3H3HA

Crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
118
Chain Sequence
PITQAFAQQFSREWIDAWNAHDLDAILSHYADGFEMSSPMIVQIAGPSGRLRGKEQVGAYWREALRMIPDLHFEWIATLAGVDSVAIHYRGAKGRLALEVFHFGPDRRVVKALAHYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SnoaL-like protein of unknown function (YP_438428.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
molecule keywords uncharacterized SnoaL-like protein
total genus 37
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h3hA00
3MYTA 3NM2A 4LMIA 1W00A 2RFRA 1OF5A 4N3VA 3RGRA 1JN5B 2K54A 4R9KA 4HKVB 2HMMB 2PZVA 3HZPA 4WYKB 3DUKA 4K1VA 4X2OA 4HZ9B 3UNLA 1OGZA 4L7KA 3K0ZA 2GBXB 1E97A 3OWYA 4U13A 1W6YA 3WMDA 5IG5A 1OPYA 2CHCA 1O7NB 1OF5B 2CKFB 2RCDA 3LZAA 4HZBB 4L8PA 3OX9A 5AEWB 3RGAA 2W2CA 3JUPA 1UUWB 2HMKB 3EF8A 5AI1A 2R4IA 2RGQA 5G2GA 5KP4A 2YFIB 5AIGA 1OHOA 3GZXB 1OUNA 3EX9A 4HM0B 2F99A 3JUMA 2HMOB 2GEYA 3KKGA 1NU3A 2XRXB 3NBRA 5AIHA 5TGNA 3GRDA 1JKGB 1ASKA 3B4PA 3EN8A 3NV0A 3MHEA 5KP1A 1OCVA 1W02A 3F8HA 3G8ZA 1QJGA 4STDA 2XSOB 3SEDA 5CF2A 3MG2A 4KVHA 1JB4A 1OH0A 3DM8A 2F86B 1S5AA 3EN1B 1BUQA 2GXFA 3CNXA 3OXAA 4X2HA 4FCMA 4OVMA 3NV0B 1OGXA 2GBWB 4XDWA 1ZX2A 4HJLB 1O7WB 2YFLB 5STDA 3FGYA 3I0YA 4HM4B 3EBYA 2STDA 2BMOB 4HM2B 3OV4A 4HM3B 3S5CA 2B1XB 4XBXA 1O7PB 1JKGA 1VZZA 1TP6A 3Q90A 1ISKA 5CXOA 4HM8B 5JPPA 1O7GB 3MG3A 1O7MB 1Z1SA 3F7XA 3FLJA 4MJDA 5CLKA 5BXQA 3GZYB 5DREA 1GY6A 2Z7AA 3F14A 3NHXA 4XBYA 1K41A 5D83A 3MKIA 5AIIA 4IIAA 2HMLB 5D81A 1U5OA 1CQSA 2BMQB 1STDA 3ECFA 3GZBA 5IF6A 5IEPA 3GZRA 3IPTA 2Z76A 3G0KA 1JB2A 2A15A 2Z77A 3A76A 4R1KA 3HX8A 2OWPA 5IG3A 3ER7A 5JPUA 3EBTA 2UX0A 3F40A 3OWUA 4LEHA 3FKAA 1UUVB 3JUOA 3JUQA 4XBTA 1DMNA 3LYGA 2BNGA 3JUNA 3D9RA 3KZTA 3EC9A 3EJVA 2I9WA 3FF0A 5KP3A 4I4KA 2F98A 5AEUB 4K1UA 3B7CA 1QMAA 3EQQB 7STDA 4Q53A 4PEJA 5CK6A 1GYBA 1NWWA 4CDLA 1GY7A 3VGNA 2YFJB 4XDVA 3H51A 5D82A 3STDA 1ULJB 2INXA 1Q40A 5IG4A 3E99A 1O7HB 1OHPA 3B4OA 4XB5A 5FW5A 1TUHA 1AR0A 3G16A 4HM1B 5HGRA 3MG1A 5IENA 2B24B 3FSDA 1E3RA 1SJWA 2GEXA 3F8XA 3BB9A 3NUVA 1W01A 4GB5A 8CHOA 1IDPA 3CPOA 4RZMA 5AIFA 3B8LA 1DMMA 1E3VA 3CNMA 4OUQA 3BLZA 3KSPA 4HM7B 5IERA 1GS3A 3NXJA 3ROBA 2XR8B 2HMJB 3SOAA 1NDOB 4HM5B 1EG9B 3DMCA 4R9LA 2HMNB 6STDA 4HM6B 3OWSA 3FH1A 1ZO2A 3F7SA 2IMJA 1EA2A 3DZLA 4WWUC 4WP5A 1OHSA 4ORLA 3SOYA 1JN5A 1A2KA 3KE7A 1HKXA 1WQLB 1JB5A 3CU3A 4J8TA 4WYKA 3UJMA 5BVBA 3HK4A 4J9AA 5DRVA 2XSHB 3MSOA 1GY5A 3FZWA 3H3HA 1C7HA 3K7CA 4FCJA 4L8OA 5IG0A 3T8UA 3T8NA 3GWRA 1DMQA 1Q42A 1Q40B 1ULIB 3F9SA 2QIYA 5EVHA 2BMRB 3EHCA 4HVNA 3DXOA 3FF2A 4LGQA 4H3UA 2QGUA 5IEOA 2JQ5A 4XM4A 3VSYA 3M8CA 5CF1A
chains in the Genus database with same CATH superfamily
2F5MA 5A0OB 4LMIA 1W00A 2RFRA 4N3VA 1I0XA 3BU4A 3FCSB 2FNQA 3K9MC 3RGRA 2HMMB 3FG3A 4K1VA 3CC73 4HZ9B 3NX0A 1B2SA 3K0ZA 1E97A 5G1KA 3WMDA 3HIGA 2F4YA 1UCLA 1AY7A 2LQVA 1DETA 5AEWB 3S28A 3RGAA 5AI1A 3BIRA 2O9UX 1D6UA 4FCZA 2LYXA 1OHOA 3RDEA 3EX9A 4HM0B 1KWIA 1I8VA 1JNQA 2F99A 2GU3A 3NBRA 1N8QA 5TGNA 1N8R4 5KP1A 2UGIA 1ZGXA 1OCVA 3F8HA 1RTUA 3G8ZA 4STDA 1RJOA 3CXC2 1VQM3 1KC84 3MG2A 2RNTA 1DYUA 1WMOA 3ZG0A 1VQO3 1S5AA 1BUJA 3AMOB 3CNXA 4JRFA 4X2HA 2L4VA 4FCMA 4OVMA 1IU7A 2GBWB 2CG1A 4HJLB 2YFLB 1BU4A 1W6GA 2STDA 1WTHA 4TX4A 2B1XB 1IQXA 3S5CA 4HBRA 1B20A 1TP6A 3GSPA 3MWZA 2WGQA 1S723 3G6E3 2W56A 1R4CA 3GZYB 3LTAA 2C10A 2CWTA 3F14A 1PFPA 1RGCA 3D79A 4FMBA 2CG0A 2UUGC 3DGLA 3HOHA 4LZIA 1JZOA 2ML6A 3O8YA 3WR2A 1YIT3 5IEPA 2CFKA 1LNHA 2O3OA 3GZRA 3IPTA 1UCJA 1NO3A 1LOXA 2Z77A 3LTBA 4O3VA 3BNCA 4R1KA 2OWPA 1LOWA 5JPUA 4LEHA 4RNTA 3K63A 1UGIA 1W2B2 2XGLA 2JDIH 1GMRA 1UUGB 1BNEA 1FGOA 3EC9A 1RGEA 2E2UA 2I9WA 3BNBA 3EJVA 2F98A 1QMAA 1MGWA 1QALA 1X1WA 1YVBI 2XFSA 4RBNA 4WHAA 1NWWA 3LMLA 4XDVA 2AAEA 2KF4A 3DY5A 3STDA 1Q40A 1V74A 1MOLA 2PNCA 4RNYA 1B2UA 1TUHA 1EKMA 2WGOA 4G1MB 1AR0A 1SIHA 1LOYA 3MG1A 1QVG2 4MMXB 1E3RA 1SJWA 1K28A 1RDSA 5EQLA 1IDPA 1YGEA 1I3FA 1I2EA 1I2GA 3CPOA 4CPKA 4R80A 1W5ZA 3B8LA 7GSPA 4RNZA 3LTCA 1DE3A 3ROBA 1VQQA 2IY2A 4BL2A 1NDOB 1EG9B 1T2HA 2HMNB 5LC7A 2E2TA 1T3BA 3Q2PA 4H61A 4HM6B 3OWSA 3K5TA 1BSDA 1Y4KA 2IMJA 4MMYB 4WP5A 1B2ZA 5BU4A 1FGRA 1DVCA 3LOYA 1N5PA 2D42A 4WYKA 2XSHB 5RNTA 3J7Yd 3H3HA 1C7HA 2XH9A 3KN4A 4KFDA 3T8UA 3T8NA 5JBSA 3CC23 3GWRA 1DMQA 1TIJA 2C11A 2OCTA 5IEOA 4LGQA 1F8NA 3FF2A 4H3UA 