3H3HA

Crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
118
Chain Sequence
b'PITQAFAQQFSREWIDAWNAHDLDAILSHYADGFEMSSPMIVQIAGPSGRLRGKEQVGAYWREALRMIPDLHFEWIATLAGVDSVAIHYRGAKGRLALEVFHFGPDRRVVKALAHYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized SnoaL-like protein
publication title Crystal structure of SnoaL-like protein of unknown function (YP_438428.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
total genus 37
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h3hA00
1NU3A 3NM2A 3FLJA 5CXOA 1TUHA 3EBYA 2HMOB 2XRXB 1GY7A 3KZTA 2BMOB 1W00A 3MG1A 4K1VA 4L8PA 1W02A 1WQLB 4LMIA 2PZVA 5AIFA 3FKAA 1C7HA 1O7GB 4HM0B 3CNXA 1GS3A 4HM5B 3B4PA 5IG4A 3NUVA 3LZAA 3STDA 3F8XA 5DRVA 2F86B 4STDA 3EC9A 1SJWA 4ORLA 3OWUA 1OPYA 3RGRA 3I0YA 1W01A 4HKVB 2XSHB 3FSDA 4WYKB 1OHSA 7STDA 2STDA 3JUOA 1STDA 4FCJA 5CLKA 3FH1A 4U13A 5IG0A 3UJMA 1JB2A 1JKGA 3DXOA 1OF5B 1JKGB 1QJGA 1JB5A 5IG3A 3GZXB 5AIHA 1OGZA 1E97A 5BXQA 3JUMA 4J8TA 2YFJB 3H3HA 5TGNA 1O7PB 5D83A 3CPOA 3GWRA 3KE7A 4CDLA 5IEOA 5KP1A 1DMQA 4H3UA 1OHOA 5AIIA 2GBXB 3CNMA 3ECFA 1W6YA 3A76A 1GY6A 3MKIA 4HM6B 1OHPA 1OCVA 1NDOB 4PEJA 4X2HA 2INXA 2CHCA 2RCDA 3OV4A 1GYBA 3NV0B 4RZMA 3D9RA 1OH0A 4XM4A 3FF0A 3DMCA 3OWYA 2W2CA 3VGNA 5IERA 2OWPA 3GZRA 4HZBB 2GEYA 4WWUC 5CK6A 4HM3B 3ROBA 5BVBA 2Z7AA 3F7SA 1JB4A 4I4KA 1S5AA 4WYKA 3G0KA 1OGXA 3GZYB 3JUQA 1ZO2A 3G16A 5IENA 4XDWA 3FF2A 4HM4B 1IDPA 2JQ5A 1OF5A 3T8NA 3BLZA 2Z77A 5HGRA 3B7CA 2XR8B 4HVNA 3EQQB 4LGQA 4GB5A 2HMJB 1CQSA 3EN8A 4HM7B 3F9SA 3BB9A 3SOYA 3F14A 3OWSA 3K0ZA 3OX9A 2HMMB 3EF8A 4J9AA 2YFLB 4HM1B 1A2KA 8CHOA 5AIGA 2HMLB 5JPPA 4KVHA 1Q40B 1O7HB 1O7NB 5G2GA 2GBWB 3EBTA 1Q42A 4Q53A 5JPUA 1JN5B 4HM8B 3E99A 2BNGA 1GY5A 2HMKB 3F40A 2R4IA 2Z76A 2B24B 1TP6A 1UUWB 2GXFA 3F7XA 3EN1B 4R1KA 3RGAA 3SEDA 4XDVA 3IPTA 4MJDA 4HZ9B 1OUNA 3B4OA 4R9LA 1AR0A 3NHXA 2GEXA 4XBTA 3Q90A 3MG3A 3NV0A 1U5OA 1ASKA 3EJVA 1DMMA 2K54A 4LEHA 3DUKA 4X2OA 5STDA 4XBXA 6STDA 2BMQB 3KKGA 5CF2A 5DREA 1ISKA 3CU3A 3K7CA 3HZPA 3B8LA 1HKXA 5AI1A 3HK4A 1E3VA 1ULIB 3DZLA 3M8CA 3UNLA 5CF1A 4FCMA 3SOAA 3DM8A 2I9WA 3EX9A 3NXJA 5FW5A 4XBYA 3JUNA 4OUQA 4XB5A 2A15A 3MYTA 1DMNA 3NBRA 4L7KA 1EA2A 1EG9B 3G8ZA 1K41A 4OVMA 1UUVB 1E3RA 1QMAA 1ZX2A 3S5CA 4K1UA 3F8HA 4R9KA 3EHCA 4IIAA 3HX8A 3MSOA 2RFRA 3JUPA 2F98A 1Q40A 2IMJA 1ULJB 2XSOB 1JN5A 3H51A 5IF6A 5D81A 3VSYA 5IEPA 3T8UA 2CKFB 3MG2A 1O7WB 5KP4A 1O7MB 2F99A 2QGUA 5KP3A 4HJLB 1NWWA 4N3VA 3LYGA 5AEUB 3KSPA 3FGYA 5EVHA 5IG5A 3WMDA 3FZWA 3OXAA 5D82A 2B1XB 3ER7A 5AEWB 3MHEA 1BUQA 2HMNB 2QIYA 3GZBA 1Z1SA 2UX0A 4HM2B 1VZZA 2BMRB 4WP5A 3GRDA 2RGQA 4L8OA 2YFIB
chains in the Genus database with same CATH superfamily
1BSCA 3DGNA 1VQ93 2AAEA 1LNHA 3WDGB 1RGCA 3SVAA 1NU3A 1GMQA 3CCM3 3NM2A 3FLJA 3IMAB 1W6GA 5CXOA 4EXRA 3OW22 1V57A 2WO0A 1BVIA 1FGRA 3QRDA 1X1XA 1F8NA 1TUHA 1MNLA 3EBYA 1C54A 2HMOB 4EV5A 2XRXB 1GY7A 2XGNA 1IQ8A 1LRAA 2KAAA 2XGLA 3BU4A 3KZTA 1TU5A 1LVNA 1Q824 3D4AA 2BMOB 1KSIA 3MPHA 3L0RA 1W00A 1RLSA 1RTUA 3MG1A 4K1VA 1YJN3 3K5TA 1SIHA 4L8PA 1JRQA 1K9M4 1W02A 1WQLB 3I553 4LMIA 1SQWA 2SARA 1RRHA 4IPBA 5FGOA 2PZVA 4N6TA 5AIFA 3NM7A 3FKAA 1C7HA 4N6OB 3S28A 1ROAA 1O7GB 2W0QA 4HM0B 3WOFB 1LQGC 1QVG2 1I3IA 1UGIA 1A90A 3CNXA 1GS3A 1RHLA 1FUSA 2BU4A 2BT3A 3B4PA 4HM5B 5IG4A 3WA3A 2ZHXB 3NUVA 4NHFA 3CCQ3 1AY7A 1VQP3 1N5HA 3LZAA 3UL6A 3STDA 2JDIH 1N8QA 1RNBA 3F8XA 1IVVA 4NREA 5GSPA 5DRVA 1K734 1IYYA 2F86B 2E2UA 3JVCA 4STDA 3EC9A 1SJWA 4ORLA 1JBTA 3S27A 1UI7A 1OPYA 3OWUA 3PCRA 3RGRA 4GSPA 2KRTA 3I0YA 1UCLA 4BIRA 1W01A 2CH9A 4HKVB 1RNTA 3X42A 1I2GA 2XSHB 4KFDA 3URPA 3FSDA 3D5IA 1GD3A 4J5GA 1GOVA 5M18A 4WYKB 1W7CA 1OHSA 1Q814 4GHOA 2C10A 7STDA 2STDA 3JUOA 4JF8A 3SX1A 1STDA 1X1WA 4FCJA 2P0XA 5CLKA 2AADA 3AGNA 3FH1A 3BNDA 4U13A 5IG0A 1TTOA 1FA3A 3UJMA 1BNEA 1GSPA 3G4S3 4H61A 1M9GA 1JB2A 3NX0A 1JKGA 3S29A 2OQEA 2CC3A 2FNQA 1QALA 3DXOA 3U97A 1NO3A 4OK0A 1IV9A 1OF5B 3LH4A 2P38A 1JKGB 5G1KA 1JZDA 1QJGA 1JB5A 1UW1A 3KCHA 3S67A 5IG3A 3HOHA 1IT8A 3GZXB 3DGMA 2RBIA 3EE1A 5AIHA 3DH2A 3U1WA 3FG3A 1OGZA 3WHOA 5RNTA 1E97A 5BXQA 1QVF2 2W56A 3JUMA 4J8TA 2YFJB 1QAFA 1BNJA 1RN7A 1RMSA 3DY5A 1I3FA 1WTHA 3H3HA 3V99A 1TRQA 5TGNA 5I97A 1O7PB 1Q9EA 1BRGA 1VQM3 5D83A 3FCSB 3CPOA 1EUIC 3AGOA 4WFOA 3GWRA 3CME3 1T2IA 2MC8A 1RN4A 3KE7A 3V92A 