3H3LA

Crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
232
structure length
232
Chain Sequence
QALDSDGIPTGGEWITMFDGKTLNGWRGYCRQDVPLGWVVEDGSITYKGSDNKADTGFGDLIYDKKFKNFVFEIEWKIDKAGNSGIFYTAQEIEGTPIYYSSPEYQLLDNENMPDAWEGCDGNRQAGAVYDMIMPDPQPVKPYGNWNKTRIVVYNQRVIHYMNDVKILEFQFGTPVWRALVDHSKFSKFSTSPEKCPEAYDLMLQCGKQPGYIGMQDHGYGVCFRNIRIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PUTATIVE SUGAR HYDROLASE (YP_001304206.1) from Parabacteroides distasonis ATCC 8503 at 1.59 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Hydrolase
molecule keywords PUTATIVE SUGAR HYDROLASE
total genus 58
structure length 232
sequence length 232
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 3h3lA00
3LF7A 3KF5A 4FFIA 2QQUA 3UGFA 3UGHA 1Y9MA 2AEYA 5FMBA 3SC7X 4EQVA 1UYPA 4AZZA 4HXCA 4B1LA 2QQWA 3RWKX 5ANNA 2XQRA 1Y9GA 3KF3A 1W2TA 3PIJA 3U14A 3H3LA 3ZR6A 1ST8A 4JQTA 5FK8A 2OXBA 4UFLA 4UFIA 4UFKA 5FMDA 4CCDA 4UFHA 4FFGA 3HBKA 3LDKA 3PIGA 5FKBA 4QHZA 2ADEA 4B1MA 2QQVA 4UFJA 3U1XA 5FK7A 2AC1A 3S5QA 2ADDA 3LIGA 3UGGA 5FKCA 3U75A 5FIXA 3LIHA 3LEMA 3IMMA 3LFIA 4FFFA 2AEZA 5FMCA 4CCEA 3NMBA 4CCCA 3ZR5A 4FFHA 1Y4WA 3LDRA 3OSDA 4UFMA
chains in the Genus database with same CATH superfamily
2XL9A 2UYBA 3LWCA 2RVAA 4XJ9A 4LBLA 4YVSC 5GLVA 4NN0A 4RS5A 4FQ4A 5K0UC 3RMXA 3ZOIA 3ZKYA 5JZGB 5LA0A 2B5HA 1YQ8A 2P2KA 1XE7A 1NLQA 3VBSB 3MLLA 2XJUA 3E5QA 1JUHA 4M0HA 4SBVA 5IFPA 5HV0A 1W9TA 2NMNA 3NVCA 5GKAC 3SEEA 4UFJA 5AC91 2XJRA 4BQ1A 4BXFA 1Q5OA 1ZA7A 2PFWA 1SDDB 4CP0A 1ZA4A 2X29A 3WX5A 3TWIA 1GZ9A 5FY8A 1BHGA 1LOEA 3HNYM 3WF0A 3PDQA 2A6XA 1W9SA 2ZJCA 3J8F1 1H1MA 1K5JA 1W8OA 2D98A 1QNYA 2VZUA 1T2XA 3WCRA 4LUKA 4Q0SA 3WNNA 4CRQA 5AC92 3CKHA 1KITA 1N1YA 1H1IA 1OQDA 2ZA9A 3QOPA 4IEOA 3BIWE 5A7WA 5C4WB 1LGNA 1SPPA 3Q9OA 4BWOA 3ZXKA 2V72A 4D7YA 1OLRA 5E88A 4ZS3A 1AJOA 1VRH3 5FP7A 2GC1A 4FI9A 5C5UA 2GSYA 4K8RB 3LKJA 2YYOA 3WDTA 5JUVA 5H9QA 3EJKA 4RFRB 2HLEA 5CAZA 3H9AA 1S0IA 4Q4Y3 1DQ1A 2P3JA 1HIXA 1CAWB 2QQUA 3JBG3 5FZ6A 2G9GA 3A7QA 3KQ4B 3D3AA 5FYYA 3N7KA 1E57A 3HJRA 5LB6A 1NE4A 4OHXA 2HWD2 5FP3A 1AZDA 3V64A 3DKWA 1W9FA 3A0NA 2RS32 4P00B 3VZKA 1OFSA 4IERA 3GHNA 3VDCA 1ZBE2 4LO7A 3BOWA 5EFUA 5FXXA 5ISLA 2RJKA 4QGNA 5A6XA 5D21A 3USUB 1SEFA 4OQ9A 5JMCA 1VBD3 1GP4A 1N47A 3IDBB 3NKGA 1IHMA 2VTXA 2ETEA 1AXZA 3VBHB 3AKTA 4CDXB 1R64A 1RVF2 2P4EA 3M8LA 5DAVA 4JQRA 5LBCA 4XDPA 3VN4A 1XYPA 1QJU1 1CWPA 4EWAA 2WC2A 1HXS1 1CAVA 4XJZA 2OX0A 1ULOA 4EQVA 4KL1A 1GZWA 2A75A 1WW6A 3KT7A 3ZXAC 1KDKA 2DVGA 1Z7S1 3OJBA 4A4AA 4K9SA 4Q4X2 3M1HA 3H7JA 3OGVA 3D82A 3J7LA 3JD72 1WMEA 1QF3A 2CWMA 2H6CA 2OXBA 5FK8A 4ARYA 3I59B 1OA4A 5JCTA 4N53C 4Q4W3 1CQ9A 4AFAA 1Z7S2 1XYOA 1C57A 2ZABA 4GAZA 4OHZA 3JB4C 3VBSC 4C1WA 4WVWA 4WV8A 4OMDA 2J7MA 5L73A 3SLIA 1DZTA 4HN1A 1H0BA 4JDNA 4L2NA 4BIOA 1DQ4A 2NQYA 2JECA 4N9HA 1YFUA 5IUQA 1HLCA 3DL3A 4IEUA 2JG8B 4JHTA 4O61A 2BGPA 2QZ3A 4MO3M 5DDJ3 3ZX7A 3CHXA 4KGQA 2J1AA 2JD9A 2WO7A 4NWWA 3WF3A 1HQLA 1ULCA 4GKXA 4OUEA 1VBA2 4MXVA 2VCBA 1YRZA 5LBEA 4LIVA 1AR63 4CUAA 3AZVA 3F95A 4HKLA 3VUOA 1E5RA 1S2KA 4YW3A 5M0TA 4NR1A 1AX1A 2IXJA 1XU2A 1DGRN 5LA9A 1UZVA 4YG3A 1D7PM 1XE0A 3U0ZA 1F8VA 1CPMA 4QPIB 4YZ3A 1HN1A 3A0KA 2D3PA 1PMJX 2Y34A 1LOAA 3IWZA 3JQWA 4WM7C 5DDJ1 4O7XA 3RZHA 2BV4A 1C5HA 1QH6A 5F6KA 3MUY1 4EYUA 1BVVA 4LBOA 3THPA 2XJSA 3INAA 2UY9A 5DZFA 3D8CA 2O8QA 3T08A 3O0VA 4UBGA 5J36A 1UD1A 5DAPA 4I2OA 4OHVA 5JMOA 1CVNA 3VHNA 4EN6B 1W3VA 3IDAA 4AGVA 4AYUA 4BE3A 4LBQB 1AR62 1YLLA 2RS53 4QKNA 1JYTA 1R1A1 4XF9A 3BTZA 1GOGA 3M7AA 2CAVA 2VUCA 1WCQA 1W8ZA 4FOQA 4QHZA 2UY8A 3USUA 1JHJA 2Z42A 3UGGA 1PX3A 5FPXA 4QPGA 4IGOA 4P08A 3CJIA 4PF1A 2PHXA 2DBIA 4PIYA 2V5DA 4BQXA 3AK0A 1NYWA 1RUH3 1BMV1 2DUQA 4AFCA 5CISA 1I6XA 4LK7A 4XHXA 4CUBA 1CESA 2RS12 2AREA 1CAUB 2BVVA 5K4LA 4YM2A 3WP6A 5GALA 5HBAA 3H0OA 3OGJA 4IGQA 4M3CE 4Q27A 2Q8DA 3RPQA 5I91A 5LBBA 5JZGA 5K0UB 5JLVA 4CDWA 5FZGA 2DDUA 1Y7BA 4J1WA 2P3YA 4OQ8A 3ZMOA 4F3JA 1IZ3A 1OFNA 1QH7A 1YQCA 4FO9A 5FFOC 3I2IA 1DQ5A 3BTAA 3NV2A 4OI1A 3UV9A 4FPGA 2WNEA 4COZA 1WW4A 3OG2A 4QKFA 4M3CB 4CDUC 3E6DA 1PVC1 2OQ6A 2VOVA 2P37A 3C3VA 1UQXA 3HN1A 4BQ3A 4E27A 5B4NA 4QXCA 4R9BA 3T1LA 3OY8A 1WKYA 4DMIA 5JR2A 2JDNA 2Y6HA 3MUZ1 4Q4V3 1FPN3 1PGW2 2H6BA 2EIEA 4YW2A 3ZIWA 1XSQA 4AZZA 3IN9A 2WZPP 5CG9A 1V6LA 2ARXA 2KD7A 4A42A 5FZCA 1QKQA 1B09A 2R043 4EWEA 1Q8OA 3ZFGB 2ZS6B 1WLCA 3AVRA 1PO21 4ISRA 3IM0A 4LO5B 1ZRDA 5KC5A 5A3UA 3H3UA 4ITCA 4Q5OA 3WNKA 3NO8A 1OVPA 1H30A 2X5IC 3R4UA 2BBVA 3ZN6A 1OURA 1FV2A 4XF0A 4RQPA 2LS6A 4IV3C 4N7UA 5FUPA 3T2QA 1UZZA 4KNCA 3ZYJB 3W59A 3H1YA 3FHQA 4CP2A 4HPKA 4ES9A 2DF7A 3KZ4C 1OF3A 3ZSKA 1V6KA 2VQUA 5FPZA 1DG6A 4LBNA 4EN9B 2I45A 2QVSB 3OYWA 1JYVA 1NQDA 2DCYA 3LB9A 2W91A 4UF0B 3VBFA 2VNVA 3ZYFA 3HWJA 1KD7A 1VB2A 1ALYA 1PVC3 2A3XA 3VL9A 3WXPA 3GF6A 5I0RA 5JAXA 2HWF2 5SV8A 4L97A 1MS0A 4Q0QA 1GWLA 4K40A 1TNFA 3N7LA 5LY1A 2KM2A 1PZ8A 2KR2A 5FZBA 4ZONA 4OI0A 2QQKA 2BNNA 3FLTA 3PMEA 5IK7A 4QQLA 1N1TA 3I3BA 5HV4A 1VMFA 2ZMLA 4YVSA 3CJIB 4S2DA 2Y38A 3RWNA 2VXRA 2RM23 1XJAA 2YU2A 5LA2A 3NRUA 1S4CA 2R0HA 1LOFC 5F5QA 5L9VA 3IB3A 1Q43A 3PL0A 4N53B 2DFBA 2WINB 1VIWB 3H3LA 4OFGA 3LOBA 5T50A 2CY6A 2VBBA 2ET7A 3OY8B 2R30A 2WYSA 4DXTA 2Y6GA 5FTTC 4EN7B 1LHOA 2Q1FA 1R083 4JGYB 4XJAA 2W9XA 2HWD3 3WY6A 3MIDA 1GQHA 2W5FA 5JOXA 1ZZ8A 4XPVA 2W08A 4V2VA 3IAPA 5GM0A 5D1IA 3EYPA 1D0HA 2QNKA 3JUUA 1HW5A 5IJRA 4CXXA 4QXKA 3RZLA 3R0RA 3ZSMA 3ZXLA 4CVUA 5A3NA 4GB33 3OBTA 3J8F3 1Y43B 1GICA 1MS1A 3NQHA 2D5HA 2JD4A 3AMQA 1D2SA 1QU0A 1OQ1A 3ZYRA 1RINA 3X29B 5JI9A 3K3OA 1RUI1 3FHIB 4QPIC 5EHDA 3J9SA 1XB9A 3I2FA 4XXAA 4FOYA 3WCSA 1D4VB 3CEWA 4K1ZA 4NAOA 1I5ZA 3T09A 4JGZB 4XVHA 1PGL1 5C8CB 4Y22A 4M3CF 2HWF1 4FPEA 4QM9A 3GJAA 1HRI3 5AC93 4XZPA 1FNYA 2DWRA 3NNJA 2D6OX 4W6WA 3IMMA 3E6CC 3UKTA 3SXWA 1RUC1 1KJLA 5FZFA 3WF1A 1KDMA 3ZPYA 4QDQA 3G6JB 2FD8A 5L9BA 1JYNA 3HBZA 5J1XA 2VZOA 1MPXA 3C2UA 3N7JA 1CAWA 3RDIA 5F37A 1H4HA 1KS4A 5IYYA 1D0GA 1U12A 3WT3A 2WLPA 3WW4A 4AWDA 1SBEA 1UXXX 1H8TA 5FZMA 3ZFEC 4CUCA 3VD9A 3U1XA 2R49A 4GB32 1OOPA 2A3YA 3JBG1 2AZ5A 3VKLA 2PELA 4HKOA 3RYRA 2QZ2A 1QDCA 3KS7A 1PX4A 2QFEA 4BK4A 4S2GA 2W94A 1NCQA 3MFCA 2Y60A 1RHI1 3PJYA 2HJIA 4Q0VA 5FYIA 3SITA 2EXHA 3C7GA 4PIXA 1REDA 1GKBA 5GJ6A 1YC61 1V6MA 3LA7A 4ASLA 1BBT1 5BNOC 2Y64A 1R091 2IXLA 5CBLA 5F3IA 1QJU3 1ONAA 4UFIA 4V2WA 4Y1YA 1ASJ1 4LJHA 1BK1A 1OLQA 1YIPA 1OUSA 2PQQA 4MOAA 5CA6A 1JZ7A 4UF0A 3VBFB 1LHUA 1AHSA 3SEPA 3PJQA 1BQPA 3AB0A 3SCHA 1YI7A 2C9AA 2MPFA 3KT4A 4DUWA 1NKGA 4ASKA 5KR7A 4ZHNA 1BBT2 1O6UA 2VM9A 2EAKA 3BODA 2R061 2J1TA 3GZUC 1W2NA 5LATA 1L7QA 1SLBA 4AEMA 3AZWA 5F8PA 3BCWA 2GN7A 2GN3A 2VCMA 1FI2A 3HT2A 4KWJA 4DRRA 2WNVC 4J6GA 4H14A 1IS3A 1UMHA 4JV4A 4OMCA 4LPLA 1G86A 1PVC2 5L7OC 4K6BA 2GP3A 5I0SA 3MLKA 4CDUA 3PUIA 2YXSA 4FTBA 3O1VA 1A34A 2XH6A 5G04L 5DZEA 1JOPA 2GC2A 1YIFA 4V1PA 5C9AA 2VMHA 1G9BA 3TEWA 5ABJC 3I2GA 1H2KA 4CU7A 1MACA 2BWCA 1O4TA 2X09A 5T5PA 4AFDA 5EYXA 4JGYC 1R092 5A1AA 2B45X 2PHDA 2PAMA 2VZ3A 4BZ4A 1RUC2 1GBGA 3VD7A 2JDUA 3ILNA 4IDZA 5H9SA 3POFA 1UX7A 4CDWC 4JHZA 5DN2A 4FCAA 5A32A 1SHWB 2FCVA 3R4DB 3ETQA 4CDWB 4TZDA 3M3CA 5FZIA 1C8M2 1OQEA 2R073 5LRSA 2VBPA 2WWUA 3GXUA 3N9LA 4MGQA 4R9DA 3UL2A 1HV1A 1LCLA 4Q4V2 1X50A 2XLFA 1S2BA 2BGCA 4LUMA 2NMOA 3CJIC 3HD8B 3WG1A 4XYXA 4QWNA 4LKDA 1DP0A 4LMFA 3ZR5A 4Y24A 3P3NA 5FQ0B 1R093 4PDWA 2R16A 4QPGB 2NN8A 4E2QA 2EIBA 1OLME 1OC1A 5A33A 3CZJA 4FP2A 5GLWA 3ZXEA 4D6QA 5FZOB 5FUIA 4YLZA 4AK3A 3ZR6A 3MI8A 3T4VA 