4XM4A 2QEX3 1RCKA 2YX9A 3KFQC 1JN5B 3WOFB 3CCV3 1MGRA 1W7CA 3DUKA 3UNLA 1Q824 5HOHA 1VQ43 3IJEB 3OWYA 4EXRA 1RGHA 4N6TA 3CME3 2F56A 1SARA 1D6ZA 2XEPA 3PXMA 1X1XA 3FG1A 2QA43 2CKFB 1K9M4 1BGSA 1UUWB 1WMNA 2RGQA 1BSAA 5G2GA 3BNEA 3EB8A 2RSXA 2YFIB 1BRKA 4K90B 3GZXB 1UCIA 3JUMA 1B21A 2HMOB 2BO9B 1OACA 2WO0A 4EC6A 1ASKA 3EN8A 4FR9A 1W02A 1NB3I 5CF2A 1VQ93 2SARA 3PYJA 3PZWA 3EN1B 2GXFA 1BRSA 3NV0B 4XDWA 3CMA3 1O7WB 2FXTA 3I0YA 3NM7A 2K0MA 3WODG 1WNHA 2CFGA 2BMOB 4HM3B 2CIUA 3Q1CA 1I3IA 4XBXA 1FA3A 1VZZA 1JKGA 1JRQA 2W0QA 2SBLA 1US1A 2F5WA 4EV5A 3CCE3 3MG3A 4MJDA 1O7MB 1X1UA 1CH0A 2ML5A 3DH2A 3X3YA 3CCR3 3D5IA 5FGOA 1VQP3 4JF8A 3V98A 1K41A 1MNLA 3MKIA 5AIIA 5D83A 3QRDA 4ILFA 1U5OA 1VQK3 3GZBA 1STDA 3V99A 1HYFA 3DGYA 1ZS7A 1BRIA 2BIRA 2A15A 3CCL3 1IV9A 5IG3A 4DKIA 1A2PA 1BSEA 3KSED 3OWUA 3FKAA 1EQKA 3JUOA 3WDGB 1YJW3 1VQN3 3LYGA 2P0XA 1BNRA 3JUNA 3UL5A 1IYYA 3KZTA 1Q7Y4 1V57A 5M1AA 2CX1A 2C4BA 4K1UA 1VQ83 3EQQB 2ZA4A 3NQZA 1MWTA 1BSBA 1K8A4 1BIRA 4CDLA 4O8SA 2K3DA 2W6JH 2YFJB 1C54A 3H51A 2D1WA 2E2VA 1UGHI 5IG4A 1O7HB 1OHPA 1RGAA 4XB5A 1RSNA 1A67A 1FGMA 1JZDA 1IK3A 3F8XA 3BB9A 3JVCA 1TRPA 1M1K4 2W9QA 2WOFA 2J8XB 3AGOA 3CNMA 4FMAA 4LYLB 4OUQA 3X40A 1BAOA 3PCRA 1JV2B 3UL6A 3ZFZA 1GS3A 5ELUA 1KD14 2IUJA 3PCSA 4HM5B 3S27A 4CCVA 3DMCA 2CWVA 5I97A 3NBJA 1BSCA 2P0MA 4WWUC 3DZLA 1EA2A 3SX1A 3G4S3 1OHSA 2Z6BA 1A2KA 4NREA 3V92A 1RGGA 3UJMA 5M19A 3QK9A 2KF3A 5BVBA 4J9AA 1QAKA 5DRVA 1RN4A 1T2IA 1GY5A 1LVNA 4FCJA 1IT7A 1W2ZA 1JJ22 3MPHA 7RNTA 1AVLA 3BNDA 1Q40B 3F9SA 5EEOA 2QIYA 5EVHA 3HI7A 3S67A 2BMRB 3EHCA 2QGUA 4BIRA 1AVKA 2XFTA 4ZM8A 5AYSC 3URPA 2IA7A 1B2XA 1V58A 5G1LA 1OF5A 4N6UA 3S29A 6RNTA 4BL3A 4R9KA 2IYJA 2CK3H 4R4KA 4WYKB 1UDII 4FMCA 4X2OA 1MWUA 2ZDJA 3I553 1YHQ3 3DGOA 1IQ8A 2GBXB 3NQYA 1OPYA 1AQZA 2CHCA 2H0IA 2RBIA 3CCM3 1GSPA 2P38A 1PY3A 1IVVA 4NPBA 2RCDA 3LZAA 1RNTA 3OX9A 4L8PA 2Y73A 1Q7HA 2W2CA 3JUPA 3WOEB 2CX0A 1RMSA 2R4IA 3A5EA 1UI8A 4O02B 2Y74A 1BANA 3DGNA 3RNTA 5KP4A 2HOHA 1BNSA 3G713 1BRNL 1D6YA 2GEYA 2OQEA 3KKGA 5ELJA 5AIHA 1Q814 2Q07A 1JKGB 3D5GA 3NV0A 1GMQA 3SXXA 1QJGA 2XSOB 1G0TA 3SEDA 3CCQ3 1JB4A 1M1XB 1OH0A 1IVXA 1N9EA 4N6LA 2MC8A 4AEQA 1BNGA 3HIIA 1GOVA 1OGXA 2KRTA 3LH4A 1ZX2A 5STDA 3AMOA 3GAXA 1X1YA 2KXGA 3EBYA 3AGNA 1FGTA 1LQGC 3D4AA 4J5GA 2XGNA 3WHOA 1MWRA 2ZL8A 5JPPA 1O7GB 1Z1SA 1RN7A 3F7XA 3FLJA 3SVAA 4K61A 1HZ1A 5DREA 1B27A 1GOUA 1TFOA 1SQWA 1L5GB 1JBSA 1RNBA 3ALAA 2OTJ3 2L1SA 2BU4A 3PS8A 5D81A 4QWTA 3CPW2 3T0UA 1TJDA 1W4NA 3ECFA 3EE1A 3VF1A 3X41A 3CCU3 1CYUA 3LXUX 3G0KA 1JB2A 1HU9A 3A76A 3L0RA 4I5QA 2R41A 1UUVB 4BTWA 1IV7A 2W03A 1DMNA 1UCKA 4EBGA 1YJN3 2BNGA 3D9RA 1KSIA 3B7CA 1QVF2 1AV4A 1NB5I 4PEJA 3CCJ3 3PGBA 4MEIA 3X3XA 1YIJ3 1CEWI 3WA3A 5D82A 1ULJB 2CFDA 2INXA 2CFWA 3E99A 4GHOA 2CH9A 3D3LA 1BRJA 5FW5A 3G16A 5HGRA 3FSDA 1NNVA 4GB5A 4HYZA 1W01A 5LC6A 8CHOA 3LT8A 1G96A 1WMPA 1T5YA 3LTDA 1IQYA 4RZMA 5AIFA 1B2MA 1E3VA 1BOXA 1I2FA 3BLZA 4HM7B 3WA2X 1N9JA 4CJNA 3NXJA 3U97A 1GOYA 1QAFA 1B3SA 4AKYA 2XR8B 1M904 1I70A 4N6NB 1YI23 2BT3A 3KIIA 2CWUA 3AHWA 2FGTA 4AKZA 4ORLA 2H0GA 2IUKA 1BRGA 1JB5A 3X42A 1RN1A 3SLUA 3HK4A 3CCS3 3OW22 4N6V0 1TRQA 3FZWA 1CYVA 2MF7A 2CFLA 3IMAB 4LSOA 3KCHA 1FW7A 1PYLA 1M9GA 1YGWA 4BTXA 5M18A 3M8CA 5CF1A 1NJI4 2CW9A 1TFKA 3MYTA 3NM2A 4EV2A 2KF5A 8RNTA 1K734 3CC43 2GSPA 1JBRA 2K54A 4IT7A 4HKVB 1N5HA 2KCDA 2PZVA 2ZHXB 3HZPA 4IPBA 4KFEA 3U1WA 1OGZA 1RCLA 4L7KA 5IG5A 4U13A 1J2BA 1DVDA 1W6YA 1FUWA 2BHMA 1O7NB 1OF5B 2KF6A 4HZBB 3EF8A 2HMKB 1LOVA 1YNVX 1RGLA 4OK0A 5AIGA 1OUNA 1IT8A 1VQL3 1NU3A 2XRXB 5BIRA 6GSPA 1FUSA 1FUTA 3GRDA 3B4PA 1BNIA 3SYUA 3MHEA 2P09A 1ROAA 5AYRB 3DGMA 2M7OA 4KVHA 3DM8A 1FYSA 4EW5A 2F86B 4BTYA 1RKYA 1LNIA 1BUQA 3OXAA 2KAAA 1R4YA 1FGQA 1SIIA 4O2HA 3FGYA 4HM4B 3N9HA 1Q864 1FZUA 4GL6A 4HM2B 3OV4A 1W6CA 4KT3B 1O7PB 1EEJA 3Q90A 4KFFA 1BNFA 5GSPA 1ISKA 1Q9EA 5CXOA 2V1LA 4HM8B 4MMZB 5CLKA 3LT9A 5BXQA 2H0HA 2W9PA 3NBBA 1GY6A 2Z7AA 1A90A 3NHXA 1EUIC 1RHLA 4NHFA 4XBYA 4IIAA 2HMLB 2BMQB 1CQSA 5IF6A 1A2VA 1GMPA 2Z76A 2W56B 3AHSA 4N6MA 3Q3FA 3HX8A 3ER7A 3EBTA 2UX0A 3F40A 1VQ63 4KZ1A 1MWSA 1RRLA 3JUQA 4XBTA 1IVWA 2W04A 3UB1A 4BU4A 4EYCA 9RNTA 3FF0A 5KP3A 4I4KA 5AEUB 7STDA 3FG4A 1UW1A 4Q53A 5CK6A 1VQ73 1GYBA 1LQMB 1GY7A 3VGNA 1RGFA 5IW9A 3I563 3CD63 2WOHA 3N54B 4HAAA 2P05A 1U8CB 3B4OA 2OOVA 5IENA 1KQS2 4HM1B 1SPUA 2B24B 2GU1A 2GEXA 3NUVA 1BVIA 1LRAA 1TU5A 1VQ53 1GD3A 4HOHA 4GSPA 1DMMA 1PU4A 2XF3A 3KSPA 5IERA 1UI7A 4N6OB 1STFI 2HMJB 3SOAA 4J5KA 4FMDA 4R9LA 3X3ZA 1IVUA 1YVSA 1LXEA 1RRHA 6STDA 2AADA 3FH1A 1ZO2A 3F7SA 1G02A 2OQEC 3SOYA 1JN5A 1TTOA 3KE7A 3TDGA 1HKXA 1WQLB 3CU3A 4J8TA 1RLSA 3MSOA 2CC3A 1BNJA 2OTL3 2OOVC 3K7CA 5IG0A 4L8OA 1GD4A 1YJ93 1JBTA 1I0VA 1Q42A 1ULIB 3N8BA 1BRHA 1RGKA 3DXOA 4HVNA 4WFOA 3VSYA 3ZG5A 1ROVA 2JQ5A