4CDLA 5IEOA 4CCVA 3LT9A 3N9HA 1I70A 3PYJA 1IT7A 5KP1A 1DMQA 4AEQA 3LMLA 4H3UA 3NQYA 1WMOA 1OHOA 2O3OA 3VF1A 3LTDA 3DGYA 5AIIA 1BNGA 2CW9A 4N6UA 1K8A4 2GBXB 1BRKA 3CNMA 3ECFA 3ZG5A 3T0UA 3HI7A 1Q864 3BNCA 2OCTA 1K28A 1AVKA 1V58A 1W6YA 1GY6A 3A76A 2OTJ3 2R41A 1WMPA 1G02A 3LTAA 2D1WA 3MKIA 3BNEA 3EB8A 4FMAA 4HM6B 3SLUA 4O2HA 4DKIA 2CFDA 2BIRA 1OHPA 2W9PA 1OCVA 3AMOA 3DGLA 1NDOB 4PEJA 1YVBI 4O02B 4X2HA 1N9JA 1SIIA 1OACA 1MWTA 1IVUA 2CHCA 2INXA 3D3LA 3NQZA 1CH0A 2BO9B 1KD14 2W04A 2RCDA 3OV4A 1GYBA 3NV0B 4JRFA 4WHAA 1RJOA 1MOLA 4RZMA 3D9RA 4RNTA 1OH0A 1LOYA 1AV4A 1YI23 1PY3A 1B20A 1FUWA 4XM4A 1YNVX 4HBRA 3FF0A 1KC84 1FYSA 1CEWI 3TDGA 3DMCA 2W6JH 3OWYA 3PCSA 3J7Yd 2W2CA 3VGNA 1N8R4 2Q07A 2CWVA 3GAXA 5LC7A 5IERA 1BNSA 1A2VA 2OWPA 3GZRA 4HZBB 3WOEB 1R4YA 4EYCA 1DVCA 2GEYA 4K61A 4ILFA 2YX9A 1J2BA 1I0VA 1I2EA 2P09A 2L1SA 1PFPA 2KF6A 2GU1A 4WWUC 1TIJA 2OOVC 5CK6A 1LNIA 4I5QA 1CYUA 2KCDA 4LZIA 4HM3B 3Q1CA 2E2VA 3ROBA 5BVBA 3CCJ3 1BRIA 1M1K4 2OOVA 4BTXA 2Z7AA 3LT8A 1YGEA 3DGOA 3F7SA 2H0GA 1D6YA 3BNBA 2M7OA 1SPUA 8RNTA 1JB4A 2GSPA 3PS8A 4I4KA 4RNZA 3CPW2 1GD4A 1S5AA 4WYKA 3G0KA 1BOXA 3CXC2 4FCZA 4BL2A 1OGXA 3GZYB 1UI8A 3JUQA 2CFGA 1ZO2A 4LSOA 4BTYA 3G16A 5IENA 4QWTA 1LXEA 4XDWA 3FF2A 4HM4B 1IDPA 2JQ5A 6GSPA 3CC73 1OF5A 3T8NA 1EQKA 3BLZA 4EBGA 1RRLA 2Z77A 3UB1A 2Y74A 1FGQA 4N6MA 5HGRA 3B7CA 2RSXA 1U8CB 1RGGA 2XR8B 2Z6BA 4HVNA 3EQQB 2CWUA 2KF3A 2H0IA 2XEPA 4LGQA 4HYZA 4GB5A 1T3BA 2HMJB 4N6LA 1CQSA 3EN8A 3KSED 4HM7B 3F9SA 1GOUA 3BB9A 3OWSA 3F14A 3SOYA 3K0ZA 3OX9A 7GSPA 2HMMB 3EF8A 4J9AA 2YFLB 5HOHA 1RGFA 4BU4A 5LC6A 4IT7A 1IQYA 2CK3H 4HM1B 1A2KA 8CHOA 1R4CA 5AIGA 1KQS2 2HMLB 1VQN3 5JPPA 2KXGA 3Q2PA 5M19A 4KVHA 1HZ1A 1M904 1Q40B 2HOHA 1O7HB 1BSEA 1O7NB 5G2GA 2CFWA 2GBWB 3NBJA 2CIUA 3HIIA 3EBTA 1Q42A 1UDII 1W2B2 4Q53A 5JPUA 3WA2X 3PXMA 3RNTA 3SYUA 1JN5B 2IUJA 3CD63 1W4NA 4HM8B 3LXUX 4BTWA 2UUGC 3E99A 1V74A 2L4VA 1IVWA 3X3YA 2BNGA 3CCS3 1BSBA 1GY5A 4KZ1A 3D5GA 1LOVA 3CCV3 4EC6A 2CG0A 3N54B 2HMKB 2WOFA 4EW5A 3LTCA 2ZDJA 3F40A 4G1MB 1VQ83 2R4IA 2Z76A 3WR2A 2B24B 3K9MC 1TP6A 1UUWB 2H0HA 2GXFA 1RDSA 1FGMA 3F7XA 1ZS7A 3EN1B 1TRPA 4R4KA 4R1KA 3RGAA 1UCKA 3SEDA 3NBBA 4XDVA 1B2SA 3IPTA 3PZWA 3D79A 1NB3I 1NB5I 4TX4A 1VQ73 4MJDA 4HZ9B 1OUNA 3B4OA 3MWZA 1AR0A 4R9LA 3NHXA 1AQZA 2GEXA 3HIGA 1RCKA 3X3XA 1BU4A 4XBTA 1T2HA 3WODG 2O9UX 1M1XB 1GMRA 1MGWA 3Q90A 1JJ22 1JBRA 3MG3A 1BSDA 3CMA3 3NV0A 2XF3A 1U5OA 1VQQA 2BHMA 4KFFA 4RNYA 1ASKA 3EJVA 1HYFA 1TJDA 4GL6A 1MWRA 3SXXA 2F5MA 4AKZA 2OTL3 1B27A 1DMMA 2K54A 2Y73A 2QA43 1RCLA 4LEHA 3DUKA 4X2OA 1BGSA 1ZGXA 3V98A 5STDA 1B2ZA 1LOWA 1IU7A 3G713 4XBXA 3CCR3 4MMYB 1DYUA 1JBSA 6STDA 4FMDA 2FGTA 1NNVA 1B2MA 2BMQB 3KKGA 2MF7A 5CF2A 1UUGB 1A67A 1DVDA 5AYSC 5DREA 5M1AA 3CC23 1ISKA 1BANA 1D6UA 3CU3A 4J5KA 4RBNA 3K7CA 4AKYA 3HZPA 2C11A 1FGTA 3B8LA 1HKXA 1Q7HA 5AI1A 3HK4A 4L8OA 1BAOA 3UL5A 4R80A 2WOHA 5A0OB 1B2UA 1E3VA 1ULIB 3DZLA 3M8CA 3UNLA 5CF1A 4FCMA 4KFEA 3SOAA 1IK3A 1DETA 5EQLA 1RKYA 3DM8A 1UCIA 1BNIA 3FG1A 1FW7A 1JZOA 2I9WA 3ALAA 3FG4A 4FR9A 4NPBA 3ZG0A 3EX9A 2C4BA 3KN4A 3NXJA 2IYJA 2W03A 3BIRA 5FW5A 2UGIA 4XBYA 1N9EA 1YGWA 3JUNA 4N6V0 1G0TA 4OUQA 4HAAA 1X1UA 4XB5A 2CX1A 2CFLA 2FXTA 1I8VA 1YHQ3 1VQK3 3N8BA 3O8YA 1BRHA 4FMCA 1WMNA 1RGHA 2A15A 3MYTA 1DMNA 3NBRA 4L7KA 1EA2A 1EG9B 3G8ZA 2QEX3 1ROVA 3CC43 1IQXA 1RSNA 2GU3A 1K41A 2LYXA 1JV2B 2IA7A 3IJEB 1MGRA 1MWUA 1FGOA 1BIRA 2W9QA 1UUVB 4OVMA 1B2XA 1E3RA 1QMAA 3CCE3 1BUJA 4HOHA 1FZUA 1ZX2A 2WGOA 1GMPA 3X40A 1DE3A 1BRJA 3AHWA 3S5CA 4K1UA 4CJNA 1RGAA 3F8HA 4R9KA 3EHCA 1AVLA 1RGKA 1A2PA 4IIAA 3HX8A 2ML6A 1LQMB 1HU9A 4EV2A 1B3SA 1N5PA 3MSOA 1MWSA 2OQEC 2RFRA 4O8SA 1KWIA 4MMZB 1IVXA 3JUPA 2F98A 1Q40A 2IY2A 2IMJA 1G96A 1ULJB 5BU4A 3PGBA 1WNHA 1YVSA 2XSOB 1SARA 3LTBA 1BSAA 4KT3B 4FMBA 2XFTA 2K3DA 1JN5A 3H51A 2WGQA 4K90B 3ZFZA 2CFKA 5IF6A 1B21A 1PYLA 5D81A 7RNTA 5JBSA 3VSYA 5IEPA 2KF5A 1T5YA 1BRNL 3A5EA 1FUTA 1I0XA 1I2FA 2RNTA 1L5GB 3T8UA 3GSPA 4MEIA 1IV7A 2CKFB 1BRSA 4O3VA 1CYVA 3MG2A 1O7WB 5KP4A 3I563 2P0MA 1O7MB 9RNTA 2CWTA 2F56A 2F99A 5IW9A 2W56B 1UGHI 5ELJA 1D6ZA 1YIT3 2QGUA 2P05A 1VQ53 2LQVA 2IUKA 3X3ZA 5KP3A 4HJLB 1PU4A 1YIJ3 3CCL3 1EKMA 1NWWA 3Q3FA 5ELUA 4N3VA 1TFKA 4CPKA 2XH9A 2F5WA 1QAKA 1W5ZA 3LYGA 1VQO3 3AHSA 4N6NB 5AEUB 3KSPA 3FGYA 5EVHA 5IG5A 1YJ93 1Y4KA 3WMDA 5G1LA 3FZWA 3OXAA 1TFOA 4MMXB 1W6CA 2ML5A 3CCU3 5D82A 1JNQA 2B1XB 3X41A 3ER7A 1BNFA 2F4YA 2XFSA 1VQ43 1STFI 6RNTA 2V1LA 1LOXA 1UCJA 1BNRA 5AEWB 3MHEA 1BUQA 5AYRB 1US1A 2HMNB 2KF4A 3RDEA 1VQ63 2QIYA 4LYLB 3GZBA 1Z1SA 3QK9A 2CG1A 1X1YA 2K0MA 2UX0A 4ZM8A 2SBLA 3G6E3 1GOYA 4HM2B 1RGEA 2D42A 2ZL8A 1YJW3 3LOYA 1VZZA 2BMRB 3KFQC 3GRDA 4WP5A 2J8XB 1Q7Y4 1VQL3 5BIRA 2ZA4A 5EEOA 3K63A 2RGQA 1EEJA 3KIIA 3AMOB 4BL3A 2PNCA 1RN1A 1S723 1NJI4 2E2TA 1RGLA 2CX0A 1W2ZA 2YFIB