3ECQA 1VBE2 2CGNA 4GJYA 5IT6A 3T2PA 1W2AX 2RJLA 1LHVA 2A6WA 1VBB1 2NYYA 4NHYA 4WM8A 2QTWB 2FMYA 5CKNA 5J48A 5JOZA 4L8QA 3I7DA 4RN5A 5GLZA 2OKXA 4KWLA 3USSA 5LZ6A 2C6SA 4LBQA 4BLJA 4QX1A 1ZBA2 4IEXA 2OIIA 4CEWB 4BMEA 2Z69A 4YNIA 4YARA 5IVEA 4FPCA 5FZHA 3TNQA 1MS5A 3DUIA 4GA9A 3VLBB 2FZ1A 1F31A 2VMIA 2YHJA 4OHWA 2LTNA 3DECA 5FQ0A 3N9OA 4Y22B 3N9PA 3EHKA 3B5LB 3VBSA 3I4IA 1STMA 2WL1A 1RVF1 4XJ8A 4GKYA 2V09A 1RGSA 4QHOA 4AAXA 1ZZ7A 2WNVB 4RGGA 2YFUA 1TEIA 3MFAA 4IL7A 1TMF3 4K3UA 3KCXA 4CEYC 2FZ2A 1DGRA 1H6XA 1QJY2 4H7LA 5EP9A 3VZNA 2ZAHA 1DLLA 2WT0A 2HH9A 2E31A 2ZGSA 4HK8A 2HYKA 1MVQA 4KBBA 4YGBA 3AYEA 5EZWA 2W95A 4AFBA 3CDZB 1VBC1 3A4UA 2UWCA 2VZTA 5LRRA 1W6QA 2D97A 1IS4A 3ZVXA 3S0MA 1F15A 1H9WA 3DGTA 2ZGQA 3FC0A 4OZXA 5DUWA 2W46A 3UGFA 2QJVA 2ZHMA 2E51A 1V6OA 2WN2A 4KG8A 3J7MA 4WVMA 5F5IA 3WINE 3RVHA 2CAUA 1L7RA 4EROA 3G7DA 4A6OA 5CB7A 3U07A 3K75B 1ZBA1 1JUIA 3E5XA 3SHRA 2WT2A 3D5OA 5ANQA 2WBKA 5FZAA 3WLUA 1VRH2 2BNOA 4QD2A 3ZDSA 3H1MA 1C28A 3JCIA 5FPAA 3SMHA 1FOD3 2GDFA 5EQUA 2BJSA 2GMMA 3UJQA 1CAXB 3MV11 3MDPA 4ZKTB 5EJ1B 4PT6A 3JQXA 1XRUA 1OHFA 3HNMA 5GZEA 5HXVA 1RL3A 5JXIA 4AEDA 5HPOA 3E6BA 5E1RA 5F7UA 5DZGA 3WNPA 1H8TC 1AL21 2P6HA 1S0FA 1WBFA 1Q8PA 3LD8A 4I02A 4P9WA 4OI2A 4XFCA 4W6XA 4UFLA 3ST7A 3POBA 2O0OA 1XC6A 3KV9A 3LGRA 1QOOA 2HWD1 2ZKLA 3V0AA 5AFEA 3OYWB 3WNLA 2XHKA 3I97A 4YGCA 4QDSA 3I2OA 3M3EA 1VB4A 1FOD1 1A3KA 1UY3A 3Q8FA 4EZ4A 5FYTA 4CXWA 1OLMA 1TVGA 4KWUA 4AXOA 3NNLA 1W8TA 1MS4A 4W6YA 5EJZB 3PNAA 1PGW1 1YI9A 1R1ZA 1W39A 1RIRA 2P6CA 3AKSA 1BYHA 5A7WB 1GP5A 3VDAA 5JOWA 3ETPA 5FZDA 1VP6A 3ZMNA 5HCHA 3CNAA 4JCKA 1U5ZA 3KVBA 4IE0A 3ZO0B 1UY2A 1MEC1 5FWEA 2LALA 3NJXA 4AVBA 5ABJB 5LEKA 1RUNA 1RXFA 3IKWA 3NAPC 2P34A 1AR91 5FOJB 1DCSA 2VZ1A 3LFIA 1RUD2 3IBMA 2GH8A 4LT5A 1K3IA 3BB6A 3WQBA 4Y1VA 1O91A 3OSDA 5CVRA 5D2AA 2P17A 4NRMA 4JAAA 3I3DA 4HOOA 4QU2A 5EV7A 1Y9MA 3BTXA 2CTVA 4GXLA 1XNCA 3B3QE 4MH0E 4AI1A 1QGLA 4KQ7A 2Q8OA 4COWA 3IAQA 2UWAA 5A33B 1ZRRA 4WZCA 1PMIA 3ILFA 3N35A 1PNGA 2E53A 3H8OA 4OUSA 3IPVB 2SLIA 5DDJ2 4XUTA 4URAA 3O1MA 4PI2A 4MHUA 5K0UA 3GZTB 4PLNA 3S6PA 1UKGA 1BEV3 5FP8A 2BOJA 2A71A 5LWBA 2IVIB 3FMGA 1SLTA 1RITA 3POSA 4MGKE 4N43A 5FV3A 1YFYA 1LENA 2D5FA 2HKXA 4HSLA 3IPVA 4Q4W2 4S2HA 4Y20A 2VU9A 5CFCA 3RYKA 1TZOA 3WDWA 1X7NA 1IPKA 1VALA 2WS91 5FDBA 2VMDA 1NXD1 4Q4X3 2PQSA 2WN3A 1HB4A 4Z2WA 1AUYA 2TEPA 3KF3A 2D43A 1DYPA 4IE5A 4J25A 2VG9A 5C3RA 3WUCA 1GANA 1RMU3 1D4M1 1LODA 1SCSA 1ULDA 3KGLA 3VB9A 4MADA 1E5SA 2PAEA 4DFSA 4PHZA 4I0BA 4IW3A 2YBPA 4RA0A 4CYDA 2VQTA 5JOYA 1CX1A 2DTWA 3CO2A 1GOFA 3AFKA 4JKKA 4XEZA 3RI9A 5FZKA 4A2UA 5L7OA 2IWGB 4Z07A 2IXIA 3VD5A 2TBVA 1JZ2A 3AZZA 1VJ2A 2VNOA 3I59A 2VMFA 3ATGA 3OBAA 2HWE2 4UFHA 2ZX2A 1S2EA 3WQ7A 1LULA 3ZXJA 4N53A 1D4M2 2LW8A 5FY5A 4XZUG 4PF5A 5IFTA 3SISA 3WNMA 3FJSA 2OPWA 5I8YA 2BQPA 4LHKA 4YVSB 2EICA 2RR11 1PO12 2ZCWA 4Q4Y2 4L9BA 3M2MA 4H2AA 3RGBA 1IKPA 4XJWA 1F35A 3ASIA 4WVZA 4HMZA 4ZY9A 4XIKA 3RQ0A 4DXRA 2HWE1 4PQ9A 4C0HA 1RC6A 3NKTA 3V0AB 3OUJA 1F9KA 3AM2A 1OF4A 3WNOA 5FPBA 4XUNA 1LB2A 2W47A 2CNAA 5FY0A 5LEJA 3ZXGA 1TQ5A 1LECA 2GZWA 1DZQA 1FXZA 2ZGPA 4NE9A 5FZEA 3SH3A 1LHWA 4JGYA 2VZQA 3B01A 4RGAA 5C6CA 5IK4A 2JE8A 1HQWA 3RNSA 3WG3A 2Y6LA 2W2IA 1IGOA 2J42A 3DXUA 2D7FA 2GC3A 2VZVA 1KFXL 3DPRA 1KS5A 5GZFA 3ZFFA 3ZSJA 1WUVA 5FMOS 4NOTA 4H7MA 3SCFA 1GNZA 2PXJA 1S0DA 3MIFA 3OBRA 4CCNA 1DLCA 2O14A 4GWMA 1NT0A 3GJBA 3ZN6B 1POV3 3ZIXA 4AEJA 4CA9A 4FXKB 3U75A 1UOBA 1S55A 2ZZQA 4QM8A 1ENRA 2DUPA 4XDQA 4XBQA 2BNMA 2IC1A 1COV3 1ZBE1 3DCQA 4HN0A 3O1RA 3NL1A 2YROA 5LASA 1OD5A 1AXKA 1V6IA 1QXPA 4UW5A 4CDQB 1C1FA 5A3LA 1GMMA 4KGGA 2A6ZA 2DCKA 2PHWA 4QX7A 5A3TA 5CG8A 3I2DA 4BMBA 3VZLA 3IDEA 1KXGA 5KXCA 3PVNA 4CEYA 4RHV3 4HG6B 2DYCA 1NG0A 3NSTA 3KHCA 1JU3A 2DVFA 4XW3A 5JVVA 5IK8A 3OD0A 3MIEA 2HBUA 4BQYA 2CHHA 1EYBA 1MQTB 2J1SA 3AP7A 1G9DA 2ARAA 2YZ4A 4SLIA 1UY1A 2XBO2 2YGMA 3UKVA 5A3WA 2NZ9A 3URFA 1SG3A 4B7KA 1OKOA 2BEOA 4LO4B 4QAWA 5FZLA 2AYHA 2QQLA 1MVEA 4AVVA 1MS8A 3ZFEA 1X82A 3T2TA 3NAPB 2WR9A 4XIOA 3LDRA 3VZJA 3B7MA 2WSVA 1WCSA 4GALA 4D6RA 2W68A 4HL0A 2WKKA 2QQPA 1LAJA 1FNZA 1XNAA 1MEC2 1ULPA 1ZZ6A 2XKPA 3I2KA 3LCPA 2B7YA 4I0WB 5E16A 5KXBA 3S7IA 3MF6A 1NCQC 1S1AA 4LNVA 1JOJA 1H9PA 4P02B 1DZRA 1JYIA 4E4ZA 2VAUA 3B9CA 3FZ3A 2ZGKA 3FUQA 4CSWA 3LOIA 2W1SA 3K4AA 4C90A 1UWWA 2PTMA 3DF0A 1W6PB 5C33A 1IPSA 1DGLA 2ZX0A 3RS6A 5FXZA 3QACA 4CEWA 2VW2A 2DFCA 1AX0A 5FZ9A 3O1SA 4Q4W1 2DUOA 3AP9A 1VPHA 1CONA 1W9WA 3LIHA 4HANA 1CN1A 2W3JA 3E5UA 3Q8EA 4BXSV 2P3IA 2WYFA 3MZHA 1UZ0A 1OXCA 2JIGA 4AHYA 2WRAA 2Q1ZB 1V9U3 3D4KA 1OSGA 1JZ8A 2R0FA 2W0XA 2ZX4A 2EIGA 1WLTA 4LO8A 5DABA 3WNXA 4C8DA 3KCCA 4UI9L 2X8KA 4YWAA 1LEMA 1ND3C 3HMYA 1MZEA 5F6LB 1RUD1 4CCOA 5EJ3A 2XB6C 4MXWB 5FO9B 1XPWA 5FLIA 2IFRA 1BVP1 2DCTA 4BM8A 5CFDC 1UOFA 1UXZA 4NIIA 5CEHA 3T0AA 4BHPA 1PGSA 3RZGA 3VDDB 3ES4A 5K8SA 2OUJA 3THTA 5T5JA 4MGSA 1MR5A 1SLCA 2Y0IA 1X8EA 1EUUA 2R042 4ZXKA 2E7QA 4AHWA 1SFYA 2HWC2 2LROA 3LEKA 2B39A 4RHV2 2WO2A 4BK5A 3N9NA 3GNEA 1XSRA 4I30A 3LF7A 3JBG2 4IE6A 4W8JA 5A1FA 5I8TA 1A78A 1YO8A 1BCXA 2V4VA 1Q8SA 1UYPA 4DUVA 3HIFA 4FTEA 4G9SB 1WWYA 2VW1A 2OYZA 4YW4A 3VKOA 1COV2 1WCDJ 2HEYF 4B4PA 4Q1RA 1HKDA 3I3QA 4K7JA 3O0WA 1ODNA 4Q26A 1TME1 5C9AC 2WA4A 1NXMA 1G8WA 1M06G 3BOPA 4DEQA 5ABJA 1REEA 4ZXEA 1WMDA 4FAHA 1YHFA 4NWVA 4NIDA 4KU8A 4LIUA 5JXHA 2H0BA 4ISQA 4BISA 4FFIA 1U5IA 3UGHA 5C8WA 5D8AA 2K0GA 1X33A 2CWSA 4LQRA 5FUNA 3R6SA 1CJPA 4IV3A 1RHI3 4K1YA 5JWPA 1ST8A 1HB2A 5FYBA 5H9PA 5FP4A 5FLJA 5FPVA 5IVBA 2VUAA 2ZGNA 3OOXA 1ZRIA 5FO7B 4AFMA 2W87A 2ID4A 3BKZA 1S0EA 2ARBA 2QQMA 3NJVA 1YCIA 4IEYA 5FYHA 1CPNA 3UESA 3CMGA 4XBLA 3VBHA 5FXWA 5ACA3 1EUTA 4E8DA 3C7FA 2DTYA 5D8AC 1N3QA 1AR72 2B46X 4L0PA 1RVF3 4BDVB 1RUI2 3A23A 3MW4A 4YW6A 2YC0A 3HNBM 2PYTA 2UURA 1UYYA 2P3KA 3K4DA 3AJZA 1VBD2 1EV13 1AL0G 2XLGA 5C7GA 1GUIA 3GZAA 3WG2A 2PHFA 4WVVA 1LESA 1AR93 4WM8C 3O1UA 3ZFEB 1RUJ2 1TNRA 4XF4A 1ND2C 1ZM1A 4QB6A 5BUVA 1NCRB 3ZXFA 4N90A 3VBOA 1ND3B 3O1OA 5A7NA 3PUHA 1UMZA 2J1EA 4TTGA 5F3EA 4IE7A 3O7OA 1C3HA 3LDBA 4JKLA 4NHXA 2XVKA 3HPNA 4DS0A 4EWDA 3CF6E 3CBNA 1O7FA 1C8NA 2QBXA 2R32A 3A21A 5DUXA 1IKQA 3JXSA 4Z8BA 3ZYHA 4RFT0 4XQDA 3NV1A 5F9TA 2YC2A 5FOBB 1VBA3 2VCCA 4BYYA 4MHRA 4A45A 5C3OA 2MEV3 4GB31 2CL2A 4AF9A 5A7SA 2ILMA 1NOVA 1QY4A 3ENRA 3RG0A 1NAEA 5FY7A 3S30A 2OUHA 2IVJA 4XILA 4FPJA 4I3PA 4RYDA 3EQEA 4XMIA 2R1BA 4Y26A 1B35A 1VR3A 5FBJA 4CP1A 4DIQA 5BYNA 1JI6A 3RI8A 4CU9A 3BIEA 1PM7A 1U0AA 3KLSA 2Y33A 4Y33A 1DGWX 4LR4A 5FYZA 1BEV2 3T0DA 3FN9A 4QQHA 2R063 3DPRB 4C1XA 2ZAAA 3WSOA 3OB8A 4QB1A 1GWMA 4CCEA 1AXYA 4AEDC 3APBA 4KU7A 1LGCA 3K2OA 4UOJA 3BI3A 1CZVA 2YB7A 3ZFGC 4XOGA 2RMU1 3ZFFC 5KHGA 1RUE3 5SV5A 3OGSA 1GSLA 2LRPA 3ZN4A 3AVSA 1QJEA 2E63A 2ZEYA 5KWRA 3M70A 1R1A3 1PO13 2GC0A 4PIZA 2WAOA 2Y6FA 1US2A 4P9GA 4BCUA 3WEZA 3TB0A 5DAWA 4EN8B 4QQ2A 4AL9A 3OTFA 4C91A 2VD7A 1OH3A 3FBYA 4A3ZA 3O12A 1W28A 1R082 2VH9A 2VZSA 1VAMA 2GMEA 1RUG3 4YZ4A 5JSPA 1WW7A 3VBRB 4DXZA 5C71A 1WA4A 3L2HA 3N9QA 3NV3A 1W0NA 1Y4WA 1PK6B 5FZ0A 1POV1 4IV1A 3NWKA 4XUOA 3VDDA 1C5IA 3A22A 4MLOA 2AEYA 3QBQA 2DU0A 4M4PA 5F2SA 3N4MA 3GYDA 2ZMKA 4UAPA 4LBJA 1AR73 1R1A2 5K7PA 2AH2A 5L7OB 3B69A 4NRPA 2A5ZA 1F4AA 5HI0A 1W8NA 3GBFA 4ES8A 4YSFA 5T3NA 2C9KA 4WM7A 4B4RA 5C3SA 2VMCA 2ZX3A 4LTAA 4IV1B 4YM1A 2XOMA 1BKZA 1GU3A 2OQ7A 3KD4A 5IVFA 1J3RA 2ZX1A 2RM21 5GZGA 5I93A 1RHI2 4FPFA 1QQP3 2WFF2 1LJ7A 1UAIA 3J4UH 5F2WA 2N7GA 1W2UA 4Q2FA 3RFRA 5F5AA 2VO5A 2HWF3 3KT1A 