chains in the Genus database with same CATH topology
5A0OB 4LMIA 1W00A 2RFRA 4N3VA 3FCSB 3RGRA 2FNQA 3K9MC 2HMMB 3FG3A 4K1VA 3CC73 4HZ9B 3NX0A 3K0ZA 3WMDA 1E97A 3HIGA 2LQVA 5AEWB 3S28A 3RGAA 5AI1A 2O9UX 1D6UA 4FCZA 2LYXA 1OHOA 3RDEA 3EX9A 4HM0B 1KWIA 2F99A 1JNQA 2GU3A 3NBRA 1N8QA 5TGNA 1N8R4 5KP1A 1OCVA 3F8HA 3G8ZA 4STDA 1RJOA 3CXC2 1VQM3 1KC84 3MG2A 1DYUA 1WMOA 1VQO3 1S5AA 3AMOB 3CNXA 4JRFA 4X2HA 2L4VA 4FCMA 4OVMA 1IU7A 2GBWB 2CG1A 4HJLB 2YFLB 1W6GA 2STDA 1WTHA 4TX4A 2B1XB 1IQXA 3S5CA 4HBRA 1TP6A 3MWZA 2WGQA 1S723 3G6E3 2W56A 1R4CA 3GZYB 3LTAA 2C10A 2CWTA 3F14A 1PFPA 4FMBA 2CG0A 3DGLA 4LZIA 2ML6A 3O8YA 1YIT3 5IEPA 2CFKA 1LNHA 2O3OA 3GZRA 3IPTA 4O3VA 1NO3A 1LOXA 2Z77A 3LTBA 4R1KA 3BNCA 2OWPA 5JPUA 4LEHA 3K63A 1W2B2 2XGLA 2JDIH 1FGOA 3EC9A 3EJVA 2E2UA 2I9WA 3BNBA 2F98A 1QMAA 1QALA 4WHAA 1YVBI 2XFSA 4RBNA 1NWWA 3LMLA 4XDVA 3DY5A 3STDA 1Q40A 1V74A 1MOLA 2PNCA 4RNYA 1TUHA 1EKMA 2WGOA 4G1MB 1AR0A 1SIHA 3MG1A 1QVG2 4MMXB 1E3RA 1SJWA 1K28A 5EQLA 1IDPA 1YGEA 3CPOA 4R80A 1W5ZA 3B8LA 4RNZA 3LTCA 3ROBA 1NDOB 1EG9B 2HMNB 5LC7A 2E2TA 3Q2PA 4H61A 4HM6B 3OWSA 3K5TA 4MMYB 1Y4KA 2IMJA 4WP5A 1FGRA 1DVCA 3LOYA 1N5PA 2D42A 4WYKA 2XSHB 3J7Yd 3H3HA 1C7HA 2XH9A 3KN4A 4KFDA 3T8UA 3T8NA 5JBSA 3CC23 3GWRA 1DMQA 1TIJA 2C11A 2OCTA 5IEOA 4LGQA 1F8NA 3FF2A 4H3UA 4XM4A 2QEX3 2YX9A 3KFQC 1JN5B 3WOFB 3CCV3 1W7CA 3DUKA 3UNLA 1Q824 1VQ43 3IJEB 3OWYA 4EXRA 3CME3 4N6TA 1D6ZA 2XEPA 3PXMA 2QA43 3FG1A 2CKFB 1K9M4 1UUWB 1WMNA 2RGQA 5G2GA 3BNEA 3EB8A 2RSXA 2YFIB 4K90B 3GZXB 3JUMA 2HMOB 2BO9B 1OACA 2WO0A 4EC6A 1ASKA 3EN8A 4FR9A 1W02A 1NB3I 5CF2A 1VQ93 3PYJA 3PZWA 3EN1B 2GXFA 3NV0B 4XDWA 3CMA3 1O7WB 2FXTA 3I0YA 3NM7A 2K0MA 3WODG 1WNHA 2CFGA 2BMOB 4HM3B 2CIUA 3Q1CA 4XBXA 1FA3A 1JKGA 1VZZA 1JRQA 2W0QA 2SBLA 1US1A 4EV5A 3CCE3 3MG3A 4MJDA 1O7MB 3X3YA 2ML5A 1VQP3 3CCR3 5FGOA 4JF8A 3V98A 1K41A 1MNLA 3MKIA 5AIIA 5D83A 3QRDA 1VQK3 1U5OA 3GZBA 1STDA 3V99A 3CCL3 2A15A 1IV9A 5IG3A 3KSED 3OWUA 3FKAA 1EQKA 3JUOA 3WDGB 1YJW3 1VQN3 3LYGA 2P0XA 3JUNA 3UL5A 3KZTA 1Q7Y4 4K1UA 1VQ83 3EQQB 3NQZA 1K8A4 4CDLA 4O8SA 2W6JH 2YFJB 3H51A 2D1WA 2E2VA 5IG4A 1O7HB 1OHPA 4XB5A 1A67A 1FGMA 1IK3A 3F8XA 3BB9A 3JVCA 2W9QA 2WOFA 3CNMA 4FMAA 4OUQA 3X40A 1M1K4 3PCRA 1JV2B 3UL6A 1GS3A 5ELUA 1KD14 2IUJA 3PCSA 4HM5B 3S27A 4CCVA 3DMCA 2CWVA 5I97A 3NBJA 4WWUC 2P0MA 3DZLA 1EA2A 3SX1A 3G4S3 1OHSA 2Z6BA 1A2KA 4NREA 3V92A 3UJMA 3QK9A 5BVBA 4J9AA 1QAKA 5DRVA 1GY5A 1LVNA 4FCJA 1IT7A 1W2ZA 1JJ22 3MPHA 1AVLA 3BNDA 1Q40B 3F9SA 5EEOA 2QIYA 5EVHA 3HI7A 3S67A 2BMRB 3EHCA 2QGUA 1AVKA 2XFTA 4ZM8A 5AYSC 2IA7A 1OF5A 4N6UA 3S29A 4R9KA 4R4KA 2CK3H 4WYKB 4X2OA 4FMCA 3I553 2ZDJA 1YHQ3 3DGOA 1IQ8A 2GBXB 3NQYA 1OPYA 2CHCA 3CCM3 2P38A 1IVVA 2RCDA 3LZAA 4L8PA 3OX9A 2Y73A 2W2CA 3JUPA 3WOEB 2R4IA 1UI8A 4O02B 2Y74A 3DGNA 5KP4A 3G713 1D6YA 2GEYA 2OQEA 3KKGA 5ELJA 5AIHA 1Q814 2Q07A 1JKGB 3NV0A 3SXXA 1QJGA 2XSOB 3SEDA 3CCQ3 1JB4A 1M1XB 1OH0A 1IVXA 1N9EA 4N6LA 2MC8A 4AEQA 3HIIA 1OGXA 2KRTA 3LH4A 1ZX2A 5STDA 3AMOA 3GAXA 2KXGA 3EBYA 1FGTA 2XGNA 2ZL8A 5JPPA 1O7GB 1Z1SA 1RN7A 3F7XA 3FLJA 3SVAA 4K61A 5DREA 1TFOA 1L5GB 1SQWA 3ALAA 2OTJ3 3PS8A 5D81A 4QWTA 3CPW2 3T0UA 1W4NA 3ECFA 3EE1A 3VF1A 3X41A 3CCU3 1CYUA 3LXUX 3G0KA 1JB2A 1HU9A 3A76A 3L0RA 1UUVB 4BTWA 1IV7A 2W03A 1DMNA 4EBGA 1YJN3 2BNGA 3D9RA 1KSIA 3B7CA 1QVF2 1AV4A 1NB5I 4PEJA 3CCJ3 3PGBA 4MEIA 3X3XA 1YIJ3 1CEWI 3WA3A 5D82A 1ULJB 2CFDA 2INXA 2CFWA 3E99A 2CH9A 3D3LA 5FW5A 3G16A 5HGRA 3FSDA 4GB5A 4HYZA 1W01A 5LC6A 8CHOA 3LT8A 1G96A 1WMPA 1T5YA 3LTDA 1IQYA 4RZMA 5AIFA 1E3VA 3WA2X 3BLZA 4HM7B 1N9JA 3NXJA 3U97A 1QAFA 4AKYA 1M904 2XR8B 4N6NB 1YI23 2BT3A 3KIIA 2CWUA 2FGTA 4AKZA 4ORLA 2IUKA 1JB5A 3X42A 3SLUA 3CCS3 3HK4A 3OW22 4N6V0 3FZWA 1CYVA 2MF7A 2CFLA 3IMAB 4LSOA 1M9GA 4BTXA 3M8CA 5CF1A 1NJI4 2CW9A 1TFKA 3MYTA 3NM2A 4EV2A 