chains in the Genus database with same CATH topology
3DGNA 1VQ93 1LNHA 3WDGB 3SVAA 1NU3A 3CCM3 3NM2A 3FLJA 3IMAB 1W6GA 5CXOA 4EXRA 3OW22 2WO0A 3QRDA 1FGRA 1F8NA 1TUHA 1MNLA 3EBYA 2HMOB 4EV5A 2XRXB 1GY7A 2XGNA 1IQ8A 2XGLA 3KZTA 1TU5A 1LVNA 1Q824 2BMOB 1KSIA 3MPHA 3L0RA 1W00A 3MG1A 4K1VA 1YJN3 3K5TA 1SIHA 4L8PA 1JRQA 1K9M4 1W02A 1WQLB 3I553 4LMIA 1SQWA 1RRHA 4IPBA 5FGOA 2PZVA 4N6TA 5AIFA 3NM7A 3FKAA 1C7HA 4N6OB 3S28A 1ROAA 1O7GB 2W0QA 4HM0B 3WOFB 1QVG2 1A90A 3CNXA 1GS3A 4HM5B 3B4PA 5IG4A 2BT3A 3WA3A 3NUVA 4NHFA 3CCQ3 1VQP3 1N5HA 3LZAA 3UL6A 3STDA 2JDIH 1N8QA 3F8XA 1IVVA 4NREA 5DRVA 1K734 2F86B 2E2UA 3JVCA 4STDA 3EC9A 1SJWA 4ORLA 3S27A 1UI7A 1OPYA 3OWUA 3PCRA 3RGRA 2KRTA 3I0YA 1W01A 2CH9A 4HKVB 3X42A 2XSHB 4KFDA 3FSDA 1GD3A 4WYKB 1W7CA 1OHSA 1Q814 2C10A 7STDA 2STDA 3JUOA 4JF8A 3SX1A 1STDA 4FCJA 2P0XA 5CLKA 3FH1A 3BNDA 4U13A 5IG0A 1FA3A 3UJMA 3G4S3 4H61A 1M9GA 1JB2A 3NX0A 1JKGA 3S29A 2OQEA 2CC3A 2FNQA 1QALA 3DXOA 3U97A 1NO3A 4OK0A 1IV9A 1OF5B 3LH4A 2P38A 1JKGB 1QJGA 1JB5A 1UW1A 3S67A 5IG3A 1IT8A 3GZXB 3DGMA 3EE1A 5AIHA 3U1WA 3FG3A 1OGZA 1E97A 5BXQA 1QVF2 2W56A 3JUMA 4J8TA 2YFJB 1QAFA 1RN7A 3DY5A 1WTHA 3H3HA 3V99A 5TGNA 5I97A 1O7PB 1VQM3 5D83A 3FCSB 3CPOA 4WFOA 3GWRA 3CME3 2MC8A 3KE7A 3V92A 4CDLA 5IEOA 4CCVA 3LT9A 3N9HA 3PYJA 1IT7A 5KP1A 1DMQA 4AEQA 3LMLA 4H3UA 3NQYA 1WMOA 1OHOA 2O3OA 3VF1A 3LTDA 5AIIA 1K8A4 2CW9A 4N6UA 2GBXB 3CNMA 3ECFA 3T0UA 3HI7A 1Q864 3BNCA 2OCTA 1K28A 1AVKA 1W6YA 3A76A 1GY6A 2OTJ3 1WMPA 3LTAA 2D1WA 3MKIA 3BNEA 3EB8A 4FMAA 4HM6B 3SLUA 4O2HA 2CFDA 1OHPA 2W9PA 1OCVA 3AMOA 3DGLA 1NDOB 4PEJA 1YVBI 4O02B 4X2HA 1N9JA 1SIIA 1OACA 2INXA 1IVUA 2CHCA 3NQZA 3D3LA 2BO9B 1KD14 2W04A 2RCDA 3OV4A 1GYBA 3NV0B 4JRFA 4WHAA 1RJOA 1MOLA 4RZMA 3D9RA 1OH0A 1AV4A 1YI23 1FUWA 4XM4A 4HBRA 3FF0A 1KC84 1CEWI 3TDGA 3DMCA 2W6JH 3OWYA 3PCSA 3J7Yd 2W2CA 3VGNA 1N8R4 2Q07A 2CWVA 3GAXA 5LC7A 5IERA 1A2VA 2OWPA 3GZRA 4HZBB 3WOEB 4EYCA 1DVCA 2GEYA 4K61A 2YX9A 1J2BA 2P09A 1PFPA 2GU1A 4WWUC 1TIJA 2OOVC 5CK6A 1CYUA 2KCDA 4LZIA 4HM3B 3Q1CA 2E2VA 3ROBA 5BVBA 3CCJ3 1M1K4 2OOVA 4BTXA 2Z7AA 3LT8A 1YGEA 3DGOA 3F7SA 1D6YA 3BNBA 2M7OA 1SPUA 3CPW2 1JB4A 3PS8A 4I4KA 4RNZA 1GD4A 1S5AA 4WYKA 3G0KA 3CXC2 4FCZA 1OGXA 3GZYB 1UI8A 3JUQA 2CFGA 1ZO2A 4LSOA 4BTYA 3G16A 5IENA 4QWTA 1LXEA 4XDWA 3FF2A 4HM4B 1IDPA 2JQ5A 3CC73 1OF5A 3T8NA 1EQKA 3BLZA 4EBGA 1RRLA 2Z77A 3UB1A 2Y74A 1FGQA 4N6MA 5HGRA 3B7CA 2RSXA 1U8CB 2XR8B 2Z6BA 4HVNA 3EQQB 2CWUA 2XEPA 4LGQA 4HYZA 4GB5A 2HMJB 4N6LA 1CQSA 3EN8A 3KSED 4HM7B 3F9SA 3BB9A 3OWSA 3F14A 3SOYA 3K0ZA 3OX9A 2HMMB 3EF8A 4J9AA 2YFLB 5LC6A 4IT7A 1IQYA 2CK3H 4HM1B 1A2KA 8CHOA 1R4CA 5AIGA 1KQS2 2HMLB 1VQN3 5JPPA 2KXGA 3Q2PA 4KVHA 1M904 1Q40B 1O7HB 1O7NB 5G2GA 2CFWA 2GBWB 3NBJA 2CIUA 3HIIA 3EBTA 1Q42A 1W2B2 4Q53A 5JPUA 3WA2X 3PXMA 1JN5B 2IUJA 3CD63 1W4NA 4HM8B 3LXUX 4BTWA 3E99A 1V74A 2L4VA 1IVWA 3X3YA 2BNGA 3CCS3 1GY5A 4KZ1A 3CCV3 4EC6A 2CG0A 3N54B 2HMKB 2WOFA 3LTCA 2ZDJA 3F40A 4G1MB 1VQ83 2R4IA 2Z76A 2B24B 3K9MC 1TP6A 1UUWB 2GXFA 1FGMA 3F7XA 4R4KA 3EN1B 4R1KA 3RGAA 3SEDA 3NBBA 4XDVA 3IPTA 3PZWA 1NB3I 1NB5I 4TX4A 1VQ73 4MJDA 4HZ9B 1OUNA 3B4OA 3MWZA 1AR0A 4R9LA 3NHXA 2GEXA 3HIGA 3X3XA 4XBTA 3WODG 2O9UX 1M1XB 3Q90A 1JJ22 3MG3A 3CMA3 3NV0A 2XF3A 1U5OA 2BHMA 4KFFA 4RNYA 1ASKA 3EJVA 4GL6A 3SXXA 4AKZA 2OTL3 1DMMA 2K54A 2Y73A 2QA43 4LEHA 3DUKA 4X2OA 3V98A 5STDA 1IU7A 3G713 4XBXA 3CCR3 4MMYB 1DYUA 6STDA 4FMDA 2FGTA 2BMQB 3KKGA 2MF7A 5CF2A 1A67A 1DVDA 5AYSC 5DREA 3CC23 1ISKA 1D6UA 3CU3A 4RBNA 3K7CA 4AKYA 3HZPA 2C11A 1FGTA 3B8LA 1HKXA 5AI1A 3HK4A 4L8OA 3UL5A 4R80A 2WOHA 5A0OB 1E3VA 1ULIB 3DZLA 3M8CA 3UNLA 5CF1A 4FCMA 4KFEA 3SOAA 1IK3A 5EQLA 1RKYA 3DM8A 3FG1A 2I9WA 3ALAA 3FG4A 4FR9A 3EX9A 3NXJA 3KN4A 2W03A 5FW5A 4XBYA 1N9EA 3JUNA 4N6V0 4OUQA 4XB5A 2CFLA 2FXTA 1YHQ3 1VQK3 