3PU8A 5FR3A 3R05A 3IIAA 4MVTA 5CNAA 4ZU7A 2A6YA 4YVWB 2V4AA 4Q4V1 1OH4A 2EXIA 4PDWC 3DYOA 1XNBA 4YZ1A 3J7HA 1U5XA 2XUEA 4XE9A 5C8CA 3UYJA 2DURA 4QPIA 1H2LA 5HCBA 3LA2A 1CIWA 1PVXA 4OZOA 4A44A 2RMU2 1WD3A 2IXHA 4RQPB 3TAYA 4ET7A 5JXJA 3UK9A 1I5PA 3AL6A 4GJZA 3DYMA 3W9AA 4QKBA 4R9CA 1PNFA 5JR7B 5HCFA 2JDZA 4IEVA 4FFHA 2WNOA 2Y6KA 1LRHA 3UJOA 3ZFGA 3VZMA 4NPMA 5FWJA 4GULA 1UY0A 3AC0A 1T6GC 2JIJA 5GZCA 1DQ2A 1JU4A 2FCTA 1UNBA 4GWIA 4P9YA 3SC7X 1K42A 2OT7A 2D3SA 1D4M3 3VBRA 5T54A 3NJYA 1W6MB 3AYDA 4LLFA 1JHNA 2P5BA 4L99A 1PO22 1W3XA 4LBQD 3HEIA 2WT1A 4M3CA 4FFGA 2JB8A 1G9CA 1XOYA 5FAXA 3P5BA 1UU5A 2MEV1 4D8MA 5BV6A 1QJY3 1NA1B 3AFGA 3M4FA 2PHRA 4R52A 5IHRA 3LEIA 1WMFA 3D0SA 1UX6A 5FMCA 2VUJA 2QQOA 2BVBA 1RMU2 4LKEA 3TN91 1V9U2 2W1WA 1CAUA 3WQ0A 4Y20B 4FT8A 4F8AA 5CFCB 2VXJA 1RUH1 2YBKA 3L2YA 2BYVE 1SQ4A 2WZR3 3FFQA 4XJUA 1AF9A 4LBMA 4CDXA 4DEVA 1QJZA 1NCQB 2DVDA 3CLPA 4KBZA 1ZVFA 4NJ4A 4YW5A 4GQ7A 2A70A 4P9IA 1RUH2 5I0UA 1ULEA 4NVPA 4A7YA 4LA2A 3BALA 1N3PA 2FDFA 5FZ8A 5JI7A 2PHTA 1EAH3 2ZHLA 1FATA 1GOHA 1BEV1 2VQAA 2BUKA 1DIWA 1AX2A 1GZTA 1RMU1 3GGLA 4A6SA 5BNNA 2J22A 4DINB 4FFFA 2Q8CA 4D0QA 3PMSA 5JIAA 3W58A 2K9ZA 3RYPA 1MS3A 4Q0UA 1VBE3 4I09A 5FY4A 1VLNA 2BU9A 2VNRA 3CL1A 2Q5TA 1PGL2 4ARXA 4L11A 5J7MA 2MHFA 2RHPA 2WNVA 1RUOA 2C5DA 3WHTA 2ZKNA 2I2SA 1HB1A 2XR4A 1FV3A 5C8CC 3MHZA 1WZXA 3KMHA 4LORA 3WP5A 2YU1A 1DQ6A 3HBKA 4HBNA 2LUWA 4R4ZA 3FX3A 1SPPB 1I3HA 5HXMA 2YPJA 2BBAA 2C0ZA 1W2OA 2W92A 3PHMA 1FYUA 1O8PA 1PZ7A 4QPYA 2TNFA 4QX0A 3T0BA 2ZGOA 4UYBA 3VDBA 1NE6A 3TN92 4XTMA 4RQPC 3D0JA 3WP4A 2LM3A 4IGPA 2XVGA 3NJZA 5CU1A 2EA7A 1OA2A 3VBHC 2SBAA 4XXPA 3FUOA 4XFIA 2BZDA 2ZEWA 5F39A 3T3YA 1MQTC 3B94A 1UIKA 1LOCA 3BN6A 2GMPA 2Q30A 3AXEA 4YVWC 5FYUA 5FZOA 4LLOA 4HSJA 1DQ0A 3AMNA 5H9RA 1UN1A 1QEXA 2VUDA 5J09A 4GMP1 3PUQA 5ERLA 4NO4A 3MYXA 2P1BA 1UF2C 1RUF1 2BFUS 2VW0A 4M01A 3WQ1A 2D6KA 1J3PA 3OEBA 3GM8A 2RDRA 1UY4A 2WFF1 1Z7S3 1DGWA 4U36A 2R6QA 3W20A 5BXXA 3C7OA 4FXGB 3ZLIA 1O3TA 1FT9A 5C3PA 1FX5A 4RR3A 4Q29A 2YGLA 4DQAA 2XHNA 4R4XA 4ATFA 3AMMA 4YM0A 5JXGA 3OBZA 5A32B 1UW8A 5LK7B 1BLZA 1M4WA 1W0PA 3GCWA 4PCRA 5IVYA 2ZEXA 4CCLA 2A1XA 3LDKA 4P9XA 3POEA 1H8TB 4XF1A 3PUSA 5DUUA 2VECA 4LULA 5FJHA 3RJRA 4MX3A 4PBPA 1S0JA 1N1SA 5DG1A 5C70A 1BMV2 2JG9A 3NNGA 1JZ4A 2VMEA 5A3PA 2VQ0A 4IUGA 2FQPA 1QJU2 4XTPA 4TLFA 1J1TA 1WCKA 4RHV1 5FJKA 1UPIA 4Y1XA 5A3OA 1UZYA 2XBO3 3ZSEA 4INDA 4B29A 5IAXA 4YZ5A 3MW2A 1LKNA 1IPJA 4A41A 1MZ6A 4YG6A 2PLV3 4MGYE 1QJX3 3SQOA 2HYXA 5KHHA 3SH5A 1W8HA 2BTVC 2C24A 3U10A 2K2SA 2Y8KA 5B4XA 1AYM1 1HRV1 1P8JA 4YG0A 3S5AA 2BP6A 2GNDA 5JPMB 4ASMB 4Y5Z0 4OUMA 1GNHA 1W03A 4NPLA 4XFAA 3VKFC 1PHMA 4OULA 5GLUA 1GFF2 3HVDA 3B9IA 2YFZA 1TMF1 1PK6C 3O5SA 3IDCB 3QD6A 1O8SA 4LHLA 1RUF2 3ON7A 1POV0 2EVXA 3CJXA 5F3GA 1J58A 5A7QA 2FCUA 4HKWA 4P5YA 1RJ8A 2DCZA 3LAGA 1N3OA 2JG9B 4BA6A 1IG0A 4QDRA 4CZSA 3U37A 2ARCA 3WVJA 4H3WA 4LHNA 4W4ZA 2JG8A 1SBDA 2CSGA 3HQXA 5T5LA 3VBUA 5C9AB 4CEYB 2C26A 3VBUB 1UIJA 4FPLA 4AVSA 1SZBA 2OVUA 4JZRA 5CIRA 4LITA 4AHZA 1W6MA 4LXLA 3ZKUA 4E4HA 2RS11 2WNUA 1X8MA 1QJY1 4MGZE 5I8SA 3AKQA 4MG2A 2ZBJA 1QWRA 3MO4A 2FDGA 3T4HB 3LZZA 4NRQA 2E6VA 3OEAA 3LSEA 3TEXA 3DKQA 3NMBA 2XJQA 5FPLA 2ES3A 4P14A 3VBRC 2JDYA 3JZVA 2NM1A 2PHUA 4HZFA 4ZS2A 1ND2B 2BRTA 3FFZA 3WG4A 3I3MA 3EXUA 3RWKX 2ZGUA 5ANNA 4RS5B 4JGZC 4EN0A 1NLSA 4ZZ5A 3R4SA 3GBWA 5T55A 1K12A 2HWB3 2FDHA 1FMD1 4OI4A 2G4IA 2WLQA 1ENSA 4ZU4A 2G1MA 4BQ5A 4DY5A 1UO9A 4F7ZA 2A73B 1UPSA 1DYOA 1WBLA 4NPRA 5BPXA 5TSWA 1QIQA 2ORXA 5FP9A 1O5UA 2CGOA 1W9YA 3K51A 1FMD2 4UW3A 1E5HA 5L36A 1JOBA 1NLRA 2WQZC 2AACA 1YEWA 4D6SA 3FL7A 3MIBA 1VBE1 1AR81 2XLAA 3GHMA 3E1F1 4XABA 3KHBA 3UETA 1GWKA 3POJA 4JGZA 2XPJA 1IG3A 3OUHA 3DPRC 3ORJA 3AKPA 1HXS3 5J3UA 2XKOA 4JVAA 4PBOA 1W2TA 1ZZ9A 2Z5WA 4CCKA 2OPKA 4QQOA 2B8MA 1JZ5A 2B4KA 4MXWA 4NUBA 4CE8A 3ZYPA 4BH9A 2X5IA 1OPOA 1E5IA 1VBA1 1ZZBA 3I8TA 1MZFA 1TME3 2D40A 2PHLA 3QCWA 5C4WA 4HFSA 1CJDA 1VRH1 1NA1A 3BU7A 4ORFA 4UW4A 4AG4A 4FBFA 5IVJA 5CZKA 3THDA 4HVQA 5I0DA 3CIHA 1Q8QA 2HEWF 1UCXA 2JDKA 3V0BA 2Z4FA 3BYWA 4YYOA 2JG8C 3FE5A 3KV5A 4JRAA 5IWFA 1KGYA 2VBDA 4E8CA 1JMUB 3C7HA 3T30A 4A3XA 5DG2A 1JN2P 3WW2A 1BBT3 1X9TA 2OA2A 4DRVA 2ADEA 4IE4A 3H8XA 3J8F2 2XJTA 3W21A 4N7IA 4X8PA 1H4GA 1RUD3 5G05L 4YFWA 3WF2A 1W6NB 5CFCC 3UT0A 2RS31 1PO11 3WR0A 3NAPA 5LW9A 4OHYA 4N43C 1IS6A 1VBC3 5D8AB 2WS92 5CFDA 4BQ4A 2WA3A 2IZWA 3N9MA 3H50A 4EJRA 4GH4C 2Q0AA 2WNUB 4LHSA 1CAVB 4BB3A 3O1TA 4FPHA 1AR82 2A6VA 2VY0A 3OCPA 2XUMA 2JENA 4NHLA 3H3ZA 4AVAA 2JICA 4XURA 5EWSA 1TMF2 1QHDA 1Y9QA 2XGXA 3ACIA 3BVCA 4BQWA 4XAEA 4K20A 1J1LA 3NNMA 1YYNA 2D93A 3KM5A 2YG0A 2HWB1 1RUE2 5ACA2 1AYN3 3FBMA 3I49A 1WCUA 2MNGA 4I01A 2ERFA 2HBTA 5BNNB 3AP5A 4CEWC 2OS2A 4IQPA 5A6ZA 3FLRA 1AL23 2YY1A 4FPOB 4CDUB 5IK5A 1XU1A 4B7EA 3LSDA 1TE1B 2CDPA 3ZXDA 1HQNA 2WUHA 3LPFA 1WLDA 5FXVA 4AQTA 4FQZA 2ZEZA 5APAA 3I2JA 4FSJA 2QQWA 2BFUL 2WSUA 1EPZA 2VPVA 4LKSA 1C1LA 4P9LA 1XNTA 3ZPOA 3RSJA 3BPZA 1PK6A 2ZXQA 3VBOB 1APNA 1SFPA 3PUAA 3ZFFB 5BNPA 3LFMA 4E2SA 1KEXA 1A6CA 3WDYA 2FDKA 3HR9A 2EF6A 1HRI2 1O3RA 4JDOA 2XG3A 5FZ1A 3I2HA 5J37A 4P5HA 1G6NA 2NP0A 1KRIA 1FOD2 2X53S 3EMRA 2YUEA 2BPA2 4IEQA 4QHBA 4XUPA 4B4QA 1Y3TA 4COVA 4D69A 3WDUA 4GH4A 4EV0A 3POYA 2BERA 3KF5A 4MZUA 5FY9A 2VJXA 3AYCA 1MQTA 1HX6A 1XYNA 5A1LA 1LOBA 5IVVA 4JX0A 1O4ZA 3VZOA 2QDRA 3HOBA 3ZM8A 3ZSLA 4NIHA 2BGOA 1ZNPA 3POIA 2VVEA 3THCA 4CP9B 5A80A 5LK5A 2Q8EA 4PLMA 1GR3A 3GBGA 2DCJA 4RS5C 5J96B 2R072 5FKBA 3MPBA 2AGSA 4BQ2A 3U4XA 1WMXA 1KQRA 1QJX2 3EB7A 1YJLA 4RR3B 1G9FA 2B9UA 4ZZ8A 5FKCA 4U2AA 1CD3G 4DOUA 1ZRFA 1DBNA 2X5IB 3LEMA 3UKNA 4GD4A 3GZEA 3KV4A 4LEJA 1NA1C 1GZCA 1SLLA 4DUXA 1PZ9A 1EV12 4P9JA 4CP9A 2VZRA 1V70A 2D44A 3MF9A 1Z0HA 2VL4A 4DO0A 2VTFA 1JXNA 1IOAA 4CCJA 1JYWA 2IXKA 4AGGA 4YRDA 5E89A 1ASJ3 4HXCA 1DF0A 1UU4A 1UZWA 2L9LA 2YPDA 2ZZJA 3PIJA 1LHNA 4GZ9A 3WHUA 2ZHNA 4XC9A 3H42B 4Y1UA 2WZ8A 4RGKA 5EXOA 2WWSA 4XACA 1DU3D 4MSVA 4HVRA 2WO3A 2O1QA 1RUG1 2E9QA 4JKMA 5IAVA 4KWKA 1JTZX 2VULA 4Y5TA 1ENQA 1EAH2 1EP0A 2C4XA 4G4FA 5CKMA 1BJQA 4Y4RA 1ZZCA 4UXAA 4NIGA 4Z82A 1NZCA 1CIYA 4Z1VA 4CU6A 1AL22 2R7EB 1LU1A 1W04A 2J1RA 4DNYA 1LNSA 1UOJA 1NY72 1W8UA 1YXWA 1ZRCA 4M0NA 5BNPC 1XXNA 1B35B 3NNFA 4NAMA 2WNUC 4O9EA 4HK9A 2X10A 1RUF3 1JBCA 3KGZA 4XCBA 4EZHA 1FPN1 3OUIA 3V65A 3BU0A 2VVFA 2JDMA 3ES1A 4OLLA 1UYZA 3N3HA 4COYA 4CDQC 1O59A 4BIFA 1V6NA 4ONUA 3B02A 1PO23 2WIIB 1F5JA 4Y4YA 4Q1PA 2W52A 4QU1A 3B93A 1W99A 3B00A 4N9IA 1Q8VA 1YQ6A 4Q4X1 3VKMA 3VHRA 1F5FA 3W5MA 4YGEA 1IS5A 1VBC2 2VOTA 3SKVA 1V00A 4CDXC 1JZ6A 3Q8CA 1B35C 2PLV2 4TLGA 1W6OB 1VBB2 1OA3A 1V9U1 1Y9GA 3PURA 4Z2AA 2WO1A 3ME2A 1ZYBA 3H8UA 3S7EA 1H2MA 3H7YA 2OW4A 2JB4A 2VGDA 5BNOB 2GNTA 4KG0A 4JC1A 4G3YC 3AP6A 1T6BX 4AI3A 1NQJA 3AXDA 4YGDA 5A6YA 4QB2A 1RB8G 2FDIA 2GH2A 4N43B 2W39A 3DN7A 2JEMA 3O1PA 1DHKB 3O0XA 3SCGA 1RYYA 1U5YA 3L9JT 1VAVA 5KBFA 4FPYA 3T1MA 1HV0A 1W06A 4XBNA 3KVAA 4CXYA 3ACLA 3M3OA 5BNNC 1JH5A 1AVBA 1WD4A 4JDMA 3PTYA 4S2FA 5FLHA 1JZ3A 1V0AA 3V56A 2K46A 3VD4A 1EV11 2RR13 2W1QA 4ATEA 1L3JA 5I0TA 2VC9A 1BZWA 1JODA 1IQAA 1QOSA 3GALA 1YJKA 1DYKA 3ELNA 4C0BA 4D7SA 5DUVA 3M3QA 3MW3A 1CX4A 4CDQA 3OPWA 4KMQA 2VMGA 1QJX1 1CAXA 2RE9A 2O8OA 3GCXA 4YZ2A 4AEDB 5A7PA 1G7YA 5FIXA 4XQWA 2R041 5F32A 2ZGTA 3ZDVA 4RR3C 2W1UA 1HJFA 3E97A 4AQ2A 3WOGA 1SMVA 2D6LX 2V5YA 2JDPA 3LE0A 4QPWA 4BPZA 4K21A 1H8VA 1XNDA 3N36A 2J1UA 2I07B 1URXA 5FREA 1GLHA 2D6NA 4MUVA 3WP3A 1RJ7A 1AR83 4IV1C 3TNPB 4AGRA 