1K734 3CC43 2K54A 4IT7A 4HKVB 1N5HA 2KCDA 2PZVA 3HZPA 4IPBA 4KFEA 3U1WA 1OGZA 4L7KA 5IG5A 1J2BA 4U13A 1DVDA 1FUWA 1W6YA 2BHMA 1O7NB 1OF5B 4HZBB 3EF8A 2HMKB 4OK0A 5AIGA 1OUNA 1IT8A 1VQL3 1NU3A 2XRXB 3GRDA 3B4PA 3MHEA 2P09A 1ROAA 5AYRB 3DGMA 2M7OA 4KVHA 3DM8A 2F86B 4BTYA 1RKYA 1BUQA 3OXAA 1FGQA 1SIIA 4O2HA 3FGYA 4HM4B 3N9HA 1Q864 4GL6A 4HM2B 3OV4A 1W6CA 1O7PB 3Q90A 4KFFA 1ISKA 5CXOA 2V1LA 4HM8B 4MMZB 5CLKA 3LT9A 5BXQA 2W9PA 3NBBA 1GY6A 2Z7AA 1A90A 3NHXA 4NHFA 4XBYA 4IIAA 2HMLB 2BMQB 1CQSA 5IF6A 1A2VA 2Z76A 2W56B 4N6MA 3HX8A 3ER7A 3EBTA 2UX0A 3F40A 1VQ63 4KZ1A 1RRLA 3JUQA 4XBTA 3UB1A 1IVWA 2W04A 4EYCA 3FF0A 5KP3A 4I4KA 5AEUB 7STDA 3FG4A 1UW1A 4Q53A 5CK6A 1VQ73 1GYBA 1GY7A 3VGNA 5IW9A 3I563 3CD63 2WOHA 3N54B 2P05A 1U8CB 3B4OA 2OOVA 5IENA 1KQS2 4HM1B 1SPUA 2B24B 2GU1A 2GEXA 3NUVA 1TU5A 1VQ53 1GD3A 1DMMA 1PU4A 2XF3A 3KSPA 5IERA 1UI7A 4N6OB 1STFI 2HMJB 3SOAA 4FMDA 4R9LA 3X3ZA 1IVUA 1LXEA 1RRHA 6STDA 3FH1A 1ZO2A 3F7SA 2OQEC 3SOYA 1JN5A 3TDGA 3KE7A 1HKXA 1WQLB 3CU3A 4J8TA 3MSOA 2CC3A 2OTL3 2OOVC 3K7CA 5IG0A 4L8OA 1GD4A 1YJ93 1Q42A 1ULIB 3N8BA 4HVNA 3DXOA 4WFOA 3VSYA 1ROVA 2JQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYT A;  3NM2 A;  4LMI A;  1W00 A;  2RFR A;  1OF5 A;  4N3V A;  3RGR A;  1JN5 B;  2K54 A;  4R9K A;  4HKV B;  2HMM B;  2PZV A;  3HZP A;  4WYK B;  3DUK A;  4K1V A;  4X2O A;  4HZ9 B;  3UNL A;  1OGZ A;  4L7K A;  3K0Z A;  2GBX B;  1E97 A;  3OWY A;  4U13 A;  1W6Y A;  3WMD A;  5IG5 A;  1OPY A;  2CHC A;  1O7N B;  1OF5 B;  2CKF B;  2RCD A;  3LZA A;  4HZB B;  4L8P A;  3OX9 A;  5AEW B;  3RGA A;  2W2C A;  3JUP A;  1UUW B;  2HMK B;  3EF8 A;  5AI1 A;  2R4I A;  2RGQ A;  5G2G A;  5KP4 A;  2YFI B;  5AIG A;  1OHO A;  3GZX B;  1OUN A;  3EX9 A;  4HM0 B;  2F99 A;  3JUM A;  2HMO B;  2GEY A;  3KKG A;  1NU3 A;  2XRX B;  3NBR A;  5AIH A;  5TGN A;  3GRD A;  1JKG B;  1ASK A;  3B4P A;  3EN8 A;  3NV0 A;  3MHE A;  5KP1 A;  1OCV A;  1W02 A;  3F8H A;  3G8Z A;  1QJG A;  4STD A;  2XSO B;  3SED A;  5CF2 A;  3MG2 A;  4KVH A;  1JB4 A;  1OH0 A;  3DM8 A;  2F86 B;  1S5A A;  3EN1 B;  1BUQ A;  2GXF A;  3CNX A;  3OXA A;  4X2H A;  4FCM A;  4OVM A;  3NV0 B;  1OGX A;  2GBW B;  4XDW A;  1ZX2 A;  4HJL B;  1O7W B;  2YFL B;  5STD A;  3FGY A;  3I0Y A;  4HM4 B;  3EBY A;  2STD A;  2BMO B;  4HM2 B;  3OV4 A;  4HM3 B;  3S5C A;  2B1X B;  4XBX A;  1O7P B;  1JKG A;  1VZZ A;  1TP6 A;  3Q90 A;  1ISK A;  5CXO A;  4HM8 B;  5JPP A;  1O7G B;  3MG3 A;  1O7M B;  1Z1S A;  3F7X A;  3FLJ A;  4MJD A;  5CLK A;  5BXQ A;  3GZY B;  5DRE A;  1GY6 A;  2Z7A A;  3F14 A;  3NHX A;  4XBY A;  1K41 A;  5D83 A;  3MKI A;  5AII A;  4IIA A;  2HML B;  5D81 A;  1U5O A;  1CQS A;  2BMQ B;  1STD A;  3ECF A;  3GZB A;  5IF6 A;  5IEP A;  3GZR A;  3IPT A;  2Z76 A;  3G0K A;  1JB2 A;  2A15 A;  2Z77 A;  3A76 A;  4R1K A;  3HX8 A;  2OWP A;  5IG3 A;  3ER7 A;  5JPU A;  3EBT A;  2UX0 A;  3F40 A;  3OWU A;  4LEH A;  3FKA A;  1UUV B;  3JUO A;  3JUQ A;  4XBT A;  1DMN A;  3LYG A;  2BNG A;  3JUN A;  3D9R A;  3KZT A;  3EC9 A;  3EJV A;  2I9W A;  3FF0 A;  5KP3 A;  4I4K A;  2F98 A;  5AEU B;  4K1U A;  3B7C A;  1QMA A;  3EQQ B;  7STD A;  4Q53 A;  4PEJ A;  5CK6 A;  1GYB A;  1NWW A;  4CDL A;  1GY7 A;  3VGN A;  2YFJ B;  4XDV A;  3H51 A;  5D82 A;  3STD A;  1ULJ B;  2INX A;  1Q40 A;  5IG4 A;  3E99 A;  1O7H B;  1OHP A;  3B4O A;  4XB5 A;  5FW5 A;  1TUH A;  1AR0 A;  3G16 A;  4HM1 B;  5HGR A;  3MG1 A;  5IEN A;  2B24 B;  3FSD A;  1E3R A;  1SJW A;  2GEX A;  3F8X A;  3BB9 A;  3NUV A;  1W01 A;  4GB5 A;  8CHO A;  1IDP A;  3CPO A;  4RZM A;  5AIF A;  3B8L A;  1DMM A;  1E3V A;  3CNM A;  4OUQ A;  3BLZ A;  3KSP A;  4HM7 B;  5IER A;  1GS3 A;  3NXJ A;  3ROB A;  2XR8 B;  2HMJ B;  3SOA A;  1NDO B;  4HM5 B;  1EG9 B;  3DMC A;  4R9L A;  2HMN B;  6STD A;  4HM6 B;  3OWS A;  3FH1 A;  1ZO2 A;  3F7S A;  2IMJ A;  1EA2 A;  3DZL A;  4WWU C;  4WP5 A;  1OHS A;  4ORL A;  3SOY A;  1JN5 A;  1A2K A;  3KE7 A;  1HKX A;  1WQL B;  1JB5 A;  3CU3 A;  4J8T A;  4WYK A;  3UJM A;  5BVB A;  3HK4 A;  4J9A A;  5DRV A;  2XSH B;  3MSO A;  1GY5 A;  3FZW A;  3H3H A;  1C7H A;  3K7C A;  4FCJ A;  4L8O A;  5IG0 A;  3T8U A;  3T8N A;  3GWR A;  1DMQ A;  1Q42 A;  1Q40 B;  1ULI B;  3F9S A;  2QIY A;  5EVH A;  2BMR B;  3EHC A;  4HVN A;  3DXO A;  3FF2 A;  4LGQ A;  4H3U A;  2QGU A;  5IEO A;  2JQ5 A;  4XM4 A;  3VSY A;  3M8C A;  5CF1 A; 
