A;  1B46 A;  1M5F A;  4QSC A;  1LAH E;  2GHA A;  3N94 A;  4ELP A;  3O66 A;  1S7Y A;  2Z8F A;  3UOR A;  5I57 A;  1J1N A;  3E4R A;  3TDJ A;  2D21 A;  4NF8 B;  4DE8 A;  4WKM A;  3RT8 A;  2DS9 A;  1B3L A;  3HST A;  5ITP A;  3B7D A;  1DMB A;  3I3V A;  2Y7K A;  1EZP A;  2B3B A;  2LAO A;  4KD5 A;  3MP1 A;  5TPA A;  3FXR A;  1IEJ A;  1PC3 A;  1B3H A;  2E1S A;  1B32 A;  4G2Z A;  1BIY A;  1OLA A;  3PD9 A;  3VVF A;  3OMB A;  3VFJ A;  4U4X A;  4FE8 A;  2QRY A;  1MQD A;  3MPK A;  1O7T A;  2QSX A;  5AA4 B;  5ICT A;  3MP6 A;  3RTF B;  3MBP A;  4LZ7 A;  1B7Z A;  4GF8 A;  3M3L A;  3TCG A;  5EHM A;  2DYX A;  1XVY A;  3PUZ E;  4ZEF A;  3CFZ A;  4RPO A;  2GH9 A;  2G29 A;  2FYI A;  4R72 A;  5TPA B;  3FJM A;  3Q29 A;  3V8X B;  3C32 A;  4ZE8 A;  3R26 A;  1MPD A;  5ICQ A;  2DWI A;  3S9M C;  3G7W A;  3PPN A;  1D9Y A;  1QW0 A;  3RNN A;  2RCA A;  4R6K A;  1TFD A;  1MDP 1;  3HCQ A;  3OD7 A;  3KJ7 A;  3T9X B;  3IX1 A;  3DP8 A;  2I3V A;  3PUW E;  3FVK A;  4U1Z A;  1OVT A;  3SEW A;  4OHN A;  4XIG Q;  1O64 A;  2XXV A;  2QMW A;  1XOC A;  4R2F A;  4C1U A;  1B1H A;  2O7I A;  3KN8 A;  2Q9T A;  4F2O A;  4GD5 A;  5BUU A;  1LCT A;  1IIW A;  1MXY A;  4KPT A;  3QUJ A;  2F6G A;  1HSL A;  2O1M A;  3B6T A;  4ZS9 A;  5BWJ A;  1P1O A;  1WVJ A;  1URS A;  3KG2 A;  3KFM A;  1A99 A;  1FTK A;  3IO4 A;  2Q88 A;  3PMX A;  4H6D A;  3I5O A;  1B0H A;  5FHM A;  1SW4 A;  4KQP A;  2A5S A;  1B6H A;  1FTL A;  3IL1 B;  3ZKL A;  3CVG A;  4G4P A;  1Z7N E;  1GVC A;  1US4 A;  1B5I A;  1Y4C A;  4RY1 A;  1JW1 A;  3A3U A;  3G3F A;  1IIT A;  4H65 A;  2ESN A;  3UA8 A;  3H6V A;  3IB2 A;  4Q0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...