3N8BA 3O8YA 4FMCA 1WMNA 2A15A 3MYTA 1DMNA 3NBRA 4L7KA 1EA2A 1EG9B 3G8ZA 2QEX3 1ROVA 3CC43 1IQXA 2GU3A 1K41A 2LYXA 1JV2B 2IA7A 3IJEB 2W9QA 1FGOA 4OVMA 1UUVB 1E3RA 1QMAA 3CCE3 1ZX2A 2WGOA 3X40A 3S5CA 4K1UA 3F8HA 4R9KA 3EHCA 1AVLA 4IIAA 3HX8A 2ML6A 1HU9A 4EV2A 1N5PA 3MSOA 2OQEC 2RFRA 4O8SA 1KWIA 4MMZB 1IVXA 3JUPA 2F98A 1Q40A 2IMJA 1G96A 1ULJB 3PGBA 1WNHA 2XSOB 3LTBA 4FMBA 2XFTA 1JN5A 3H51A 2WGQA 4K90B 2CFKA 5IF6A 5D81A 5JBSA 3VSYA 5IEPA 1T5YA 1L5GB 3T8UA 4MEIA 1IV7A 2CKFB 4O3VA 1CYVA 3MG2A 1O7WB 5KP4A 3I563 2P0MA 1O7MB 2CWTA 2F99A 5IW9A 2W56B 5ELJA 1D6ZA 1YIT3 2QGUA 2P05A 1VQ53 2LQVA 2IUKA 3X3ZA 5KP3A 4HJLB 1PU4A 1YIJ3 3CCL3 1EKMA 1NWWA 5ELUA 4N3VA 1TFKA 2XH9A 1QAKA 1W5ZA 3LYGA 1VQO3 4N6NB 5AEUB 3KSPA 3FGYA 5EVHA 5IG5A 1YJ93 1Y4KA 3WMDA 3FZWA 3OXAA 1TFOA 4MMXB 1W6CA 2ML5A 3CCU3 5D82A 1JNQA 2B1XB 3X41A 3ER7A 1VQ43 2XFSA 1STFI 2V1LA 1LOXA 5AEWB 3MHEA 1BUQA 5AYRB 1US1A 2HMNB 3RDEA 1VQ63 2QIYA 3GZBA 1Z1SA 3QK9A 2CG1A 2K0MA 2UX0A 4ZM8A 2SBLA 3G6E3 4HM2B 2D42A 2ZL8A 1YJW3 3LOYA 1VZZA 2BMRB 3KFQC 3GRDA 4WP5A 1Q7Y4 1VQL3 5EEOA 3K63A 2RGQA 3KIIA 3AMOB 1NJI4 2PNCA 1S723 2E2TA 1W2ZA 2YFIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU3 A;  3NM2 A;  3FLJ A;  5CXO A;  1TUH A;  3EBY A;  2HMO B;  2XRX B;  1GY7 A;  3KZT A;  2BMO B;  1W00 A;  3MG1 A;  4K1V A;  4L8P A;  1W02 A;  1WQL B;  4LMI A;  2PZV A;  5AIF A;  3FKA A;  1C7H A;  1O7G B;  4HM0 B;  3CNX A;  1GS3 A;  4HM5 B;  3B4P A;  5IG4 A;  3NUV A;  3LZA A;  3STD A;  3F8X A;  5DRV A;  2F86 B;  4STD A;  3EC9 A;  1SJW A;  4ORL A;  3OWU A;  1OPY A;  3RGR A;  3I0Y A;  1W01 A;  4HKV B;  2XSH B;  3FSD A;  4WYK B;  1OHS A;  7STD A;  2STD A;  3JUO A;  1STD A;  4FCJ A;  5CLK A;  3FH1 A;  4U13 A;  5IG0 A;  3UJM A;  1JB2 A;  1JKG A;  3DXO A;  1OF5 B;  1JKG B;  1QJG A;  1JB5 A;  5IG3 A;  3GZX B;  5AIH A;  1OGZ A;  1E97 A;  5BXQ A;  3JUM A;  4J8T A;  2YFJ B;  3H3H A;  5TGN A;  1O7P B;  5D83 A;  3CPO A;  3GWR A;  3KE7 A;  4CDL A;  5IEO A;  5KP1 A;  1DMQ A;  4H3U A;  1OHO A;  5AII A;  2GBX B;  3CNM A;  3ECF A;  1W6Y A;  3A76 A;  1GY6 A;  3MKI A;  4HM6 B;  1OHP A;  1OCV A;  1NDO B;  4PEJ A;  4X2H A;  2INX A;  2CHC A;  2RCD A;  3OV4 A;  1GYB A;  3NV0 B;  4RZM A;  3D9R A;  1OH0 A;  4XM4 A;  3FF0 A;  3DMC A;  3OWY A;  2W2C A;  3VGN A;  5IER A;  2OWP A;  3GZR A;  4HZB B;  2GEY A;  4WWU C;  5CK6 A;  4HM3 B;  3ROB A;  5BVB A;  2Z7A A;  3F7S A;  1JB4 A;  4I4K A;  1S5A A;  4WYK A;  3G0K A;  1OGX A;  3GZY B;  3JUQ A;  1ZO2 A;  3G16 A;  5IEN A;  4XDW A;  3FF2 A;  4HM4 B;  1IDP A;  2JQ5 A;  1OF5 A;  3T8N A;  3BLZ A;  2Z77 A;  5HGR A;  3B7C A;  2XR8 B;  4HVN A;  3EQQ B;  4LGQ A;  4GB5 A;  2HMJ B;  1CQS A;  3EN8 A;  4HM7 B;  3F9S A;  3BB9 A;  3SOY A;  3F14 A;  3OWS A;  3K0Z A;  3OX9 A;  2HMM B;  3EF8 A;  4J9A A;  2YFL B;  4HM1 B;  1A2K A;  8CHO A;  5AIG A;  2HML B;  5JPP A;  4KVH A;  1Q40 B;  1O7H B;  1O7N B;  5G2G A;  2GBW B;  3EBT A;  1Q42 A;  4Q53 A;  5JPU A;  1JN5 B;  4HM8 B;  3E99 A;  2BNG A;  1GY5 A;  2HMK B;  3F40 A;  2R4I A;  2Z76 A;  2B24 B;  1TP6 A;  1UUW B;  2GXF A;  3F7X A;  3EN1 B;  4R1K A;  3RGA A;  3SED A;  4XDV A;  3IPT A;  4MJD A;  4HZ9 B;  1OUN A;  3B4O A;  4R9L A;  1AR0 A;  3NHX A;  2GEX A;  4XBT A;  3Q90 A;  3MG3 A;  3NV0 A;  1U5O A;  1ASK A;  3EJV A;  1DMM A;  2K54 A;  4LEH A;  3DUK A;  4X2O A;  5STD A;  4XBX A;  6STD A;  2BMQ B;  3KKG A;  5CF2 A;  5DRE A;  1ISK A;  3CU3 A;  3K7C A;  3HZP A;  3B8L A;  1HKX A;  5AI1 A;  3HK4 A;  1E3V A;  1ULI B;  3DZL A;  3M8C A;  3UNL A;  5CF1 A;  4FCM A;  3SOA A;  3DM8 A;  2I9W A;  3EX9 A;  3NXJ A;  5FW5 A;  4XBY A;  3JUN A;  4OUQ A;  4XB5 A;  2A15 A;  3MYT A;  1DMN A;  3NBR A;  4L7K A;  1EA2 A;  1EG9 B;  3G8Z A;  1K41 A;  4OVM A;  1UUV B;  1E3R A;  1QMA A;  1ZX2 A;  3S5C A;  4K1U A;  3F8H A;  4R9K A;  3EHC A;  4IIA A;  3HX8 A;  3MSO A;  2RFR A;  3JUP A;  2F98 A;  1Q40 A;  2IMJ A;  1ULJ B;  2XSO B;  1JN5 A;  3H51 A;  5IF6 A;  5D81 A;  3VSY A;  5IEP A;  3T8U A;  2CKF B;  3MG2 A;  1O7W B;  5KP4 A;  1O7M B;  2F99 A;  2QGU A;  5KP3 A;  4HJL B;  1NWW A;  4N3V A;  3LYG A;  5AEU B;  3KSP A;  3FGY A;  5EVH A;  5IG5 A;  3WMD A;  3FZW A;  3OXA A;  5D82 A;  2B1X B;  3ER7 A;  5AEW B;  3MHE A;  1BUQ A;  2HMN B;  2QIY A;  3GZB A;  1Z1S A;  2UX0 A;  4HM2 B;  1VZZ A;  2BMR B;  4WP5 A;  3GRD A;  2RGQ A;  4L8O A;  2YFI B; 