#chains in the Genus database with same CATH topology
 2F5M A;  5A0O B;  4LMI A;  1W00 A;  2RFR A;  4N3V A;  1I0X A;  3BU4 A;  3FCS B;  2FNQ A;  3K9M C;  3RGR A;  2HMM B;  3FG3 A;  4K1V A;  3CC7 3;  4HZ9 B;  3NX0 A;  1B2S A;  3K0Z A;  1E97 A;  5G1K A;  3WMD A;  3HIG A;  2F4Y A;  1UCL A;  1AY7 A;  2LQV A;  1DET A;  5AEW B;  3S28 A;  3RGA A;  5AI1 A;  3BIR A;  2O9U X;  1D6U A;  4FCZ A;  2LYX A;  1OHO A;  3RDE A;  3EX9 A;  4HM0 B;  1KWI A;  1I8V A;  1JNQ A;  2F99 A;  2GU3 A;  3NBR A;  1N8Q A;  5TGN A;  1N8R 4;  5KP1 A;  2UGI A;  1ZGX A;  1OCV A;  3F8H A;  1RTU A;  3G8Z A;  4STD A;  1RJO A;  3CXC 2;  1VQM 3;  1KC8 4;  3MG2 A;  2RNT A;  1DYU A;  1WMO A;  3ZG0 A;  1VQO 3;  1S5A A;  1BUJ A;  3AMO B;  3CNX A;  4JRF A;  4X2H A;  2L4V A;  4FCM A;  4OVM A;  1IU7 A;  2GBW B;  2CG1 A;  4HJL B;  2YFL B;  1BU4 A;  1W6G A;  2STD A;  1WTH A;  4TX4 A;  2B1X B;  1IQX A;  3S5C A;  4HBR A;  1B20 A;  1TP6 A;  3GSP A;  3MWZ A;  2WGQ A;  1S72 3;  3G6E 3;  2W56 A;  1R4C A;  3GZY B;  3LTA A;  2C10 A;  2CWT A;  3F14 A;  1PFP A;  1RGC A;  3D79 A;  4FMB A;  2CG0 A;  2UUG C;  3DGL A;  3HOH A;  4LZI A;  1JZO A;  2ML6 A;  3O8Y A;  3WR2 A;  1YIT 3;  5IEP A;  2CFK A;  1LNH A;  2O3O A;  3GZR A;  3IPT A;  1UCJ A;  1NO3 A;  1LOX A;  2Z77 A;  3LTB A;  4O3V A;  3BNC A;  4R1K A;  2OWP A;  1LOW A;  5JPU A;  4LEH A;  4RNT A;  3K63 A;  1UGI A;  1W2B 2;  2XGL A;  2JDI H;  1GMR A;  1UUG B;  1BNE A;  1FGO A;  3EC9 A;  1RGE A;  2E2U A;  2I9W A;  3BNB A;  3EJV A;  2F98 A;  1QMA A;  1MGW A;  1QAL A;  1X1W A;  1YVB I;  2XFS A;  4RBN A;  4WHA A;  1NWW A;  3LML A;  4XDV A;  2AAE A;  2KF4 A;  3DY5 A;  3STD A;  1Q40 A;  1V74 A;  1MOL A;  2PNC A;  4RNY A;  1B2U A;  1TUH A;  1EKM A;  2WGO A;  4G1M B;  1AR0 A;  1SIH A;  1LOY A;  3MG1 A;  1QVG 2;  4MMX B;  1E3R A;  1SJW A;  1K28 A;  1RDS A;  5EQL A;  1IDP A;  1YGE A;  1I3F A;  1I2E A;  1I2G A;  3CPO A;  4CPK A;  4R80 A;  1W5Z A;  3B8L A;  7GSP A;  4RNZ A;  3LTC A;  1DE3 A;  3ROB A;  1VQQ A;  2IY2 A;  4BL2 A;  1NDO B;  1EG9 B;  1T2H A;  2HMN B;  5LC7 A;  2E2T A;  1T3B A;  3Q2P A;  4H61 A;  4HM6 B;  3OWS A;  3K5T A;  1BSD A;  1Y4K A;  2IMJ A;  4MMY B;  4WP5 A;  1B2Z A;  5BU4 A;  1FGR A;  1DVC A;  3LOY A;  1N5P A;  2D42 A;  4WYK A;  2XSH B;  5RNT A;  3J7Y d;  3H3H A;  1C7H A;  2XH9 A;  3KN4 A;  4KFD A;  3T8U A;  3T8N A;  5JBS A;  3CC2 3;  3GWR A;  1DMQ A;  1TIJ A;  2C11 A;  2OCT A;  5IEO A;  4LGQ A;  1F8N A;  3FF2 A;  4H3U A;  4XM4 A;  2QEX 3;  1RCK A;  2YX9 A;  3KFQ C;  1JN5 B;  3WOF B;  3CCV 3;  1MGR A;  1W7C A;  3DUK A;  3UNL A;  1Q82 4;  5HOH A;  1VQ4 3;  3IJE B;  3OWY A;  4EXR A;  1RGH A;  4N6T A;  3CME 3;  2F56 A;  1SAR A;  1D6Z A;  2XEP A;  3PXM A;  1X1X A;  3FG1 A;  2QA4 3;  2CKF B;  1K9M 4;  1BGS A;  1UUW B;  1WMN A;  2RGQ A;  1BSA A;  5G2G A;  3BNE A;  3EB8 A;  2RSX A;  2YFI B;  1BRK A;  4K90 B;  3GZX B;  1UCI A;  3JUM A;  1B21 A;  2HMO B;  2BO9 B;  1OAC A;  2WO0 A;  4EC6 A;  1ASK A;  3EN8 A;  4FR9 A;  1W02 A;  1NB3 I;  5CF2 A;  1VQ9 3;  2SAR A;  3PYJ A;  3PZW A;  3EN1 B;  2GXF A;  1BRS A;  3NV0 B;  4XDW A;  3CMA 3;  1O7W B;  2FXT A;  3I0Y A;  3NM7 A;  2K0M A;  3WOD G;  1WNH A;  2CFG A;  2BMO B;  4HM3 B;  2CIU A;  3Q1C A;  1I3I A;  4XBX A;  1FA3 A;  1VZZ A;  1JKG A;  1JRQ A;  2W0Q A;  2SBL A;  1US1 A;  2F5W A;  4EV5 A;  3CCE 3;  3MG3 A;  4MJD A;  1O7M B;  1X1U A;  1CH0 A;  2ML5 A;  3DH2 A;  3X3Y A;  3CCR 3;  3D5I A;  5FGO A;  1VQP 3;  4JF8 A;  3V98 A;  1K41 A;  1MNL A;  3MKI A;  5AII A;  5D83 A;  3QRD A;  4ILF A;  1U5O A;  1VQK 3;  3GZB A;  1STD A;  3V99 A;  1HYF A;  3DGY A;  1ZS7 A;  1BRI A;  2BIR A;  2A15 A;  3CCL 3;  1IV9 A;  5IG3 A;  4DKI A;  1A2P A;  1BSE A;  3KSE D;  3OWU A;  3FKA A;  1EQK A;  3JUO A;  3WDG B;  1YJW 3;  1VQN 3;  3LYG A;  2P0X A;  1BNR A;  3JUN A;  3UL5 A;  1IYY A;  3KZT A;  1Q7Y 4;  1V57 A;  5M1A A;  2CX1 A;  2C4B A;  4K1U A;  1VQ8 3;  3EQQ B;  2ZA4 A;  3NQZ A;  1MWT A;  1BSB A;  1K8A 4;  1BIR A;  4CDL A;  4O8S A;  2K3D A;  2W6J H;  2YFJ B;  1C54 A;  3H51 A;  2D1W A;  2E2V A;  1UGH I;  5IG4 A;  1O7H B;  1OHP A;  1RGA A;  4XB5 A;  1RSN A;  1A67 A;  1FGM A;  1JZD A;  1IK3 A;  3F8X A;  3BB9 A;  3JVC A;  1TRP A;  1M1K 4;  