3MV01 1C8M1 4JQTA 3VHOA 4EE2A 1SBFA 3HQUA 1COV1 1ZBE3 3ABZA 4XAAA 2KXLA 1AJKA 1SCRA 5F3CA 2FBEA 1NCRA 2G9ZA 5JIUA 3RZKA 2J1VA 4KH9A 3JB8A 4MGTA 2WS93 4QMAA 4AEKA 5BNQA 2RJ2A 2WFPA 4YVWA 2ZACA 4TSVA 3CU7A 2EIDA 1LGBA 1OUXA 4XDOA 3DV8A 5DQ0A 2RS51 1AYM3 1HRV3 2HWC1 3RZZA 4CPBA 2B42B 2C1FA 4UFMA 3BUCA 2RM22 3TEZA 5E6HA 5AFBA 5GZDA 1KJRA 1NX9A 1XNKA 4OYUA 5FZ3A 2CV6A 4PLOA 5IW0A 2F6BA 1NCRC 4PQQA 1ND2A 2D6MA 3U14A 1HB3A 3O14A 2IXCA 1MS9A 3H8RA 4D3WA 5BY5A 4NROA 1QMJA 5J98B 3VDDC 1PIV1 1GNYA 3OF1A 5BNOA 1GQPA 4IESA 2IUWA 5KHJA 3UNPA 2NPIA 5LBFA 4ZU5A 3F2ZA 4JTNA 1F4HA 4W50A 3BPSA 3EO6A 1GZWB 3DYPA 1VAKA 4FOWA 4IEWA 1JYCA 1W6NA 3KQRA 4Q0PA 3MIHA 1Z78A 5LCWL 3PVOA 2E26A 3BGAA 3KSCA 1QXJA 1Q3EA 2RDSA 2WZEA 1YQ5A 1W0OA 4AI8A 1WW5A 4AR2A 2XVLA 4YM3A 4NMIA 4M4RA 2WZR1 4GH4B 1EPWA 1AYN2 4Q8LA 2JJ6A 3MEPA 2F17A 4YW1A 4CPBD 4LO6B 4QKDA 3EBRA 1OBNA 2ZGRA 5EPAA 1ACCA 3AMPA 4B1MA 1W8WA 3OPTA 2ZOEB 4OVEA 1S0CA 3SKJE 4CTEA 2RDNA 1DDLA 2BOIA 2VOXA 2YDEA 3C7EA 1J3QA 2F4PA 2WABA 4GMP3 4CCMA 2AEZA 1L7LA 1AR61 4FAGA 1DFQA 2HWE3 1S0GA 2QUOA 4MV2A 3AMHA 2JWPA 3SNMA 5T5OA 3NW4A 3TOJA 2XXZA 1GP6A 3POGA 4Y3OA 1RUI3 3VHPA 3RMYA 2QE3A 5A6QA 1LOFA 5A3MA 3PLQA 5L19A 2XL7A 3VKNA 1VBD1 4QX3A 4Y1ZA 2Y6JA 4AVTA 3VBUC 2JDHA 1NUKA 3M3IA 3WZ1A 4MYEA 4CUGA 2VOWA 5KHIA 2A3WA 3P3PA 4UW6A 4QXBA 4HPKB 2VTXJ 5KXDA 4O65A 1OPMA 2PAKA 4L92A 4DY3A 5E8AA 4AI0A 2FDJA 4Q8KA 5B2GB 5KXEA 1O4YA 3FLPA 2JE9A 4FTSA 3HQRA 5FYSA 1LTEA 3AYAA 1W6PA 4HLTA 4AW7A 5FMBA 3MIGA 1OKQA 2ORZA 5F1RA 2KA3A 1XBFA 2RR12 3AP4A 4Q4Y1 5FZ7A 3H1WA 1ODMA 3AL5A 5FY1A 4E9KA 4TN7A 4XMAA 1CGPA 3VD3A 4QPGC 2Q1MA 5A70A 1A8MA 1ENXA 1JW6A 3J7NA 5LY2A 2VR4A 3QH7A 1PM4A 3PIGA 1W8FA 5FBZA 1UOGA 2NLRA 4PDWB 1TME2 4NIAA 2AUYA 4LOTA 2MEV2 4I3GA 5DAXA 3S5QA 1OVSA 1W05A 2PA7A 3TBDA 3ACHA 1PIV3 2DU1A 2UU8A 3ALQA 4KI5M 4FP3A 1I1EA 2UWBA 4I0AA 2WDBA 4QXHA 4FPKA 2JKBA 2QQIA 2YC4A 1HXS2 1J83A 2JKXA 1LOGA 2XWJB 2QCSB 4QX8A 4XFHA 4XFGA 4IETA 1IQDC 1VBB3 2GNMA 3TRSB 4E4DX 3TN93 2DVBA 5KC6A 4RD7A 3AJYA 2A7AA 3QH6A 2EALA 3RZJA 5FMDA 1K5MA 3I3EA 4AQSA 2HWC3 4RL7A 4CCDA 3V0BB 4PJYA 2VZPA 3KWVA 2EAAA 2Y0OA 4E2GA 2QDNA 2JDAA 5FPUA 1LR5A 2EXJA 3U11A 5DMYA 4YFZA 4HVOA 2ADDA 2PN5A 1J84A 1PMHX 2ATFA 2IFWA 2DV9A 3LIGA 3MBWA 5FYVA 4B3NA 5EIYB 2HWB2 2FHRA 4CCCA 2GU9A 1QDOA 2V73A 2WWJA 2F4LA 5L9RA 3OGGA 3VV1A 1QXRA 5FMOL 4LK6A 2VVDA 3LA3A 5CKQA 1K5MC 5C5TA 2XMLA 2OZJA 1Q56A 1OOPB 4XUQA 3WUDA 5FZ4A 2JXAA 1YQ2A 2XQRA 5CADA 2WAAA 5JSRA 2BDRA 2H0VA 1JS9A 4LE4A 3U78A 4XFFA 4AI2A 1SFNA 1NZIA 1RXGA 2ENRA 4D7TA 3WV6A 3T2OA 4XFBA 4AHXA 4IXLA 1GQGA 2VE1A 3PTRB 3SH4A 2R062 1K45A 4J1XA 3ZN5A 3JD73 4XETA 5IVCA 1BXHA 3WW1A 1F2NA 4TWTA 3POWA 3VBFC 2WQ8A 1CZTA 3OGRA 2D3RA 5C3QA 4E4SA 2ZMNA 1W6QB 5EYYA 1UYXA 3OPZA 4META 1RTVA 4UBHA 1JYXA 2E7TA 5JPNB 1MEC3 1EAH1 2E33A 4F83A 1ASJ2 2YV8A 5HCAA 2XJVA 2D6PA 5DAQA 2RS52 3RJ2X 1H6YA 1SDWA 1WLWA 5T52A 1TG7A 2QQJA 4LA3A 1YWKA 2AENA 1YFXA 1HDKA 2QQVA 3HAGA 4AQ6A 2VCAA 3IIIA 3TYJA 4DB5A 5IATA 1REFA 1FAYA 2WJSA 2ZGMA 1OI6A 3VL8A 3K46A 3IMNA 1UU6A 3HN3A 1VRBA 3K3NA 1FPN2 1YNAA 1AR92 2E7AA 2RV9A 2UYAA 1RUC3 2B9VA 2Q4SA 1V6JA 2ZGLA 3ZYBA 3CZUA 1I9RA 5GLTA 3K48A 4HETA 3WD5A 1PIV2 5AVPA 4BJ0A 5JDBA 4LBKA 1W90A 2XQXA 2G19A 3AX4A 5F5CA 4MGIE 3LQCA 3U4SA 2GAUA 2OZ6A 1CZSA 2QQNA 4M00A 4NHMA 5LA1A 2QKDA 4GWJA 3C8XA 4GWNA 4DZGA 4DXSA 5FYCA 1GV9A 1UL9A 3GDBA 3IT8A 4QQPA 2Y26A 3NV4A 5FCCA 1QJFA 3KV6A 5ACA1 1OT5A 1UMIA 2TUNA 3PVBB 5AVAA 2XWBB 4D94A 3RRDA 2DVAA 3I54A 2RS13 4FVVA 3J26N 3AZXA 1WA6X 4QGMA 4XHBA 3P1IA 4Y5SA 5FO8B 3RZMA 4H55A 1QQP2 4UT5A 5C4WC 5KHKA 1ZBA3 3FHAA 4IEZA 1N1VA 5DPNA 3ZYIB 4O9GA 1LEDA 1HN0A 1UKRA 4IEPA 2ZPXA 4UFKA 4X6RB 1O3QA 1R081 1BK0A 3VGIA 2CDOA 3MGUA 4X8NA 3CQOA 1CR7A 1YUDA 2HEVF 3K77A 2BWAA 2WQ4A 4FOVA 4K8FA 1US3A 2R1DA 3ITQA 4OCTA 4PI0A 1A8DA 1H2NA 4WM7B 1SLAA 1QQP1 4QX5A 1RUJ1 4WZFA 1OMIA 2DBNA 2EXKA 1RUE1 4AE2A 5K9YA 3LPGA 4TYSA 3D6EA 2YMZA 4UWDA 2GNBA 2XONA 3JU9A 5CFDB 1RUG2 2RS33 4BU2A 2CU5A 1OOPC 4R9AA 4B8EA 4BLIA 4BOWA 3WF4A 2Z2SB 1OD3A 3ACFA 5DXDA 4LOSA 4ZPIA 1C8M3 2PMWB 2PLV1 4DPNA 5JZGC 1AR71 2AR6A 3Q8BA 2ZTNA 4GMP0 4A7ZA 1QOTA 1POQA 4R8HA 2XBO1 3IZOA 2AC1A 2XDVA 1HJGA 4W65A 3KB5A 2VNGA 4Z92B 4AVCA 4TXWA 5JSOA 1VMHA 2X05A 3MLJA 2RDQA 1QNWA 1HRI1 4JTOA 1G9AA 3KCYA 2BW8A 2RMU3 4AAPA 3K4ZA 4XF3A 3N7MA 2GP5A 1W6OA 3ACGA 3AZYA 1ULGA 1ZREA 3S57A 2R071 2Z79A 3DXTA 3DEMA 4HONA 3W5NA 2RG4A 3BTYA 4YPJA 2GALA 3TEYA 3PU3A 2ZHKA 2JG9C 4COUA 5CYYA 4QGLA 4CU8A 3WDVA 1NY71 4LKFA 1GYKA 5A7OA 3JD71 4WBBA 1XE8A 3MPPG 3OD4A 1O5LA 3P6BA 3Q8AA 1S0BA 5BNPB 4GIQA 4IV3B 2XJPA 2E32A 2FMDA 5FRAA 2WFF3 2CGPA 1SLIA 4LE3A 1AYN1 1C4RA 2G9FA 2WZR2 3FWEA 2ET1A 2VOKA 2JE7A 1J59A 3ROUA 2YBSA 1KFUL 1MZ5A 3ILRA 3LEGA 1ZX5A 4N8MA 4X6QB 4XCAA 3VBOC 4B1LA 3QLQA 5FYMA 1X9PA 1XQNA 3AKRA 4RSUA 1EY2A 4WVMB 4XQ4A 1AYM2 1HRV2 4AOCA 4QX2A 3MICA 4WM8B 1VMJA 3WDXA 1O3SA 1SACA 4QT6A 3WW3A 4AI9A 1ULFA 2I74A 1VE0A 1YFWA 3HT1A 4NHKA 4YW7A 5FK7A 4JRLA 3ZYGA 1FMD3 1K5MB 1WGPA 1RUJ3 1LU2A 4HT1T 1H1AA 4A7KA 1D2QA 1X36A 1ND3A 2JX9A 3PVEA 4URTA 2CYFA
chains in the Genus database with same CATH topology
3LF7A 3KF5A 4FFIA 2QQUA 3UGFA 3UGHA 1Y9MA 2AEYA 5FMBA 3SC7X 4EQVA 1UYPA 4AZZA 4HXCA 4B1LA 2QQWA 3RWKX 5ANNA 2XQRA 1Y9GA 3KF3A 1W2TA 3PIJA 3U14A 3H3LA 3ZR6A 1ST8A 4JQTA 5FK8A 2OXBA 4UFLA 4UFIA 4UFKA 5FMDA 4CCDA 4UFHA 4FFGA 3HBKA 3LDKA 3PIGA 5FKBA 4QHZA 2ADEA 4B1MA 2QQVA 4UFJA 3U1XA 5FK7A 2AC1A 3S5QA 2ADDA 3LIGA 3UGGA 5FKCA 3U75A 5FIXA 3LIHA 3LEMA 3IMMA 3LFIA 4FFFA 2AEZA 5FMCA 4CCEA 3NMBA 4CCCA 3ZR5A 4FFHA 1Y4WA 3LDRA 3OSDA 4UFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF7 A;  3KF5 A;  4FFI A;  2QQU A;  3UGF A;  3UGH A;  1Y9M A;  2AEY A;  5FMB A;  3SC7 X;  4EQV A;  1UYP A;  4AZZ A;  4HXC A;  4B1L A;  2QQW A;  3RWK X;  5ANN A;  2XQR A;  1Y9G A;  3KF3 A;  1W2T A;  3PIJ A;  3U14 A;  3H3L A;  3ZR6 A;  1ST8 A;  4JQT A;  5FK8 A;  2OXB A;  4UFL A;  4UFI A;  4UFK A;  5FMD A;  4CCD A;  4UFH A;  4FFG A;  3HBK A;  3LDK A;  3PIG A;  5FKB A;  4QHZ A;  2ADE A;  4B1M A;  2QQV A;  4UFJ A;  3U1X A;  5FK7 A;  2AC1 A;  3S5Q A;  2ADD A;  3LIG A;  3UGG A;  5FKC A;  3U75 A;  5FIX A;  3LIH A;  3LEM A;  3IMM A;  3LFI A;  4FFF A;  2AEZ A;  5FMC A;  4CCE A;  3NMB A;  4CCC A;  3ZR5 A;  4FFH A;  1Y4W A;  3LDR A;  3OSD A;  4UFM A; 
#chains in the Genus database with same CATH topology