#chains in the Genus database with same CATH topology
 1BSC A;  3DGN A;  1VQ9 3;  2AAE A;  1LNH A;  3WDG B;  1RGC A;  3SVA A;  1NU3 A;  1GMQ A;  3CCM 3;  3NM2 A;  3FLJ A;  3IMA B;  1W6G A;  5CXO A;  4EXR A;  3OW2 2;  1V57 A;  2WO0 A;  1BVI A;  1FGR A;  3QRD A;  1X1X A;  1F8N A;  1TUH A;  1MNL A;  3EBY A;  1C54 A;  2HMO B;  4EV5 A;  2XRX B;  1GY7 A;  2XGN A;  1IQ8 A;  1LRA A;  2KAA A;  2XGL A;  3BU4 A;  3KZT A;  1TU5 A;  1LVN A;  1Q82 4;  3D4A A;  2BMO B;  1KSI A;  3MPH A;  3L0R A;  1W00 A;  1RLS A;  1RTU A;  3MG1 A;  4K1V A;  1YJN 3;  3K5T A;  1SIH A;  4L8P A;  1JRQ A;  1K9M 4;  1W02 A;  1WQL B;  3I55 3;  4LMI A;  1SQW A;  2SAR A;  1RRH A;  4IPB A;  5FGO A;  2PZV A;  4N6T A;  5AIF A;  3NM7 A;  3FKA A;  1C7H A;  4N6O B;  3S28 A;  1ROA A;  1O7G B;  2W0Q A;  4HM0 B;  3WOF B;  1LQG C;  1QVG 2;  1I3I A;  1UGI A;  1A90 A;  3CNX A;  1GS3 A;  1RHL A;  1FUS A;  2BU4 A;  2BT3 A;  3B4P A;  4HM5 B;  5IG4 A;  3WA3 A;  2ZHX B;  3NUV A;  4NHF A;  3CCQ 3;  1AY7 A;  1VQP 3;  1N5H A;  3LZA A;  3UL6 A;  3STD A;  2JDI H;  1N8Q A;  1RNB A;  3F8X A;  1IVV A;  4NRE A;  5GSP A;  5DRV A;  1K73 4;  1IYY A;  2F86 B;  2E2U A;  3JVC A;  4STD A;  3EC9 A;  1SJW A;  4ORL A;  1JBT A;  3S27 A;  1UI7 A;  1OPY A;  3OWU A;  3PCR A;  3RGR A;  4GSP A;  2KRT A;  3I0Y A;  1UCL A;  4BIR A;  1W01 A;  2CH9 A;  4HKV B;  1RNT A;  3X42 A;  1I2G A;  2XSH B;  4KFD A;  3URP A;  3FSD A;  3D5I A;  1GD3 A;  4J5G A;  1GOV A;  5M18 A;  4WYK B;  1W7C A;  1OHS A;  1Q81 4;  4GHO A;  2C10 A;  7STD A;  2STD A;  3JUO A;  4JF8 A;  3SX1 A;  1STD A;  1X1W A;  4FCJ A;  2P0X A;  5CLK A;  2AAD A;  3AGN A;  3FH1 A;  3BND A;  4U13 A;  5IG0 A;  1TTO A;  1FA3 A;  3UJM A;  1BNE A;  1GSP A;  3G4S 3;  4H61 A;  1M9G A;  1JB2 A;  3NX0 A;  1JKG A;  3S29 A;  2OQE A;  2CC3 A;  2FNQ A;  1QAL A;  3DXO A;  3U97 A;  1NO3 A;  4OK0 A;  1IV9 A;  1OF5 B;  3LH4 A;  2P38 A;  1JKG B;  5G1K A;  1JZD A;  1QJG A;  1JB5 A;  1UW1 A;  3KCH A;  3S67 A;  5IG3 A;  3HOH A;  1IT8 A;  3GZX B;  3DGM A;  2RBI A;  3EE1 A;  5AIH A;  3DH2 A;  3U1W A;  3FG3 A;  1OGZ A;  3WHO A;  5RNT A;  1E97 A;  5BXQ A;  1QVF 2;  2W56 A;  3JUM A;  4J8T A;  2YFJ B;  1QAF A;  1BNJ A;  1RN7 A;  1RMS A;  3DY5 A;  1I3F A;  1WTH A;  3H3H A;  3V99 A;  1TRQ A;  5TGN A;  5I97 A;  1O7P B;  1Q9E A;  1BRG A;  1VQM 3;  5D83 A;  3FCS B;  3CPO A;  1EUI C;  3AGO A;  4WFO A;  3GWR A;  3CME 3;  1T2I A;  2MC8 A;  1RN4 A;  3KE7 A;  3V92 A;  4CDL A;  5IEO A;  4CCV A;  3LT9 A;  3N9H A;  1I70 A;  3PYJ A;  1IT7 A;  5KP1 A;  1DMQ A;  4AEQ A;  3LML A;  4H3U A;  3NQY A;  1WMO A;  1OHO A;  2O3O A;  3VF1 A;  3LTD A;  3DGY A;  5AII A;  1BNG A;  2CW9 A;  4N6U A;  1K8A 4;  2GBX B;  1BRK A;  3CNM A;  3ECF A;  3ZG5 A;  3T0U A;  3HI7 A;  1Q86 4;  3BNC A;  2OCT A;  1K28 A;  1AVK A;  1V58 A;  1W6Y A;  1GY6 A;  3A76 A;  2OTJ 3;  2R41 A;  1WMP A;  1G02 A;  3LTA A;  2D1W A;  3MKI A;  3BNE A;  3EB8 A;  4FMA A;  4HM6 B;  3SLU A;  4O2H A;  4DKI A;  2CFD A;  2BIR A;  1OHP A;  2W9P A;  1OCV A;  3AMO A;  3DGL A;  1NDO B;  4PEJ A;  1YVB I;  4O02 B;  4X2H A;  1N9J A;  1SII A;  1OAC A;  1MWT A;  1IVU A;  2CHC A;  2INX A;  3D3L A;  3NQZ A;  1CH0 A;  2BO9 B;  1KD1 4;  2W04 A;  2RCD A;  3OV4 A;  1GYB A;  3NV0 B;  4JRF A;  4WHA A;  1RJO A;  1MOL A;  4RZM A;  3D9R A;  4RNT A;  1OH0 A;  1LOY A;  1AV4 A;  1YI2 3;  1PY3 A;  1B20 A;  1FUW A;  4XM4 A;  1YNV X;  4HBR A;  3FF0 A;  1KC8 4;  1FYS A;  1CEW I;  3TDG A;  3DMC A;  2W6J H;  3OWY A;  3PCS A;  3J7Y d;  2W2C A;  3VGN A;  1N8R 4;  2Q07 A;  2CWV A;  3GAX A;  5LC7 A;  5IER A;  1BNS A;  1A2V A;  2OWP A;  3GZR A;  4HZB B;  3WOE B;  1R4Y A;  4EYC A;  1DVC A;  2GEY A;  4K61 A;  4ILF A;  2YX9 A;  1J2B A;  1I0V A;  1I2E A;  2P09 A;  2L1S A;  1PFP A;  2KF6 A;  2GU1 A;  4WWU C;  1TIJ A;  2OOV C;  5CK6 A;  1LNI A;  4I5Q A;  1CYU A;  2KCD A;  4LZI A;  4HM3 B;  3Q1C A;  2E2V A;  3ROB A;  5BVB A;  3CCJ 3;  1BRI A;  1M1K 4;  2OOV A;  4BTX A;  2Z7A A;  3LT8 A;  1YGE A;  3DGO A;  3F7S A;  2H0G A;  1D6Y A;  3BNB A;  2M7O A;  1SPU A;  8RNT A;  1JB4 A;  2GSP A;  3PS8 A;  4I4K A;  4RNZ A;  3CPW 2;  1GD4 A;  1S5A A;  4WYK A;  3G0K A;  1BOX A;  3CXC 2;  4FCZ A;  4BL2 A;  1OGX A;  3GZY