2W9Q A;  2WOF A;  2J8X B;  3AGO A;  3CNM A;  4FMA A;  4LYL B;  4OUQ A;  3X40 A;  1BAO A;  3PCR A;  1JV2 B;  3UL6 A;  3ZFZ A;  1GS3 A;  5ELU A;  1KD1 4;  2IUJ A;  3PCS A;  4HM5 B;  3S27 A;  4CCV A;  3DMC A;  2CWV A;  5I97 A;  3NBJ A;  1BSC A;  2P0M A;  4WWU C;  3DZL A;  1EA2 A;  3SX1 A;  3G4S 3;  1OHS A;  2Z6B A;  1A2K A;  4NRE A;  3V92 A;  1RGG A;  3UJM A;  5M19 A;  3QK9 A;  2KF3 A;  5BVB A;  4J9A A;  1QAK A;  5DRV A;  1RN4 A;  1T2I A;  1GY5 A;  1LVN A;  4FCJ A;  1IT7 A;  1W2Z A;  1JJ2 2;  3MPH A;  7RNT A;  1AVL A;  3BND A;  1Q40 B;  3F9S A;  5EEO A;  2QIY A;  5EVH A;  3HI7 A;  3S67 A;  2BMR B;  3EHC A;  2QGU A;  4BIR A;  1AVK A;  2XFT A;  4ZM8 A;  5AYS C;  3URP A;  2IA7 A;  1B2X A;  1V58 A;  5G1L A;  1OF5 A;  4N6U A;  3S29 A;  6RNT A;  4BL3 A;  4R9K A;  2IYJ A;  2CK3 H;  4R4K A;  4WYK B;  1UDI I;  4FMC A;  4X2O A;  1MWU A;  2ZDJ A;  3I55 3;  1YHQ 3;  3DGO A;  1IQ8 A;  2GBX B;  3NQY A;  1OPY A;  1AQZ A;  2CHC A;  2H0I A;  2RBI A;  3CCM 3;  1GSP A;  2P38 A;  1PY3 A;  1IVV A;  4NPB A;  2RCD A;  3LZA A;  1RNT A;  3OX9 A;  4L8P A;  2Y73 A;  1Q7H A;  2W2C A;  3JUP A;  3WOE B;  2CX0 A;  1RMS A;  2R4I A;  3A5E A;  1UI8 A;  4O02 B;  2Y74 A;  1BAN A;  3DGN A;  3RNT A;  5KP4 A;  2HOH A;  1BNS A;  3G71 3;  1BRN L;  1D6Y A;  2GEY A;  2OQE A;  3KKG A;  5ELJ A;  5AIH A;  1Q81 4;  2Q07 A;  1JKG B;  3D5G A;  3NV0 A;  1GMQ A;  3SXX A;  1QJG A;  2XSO B;  1G0T A;  3SED A;  3CCQ 3;  1JB4 A;  1M1X B;  1OH0 A;  1IVX A;  1N9E A;  4N6L A;  2MC8 A;  4AEQ A;  1BNG A;  3HII A;  1GOV A;  1OGX A;  2KRT A;  3LH4 A;  1ZX2 A;  5STD A;  3AMO A;  3GAX A;  1X1Y A;  2KXG A;  3EBY A;  3AGN A;  1FGT A;  1LQG C;  3D4A A;  4J5G A;  2XGN A;  3WHO A;  1MWR A;  2ZL8 A;  5JPP A;  1O7G B;  1Z1S A;  1RN7 A;  3F7X A;  3FLJ A;  3SVA A;  4K61 A;  1HZ1 A;  5DRE A;  1B27 A;  1GOU A;  1TFO A;  1SQW A;  1L5G B;  1JBS A;  1RNB A;  3ALA A;  2OTJ 3;  2L1S A;  2BU4 A;  3PS8 A;  5D81 A;  4QWT A;  3CPW 2;  3T0U A;  1TJD A;  1W4N A;  3ECF A;  3EE1 A;  3VF1 A;  3X41 A;  3CCU 3;  1CYU A;  3LXU X;  3G0K A;  1JB2 A;  1HU9 A;  3A76 A;  3L0R A;  4I5Q A;  2R41 A;  1UUV B;  4BTW A;  1IV7 A;  2W03 A;  1DMN A;  1UCK A;  4EBG A;  1YJN 3;  2BNG A;  3D9R A;  1KSI A;  3B7C A;  1QVF 2;  1AV4 A;  1NB5 I;  4PEJ A;  3CCJ 3;  3PGB A;  4MEI A;  3X3X A;  1YIJ 3;  1CEW I;  3WA3 A;  5D82 A;  1ULJ B;  2CFD A;  2INX A;  2CFW A;  3E99 A;  4GHO A;  2CH9 A;  3D3L A;  1BRJ A;  5FW5 A;  3G16 A;  5HGR A;  3FSD A;  1NNV A;  4GB5 A;  4HYZ A;  1W01 A;  5LC6 A;  8CHO A;  3LT8 A;  1G96 A;  1WMP A;  1T5Y A;  3LTD A;  1IQY A;  4RZM A;  5AIF A;  1B2M A;  1E3V A;  1BOX A;  1I2F A;  3BLZ A;  4HM7 B;  3WA2 X;  1N9J A;  4CJN A;  3NXJ A;  3U97 A;  1GOY A;  1QAF A;  1B3S A;  4AKY A;  2XR8 B;  1M90 4;  1I70 A;  4N6N B;  1YI2 3;  2BT3 A;  3KII A;  2CWU A;  3AHW A;  2FGT A;  4AKZ A;  4ORL A;  2H0G A;  2IUK A;  1BRG A;  1JB5 A;  3X42 A;  1RN1 A;  3SLU A;  3HK4 A;  3CCS 3;  3OW2 2;  4N6V 0;  1TRQ A;  3FZW A;  1CYV A;  2MF7 A;  2CFL A;  3IMA B;  4LSO A;  3KCH A;  1FW7 A;  1PYL A;  1M9G A;  1YGW A;  4BTX A;  5M18 A;  3M8C A;  5CF1 A;  1NJI 4;  2CW9 A;  1TFK A;  3MYT A;  3NM2 A;  4EV2 A;  2KF5 A;  8RNT A;  1K73 4;  3CC4 3;  2GSP A;  1JBR A;  2K54 A;  4IT7 A;  4HKV B;  1N5H A;  2KCD A;  2PZV A;  2ZHX B;  3HZP A;  4IPB A;  4KFE A;  3U1W A;  1OGZ A;  1RCL A;  4L7K A;  5IG5 A;  4U13 A;  1J2B A;  1DVD A;  1W6Y A;  1FUW A;  2BHM A;  1O7N B;  1OF5 B;  2KF6 A;  4HZB B;  3EF8 A;  2HMK B;  1LOV A;  1YNV X;  1RGL A;  4OK0 A;  5AIG A;  1OUN A;  1IT8 A;  1VQL 3;  1NU3 A;  2XRX B;  5BIR A;  6GSP A;  1FUS A;  1FUT A;  3GRD A;  3B4P A;  1BNI A;  3SYU A;  3MHE A;  2P09 A;  1ROA A;  5AYR B;  3DGM A;  2M7O A;  4KVH A;  3DM8 A;  1FYS A;  4EW5 A;  2F86 B;  4BTY A;  1RKY A;  1LNI A;  1BUQ A;  3OXA A;  2KAA A;  1R4Y A;  1FGQ A;  1SII A;  4O2H A;  3FGY A;  4HM4 B;  3N9H A;  1Q86 4;  1FZU A;  4GL6 A;  4HM2 B;  3OV4 A;  1W6C A;  4KT3 B;  1O7P B;  1EEJ A;  3Q90 A;  4KFF A;  1BNF A;  5GSP A;  1ISK A;  1Q9E A;  5CXO A;  2V1L A;  4HM8 B;  4MMZ B;  5CLK A;  3LT9 A;  5BXQ A;  2H0H A;  2W9P A;  3NBB A;  1GY6 A;  2Z7A A;  1A90 A;  3NHX A;  1EUI C;  1RHL A;  4NHF A;  4XBY A;  4IIA A;  2HML B;  2BMQ B;  1CQS A;  5IF6 A;  1A2V A;  1GMP A;  2Z76 A;  