 2XL9 A;  2UYB A;  3LWC A;  2RVA A;  4XJ9 A;  4LBL A;  4YVS C;  5GLV A;  4NN0 A;  4RS5 A;  4FQ4 A;  5K0U C;  3RMX A;  3ZOI A;  3ZKY A;  5JZG B;  5LA0 A;  2B5H A;  1YQ8 A;  2P2K A;  1XE7 A;  1NLQ A;  3VBS B;  3MLL A;  2XJU A;  3E5Q A;  1JUH A;  4M0H A;  4SBV A;  5IFP A;  5HV0 A;  1W9T A;  2NMN A;  3NVC A;  5GKA C;  3SEE A;  4UFJ A;  5AC9 1;  2XJR A;  4BQ1 A;  4BXF A;  1Q5O A;  1ZA7 A;  2PFW A;  1SDD B;  4CP0 A;  1ZA4 A;  2X29 A;  3WX5 A;  3TWI A;  1GZ9 A;  5FY8 A;  1BHG A;  1LOE A;  3HNY M;  3WF0 A;  3PDQ A;  2A6X A;  1W9S A;  2ZJC A;  3J8F 1;  1H1M A;  1K5J A;  1W8O A;  2D98 A;  1QNY A;  2VZU A;  1T2X A;  3WCR A;  4LUK A;  4Q0S A;  3WNN A;  4CRQ A;  5AC9 2;  3CKH A;  1KIT A;  1N1Y A;  1H1I A;  1OQD A;  2ZA9 A;  3QOP A;  4IEO A;  3BIW E;  5A7W A;  5C4W B;  1LGN A;  1SPP A;  3Q9O A;  4BWO A;  3ZXK A;  2V72 A;  4D7Y A;  1OLR A;  5E88 A;  4ZS3 A;  1AJO A;  1VRH 3;  5FP7 A;  2GC1 A;  4FI9 A;  5C5U A;  2GSY A;  4K8R B;  3LKJ A;  2YYO A;  3WDT A;  5JUV A;  5H9Q A;  3EJK A;  4RFR B;  2HLE A;  5CAZ A;  3H9A A;  1S0I A;  4Q4Y 3;  1DQ1 A;  2P3J A;  1HIX A;  1CAW B;  2QQU A;  3JBG 3;  5FZ6 A;  2G9G A;  3A7Q A;  3KQ4 B;  3D3A A;  5FYY A;  3N7K A;  1E57 A;  3HJR A;  5LB6 A;  1NE4 A;  4OHX A;  2HWD 2;  5FP3 A;  1AZD A;  3V64 A;  3DKW A;  1W9F A;  3A0N A;  2RS3 2;  4P00 B;  3VZK A;  1OFS A;  4IER A;  3GHN A;  3VDC A;  1ZBE 2;  4LO7 A;  3BOW A;  5EFU A;  5FXX A;  5ISL A;  2RJK A;  4QGN A;  5A6X A;  5D21 A;  3USU B;  1SEF A;  4OQ9 A;  5JMC A;  1VBD 3;  1GP4 A;  1N47 A;  3IDB B;  3NKG A;  1IHM A;  2VTX A;  2ETE A;  1AXZ A;  3VBH B;  3AKT A;  4CDX B;  1R64 A;  1RVF 2;  2P4E A;  3M8L A;  5DAV A;  4JQR A;  5LBC A;  4XDP A;  3VN4 A;  1XYP A;  1QJU 1;  1CWP A;  4EWA A;  2WC2 A;  1HXS 1;  1CAV A;  4XJZ A;  2OX0 A;  1ULO A;  4EQV A;  4KL1 A;  1GZW A;  2A75 A;  1WW6 A;  3KT7 A;  3ZXA C;  1KDK A;  2DVG A;  1Z7S 1;  3OJB A;  4A4A A;  4K9S A;  4Q4X 2;  3M1H A;  3H7J A;  3OGV A;  3D82 A;  3J7L A;  3JD7 2;  1WME A;  1QF3 A;  2CWM A;  2H6C A;  2OXB A;  5FK8 A;  4ARY A;  3I59 B;  1OA4 A;  5JCT A;  4N53 C;  4Q4W 3;  1CQ9 A;  4AFA A;  1Z7S 2;  1XYO A;  1C57 A;  2ZAB A;  4GAZ A;  4OHZ A;  3JB4 C;  3VBS C;  4C1W A;  4WVW A;  4WV8 A;  4OMD A;  2J7M A;  5L73 A;  3SLI A;  1DZT A;  4HN1 A;  1H0B A;  4JDN A;  4L2N A;  4BIO A;  1DQ4 A;  2NQY A;  2JEC A;  4N9H A;  1YFU A;  5IUQ A;  1HLC A;  3DL3 A;  4IEU A;  2JG8 B;  4JHT A;  4O61 A;  2BGP A;  2QZ3 A;  4MO3 M;  5DDJ 3;  3ZX7 A;  3CHX A;  4KGQ A;  2J1A A;  2JD9 A;  2WO7 A;  4NWW A;  3WF3 A;  1HQL A;  1ULC A;  4GKX A;  4OUE A;  1VBA 2;  4MXV A;  2VCB A;  1YRZ A;  5LBE A;  4LIV A;  1AR6 3;  4CUA A;  3AZV A;  3F95 A;  4HKL A;  3VUO A;  1E5R A;  1S2K A;  4YW3 A;  5M0T A;  4NR1 A;  1AX1 A;  2IXJ A;  1XU2 A;  1DGR N;  5LA9 A;  1UZV A;  4YG3 A;  1D7P M;  1XE0 A;  3U0Z A;  1F8V A;  1CPM A;  4QPI B;  4YZ3 A;  1HN1 A;  3A0K A;  2D3P A;  1PMJ X;  2Y34 A;  1LOA A;  3IWZ A;  3JQW A;  4WM7 C;  5DDJ 1;  4O7X A;  3RZH A;  2BV4 A;  1C5H A;  1QH6 A;  5F6K A;  3MUY 1;  4EYU A;  1BVV A;  4LBO A;  3THP A;  2XJS A;  3INA A;  2UY9 A;  5DZF A;  3D8C A;  2O8Q A;  3T08 A;  3O0V A;  4UBG A;  5J36 A;  1UD1 A;  5DAP A;  4I2O A;  4OHV A;  5JMO A;  1CVN A;  3VHN A;  4EN6 B;  1W3V A;  3IDA A;  4AGV A;  4AYU A;  4BE3 A;  4LBQ B;  1AR6 2;  1YLL A;  2RS5 3;  4QKN A;  1JYT A;  1R1A 1;  4XF9 A;  3BTZ A;  1GOG A;  3M7A A;  2CAV A;  2VUC A;  1WCQ A;  1W8Z A;  4FOQ A;  4QHZ A;  2UY8 A;  3USU A;  1JHJ A;  2Z42 A;  3UGG A;  1PX3 A;  5FPX A;  4QPG A;  4IGO A;  4P08 A;  3CJI A;  4PF1 A;  2PHX A;  2DBI A;  4PIY A;  2V5D A;  4BQX A;  3AK0 A;  1NYW A;  1RUH 3;  1BMV 1;  2DUQ A;  4AFC A;  5CIS A;  1I6X A;  4LK7 A;  4XHX A;  4CUB A;  1CES A;  2RS1 2;  2ARE A;  1CAU B;  2BVV A;  5K4L A;  4YM2 A;  3WP6 A;  5GAL A;  5HBA A;  3H0O A;  3OGJ A;  4IGQ A;  4M3C E;  4Q27 A;  2Q8D A;  3RPQ A;  5I91 A;  5LBB A;  5JZG A;  5K0U B;  5JLV A;  4CDW A;  5FZG A;  2DDU A;  1Y7B A;  4J1W A;  2P3Y A;  4OQ8 A;  3ZMO A;  4F3J A;  1IZ3 A;  1OFN A;  1QH7 A;  1YQC A;  4FO9 A;  5FFO C;  3I2I A;  1DQ5 A;  3BTA A;  3NV2 A;  4OI1 A;  3UV9 A;  4FPG A;  2WNE A;  4COZ A;  1WW4 A;  3OG2 A;  4QKF A;  4M3C B;  4CDU C;  3E6D A;  1PVC 1;  2OQ6 A;  2VOV A;  2P37 A;  3C3V A;  1UQX A;  3HN1 A;  4BQ3 A;  4E27 A;  5B4N A;  4QXC A;  4R9B A;  3T1L A;  3OY8 A;  1WKY A;  4DMI A;  5JR2 A;  2JDN A;  2Y6H A;  3MUZ 1;  4Q4V 3;  1FPN 3;  1PGW 2;  2H6B A;  2EIE A;  4YW2 A;  3ZIW A;  1XSQ A;  4AZZ A;  3IN9 A;  2WZP P;  5CG9 A;  1V6L A;  2ARX A;  2KD7 A;  4A42 A;  5FZC A;  1QKQ A;  1B09 A;  2R04 3;  4EWE A;  1Q8O A;  3ZFG B;  2ZS6 B;  1WLC A;  3AVR A;  1PO2 1;  4ISR A;  3IM0 A;  4LO5 B;  1ZRD A;  5KC5 A;  5A3U A;  3H3U A;  4ITC A;  4Q5O A;  3WNK A;  3NO8 A;  1OVP A;  1H30 A;  2X5I C;  3R4U A;  2BBV A;  3ZN6 A;  1OUR A;  1FV2 A;  4XF0 A;  4RQP A;  2LS6 A;  4IV3 C;  4N7U A;  5FUP A;  3T2Q A;  1UZZ A;  4KNC A;  3ZYJ B;  3W59 A;  3H1Y A;  3FHQ A;  4CP2 A;  4HPK A;  4ES9 A;  2DF7 A;  3KZ4 C;  1OF3 A;  3ZSK A;  1V6K A;  2VQU A;  5FPZ A;  1DG6 A;  4LBN A;  4EN9 B;  2I45 A;  2QVS B;  3OYW A;  1JYV A;  1NQD A;  2DCY A;  3LB9 A;  2W91 A;  4UF0 B;  3VBF A;  2VNV A;  3ZYF A;  3HWJ A;  1KD7 A;  1VB2 A;  1ALY A;  1PVC 3;  2A3X A;  3VL9 A;  3WXP A;  3GF6 A;  5I0R A;  5JAX A;  2HWF 2;  5SV8 A;  4L97 A;  1MS0 A;  4Q0Q A;  1GWL A;  4K40 A;  1TNF A;  3N7L A;  5LY1 A;  2KM2 A;  1PZ8 A;  2KR2 A;  5FZB A;  4ZON A;  4OI0 A;  2QQK A;  2BNN A;  3FLT A;  3PME A;  5IK7 A;  4QQL A;  1N1T A;  3I3B A;  5HV4 A;  1VMF A;  2ZML A;  4YVS A;  3CJI B;  4S2D A;  2Y38 A;  3RWN A;  2VXR A;  2RM2 3;  1XJA A;  2YU2 A;  5LA2 A;  3NRU A;  1S4C A;  2R0H A;  1LOF C;  5F5Q A;  5L9V A;  3IB3 A;  1Q43 A;  3PL0 A;  4N53 B;  2DFB A;  2WIN B;  1VIW B;  3H3L A;  4OFG A;  3LOB A;  5T50 A;  2CY6 A;  2VBB A;  2ET7 A;  3OY8 B;  2R30 A;  2WYS A;  4DXT A;  2Y6G A;  5FTT C;  4EN7 B;  1LHO A;  2Q1F A;  1R08 3;  4JGY B;  4XJA A;  2W9X A;  2HWD 3;  3WY6 A;  3MID A;  1GQH A;  2W5F A;  5JOX A;  1ZZ8 A;  4XPV A;  2W08 A;  4V2V A;  3IAP A;  5GM0 A;  5D1I A;  3EYP A;  1D0H A;  2QNK A;  3JUU A;  1HW5 A;  5IJR A;  4CXX A;  4QXK A;  3RZL A;  3R0R A;  3ZSM A;  3ZXL A;  4CVU A;  5A3N A;  4GB3 3;  3OBT A;  3J8F 3;  1Y43 B;  1GIC A;  1MS1 A;  3NQH A;  2D5H A;  2JD4 A;  3AMQ A;  1D2S A;  1QU0 A;  1OQ1 A;  3ZYR A;  1RIN A;  3X29 B;  5JI9 A;  3K3O A;  1RUI 1;  3FHI B;  4QPI C;  5EHD A;  3J9S A;  1XB9 A;  3I2F A;  4XXA A;  4FOY A;  3WCS A;  1D4V B;  3CEW A;  4K1Z A;  4NAO A;  1I5Z A;  3T09 A;  4JGZ B;  4XVH A;  1PGL 1;  5C8C B;  4Y22 A;  4M3C F;  2HWF 1;  4FPE A;  4QM9 A;  3GJA A;  1HRI 3;  5AC9 3;  4XZP A;  1FNY A;  2DWR A;  3NNJ A;  2D6O X;  4W6W A;  3IMM A;  3E6C C;  3UKT A;  3SXW A;  1RUC 1;  1KJL A;  5FZF A;  3WF1 A;  1KDM A;  3ZPY A;  4QDQ A;  3G6J B;  2FD8 A;  5L9B A;  1JYN A;  3HBZ A;  5J1X A;  2VZO A;  1MPX A;  3C2U A;  3N7J A;  1CAW A;  3RDI A;  5F37 A;  1H4H A;  1KS4 A;  5IYY A;  1D0G A;  1U12 A;  3WT3 A;  2WLP A;  3WW4 A;  4AWD A;  1SBE A;  1UXX X;  1H8T A;  5FZM A;  3ZFE C;  4CUC A;  3VD9 A;  3U1X A;  2R49 A;  4GB3 2;  1OOP A;  2A3Y A;  3JBG 1;  2AZ5 A;  3VKL A;  2PEL A;  4HKO A;  3RYR A;  2QZ2 A;  1QDC A;  3KS7 A;  1PX4 A;  2QFE A;  4BK4 A;  4S2G A;  2W94 A;  1NCQ A;  3MFC A;  2Y60 A;  1RHI 1;  3PJY A;  2HJI A;  4Q0V A;  5FYI A;  3SIT A;  2EXH A;  3C7G A;  4PIX A;  1RED A;  1GKB A;  5GJ6 A;  1YC6 1;  1V6M A;  3LA7 A;  4ASL A;  1BBT 1;  5BNO C;  2Y64 A;  1R09 1;  2IXL A;  5CBL A;  5F3I A;  1QJU 3;  1ONA A;  4UFI A;  4V2W A;  4Y1Y A;  1ASJ 1;  4LJH A;  1BK1 A;  1OLQ A;  1YIP A;  1OUS A;  2PQQ A;  4MOA A;  5CA6 A;  1JZ7 A;  4UF0 A;  3VBF B;  1LHU A;  1AHS A;  3SEP A;  3PJQ A;  1BQP A;  3AB0 A;  3SCH A;  1YI7 A;  2C9A A;  2MPF A;  3KT4 A;  4DUW A;  1NKG A;  4ASK A;  5KR7 A;  4ZHN A;  1BBT 2;  1O6U A;  2VM9 A;  2EAK A;  3BOD A;  2R06 1;  2J1T A;  3GZU C;  1W2N A;  5LAT A;  1L7Q A;  1SLB A;  4AEM A;  3AZW A;  5F8P A;  3BCW A;  2GN7 A;  2GN3 A;  2VCM A;  1FI2 A;  3HT2 A;  4KWJ A;  4DRR A;  2WNV C;  4J6G A;  4H14 A;  1IS3 A;  1UMH A;  4JV4 A;  4OMC A;  4LPL A;  1G86 A;  1PVC 2;  5L7O C;  4K6B A;  2GP3 A;  5I0S A;  3MLK A;  4CDU A;  3PUI A;  2YXS A;  4FTB A;  3O1V A;  1A34 A;  2XH6 A;  5G04 L;  5DZE A;  1JOP A;  2GC2 A;  1YIF A;  4V1P A;  5C9A A;  2VMH A;  1G9B A;  3TEW A;  5ABJ C;  3I2G A;  1H2K A;  4CU7 A;  1MAC A;  2BWC A;  1O4T A;  2X09 A;  5T5P A;  4AFD A;  5EYX A;  4JGY C;  1R09 2;  5A1A