B;  1UI8 A;  3JUQ A;  2CFG A;  1ZO2 A;  4LSO A;  4BTY A;  3G16 A;  5IEN A;  4QWT A;  1LXE A;  4XDW A;  3FF2 A;  4HM4 B;  1IDP A;  2JQ5 A;  6GSP A;  3CC7 3;  1OF5 A;  3T8N A;  1EQK A;  3BLZ A;  4EBG A;  1RRL A;  2Z77 A;  3UB1 A;  2Y74 A;  1FGQ A;  4N6M A;  5HGR A;  3B7C A;  2RSX A;  1U8C B;  1RGG A;  2XR8 B;  2Z6B A;  4HVN A;  3EQQ B;  2CWU A;  2KF3 A;  2H0I A;  2XEP A;  4LGQ A;  4HYZ A;  4GB5 A;  1T3B A;  2HMJ B;  4N6L A;  1CQS A;  3EN8 A;  3KSE D;  4HM7 B;  3F9S A;  1GOU A;  3BB9 A;  3OWS A;  3F14 A;  3SOY A;  3K0Z A;  3OX9 A;  7GSP A;  2HMM B;  3EF8 A;  4J9A A;  2YFL B;  5HOH A;  1RGF A;  4BU4 A;  5LC6 A;  4IT7 A;  1IQY A;  2CK3 H;  4HM1 B;  1A2K A;  8CHO A;  1R4C A;  5AIG A;  1KQS 2;  2HML B;  1VQN 3;  5JPP A;  2KXG A;  3Q2P A;  5M19 A;  4KVH A;  1HZ1 A;  1M90 4;  1Q40 B;  2HOH A;  1O7H B;  1BSE A;  1O7N B;  5G2G A;  2CFW A;  2GBW B;  3NBJ A;  2CIU A;  3HII A;  3EBT A;  1Q42 A;  1UDI I;  1W2B 2;  4Q53 A;  5JPU A;  3WA2 X;  3PXM A;  3RNT A;  3SYU A;  1JN5 B;  2IUJ A;  3CD6 3;  1W4N A;  4HM8 B;  3LXU X;  4BTW A;  2UUG C;  3E99 A;  1V74 A;  2L4V A;  1IVW A;  3X3Y A;  2BNG A;  3CCS 3;  1BSB A;  1GY5 A;  4KZ1 A;  3D5G A;  1LOV A;  3CCV 3;  4EC6 A;  2CG0 A;  3N54 B;  2HMK B;  2WOF A;  4EW5 A;  3LTC A;  2ZDJ A;  3F40 A;  4G1M B;  1VQ8 3;  2R4I A;  2Z76 A;  3WR2 A;  2B24 B;  3K9M C;  1TP6 A;  1UUW B;  2H0H A;  2GXF A;  1RDS A;  1FGM A;  3F7X A;  1ZS7 A;  3EN1 B;  1TRP A;  4R4K A;  4R1K A;  3RGA A;  1UCK A;  3SED A;  3NBB A;  4XDV A;  1B2S A;  3IPT A;  3PZW A;  3D79 A;  1NB3 I;  1NB5 I;  4TX4 A;  1VQ7 3;  4MJD A;  4HZ9 B;  1OUN A;  3B4O A;  3MWZ A;  1AR0 A;  4R9L A;  3NHX A;  1AQZ A;  2GEX A;  3HIG A;  1RCK A;  3X3X A;  1BU4 A;  4XBT A;  1T2H A;  3WOD G;  2O9U X;  1M1X B;  1GMR A;  1MGW A;  3Q90 A;  1JJ2 2;  1JBR A;  3MG3 A;  1BSD A;  3CMA 3;  3NV0 A;  2XF3 A;  1U5O A;  1VQQ A;  2BHM A;  4KFF A;  4RNY A;  1ASK A;  3EJV A;  1HYF A;  1TJD A;  4GL6 A;  1MWR A;  3SXX A;  2F5M A;  4AKZ A;  2OTL 3;  1B27 A;  1DMM A;  2K54 A;  2Y73 A;  2QA4 3;  1RCL A;  4LEH A;  3DUK A;  4X2O A;  1BGS A;  1ZGX A;  3V98 A;  5STD A;  1B2Z A;  1LOW A;  1IU7 A;  3G71 3;  4XBX A;  3CCR 3;  4MMY B;  1DYU A;  1JBS A;  6STD A;  4FMD A;  2FGT A;  1NNV A;  1B2M A;  2BMQ B;  3KKG A;  2MF7 A;  5CF2 A;  1UUG B;  1A67 A;  1DVD A;  5AYS C;  5DRE A;  5M1A A;  3CC2 3;  1ISK A;  1BAN A;  1D6U A;  3CU3 A;  4J5K A;  4RBN A;  3K7C A;  4AKY A;  3HZP A;  2C11 A;  1FGT A;  3B8L A;  1HKX A;  1Q7H A;  5AI1 A;  3HK4 A;  4L8O A;  1BAO A;  3UL5 A;  4R80 A;  2WOH A;  5A0O B;  1B2U A;  1E3V A;  1ULI B;  3DZL A;  3M8C A;  3UNL A;  5CF1 A;  4FCM A;  4KFE A;  3SOA A;  1IK3 A;  1DET A;  5EQL A;  1RKY A;  3DM8 A;  1UCI A;  1BNI A;  3FG1 A;  1FW7 A;  1JZO A;  2I9W A;  3ALA A;  3FG4 A;  4FR9 A;  4NPB A;  3ZG0 A;  3EX9 A;  2C4B A;  3KN4 A;  3NXJ A;  2IYJ A;  2W03 A;  3BIR A;  5FW5 A;  2UGI A;  4XBY A;  1N9E A;  1YGW A;  3JUN A;  4N6V 0;  1G0T A;  4OUQ A;  4HAA A;  1X1U A;  4XB5 A;  2CX1 A;  2CFL A;  2FXT A;  1I8V A;  1YHQ 3;  1VQK 3;  3N8B A;  3O8Y A;  1BRH A;  4FMC A;  1WMN A;  1RGH A;  2A15 A;  3MYT A;  1DMN A;  3NBR A;  4L7K A;  1EA2 A;  1EG9 B;  3G8Z A;  2QEX 3;  1ROV A;  3CC4 3;  1IQX A;  1RSN A;  2GU3 A;  1K41 A;  2LYX A;  1JV2 B;  2IA7 A;  3IJE B;  1MGR A;  1MWU A;  1FGO A;  1BIR A;  2W9Q A;  1UUV B;  4OVM A;  1B2X A;  1E3R A;  1QMA A;  3CCE 3;  1BUJ A;  4HOH A;  1FZU A;  1ZX2 A;  2WGO A;  1GMP A;  3X40 A;  1DE3 A;  1BRJ A;  3AHW A;  3S5C A;  4K1U A;  4CJN A;  1RGA A;  3F8H A;  4R9K A;  3EHC A;  1AVL A;  1RGK A;  1A2P A;  4IIA A;  3HX8 A;  2ML6 A;  1LQM B;  1HU9 A;  4EV2 A;  1B3S A;  1N5P A;  3MSO A;  1MWS A;  2OQE C;  2RFR A;  4O8S A;  1KWI A;  4MMZ B;  1IVX A;  3JUP A;  2F98 A;  1Q40 A;  2IY2 A;  2IMJ A;  1G96 A;  1ULJ B;  5BU4 A;  3PGB A;  1WNH A;  1YVS A;  2XSO B;  1SAR A;  3LTB A;  1BSA A;  4KT3 B;  4FMB A;  2XFT A;  2K3D A;  1JN5 A;  3H51 A;  2WGQ A;  4K90 B;  3ZFZ A;  2CFK A;  5IF6 A;  1B21 A;  1PYL A;  5D81 A;  7RNT A;  5JBS A;  3VSY A;  5IEP A;  2KF5 A;  1T5Y A;  1BRN L;  3A5E A;  1FUT A;  1I0X A;  1I2F A;  2RNT A;  1L5G B;  3T8U A;  3GSP A;  4MEI A;  1IV7 A;  2CKF B;  1BRS A;  4O3V A;  1CYV A;  3MG2 A;  1O7W B;  5KP4 A;  3I56 3;  2P0M A;  1O7M B;  9RNT A;  