2W56 B;  3AHS A;  4N6M A;  3Q3F A;  3HX8 A;  3ER7 A;  3EBT A;  2UX0 A;  3F40 A;  1VQ6 3;  4KZ1 A;  1MWS A;  1RRL A;  3JUQ A;  4XBT A;  1IVW A;  2W04 A;  3UB1 A;  4BU4 A;  4EYC A;  9RNT A;  3FF0 A;  5KP3 A;  4I4K A;  5AEU B;  7STD A;  3FG4 A;  1UW1 A;  4Q53 A;  5CK6 A;  1VQ7 3;  1GYB A;  1LQM B;  1GY7 A;  3VGN A;  1RGF A;  5IW9 A;  3I56 3;  3CD6 3;  2WOH A;  3N54 B;  4HAA A;  2P05 A;  1U8C B;  3B4O A;  2OOV A;  5IEN A;  1KQS 2;  4HM1 B;  1SPU A;  2B24 B;  2GU1 A;  2GEX A;  3NUV A;  1BVI A;  1LRA A;  1TU5 A;  1VQ5 3;  1GD3 A;  4HOH A;  4GSP A;  1DMM A;  1PU4 A;  2XF3 A;  3KSP A;  5IER A;  1UI7 A;  4N6O B;  1STF I;  2HMJ B;  3SOA A;  4J5K A;  4FMD A;  4R9L A;  3X3Z A;  1IVU A;  1YVS A;  1LXE A;  1RRH A;  6STD A;  2AAD A;  3FH1 A;  1ZO2 A;  3F7S A;  1G02 A;  2OQE C;  3SOY A;  1JN5 A;  1TTO A;  3KE7 A;  3TDG A;  1HKX A;  1WQL B;  3CU3 A;  4J8T A;  1RLS A;  3MSO A;  2CC3 A;  1BNJ A;  2OTL 3;  2OOV C;  3K7C A;  5IG0 A;  4L8O A;  1GD4 A;  1YJ9 3;  1JBT A;  1I0V A;  1Q42 A;  1ULI B;  3N8B A;  1BRH A;  1RGK A;  3DXO A;  4HVN A;  4WFO A;  3VSY A;  3ZG5 A;  1ROV A;  2JQ5 A; 
#chains in the Genus database with same CATH homology
 5A0O B;  4LMI A;  1W00 A;  2RFR A;  4N3V A;  3FCS B;  3RGR A;  2FNQ A;  3K9M C;  2HMM B;  3FG3 A;  4K1V A;  3CC7 3;  4HZ9 B;  3NX0 A;  3K0Z A;  3WMD A;  1E97 A;  3HIG A;  2LQV A;  5AEW B;  3S28 A;  3RGA A;  5AI1 A;  2O9U X;  1D6U A;  4FCZ A;  2LYX A;  1OHO A;  3RDE A;  3EX9 A;  4HM0 B;  1KWI A;  2F99 A;  1JNQ A;  2GU3 A;  3NBR A;  1N8Q A;  5TGN A;  1N8R 4;  5KP1 A;  1OCV A;  3F8H A;  3G8Z A;  4STD A;  1RJO A;  3CXC 2;  1VQM 3;  1KC8 4;  3MG2 A;  1DYU A;  1WMO A;  1VQO 3;  1S5A A;  3AMO B;  3CNX A;  4JRF A;  4X2H A;  2L4V A;  4FCM A;  4OVM A;  1IU7 A;  2GBW B;  2CG1 A;  4HJL B;  2YFL B;  1W6G A;  2STD A;  1WTH A;  4TX4 A;  2B1X B;  1IQX A;  3S5C A;  4HBR A;  1TP6 A;  3MWZ A;  2WGQ A;  1S72 3;  3G6E 3;  2W56 A;  1R4C A;  3GZY B;  3LTA A;  2C10 A;  2CWT A;  3F14 A;  1PFP A;  4FMB A;  2CG0 A;  3DGL A;  4LZI A;  2ML6 A;  3O8Y A;  1YIT 3;  5IEP A;  2CFK A;  1LNH A;  2O3O A;  3GZR A;  3IPT A;  4O3V A;  1NO3 A;  1LOX A;  2Z77 A;  3LTB A;  4R1K A;  3BNC A;  2OWP A;  5JPU A;  4LEH A;  3K63 A;  1W2B 2;  2XGL A;  2JDI H;  1FGO A;  3EC9 A;  3EJV A;  2E2U A;  2I9W A;  3BNB A;  2F98 A;  1QMA A;  1QAL A;  4WHA A;  1YVB I;  2XFS A;  4RBN A;  1NWW A;  3LML A;  4XDV A;  3DY5 A;  3STD A;  1Q40 A;  1V74 A;  1MOL A;  2PNC A;  4RNY A;  1TUH A;  1EKM A;  2WGO A;  4G1M B;  1AR0 A;  1SIH A;  3MG1 A;  1QVG 2;  4MMX B;  1E3R A;  1SJW A;  1K28 A;  5EQL A;  1IDP A;  1YGE A;  3CPO A;  4R80 A;  1W5Z A;  3B8L A;  4RNZ A;  3LTC A;  3ROB A;  1NDO B;  1EG9 B;  2HMN B;  5LC7 A;  2E2T A;  3Q2P A;  4H61 A;  4HM6 B;  3OWS A;  3K5T A;  4MMY B;  1Y4K A;  2IMJ A;  4WP5 A;  1FGR A;  1DVC A;  3LOY A;  1N5P A;  2D42 A;  4WYK A;  2XSH B;  3J7Y d;  3H3H A;  1C7H A;  2XH9 A;  3KN4 A;  4KFD A;  3T8U A;  3T8N A;  5JBS A;  3CC2 3;  3GWR A;  1DMQ A;  1TIJ A;  2C11 A;  2OCT A;  5IEO A;  4LGQ A;  1F8N A;  3FF2 A;  4H3U A;  4XM4 A;  2QEX 3;  2YX9 A;  3KFQ C;  1JN5 B;  3WOF B;  3CCV 3;  1W7C A;  3DUK A;  3UNL A;  1Q82 4;  1VQ4 3;  3IJE B;  3OWY A;  4EXR A;  3CME 3;  4N6T A;  1D6Z A;  2XEP A;  3PXM A;  2QA4 3;  3FG1 A;  2CKF B;  1K9M 4;  1UUW B;  1WMN A;  2RGQ A;  5G2G A;  3BNE A;  3EB8 A;  2RSX A;  2YFI B;  4K90 B;  3GZX B;  3JUM A;  2HMO B;  2BO9 B;  1OAC A;  2WO0 A;  4EC6 A;  1ASK A;  3EN8 A;  4FR9 A;  1W02 A;  1NB3 I;  5CF2 A;  1VQ9 3;  3PYJ A;  3PZW A;  3EN1 B;  2GXF A;  3NV0 B;  4XDW A;  3CMA 3;  1O7W B;  2FXT A;  3I0Y A;  3NM7 A;  2K0M A;  3WOD G;  1WNH A;  2CFG A;  2BMO B;  4HM3 B;  2CIU A;  3Q1C A;  4XBX A;  1FA3 A;  1JKG A;  1VZZ A;  1JRQ A;  2W0Q A;  2SBL A;  1US1 A;  4EV5 A;  3CCE 3;  3MG3 A;  4MJD A;  1O7M B;  3X3Y A;  2ML5 A;  1VQP 3;  3CCR 3;  5FGO A;  4JF8 A;  3V98 A;  1K41 A;  1MNL A;  3MKI A;  5AII A;  5D83 A;  3QRD A;  1VQK 3;  1U5O A;  3GZB A;  1STD A;  3V99 A;  3CCL 3;  2A15 A;  1IV9 A;  5IG3 A;  3KSE D;  3OWU A;  3FKA A;  1EQK A;  3JUO A;  3WDG B;  1YJW 3;  1VQN 3;  3LYG A;  2P0X A;  3JUN A;  3UL5 A;  3KZT A;  1Q7Y 4;  4K1U A;  1VQ8 3;  3EQQ B;  3NQZ A;  1K8A 4;  4CDL A;  4O8S A;  2W6J H;  2YFJ B;  3H51 A;  2D1W A;  2E2V A;  5IG4 