A;  2B45 X;  2PHD A;  2PAM A;  2VZ3 A;  4BZ4 A;  1RUC 2;  1GBG A;  3VD7 A;  2JDU A;  3ILN A;  4IDZ A;  5H9S A;  3POF A;  1UX7 A;  4CDW C;  4JHZ A;  5DN2 A;  4FCA A;  5A32 A;  1SHW B;  2FCV A;  3R4D B;  3ETQ A;  4CDW B;  4TZD A;  3M3C A;  5FZI A;  1C8M 2;  1OQE A;  2R07 3;  5LRS A;  2VBP A;  2WWU A;  3GXU A;  3N9L A;  4MGQ A;  4R9D A;  3UL2 A;  1HV1 A;  1LCL A;  4Q4V 2;  1X50 A;  2XLF A;  1S2B A;  2BGC A;  4LUM A;  2NMO A;  3CJI C;  3HD8 B;  3WG1 A;  4XYX A;  4QWN A;  4LKD A;  1DP0 A;  4LMF A;  3ZR5 A;  4Y24 A;  3P3N A;  5FQ0 B;  1R09 3;  4PDW A;  2R16 A;  4QPG B;  2NN8 A;  4E2Q A;  2EIB A;  1OLM E;  1OC1 A;  5A33 A;  3CZJ A;  4FP2 A;  5GLW A;  3ZXE A;  4D6Q A;  5FZO B;  5FUI A;  4YLZ A;  4AK3 A;  3ZR6 A;  3MI8 A;  3T4V A;  3ECQ A;  1VBE 2;  2CGN A;  4GJY A;  5IT6 A;  3T2P A;  1W2A X;  2RJL A;  1LHV A;  2A6W A;  1VBB 1;  2NYY A;  4NHY A;  4WM8 A;  2QTW B;  2FMY A;  5CKN A;  5J48 A;  5JOZ A;  4L8Q A;  3I7D A;  4RN5 A;  5GLZ A;  2OKX A;  4KWL A;  3USS A;  5LZ6 A;  2C6S A;  4LBQ A;  4BLJ A;  4QX1 A;  1ZBA 2;  4IEX A;  2OII A;  4CEW B;  4BME A;  2Z69 A;  4YNI A;  4YAR A;  5IVE A;  4FPC A;  5FZH A;  3TNQ A;  1MS5 A;  3DUI A;  4GA9 A;  3VLB B;  2FZ1 A;  1F31 A;  2VMI A;  2YHJ A;  4OHW A;  2LTN A;  3DEC A;  5FQ0 A;  3N9O A;  4Y22 B;  3N9P A;  3EHK A;  3B5L B;  3VBS A;  3I4I A;  1STM A;  2WL1 A;  1RVF 1;  4XJ8 A;  4GKY A;  2V09 A;  1RGS A;  4QHO A;  4AAX A;  1ZZ7 A;  2WNV B;  4RGG A;  2YFU A;  1TEI A;  3MFA A;  4IL7 A;  1TMF 3;  4K3U A;  3KCX A;  4CEY C;  2FZ2 A;  1DGR A;  1H6X A;  1QJY 2;  4H7L A;  5EP9 A;  3VZN A;  2ZAH A;  1DLL A;  2WT0 A;  2HH9 A;  2E31 A;  2ZGS A;  4HK8 A;  2HYK A;  1MVQ A;  4KBB A;  4YGB A;  3AYE A;  5EZW A;  2W95 A;  4AFB A;  3CDZ B;  1VBC 1;  3A4U A;  2UWC A;  2VZT A;  5LRR A;  1W6Q A;  2D97 A;  1IS4 A;  3ZVX A;  3S0M A;  1F15 A;  1H9W A;  3DGT A;  2ZGQ A;  3FC0 A;  4OZX A;  5DUW A;  2W46 A;  3UGF A;  2QJV A;  2ZHM A;  2E51 A;  1V6O A;  2WN2 A;  4KG8 A;  3J7M A;  4WVM A;  5F5I A;  3WIN E;  3RVH A;  2CAU A;  1L7R A;  4ERO A;  3G7D A;  4A6O A;  5CB7 A;  3U07 A;  3K75 B;  1ZBA 1;  1JUI A;  3E5X A;  3SHR A;  2WT2 A;  3D5O A;  5ANQ A;  2WBK A;  5FZA A;  3WLU A;  1VRH 2;  2BNO A;  4QD2 A;  3ZDS A;  3H1M A;  1C28 A;  3JCI A;  5FPA A;  3SMH A;  1FOD 3;  2GDF A;  5EQU A;  2BJS A;  2GMM A;  3UJQ A;  1CAX B;  3MV1 1;  3MDP A;  4ZKT B;  5EJ1 B;  4PT6 A;  3JQX A;  1XRU A;  1OHF A;  3HNM A;  5GZE A;  5HXV A;  1RL3 A;  5JXI A;  4AED A;  5HPO A;  3E6B A;  5E1R A;  5F7U A;  5DZG A;  3WNP A;  1H8T C;  1AL2 1;  2P6H A;  1S0F A;  1WBF A;  1Q8P A;  3LD8 A;  4I02 A;  4P9W A;  4OI2 A;  4XFC A;  4W6X A;  4UFL A;  3ST7 A;  3POB A;  2O0O A;  1XC6 A;  3KV9 A;  3LGR A;  1QOO A;  2HWD 1;  2ZKL A;  3V0A A;  5AFE A;  3OYW B;  3WNL A;  2XHK A;  3I97 A;  4YGC A;  4QDS A;  3I2O A;  3M3E A;  1VB4 A;  1FOD 1;  1A3K A;  1UY3 A;  3Q8F A;  4EZ4 A;  5FYT A;  4CXW A;  1OLM A;  1TVG A;  4KWU A;  4AXO A;  3NNL A;  1W8T A;  1MS4 A;  4W6Y A;  5EJZ B;  3PNA A;  1PGW 1;  1YI9 A;  1R1Z A;  1W39 A;  1RIR A;  2P6C A;  3AKS A;  1BYH A;  5A7W B;  1GP5 A;  3VDA A;  5JOW A;  3ETP A;  5FZD A;  1VP6 A;  3ZMN A;  5HCH A;  3CNA A;  4JCK A;  1U5Z A;  3KVB A;  4IE0 A;  3ZO0 B;  1UY2 A;  1MEC 1;  5FWE A;  2LAL A;  3NJX A;  4AVB A;  5ABJ B;  5LEK A;  1RUN A;  1RXF A;  3IKW A;  3NAP C;  2P34 A;  1AR9 1;  5FOJ B;  1DCS A;  2VZ1 A;  3LFI A;  1RUD 2;  3IBM A;  2GH8 A;  4LT5 A;  1K3I A;  3BB6 A;  3WQB A;  4Y1V A;  1O91 A;  3OSD A;  5CVR A;  5D2A A;  2P17 A;  4NRM A;  4JAA A;  3I3D A;  4HOO A;  4QU2 A;  5EV7 A;  1Y9M A;  3BTX A;  2CTV A;  4GXL A;  1XNC A;  3B3Q E;  4MH0 E;  4AI1 A;  1QGL A;  4KQ7 A;  2Q8O A;  4COW A;  3IAQ A;  2UWA A;  5A33 B;  1ZRR A;  4WZC A;  1PMI A;  3ILF A;  3N35 A;  1PNG A;  2E53 A;  3H8O A;  4OUS A;  3IPV B;  2SLI A;  5DDJ 2;  4XUT A;  4URA A;  3O1M A;  4PI2 A;  4MHU A;  5K0U A;  3GZT B;  4PLN A;  3S6P A;  1UKG A;  1BEV 3;  5FP8 A;  2BOJ A;  2A71 A;  5LWB A;  2IVI B;  3FMG A;  1SLT A;  1RIT A;  3POS A;  4MGK E;  4N43 A;  5FV3 A;  1YFY A;  1LEN A;  2D5F A;  2HKX A;  4HSL A;  3IPV A;  4Q4W 2;  4S2H A;  4Y20 A;  2VU9 A;  5CFC A;  3RYK A;  1TZO A;  3WDW A;  1X7N A;  1IPK A;  1VAL A;  2WS9 1;  5FDB A;  2VMD A;  1NXD 1;  4Q4X 3;  2PQS A;  2WN3 A;  1HB4 A;  4Z2W A;  1AUY A;  2TEP A;  3KF3 A;  2D43 A;  1DYP A;  4IE5 A;  4J25 A;  2VG9 A;  5C3R A;  3WUC A;  1GAN A;  1RMU 3;  1D4M 1;  1LOD A;  1SCS A;  1ULD A;  3KGL A;  3VB9 A;  4MAD A;  1E5S A;  2PAE A;  4DFS A;  4PHZ A;  4I0B A;  4IW3 A;  2YBP A;  4RA0 A;  4CYD A;  2VQT A;  5JOY A;  1CX1 A;  2DTW A;  3CO2 A;  1GOF A;  3AFK A;  4JKK A;  4XEZ A;  3RI9 A;  5FZK A;  4A2U A;  5L7O A;  2IWG B;  4Z07 A;  2IXI A;  3VD5 A;  2TBV A;  1JZ2 A;  3AZZ A;  1VJ2 A;  2VNO A;  3I59 A;  2VMF A;  3ATG A;  3OBA A;  2HWE 2;  4UFH A;  2ZX2 A;  1S2E A;  3WQ7 A;  1LUL A;  3ZXJ A;  4N53 A;  1D4M 2;  2LW8 A;  5FY5 A;  4XZU G;  4PF5 A;  5IFT A;  3SIS A;  3WNM A;  3FJS A;  2OPW A;  5I8Y A;  2BQP A;  4LHK A;  4YVS B;  2EIC A;  2RR1 1;  1PO1 2;  2ZCW A;  4Q4Y 2;  4L9B A;  3M2M A;  4H2A A;  3RGB A;  1IKP A;  4XJW A;  1F35 A;  3ASI A;  4WVZ A;  4HMZ A;  4ZY9 A;  4XIK A;  3RQ0 A;  4DXR A;  2HWE 1;  4PQ9 A;  4C0H A;  1RC6 A;  3NKT A;  3V0A B;  3OUJ A;  1F9K A;  3AM2 A;  1OF4 A;  3WNO A;  5FPB A;  4XUN A;  1LB2 A;  2W47 A;  2CNA A;  5FY0 A;  5LEJ A;  3ZXG A;  1TQ5 A;  1LEC A;  2GZW A;  1DZQ A;  1FXZ A;  2ZGP A;  4NE9 A;  5FZE A;  3SH3 A;  1LHW A;  4JGY A;  2VZQ A;  3B01 A;  4RGA A;  5C6C A;  5IK4 A;  2JE8 A;  1HQW A;  3RNS A;  3WG3 A;  2Y6L A;  2W2I A;  1IGO A;  2J42 A;  3DXU A;  2D7F A;  2GC3 A;  2VZV A;  1KFX L;  3DPR A;  1KS5 A;  5GZF A;  3ZFF A;  3ZSJ A;  1WUV A;  5FMO S;  4NOT A;  4H7M A;  3SCF A;  1GNZ A;  2PXJ A;  1S0D A;  3MIF A;  3OBR A;  4CCN A;  1DLC A;  2O14 A;  4GWM A;  1NT0 A;  3GJB A;  3ZN6 B;  1POV 3;  3ZIX A;  4AEJ A;  4CA9 A;  4FXK B;  3U75 A;  1UOB A;  1S55 A;  2ZZQ A;  4QM8 A;  1ENR A;  2DUP A;  4XDQ A;  4XBQ A;  2BNM A;  2IC1 A;  1COV 3;  1ZBE 1;  3DCQ A;  4HN0 A;  3O1R A;  3NL1 A;  2YRO A;  5LAS A;  1OD5 A;  1AXK A;  1V6I A;  1QXP A;  4UW5 A;  4CDQ B;  1C1F A;  5A3L A;  1GMM A;  4KGG A;  2A6Z A;  2DCK A;  2PHW A;  4QX7 A;  5A3T A;  5CG8 A;  3I2D A;  4BMB A;  3VZL A;  3IDE A;  1KXG A;  5KXC A;  3PVN A;  4CEY A;  4RHV 3;  4HG6 B;  2DYC A;  1NG0 A;  3NST A;  3KHC A;  1JU3 A;  2DVF A;  4XW3 A;  5JVV A;  5IK8 A;  3OD0 A;  3MIE A;  2HBU A;  4BQY A;  2CHH A;  1EYB A;  1MQT B;  2J1S A;  3AP7 A;  1G9D A;  2ARA A;  2YZ4 A;  4SLI A;  1UY1 A;  2XBO 2;  2YGM A;  3UKV A;  5A3W A;  2NZ9 A;  3URF A;  1SG3 A;  4B7K A;  1OKO A;  2BEO A;  4LO4 B;  4QAW A;  5FZL A;  2AYH A;  2QQL A;  1MVE A;  4AVV A;  1MS8 A;  3ZFE A;  1X82 A;  3T2T A;  3NAP B;  2WR9 A;  4XIO A;  3LDR A;  3VZJ A;  3B7M A;  2WSV A;  1WCS A;  4GAL A;  4D6R A;  2W68 A;  4HL0 A;  2WKK A;  2QQP A;  1LAJ A;  1FNZ A;  1XNA A;  1MEC 2;  1ULP A;  1ZZ6 A;  2XKP A;  3I2K A;  3LCP A;  2B7Y A;  4I0W B;  5E16 A;  5KXB A;  3S7I A;  3MF6 A;  1NCQ C;  1S1A A;  4LNV A;  1JOJ A;  1H9P A;  4P02 B;  1DZR A;  1JYI A;  4E4Z A;  2VAU A;  3B9C A;  3FZ3 A;  2ZGK A;  3FUQ A;  4CSW A;  3LOI A;  2W1S A;  3K4A A;  4C90 A;  1UWW A;  2PTM A;  3DF0 A;  1W6P B;  5C33 A;  1IPS A;  1DGL A;  2ZX0 A;  3RS6 A;  5FXZ A;  3QAC A;  4CEW A;  2VW2 A;  2DFC A;  1AX0 A;  5FZ9 A;  3O1S A;  4Q4W 1;  2DUO A;  3AP9 A;  1VPH A;  