2CWT A;  2F56 A;  2F99 A;  5IW9 A;  2W56 B;  1UGH I;  5ELJ A;  1D6Z A;  1YIT 3;  2QGU A;  2P05 A;  1VQ5 3;  2LQV A;  2IUK A;  3X3Z A;  5KP3 A;  4HJL B;  1PU4 A;  1YIJ 3;  3CCL 3;  1EKM A;  1NWW A;  3Q3F A;  5ELU A;  4N3V A;  1TFK A;  4CPK A;  2XH9 A;  2F5W A;  1QAK A;  1W5Z A;  3LYG A;  1VQO 3;  3AHS A;  4N6N B;  5AEU B;  3KSP A;  3FGY A;  5EVH A;  5IG5 A;  1YJ9 3;  1Y4K A;  3WMD A;  5G1L A;  3FZW A;  3OXA A;  1TFO A;  4MMX B;  1W6C A;  2ML5 A;  3CCU 3;  5D82 A;  1JNQ A;  2B1X B;  3X41 A;  3ER7 A;  1BNF A;  2F4Y A;  2XFS A;  1VQ4 3;  1STF I;  6RNT A;  2V1L A;  1LOX A;  1UCJ A;  1BNR A;  5AEW B;  3MHE A;  1BUQ A;  5AYR B;  1US1 A;  2HMN B;  2KF4 A;  3RDE A;  1VQ6 3;  2QIY A;  4LYL B;  3GZB A;  1Z1S A;  3QK9 A;  2CG1 A;  1X1Y A;  2K0M A;  2UX0 A;  4ZM8 A;  2SBL A;  3G6E 3;  1GOY A;  4HM2 B;  1RGE A;  2D42 A;  2ZL8 A;  1YJW 3;  3LOY A;  1VZZ A;  2BMR B;  3KFQ C;  3GRD A;  4WP5 A;  2J8X B;  1Q7Y 4;  1VQL 3;  5BIR A;  2ZA4 A;  5EEO A;  3K63 A;  2RGQ A;  1EEJ A;  3KII A;  3AMO B;  4BL3 A;  2PNC A;  1RN1 A;  1S72 3;  1NJI 4;  2E2T A;  1RGL A;  2CX0 A;  1W2Z A;  2YFI B; 
#chains in the Genus database with same CATH homology
 3DGN A;  1VQ9 3;  1LNH A;  3WDG B;  3SVA A;  1NU3 A;  3CCM 3;  3NM2 A;  3FLJ A;  3IMA B;  1W6G A;  5CXO A;  4EXR A;  3OW2 2;  2WO0 A;  3QRD A;  1FGR A;  1F8N A;  1TUH A;  1MNL A;  3EBY A;  2HMO B;  4EV5 A;  2XRX B;  1GY7 A;  2XGN A;  1IQ8 A;  2XGL A;  3KZT A;  1TU5 A;  1LVN A;  1Q82 4;  2BMO B;  1KSI A;  3MPH A;  3L0R A;  1W00 A;  3MG1 A;  4K1V A;  1YJN 3;  3K5T A;  1SIH A;  4L8P A;  1JRQ A;  1K9M 4;  1W02 A;  1WQL B;  3I55 3;  4LMI A;  1SQW A;  1RRH A;  4IPB A;  5FGO A;  2PZV A;  4N6T A;  5AIF A;  3NM7 A;  3FKA A;  1C7H A;  4N6O B;  3S28 A;  1ROA A;  1O7G B;  2W0Q A;  4HM0 B;  3WOF B;  1QVG 2;  1A90 A;  3CNX A;  1GS3 A;  4HM5 B;  3B4P A;  5IG4 A;  2BT3 A;  3WA3 A;  3NUV A;  4NHF A;  3CCQ 3;  1VQP 3;  1N5H A;  3LZA A;  3UL6 A;  3STD A;  2JDI H;  1N8Q A;  3F8X A;  1IVV A;  4NRE A;  5DRV A;  1K73 4;  2F86 B;  2E2U A;  3JVC A;  4STD A;  3EC9 A;  1SJW A;  4ORL A;  3S27 A;  1UI7 A;  1OPY A;  3OWU A;  3PCR A;  3RGR A;  2KRT A;  3I0Y A;  1W01 A;  2CH9 A;  4HKV B;  3X42 A;  2XSH B;  4KFD A;  3FSD A;  1GD3 A;  4WYK B;  1W7C A;  1OHS A;  1Q81 4;  2C10 A;  7STD A;  2STD A;  3JUO A;  4JF8 A;  3SX1 A;  1STD A;  4FCJ A;  2P0X A;  5CLK A;  3FH1 A;  3BND A;  4U13 A;  5IG0 A;  1FA3 A;  3UJM A;  3G4S 3;  4H61 A;  1M9G A;  1JB2 A;  3NX0 A;  1JKG A;  3S29 A;  2OQE A;  2CC3 A;  2FNQ A;  1QAL A;  3DXO A;  3U97 A;  1NO3 A;  4OK0 A;  1IV9 A;  1OF5 B;  3LH4 A;  2P38 A;  1JKG B;  1QJG A;  1JB5 A;  1UW1 A;  3S67 A;  5IG3 A;  1IT8 A;  3GZX B;  3DGM A;  3EE1 A;  5AIH A;  3U1W A;  3FG3 A;  1OGZ A;  1E97 A;  5BXQ A;  1QVF 2;  2W56 A;  3JUM A;  4J8T A;  2YFJ B;  1QAF A;  1RN7 A;  3DY5 A;  1WTH A;  3H3H A;  3V99 A;  5TGN A;  5I97 A;  1O7P B;  1VQM 3;  5D83 A;  3FCS B;  3CPO A;  4WFO A;  3GWR A;  3CME 3;  2MC8 A;  3KE7 A;  3V92 A;  4CDL A;  5IEO A;  4CCV A;  3LT9 A;  3N9H A;  3PYJ A;  1IT7 A;  5KP1 A;  1DMQ A;  4AEQ A;  3LML A;  4H3U A;  3NQY A;  1WMO A;  1OHO A;  2O3O A;  3VF1 A;  3LTD A;  5AII A;  1K8A 4;  2CW9 A;  4N6U A;  2GBX B;  3CNM A;  3ECF A;  3T0U A;  3HI7 A;  1Q86 4;  3BNC A;  2OCT A;  1K28 A;  1AVK A;  1W6Y A;  3A76 A;  1GY6 A;  2OTJ 3;  1WMP A;  3LTA A;  2D1W A;  3MKI A;  3BNE A;  3EB8 A;  4FMA A;  4HM6 B;  3SLU A;  4O2H A;  2CFD A;  1OHP A;  2W9P A;  1OCV A;  3AMO A;  3DGL A;  1NDO B;  4PEJ A;  1YVB I;  4O02 B;  4X2H A;  1N9J A;  1SII A;  1OAC A;  2INX A;  1IVU A;  2CHC A;  3NQZ A;  3D3L A;  2BO9 B;  1KD1 4;  2W04 A;  2RCD A;  3OV4 A;  1GYB A;  3NV0 B;  4JRF A;  4WHA A;  1RJO A;  1MOL A;  4RZM A;  3D9R A;  1OH0 A;  1AV4 A;  1YI2 3;  1FUW A;  4XM4 A;  4HBR A;  3FF0 A;  1KC8 4;  1CEW I;  3TDG A;  3DMC A;  2W6J H;  3OWY A;  3PCS A;  3J7Y d;  2W2C A;  3VGN A;  1N8R 4;  2Q07 A;  2CWV A;  3GAX A;  5LC7 A;  5IER A;  1A2V A;  2OWP A;  3GZR A;  4HZB B;  3WOE B;  4EYC A;  1DVC A;  2GEY A;  4K61 A;  2YX9 A;  1J2B A;  2P09 A;  1PFP A;  2GU1 A;  4WWU C;  1TIJ A;  2OOV C;  5CK6 A;  1CYU A;  2KCD A;  4LZI A;  4HM3 B;  3Q1C A;  2E2V A;  3ROB A;  5BVB A;  3CCJ 3;  1M1K 4;  2OOV A;  4BTX A;  2Z7A A;  3LT8 A;  1YGE A;  3DGO A;  