A;  1O7H B;  1OHP A;  4XB5 A;  1A67 A;  1FGM A;  1IK3 A;  3F8X A;  3BB9 A;  3JVC A;  2W9Q A;  2WOF A;  3CNM A;  4FMA A;  4OUQ A;  3X40 A;  1M1K 4;  3PCR A;  1JV2 B;  3UL6 A;  1GS3 A;  5ELU A;  1KD1 4;  2IUJ A;  3PCS A;  4HM5 B;  3S27 A;  4CCV A;  3DMC A;  2CWV A;  5I97 A;  3NBJ A;  4WWU C;  2P0M A;  3DZL A;  1EA2 A;  3SX1 A;  3G4S 3;  1OHS A;  2Z6B A;  1A2K A;  4NRE A;  3V92 A;  3UJM A;  3QK9 A;  5BVB A;  4J9A A;  1QAK A;  5DRV A;  1GY5 A;  1LVN A;  4FCJ A;  1IT7 A;  1W2Z A;  1JJ2 2;  3MPH A;  1AVL A;  3BND A;  1Q40 B;  3F9S A;  5EEO A;  2QIY A;  5EVH A;  3HI7 A;  3S67 A;  2BMR B;  3EHC A;  2QGU A;  1AVK A;  2XFT A;  4ZM8 A;  5AYS C;  2IA7 A;  1OF5 A;  4N6U A;  3S29 A;  4R9K A;  4R4K A;  2CK3 H;  4WYK B;  4X2O A;  4FMC A;  3I55 3;  2ZDJ A;  1YHQ 3;  3DGO A;  1IQ8 A;  2GBX B;  3NQY A;  1OPY A;  2CHC A;  3CCM 3;  2P38 A;  1IVV A;  2RCD A;  3LZA A;  4L8P A;  3OX9 A;  2Y73 A;  2W2C A;  3JUP A;  3WOE B;  2R4I A;  1UI8 A;  4O02 B;  2Y74 A;  3DGN A;  5KP4 A;  3G71 3;  1D6Y A;  2GEY A;  2OQE A;  3KKG A;  5ELJ A;  5AIH A;  1Q81 4;  2Q07 A;  1JKG B;  3NV0 A;  3SXX A;  1QJG A;  2XSO B;  3SED A;  3CCQ 3;  1JB4 A;  1M1X B;  1OH0 A;  1IVX A;  1N9E A;  4N6L A;  2MC8 A;  4AEQ A;  3HII A;  1OGX A;  2KRT A;  3LH4 A;  1ZX2 A;  5STD A;  3AMO A;  3GAX A;  2KXG A;  3EBY A;  1FGT A;  2XGN A;  2ZL8 A;  5JPP A;  1O7G B;  1Z1S A;  1RN7 A;  3F7X A;  3FLJ A;  3SVA A;  4K61 A;  5DRE A;  1TFO A;  1L5G B;  1SQW A;  3ALA A;  2OTJ 3;  3PS8 A;  5D81 A;  4QWT A;  3CPW 2;  3T0U A;  1W4N A;  3ECF A;  3EE1 A;  3VF1 A;  3X41 A;  3CCU 3;  1CYU A;  3LXU X;  3G0K A;  1JB2 A;  1HU9 A;  3A76 A;  3L0R A;  1UUV B;  4BTW A;  1IV7 A;  2W03 A;  1DMN A;  4EBG A;  1YJN 3;  2BNG A;  3D9R A;  1KSI A;  3B7C A;  1QVF 2;  1AV4 A;  1NB5 I;  4PEJ A;  3CCJ 3;  3PGB A;  4MEI A;  3X3X A;  1YIJ 3;  1CEW I;  3WA3 A;  5D82 A;  1ULJ B;  2CFD A;  2INX A;  2CFW A;  3E99 A;  2CH9 A;  3D3L A;  5FW5 A;  3G16 A;  5HGR A;  3FSD A;  4GB5 A;  4HYZ A;  1W01 A;  5LC6 A;  8CHO A;  3LT8 A;  1G96 A;  1WMP A;  1T5Y A;  3LTD A;  1IQY A;  4RZM A;  5AIF A;  1E3V A;  3WA2 X;  3BLZ A;  4HM7 B;  1N9J A;  3NXJ A;  3U97 A;  1QAF A;  4AKY A;  1M90 4;  2XR8 B;  4N6N B;  1YI2 3;  2BT3 A;  3KII A;  2CWU A;  2FGT A;  4AKZ A;  4ORL A;  2IUK A;  1JB5 A;  3X42 A;  3SLU A;  3CCS 3;  3HK4 A;  3OW2 2;  4N6V 0;  3FZW A;  1CYV A;  2MF7 A;  2CFL A;  3IMA B;  4LSO A;  1M9G A;  4BTX A;  3M8C A;  5CF1 A;  1NJI 4;  2CW9 A;  1TFK A;  3MYT A;  3NM2 A;  4EV2 A;  1K73 4;  3CC4 3;  2K54 A;  4IT7 A;  4HKV B;  1N5H A;  2KCD A;  2PZV A;  3HZP A;  4IPB A;  4KFE A;  3U1W A;  1OGZ A;  4L7K A;  5IG5 A;  1J2B A;  4U13 A;  1DVD A;  1FUW A;  1W6Y A;  2BHM A;  1O7N B;  1OF5 B;  4HZB B;  3EF8 A;  2HMK B;  4OK0 A;  5AIG A;  1OUN A;  1IT8 A;  1VQL 3;  1NU3 A;  2XRX B;  3GRD A;  3B4P A;  3MHE A;  2P09 A;  1ROA A;  5AYR B;  3DGM A;  2M7O A;  4KVH A;  3DM8 A;  2F86 B;  4BTY A;  1RKY A;  1BUQ A;  3OXA A;  1FGQ A;  1SII A;  4O2H A;  3FGY A;  4HM4 B;  3N9H A;  1Q86 4;  4GL6 A;  4HM2 B;  3OV4 A;  1W6C A;  1O7P B;  3Q90 A;  4KFF A;  1ISK A;  5CXO A;  2V1L A;  4HM8 B;  4MMZ B;  5CLK A;  3LT9 A;  5BXQ A;  2W9P A;  3NBB A;  1GY6 A;  2Z7A A;  1A90 A;  3NHX A;  4NHF A;  4XBY A;  4IIA A;  2HML B;  2BMQ B;  1CQS A;  5IF6 A;  1A2V A;  2Z76 A;  2W56 B;  4N6M A;  3HX8 A;  3ER7 A;  3EBT A;  2UX0 A;  3F40 A;  1VQ6 3;  4KZ1 A;  1RRL A;  3JUQ A;  4XBT A;  3UB1 A;  1IVW A;  2W04 A;  4EYC A;  3FF0 A;  5KP3 A;  4I4K A;  5AEU B;  7STD A;  3FG4 A;  1UW1 A;  4Q53 A;  5CK6 A;  1VQ7 3;  1GYB A;  1GY7 A;  3VGN A;  5IW9 A;  3I56 3;  3CD6 3;  2WOH A;  3N54 B;  2P05 A;  1U8C B;  3B4O A;  2OOV A;  5IEN A;  1KQS 2;  4HM1 B;  1SPU A;  2B24 B;  2GU1 A;  2GEX A;  3NUV A;  1TU5 A;  1VQ5 3;  1GD3 A;  1DMM A;  1PU4 A;  2XF3 A;  3KSP A;  5IER A;  1UI7 A;  4N6O B;  1STF I;  2HMJ B;  3SOA A;  4FMD A;  4R9L A;  3X3Z A;  1IVU A;  1LXE A;  1RRH A;  6STD A;  3FH1 A;  1ZO2 A;  3F7S A;  2OQE C;  3SOY A;  1JN5 A;  3TDG A;  3KE7 A;  1HKX A;  1WQL B;  3CU3 A;  4J8T A;  3MSO A;  2CC3 A;  2OTL 3;  2OOV C;  3K7C A;  5IG0 A;  4L8O A;  1GD4 A;  1YJ9 3;  1Q42 A;  1ULI B;  3N8B A;  4HVN A;  3DXO A;  4WFO A;  3VSY A;  1ROV A;  2JQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...