1CON A;  1W9W A;  3LIH A;  4HAN A;  1CN1 A;  2W3J A;  3E5U A;  3Q8E A;  4BXS V;  2P3I A;  2WYF A;  3MZH A;  1UZ0 A;  1OXC A;  2JIG A;  4AHY A;  2WRA A;  2Q1Z B;  1V9U 3;  3D4K A;  1OSG A;  1JZ8 A;  2R0F A;  2W0X A;  2ZX4 A;  2EIG A;  1WLT A;  4LO8 A;  5DAB A;  3WNX A;  4C8D A;  3KCC A;  4UI9 L;  2X8K A;  4YWA A;  1LEM A;  1ND3 C;  3HMY A;  1MZE A;  5F6L B;  1RUD 1;  4CCO A;  5EJ3 A;  2XB6 C;  4MXW B;  5FO9 B;  1XPW A;  5FLI A;  2IFR A;  1BVP 1;  2DCT A;  4BM8 A;  5CFD C;  1UOF A;  1UXZ A;  4NII A;  5CEH A;  3T0A A;  4BHP A;  1PGS A;  3RZG A;  3VDD B;  3ES4 A;  5K8S A;  2OUJ A;  3THT A;  5T5J A;  4MGS A;  1MR5 A;  1SLC A;  2Y0I A;  1X8E A;  1EUU A;  2R04 2;  4ZXK A;  2E7Q A;  4AHW A;  1SFY A;  2HWC 2;  2LRO A;  3LEK A;  2B39 A;  4RHV 2;  2WO2 A;  4BK5 A;  3N9N A;  3GNE A;  1XSR A;  4I30 A;  3LF7 A;  3JBG 2;  4IE6 A;  4W8J A;  5A1F A;  5I8T A;  1A78 A;  1YO8 A;  1BCX A;  2V4V A;  1Q8S A;  1UYP A;  4DUV A;  3HIF A;  4FTE A;  4G9S B;  1WWY A;  2VW1 A;  2OYZ A;  4YW4 A;  3VKO A;  1COV 2;  1WCD J;  2HEY F;  4B4P A;  4Q1R A;  1HKD A;  3I3Q A;  4K7J A;  3O0W A;  1ODN A;  4Q26 A;  1TME 1;  5C9A C;  2WA4 A;  1NXM A;  1G8W A;  1M06 G;  3BOP A;  4DEQ A;  5ABJ A;  1REE A;  4ZXE A;  1WMD A;  4FAH A;  1YHF A;  4NWV A;  4NID A;  4KU8 A;  4LIU A;  5JXH A;  2H0B A;  4ISQ A;  4BIS A;  4FFI A;  1U5I A;  3UGH A;  5C8W A;  5D8A A;  2K0G A;  1X33 A;  2CWS A;  4LQR A;  5FUN A;  3R6S A;  1CJP A;  4IV3 A;  1RHI 3;  4K1Y A;  5JWP A;  1ST8 A;  1HB2 A;  5FYB A;  5H9P A;  5FP4 A;  5FLJ A;  5FPV A;  5IVB A;  2VUA A;  2ZGN A;  3OOX A;  1ZRI A;  5FO7 B;  4AFM A;  2W87 A;  2ID4 A;  3BKZ A;  1S0E A;  2ARB A;  2QQM A;  3NJV A;  1YCI A;  4IEY A;  5FYH A;  1CPN A;  3UES A;  3CMG A;  4XBL A;  3VBH A;  5FXW A;  5ACA 3;  1EUT A;  4E8D A;  3C7F A;  2DTY A;  5D8A C;  1N3Q A;  1AR7 2;  2B46 X;  4L0P A;  1RVF 3;  4BDV B;  1RUI 2;  3A23 A;  3MW4 A;  4YW6 A;  2YC0 A;  3HNB M;  2PYT A;  2UUR A;  1UYY A;  2P3K A;  3K4D A;  3AJZ A;  1VBD 2;  1EV1 3;  1AL0 G;  2XLG A;  5C7G A;  1GUI A;  3GZA A;  3WG2 A;  2PHF A;  4WVV A;  1LES A;  1AR9 3;  4WM8 C;  3O1U A;  3ZFE B;  1RUJ 2;  1TNR A;  4XF4 A;  1ND2 C;  1ZM1 A;  4QB6 A;  5BUV A;  1NCR B;  3ZXF A;  4N90 A;  3VBO A;  1ND3 B;  3O1O A;  5A7N A;  3PUH A;  1UMZ A;  2J1E A;  4TTG A;  5F3E A;  4IE7 A;  3O7O A;  1C3H A;  3LDB A;  4JKL A;  4NHX A;  2XVK A;  3HPN A;  4DS0 A;  4EWD A;  3CF6 E;  3CBN A;  1O7F A;  1C8N A;  2QBX A;  2R32 A;  3A21 A;  5DUX A;  1IKQ A;  3JXS A;  4Z8B A;  3ZYH A;  4RFT 0;  4XQD A;  3NV1 A;  5F9T A;  2YC2 A;  5FOB B;  1VBA 3;  2VCC A;  4BYY A;  4MHR A;  4A45 A;  5C3O A;  2MEV 3;  4GB3 1;  2CL2 A;  4AF9 A;  5A7S A;  2ILM A;  1NOV A;  1QY4 A;  3ENR A;  3RG0 A;  1NAE A;  5FY7 A;  3S30 A;  2OUH A;  2IVJ A;  4XIL A;  4FPJ A;  4I3P A;  4RYD A;  3EQE A;  4XMI A;  2R1B A;  4Y26 A;  1B35 A;  1VR3 A;  5FBJ A;  4CP1 A;  4DIQ A;  5BYN A;  1JI6 A;  3RI8 A;  4CU9 A;  3BIE A;  1PM7 A;  1U0A A;  3KLS A;  2Y33 A;  4Y33 A;  1DGW X;  4LR4 A;  5FYZ A;  1BEV 2;  3T0D A;  3FN9 A;  4QQH A;  2R06 3;  3DPR B;  4C1X A;  2ZAA A;  3WSO A;  3OB8 A;  4QB1 A;  1GWM A;  4CCE A;  1AXY A;  4AED C;  3APB A;  4KU7 A;  1LGC A;  3K2O A;  4UOJ A;  3BI3 A;  1CZV A;  2YB7 A;  3ZFG C;  4XOG A;  2RMU 1;  3ZFF C;  5KHG A;  1RUE 3;  5SV5 A;  3OGS A;  1GSL A;  2LRP A;  3ZN4 A;  3AVS A;  1QJE A;  2E63 A;  2ZEY A;  5KWR A;  3M70 A;  1R1A 3;  1PO1 3;  2GC0 A;  4PIZ A;  2WAO A;  2Y6F A;  1US2 A;  4P9G A;  4BCU A;  3WEZ A;  3TB0 A;  5DAW A;  4EN8 B;  4QQ2 A;  4AL9 A;  3OTF A;  4C91 A;  2VD7 A;  1OH3 A;  3FBY A;  4A3Z A;  3O12 A;  1W28 A;  1R08 2;  2VH9 A;  2VZS A;  1VAM A;  2GME A;  1RUG 3;  4YZ4 A;  5JSP A;  1WW7 A;  3VBR B;  4DXZ A;  5C71 A;  1WA4 A;  3L2H A;  3N9Q A;  3NV3 A;  1W0N A;  1Y4W A;  1PK6 B;  5FZ0 A;  1POV 1;  4IV1 A;  3NWK A;  4XUO A;  3VDD A;  1C5I A;  3A22 A;  4MLO A;  2AEY A;  3QBQ A;  2DU0 A;  4M4P A;  5F2S A;  3N4M A;  3GYD A;  2ZMK A;  4UAP A;  4LBJ A;  1AR7 3;  1R1A 2;  5K7P A;  2AH2 A;  5L7O B;  3B69 A;  4NRP A;  2A5Z A;  1F4A A;  5HI0 A;  1W8N A;  3GBF A;  4ES8 A;  4YSF A;  5T3N A;  2C9K A;  4WM7 A;  4B4R A;  5C3S A;  2VMC A;  2ZX3 A;  4LTA A;  4IV1 B;  4YM1 A;  2XOM A;  1BKZ A;  1GU3 A;  2OQ7 A;  3KD4 A;  5IVF A;  1J3R A;  2ZX1 A;  2RM2 1;  5GZG A;  5I93 A;  1RHI 2;  4FPF A;  1QQP 3;  2WFF 2;  1LJ7 A;  1UAI A;  3J4U H;  5F2W A;  2N7G A;  1W2U A;  4Q2F A;  3RFR A;  5F5A A;  2VO5 A;  2HWF 3;  3KT1 A;  3PU8 A;  5FR3 A;  3R05 A;  3IIA A;  4MVT A;  5CNA A;  4ZU7 A;  2A6Y A;  4YVW B;  2V4A A;  4Q4V 1;  1OH4 A;  2EXI A;  4PDW C;  3DYO A;  1XNB A;  4YZ1 A;  3J7H A;  1U5X A;  2XUE A;  4XE9 A;  5C8C A;  3UYJ A;  2DUR A;  4QPI A;  1H2L A;  5HCB A;  3LA2 A;  1CIW A;  1PVX A;  4OZO A;  4A44 A;  2RMU 2;  1WD3 A;  2IXH A;  4RQP B;  3TAY A;  4ET7 A;  5JXJ A;  3UK9 A;  1I5P A;  3AL6 A;  4GJZ A;  3DYM A;  3W9A A;  4QKB A;  4R9C A;  1PNF A;  5JR7 B;  5HCF A;  2JDZ A;  4IEV A;  4FFH A;  2WNO A;  2Y6K A;  1LRH A;  3UJO A;  3ZFG A;  3VZM A;  4NPM A;  5FWJ A;  4GUL A;  1UY0 A;  3AC0 A;  1T6G C;  2JIJ A;  5GZC A;  1DQ2 A;  1JU4 A;  2FCT A;  1UNB A;  4GWI A;  4P9Y A;  3SC7 X;  1K42 A;  2OT7 A;  2D3S A;  1D4M 3;  3VBR A;  5T54 A;  3NJY A;  1W6M B;  3AYD A;  4LLF A;  1JHN A;  2P5B A;  4L99 A;  1PO2 2;  1W3X A;  4LBQ D;  3HEI A;  2WT1 A;  4M3C A;  4FFG A;  2JB8 A;  1G9C A;  1XOY A;  5FAX A;  3P5B A;  1UU5 A;  2MEV 1;  4D8M A;  5BV6 A;  1QJY 3;  1NA1 B;  3AFG A;  3M4F A;  2PHR A;  4R52 A;  5IHR A;  3LEI A;  1WMF A;  3D0S A;  1UX6 A;  5FMC A;  2VUJ A;  2QQO A;  2BVB A;  1RMU 2;  4LKE A;  3TN9 1;  1V9U 2;  2W1W A;  1CAU A;  3WQ0 A;  4Y20 B;  4FT8 A;  4F8A A;  5CFC B;  2VXJ A;  1RUH 1;  2YBK A;  3L2Y A;  2BYV E;  1SQ4 A;  2WZR 3;  3FFQ A;  4XJU A;  1AF9 A;  4LBM A;  4CDX A;  4DEV A;  1QJZ A;  1NCQ B;  2DVD A;  3CLP A;  4KBZ A;  1ZVF A;  4NJ4 A;  4YW5 A;  4GQ7 A;  2A70 A;  4P9I A;  1RUH 2;  5I0U A;  1ULE A;  4NVP A;  4A7Y A;  4LA2 A;  3BAL A;  1N3P A;  2FDF A;  5FZ8 A;  5JI7 A;  2PHT A;  1EAH 3;  2ZHL A;  1FAT A;  1GOH A;  1BEV 1;  2VQA A;  2BUK A;  1DIW A;  1AX2 A;  1GZT A;  1RMU 1;  3GGL A;  4A6S A;  5BNN A;  2J22 A;  4DIN B;  4FFF A;  2Q8C A;  4D0Q A;  3PMS A;  5JIA A;  3W58 A;  2K9Z A;  3RYP A;  1MS3 A;  4Q0U A;  1VBE 3;  4I09 A;  5FY4 A;  1VLN A;  2BU9 A;  2VNR A;  3CL1 A;  2Q5T A;  1PGL 2;  4ARX A;  4L11 A;  5J7M A;  2MHF A;  2RHP A;  2WNV A;  1RUO A;  2C5D A;  3WHT A;  2ZKN A;  2I2S A;  1HB1 A;  2XR4 A;  1FV3 A;  5C8C C;  3MHZ A;  1WZX A;  3KMH A;  4LOR A;  3WP5 A;  2YU1 A;  1DQ6 A;  3HBK A;  4HBN A;  2LUW A;  4R4Z A;  3FX3 A;  1SPP B;  1I3H A;  5HXM A;  2YPJ A;  2BBA A;  2C0Z A;  1W2O A;  2W92 A;  3PHM A;  1FYU A;  1O8P A;  1PZ7 A;  4QPY A;  2TNF A;  4QX0 A;  3T0B A;  2ZGO A;  4UYB A;  3VDB A;  1NE6 A;  3TN9 2;  4XTM A;  4RQP C;  3D0J A;  3WP4 A;  2LM3 A;  4IGP A;  2XVG A;  3NJZ A;  5CU1 A;  2EA7 A;  1OA2 A;  3VBH C;  2SBA A;  4XXP A;  3FUO A;  4XFI A;  2BZD A;  2ZEW A;  5F39 A;  3T3Y A;  1MQT C;  3B94 A;  1UIK A;  1LOC A;  3BN6 A;  2GMP A;  2Q30 A;  3AXE A;  4YVW C;  5FYU A;  5FZO A;  4LLO A;  4HSJ A;  1DQ0 A;  3AMN A;  5H9R A;  1UN1 A;  1QEX A;  2VUD A;  5J09 A;  4GMP 1;  3PUQ A;  5ERL A;  4NO4 A;  3MYX A;  2P1B A;  1UF2 C;  1RUF 1;  2BFU S;  2VW0 A;  4M01 A;  3WQ1 A;  2D6K A;  1J3P A;  3OEB A;  3GM8 A;  2RDR A;  1UY4 A;  2WFF 1;  1Z7S 3;  1DGW A;  4U36 A;  2R6Q