3F7S A;  1D6Y A;  3BNB A;  2M7O A;  1SPU A;  3CPW 2;  1JB4 A;  3PS8 A;  4I4K A;  4RNZ A;  1GD4 A;  1S5A A;  4WYK A;  3G0K A;  3CXC 2;  4FCZ A;  1OGX A;  3GZY B;  1UI8 A;  3JUQ A;  2CFG A;  1ZO2 A;  4LSO A;  4BTY A;  3G16 A;  5IEN A;  4QWT A;  1LXE A;  4XDW A;  3FF2 A;  4HM4 B;  1IDP A;  2JQ5 A;  3CC7 3;  1OF5 A;  3T8N A;  1EQK A;  3BLZ A;  4EBG A;  1RRL A;  2Z77 A;  3UB1 A;  2Y74 A;  1FGQ A;  4N6M A;  5HGR A;  3B7C A;  2RSX A;  1U8C B;  2XR8 B;  2Z6B A;  4HVN A;  3EQQ B;  2CWU A;  2XEP A;  4LGQ A;  4HYZ A;  4GB5 A;  2HMJ B;  4N6L A;  1CQS A;  3EN8 A;  3KSE D;  4HM7 B;  3F9S A;  3BB9 A;  3OWS A;  3F14 A;  3SOY A;  3K0Z A;  3OX9 A;  2HMM B;  3EF8 A;  4J9A A;  2YFL B;  5LC6 A;  4IT7 A;  1IQY A;  2CK3 H;  4HM1 B;  1A2K A;  8CHO A;  1R4C A;  5AIG A;  1KQS 2;  2HML B;  1VQN 3;  5JPP A;  2KXG A;  3Q2P A;  4KVH A;  1M90 4;  1Q40 B;  1O7H B;  1O7N B;  5G2G A;  2CFW A;  2GBW B;  3NBJ A;  2CIU A;  3HII A;  3EBT A;  1Q42 A;  1W2B 2;  4Q53 A;  5JPU A;  3WA2 X;  3PXM A;  1JN5 B;  2IUJ A;  3CD6 3;  1W4N A;  4HM8 B;  3LXU X;  4BTW A;  3E99 A;  1V74 A;  2L4V A;  1IVW A;  3X3Y A;  2BNG A;  3CCS 3;  1GY5 A;  4KZ1 A;  3CCV 3;  4EC6 A;  2CG0 A;  3N54 B;  2HMK B;  2WOF A;  3LTC A;  2ZDJ A;  3F40 A;  4G1M B;  1VQ8 3;  2R4I A;  2Z76 A;  2B24 B;  3K9M C;  1TP6 A;  1UUW B;  2GXF A;  1FGM A;  3F7X A;  4R4K A;  3EN1 B;  4R1K A;  3RGA A;  3SED A;  3NBB A;  4XDV A;  3IPT A;  3PZW A;  1NB3 I;  1NB5 I;  4TX4 A;  1VQ7 3;  4MJD A;  4HZ9 B;  1OUN A;  3B4O A;  3MWZ A;  1AR0 A;  4R9L A;  3NHX A;  2GEX A;  3HIG A;  3X3X A;  4XBT A;  3WOD G;  2O9U X;  1M1X B;  3Q90 A;  1JJ2 2;  3MG3 A;  3CMA 3;  3NV0 A;  2XF3 A;  1U5O A;  2BHM A;  4KFF A;  4RNY A;  1ASK A;  3EJV A;  4GL6 A;  3SXX A;  4AKZ A;  2OTL 3;  1DMM A;  2K54 A;  2Y73 A;  2QA4 3;  4LEH A;  3DUK A;  4X2O A;  3V98 A;  5STD A;  1IU7 A;  3G71 3;  4XBX A;  3CCR 3;  4MMY B;  1DYU A;  6STD A;  4FMD A;  2FGT A;  2BMQ B;  3KKG A;  2MF7 A;  5CF2 A;  1A67 A;  1DVD A;  5AYS C;  5DRE A;  3CC2 3;  1ISK A;  1D6U A;  3CU3 A;  4RBN A;  3K7C A;  4AKY A;  3HZP A;  2C11 A;  1FGT A;  3B8L A;  1HKX A;  5AI1 A;  3HK4 A;  4L8O A;  3UL5 A;  4R80 A;  2WOH A;  5A0O B;  1E3V A;  1ULI B;  3DZL A;  3M8C A;  3UNL A;  5CF1 A;  4FCM A;  4KFE A;  3SOA A;  1IK3 A;  5EQL A;  1RKY A;  3DM8 A;  3FG1 A;  2I9W A;  3ALA A;  3FG4 A;  4FR9 A;  3EX9 A;  3NXJ A;  3KN4 A;  2W03 A;  5FW5 A;  4XBY A;  1N9E A;  3JUN A;  4N6V 0;  4OUQ A;  4XB5 A;  2CFL A;  2FXT A;  1YHQ 3;  1VQK 3;  3N8B A;  3O8Y A;  4FMC A;  1WMN A;  2A15 A;  3MYT A;  1DMN A;  3NBR A;  4L7K A;  1EA2 A;  1EG9 B;  3G8Z A;  2QEX 3;  1ROV A;  3CC4 3;  1IQX A;  2GU3 A;  1K41 A;  2LYX A;  1JV2 B;  2IA7 A;  3IJE B;  2W9Q A;  1FGO A;  4OVM A;  1UUV B;  1E3R A;  1QMA A;  3CCE 3;  1ZX2 A;  2WGO A;  3X40 A;  3S5C A;  4K1U A;  3F8H A;  4R9K A;  3EHC A;  1AVL A;  4IIA A;  3HX8 A;  2ML6 A;  1HU9 A;  4EV2 A;  1N5P A;  3MSO A;  2OQE C;  2RFR A;  4O8S A;  1KWI A;  4MMZ B;  1IVX A;  3JUP A;  2F98 A;  1Q40 A;  2IMJ A;  1G96 A;  1ULJ B;  3PGB A;  1WNH A;  2XSO B;  3LTB A;  4FMB A;  2XFT A;  1JN5 A;  3H51 A;  2WGQ A;  4K90 B;  2CFK A;  5IF6 A;  5D81 A;  5JBS A;  3VSY A;  5IEP A;  1T5Y A;  1L5G B;  3T8U A;  4MEI A;  1IV7 A;  2CKF B;  4O3V A;  1CYV A;  3MG2 A;  1O7W B;  5KP4 A;  3I56 3;  2P0M A;  1O7M B;  2CWT A;  2F99 A;  5IW9 A;  2W56 B;  5ELJ A;  1D6Z A;  1YIT 3;  2QGU A;  2P05 A;  1VQ5 3;  2LQV A;  2IUK A;  3X3Z A;  5KP3 A;  4HJL B;  1PU4 A;  1YIJ 3;  3CCL 3;  1EKM A;  1NWW A;  5ELU A;  4N3V A;  1TFK A;  2XH9 A;  1QAK A;  1W5Z A;  3LYG A;  1VQO 3;  4N6N B;  5AEU B;  3KSP A;  3FGY A;  5EVH A;  5IG5 A;  1YJ9 3;  1Y4K A;  3WMD A;  3FZW A;  3OXA A;  1TFO A;  4MMX B;  1W6C A;  2ML5 A;  3CCU 3;  5D82 A;  1JNQ A;  2B1X B;  3X41 A;  3ER7 A;  1VQ4 3;  2XFS A;  1STF I;  2V1L A;  1LOX A;  5AEW B;  3MHE A;  1BUQ A;  5AYR B;  1US1 A;  2HMN B;  3RDE A;  1VQ6 3;  2QIY A;  3GZB A;  1Z1S A;  3QK9 A;  2CG1 A;  2K0M A;  2UX0 A;  4ZM8 A;  2SBL A;  3G6E 3;  4HM2 B;  2D42 A;  2ZL8 A;  1YJW 3;  3LOY A;  1VZZ A;  2BMR B;  3KFQ C;  3GRD A;  4WP5 A;  1Q7Y 4;  1VQL 3;  5EEO A;  3K63 A;  2RGQ A;  3KII A;  3AMO B;  1NJI 4;  2PNC A;  1S72 3;  2E2T A;  1W2Z A;  2YFI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...