A;  3W20 A;  5BXX A;  3C7O A;  4FXG B;  3ZLI A;  1O3T A;  1FT9 A;  5C3P A;  1FX5 A;  4RR3 A;  4Q29 A;  2YGL A;  4DQA A;  2XHN A;  4R4X A;  4ATF A;  3AMM A;  4YM0 A;  5JXG A;  3OBZ A;  5A32 B;  1UW8 A;  5LK7 B;  1BLZ A;  1M4W A;  1W0P A;  3GCW A;  4PCR A;  5IVY A;  2ZEX A;  4CCL A;  2A1X A;  3LDK A;  4P9X A;  3POE A;  1H8T B;  4XF1 A;  3PUS A;  5DUU A;  2VEC A;  4LUL A;  5FJH A;  3RJR A;  4MX3 A;  4PBP A;  1S0J A;  1N1S A;  5DG1 A;  5C70 A;  1BMV 2;  2JG9 A;  3NNG A;  1JZ4 A;  2VME A;  5A3P A;  2VQ0 A;  4IUG A;  2FQP A;  1QJU 2;  4XTP A;  4TLF A;  1J1T A;  1WCK A;  4RHV 1;  5FJK A;  1UPI A;  4Y1X A;  5A3O A;  1UZY A;  2XBO 3;  3ZSE A;  4IND A;  4B29 A;  5IAX A;  4YZ5 A;  3MW2 A;  1LKN A;  1IPJ A;  4A41 A;  1MZ6 A;  4YG6 A;  2PLV 3;  4MGY E;  1QJX 3;  3SQO A;  2HYX A;  5KHH A;  3SH5 A;  1W8H A;  2BTV C;  2C24 A;  3U10 A;  2K2S A;  2Y8K A;  5B4X A;  1AYM 1;  1HRV 1;  1P8J A;  4YG0 A;  3S5A A;  2BP6 A;  2GND A;  5JPM B;  4ASM B;  4Y5Z 0;  4OUM A;  1GNH A;  1W03 A;  4NPL A;  4XFA A;  3VKF C;  1PHM A;  4OUL A;  5GLU A;  1GFF 2;  3HVD A;  3B9I A;  2YFZ A;  1TMF 1;  1PK6 C;  3O5S A;  3IDC B;  3QD6 A;  1O8S A;  4LHL A;  1RUF 2;  3ON7 A;  1POV 0;  2EVX A;  3CJX A;  5F3G A;  1J58 A;  5A7Q A;  2FCU A;  4HKW A;  4P5Y A;  1RJ8 A;  2DCZ A;  3LAG A;  1N3O A;  2JG9 B;  4BA6 A;  1IG0 A;  4QDR A;  4CZS A;  3U37 A;  2ARC A;  3WVJ A;  4H3W A;  4LHN A;  4W4Z A;  2JG8 A;  1SBD A;  2CSG A;  3HQX A;  5T5L A;  3VBU A;  5C9A B;  4CEY B;  2C26 A;  3VBU B;  1UIJ A;  4FPL A;  4AVS A;  1SZB A;  2OVU A;  4JZR A;  5CIR A;  4LIT A;  4AHZ A;  1W6M A;  4LXL A;  3ZKU A;  4E4H A;  2RS1 1;  2WNU A;  1X8M A;  1QJY 1;  4MGZ E;  5I8S A;  3AKQ A;  4MG2 A;  2ZBJ A;  1QWR A;  3MO4 A;  2FDG A;  3T4H B;  3LZZ A;  4NRQ A;  2E6V A;  3OEA A;  3LSE A;  3TEX A;  3DKQ A;  3NMB A;  2XJQ A;  5FPL A;  2ES3 A;  4P14 A;  3VBR C;  2JDY A;  3JZV A;  2NM1 A;  2PHU A;  4HZF A;  4ZS2 A;  1ND2 B;  2BRT A;  3FFZ A;  3WG4 A;  3I3M A;  3EXU A;  3RWK X;  2ZGU A;  5ANN A;  4RS5 B;  4JGZ C;  4EN0 A;  1NLS A;  4ZZ5 A;  3R4S A;  3GBW A;  5T55 A;  1K12 A;  2HWB 3;  2FDH A;  1FMD 1;  4OI4 A;  2G4I A;  2WLQ A;  1ENS A;  4ZU4 A;  2G1M A;  4BQ5 A;  4DY5 A;  1UO9 A;  4F7Z A;  2A73 B;  1UPS A;  1DYO A;  1WBL A;  4NPR A;  5BPX A;  5TSW A;  1QIQ A;  2ORX A;  5FP9 A;  1O5U A;  2CGO A;  1W9Y A;  3K51 A;  1FMD 2;  4UW3 A;  1E5H A;  5L36 A;  1JOB A;  1NLR A;  2WQZ C;  2AAC A;  1YEW A;  4D6S A;  3FL7 A;  3MIB A;  1VBE 1;  1AR8 1;  2XLA A;  3GHM A;  3E1F 1;  4XAB A;  3KHB A;  3UET A;  1GWK A;  3POJ A;  4JGZ A;  2XPJ A;  1IG3 A;  3OUH A;  3DPR C;  3ORJ A;  3AKP A;  1HXS 3;  5J3U A;  2XKO A;  4JVA A;  4PBO A;  1W2T A;  1ZZ9 A;  2Z5W A;  4CCK A;  2OPK A;  4QQO A;  2B8M A;  1JZ5 A;  2B4K A;  4MXW A;  4NUB A;  4CE8 A;  3ZYP A;  4BH9 A;  2X5I A;  1OPO A;  1E5I A;  1VBA 1;  1ZZB A;  3I8T A;  1MZF A;  1TME 3;  2D40 A;  2PHL A;  3QCW A;  5C4W A;  4HFS A;  1CJD A;  1VRH 1;  1NA1 A;  3BU7 A;  4ORF A;  4UW4 A;  4AG4 A;  4FBF A;  5IVJ A;  5CZK A;  3THD A;  4HVQ A;  5I0D A;  3CIH A;  1Q8Q A;  2HEW F;  1UCX A;  2JDK A;  3V0B A;  2Z4F A;  3BYW A;  4YYO A;  2JG8 C;  3FE5 A;  3KV5 A;  4JRA A;  5IWF A;  1KGY A;  2VBD A;  4E8C A;  1JMU B;  3C7H A;  3T30 A;  4A3X A;  5DG2 A;  1JN2 P;  3WW2 A;  1BBT 3;  1X9T A;  2OA2 A;  4DRV A;  2ADE A;  4IE4 A;  3H8X A;  3J8F 2;  2XJT A;  3W21 A;  4N7I A;  4X8P A;  1H4G A;  1RUD 3;  5G05 L;  4YFW A;  3WF2 A;  1W6N B;  5CFC C;  3UT0 A;  2RS3 1;  1PO1 1;  3WR0 A;  3NAP A;  5LW9 A;  4OHY A;  4N43 C;  1IS6 A;  1VBC 3;  5D8A B;  2WS9 2;  5CFD A;  4BQ4 A;  2WA3 A;  2IZW A;  3N9M A;  3H50 A;  4EJR A;  4GH4 C;  2Q0A A;  2WNU B;  4LHS A;  1CAV B;  4BB3 A;  3O1T A;  4FPH A;  1AR8 2;  2A6V A;  2VY0 A;  3OCP A;  2XUM A;  2JEN A;  4NHL A;  3H3Z A;  4AVA A;  2JIC A;  4XUR A;  5EWS A;  1TMF 2;  1QHD A;  1Y9Q A;  2XGX A;  3ACI A;  3BVC A;  4BQW A;  4XAE A;  4K20 A;  1J1L A;  3NNM A;  1YYN A;  2D93 A;  3KM5 A;  2YG0 A;  2HWB 1;  1RUE 2;  5ACA 2;  1AYN 3;  3FBM A;  3I49 A;  1WCU A;  2MNG A;  4I01 A;  2ERF A;  2HBT A;  5BNN B;  3AP5 A;  4CEW C;  2OS2 A;  4IQP A;  5A6Z A;  3FLR A;  1AL2 3;  2YY1 A;  4FPO B;  4CDU B;  5IK5 A;  1XU1 A;  4B7E A;  3LSD A;  1TE1 B;  2CDP A;  3ZXD A;  1HQN A;  2WUH A;  3LPF A;  1WLD A;  5FXV A;  4AQT A;  4FQZ A;  2ZEZ A;  5APA A;  3I2J A;  4FSJ A;  2QQW A;  2BFU L;  2WSU A;  1EPZ A;  2VPV A;  4LKS A;  1C1L A;  4P9L A;  1XNT A;  3ZPO A;  3RSJ A;  3BPZ A;  1PK6 A;  2ZXQ A;  3VBO B;  1APN A;  1SFP A;  3PUA A;  3ZFF B;  5BNP A;  3LFM A;  4E2S A;  1KEX A;  1A6C A;  3WDY A;  2FDK A;  3HR9 A;  2EF6 A;  1HRI 2;  1O3R A;  4JDO A;  2XG3 A;  5FZ1 A;  3I2H A;  5J37 A;  4P5H A;  1G6N A;  2NP0 A;  1KRI A;  1FOD 2;  2X53 S;  3EMR A;  2YUE A;  2BPA 2;  4IEQ A;  4QHB A;  4XUP A;  4B4Q A;  1Y3T A;  4COV A;  4D69 A;  3WDU A;  4GH4 A;  4EV0 A;  3POY A;  2BER A;  3KF5 A;  4MZU A;  5FY9 A;  2VJX A;  3AYC A;  1MQT A;  1HX6 A;  1XYN A;  5A1L A;  1LOB A;  5IVV A;  4JX0 A;  1O4Z A;  3VZO A;  2QDR A;  3HOB A;  3ZM8 A;  3ZSL A;  4NIH A;  2BGO A;  1ZNP A;  3POI A;  2VVE A;  3THC A;  4CP9 B;  5A80 A;  5LK5 A;  2Q8E A;  4PLM A;  1GR3 A;  3GBG A;  2DCJ A;  4RS5 C;  5J96 B;  2R07 2;  5FKB A;  3MPB A;  2AGS A;  4BQ2 A;  3U4X A;  1WMX A;  1KQR A;  1QJX 2;  3EB7 A;  1YJL A;  4RR3 B;  1G9F A;  2B9U A;  4ZZ8 A;  5FKC A;  4U2A A;  1CD3 G;  4DOU A;  1ZRF A;  1DBN A;  2X5I B;  3LEM A;  3UKN A;  4GD4 A;  3GZE A;  3KV4 A;  4LEJ A;  1NA1 C;  1GZC A;  1SLL A;  4DUX A;  1PZ9 A;  1EV1 2;  4P9J A;  4CP9 A;  2VZR A;  1V70 A;  2D44 A;  3MF9 A;  1Z0H A;  2VL4 A;  4DO0 A;  2VTF A;  1JXN A;  1IOA A;  4CCJ A;  1JYW A;  2IXK A;  4AGG A;  4YRD A;  5E89 A;  1ASJ 3;  4HXC A;  1DF0 A;  1UU4 A;  1UZW A;  2L9L A;  2YPD A;  2ZZJ A;  3PIJ A;  1LHN A;  4GZ9 A;  3WHU A;  2ZHN A;  4XC9 A;  3H42 B;  4Y1U A;  2WZ8 A;  4RGK A;  5EXO A;  2WWS A;  4XAC A;  1DU3 D;  4MSV A;  4HVR A;  2WO3 A;  2O1Q A;  1RUG 1;  2E9Q A;  4JKM A;  5IAV A;  4KWK A;  1JTZ X;  2VUL A;  4Y5T A;  1ENQ A;  1EAH 2;  1EP0 A;  2C4X A;  4G4F A;  5CKM A;  1BJQ A;  4Y4R A;  1ZZC A;  4UXA A;  4NIG A;  4Z82 A;  1NZC A;  1CIY A;  4Z1V A;  4CU6 A;  1AL2 2;  2R7E B;  1LU1 A;  1W04 A;  2J1R A;  4DNY A;  1LNS A;  1UOJ A;  1NY7 2;  1W8U A;  1YXW A;  1ZRC A;  4M0N A;  5BNP C;  1XXN A;  1B35 B;  3NNF A;  4NAM A;  2WNU C;  4O9E A;  4HK9 A;  2X10 A;  1RUF 3;  1JBC A;  3KGZ A;  4XCB A;  4EZH A;  1FPN 1;  3OUI A;  3V65 A;  3BU0 A;  2VVF A;  2JDM A;  3ES1 A;  4OLL A;  1UYZ A;  3N3H A;  4COY A;  4CDQ C;  1O59 A;  4BIF A;  1V6N A;  4ONU A;  3B02 A;  1PO2 3;  2WII B;  1F5J A;  4Y4Y A;  4Q1P A;  2W52 A;  4QU1 A;  3B93 A;  1W99 A;  3B00 A;  4N9I A;  1Q8V A;  1YQ6 A;  4Q4X 1;  3VKM A;  3VHR A;  1F5F A;  3W5M A;  4YGE A;  1IS5 A;  1VBC 2;  2VOT A;  3SKV A;  1V00 A;  4CDX C;  1JZ6 A;  3Q8C A;  1B35 C;  2PLV 2;  4TLG A;  1W6O B;  1VBB 2;  1OA3 A;  1V9U 1;  1Y9G A;  3PUR A;  4Z2A A;  2WO1 A;  3ME2 A;  1ZYB A;  3H8U A;  3S7E A;  1H2M A;  3H7Y A;  2OW4 A;  2JB4 A;  2VGD A;  5BNO B;  2GNT A;  4KG0 A;  4JC1 A;  4G3Y C;  3AP6 A;  1T6B X;  4AI3 A;  1NQJ A;  3AXD A;  4YGD A;  5A6Y A;  4QB2 A;  1RB8 G;  2FDI A;  2GH2 A;  4N43 B;  2W39 A;  3DN7 A;  2JEM A;  3O1P A;  1DHK B;  3O0X A;  3SCG A;  1RYY A;  1U5Y A;  3L9J T;  1VAV A;  5KBF A;  4FPY A;  3T1M A;  1HV0 A;  1W06 A;  4XBN A;  3KVA A;  4CXY A;  3ACL A;  3M3O A;  5BNN C;  1JH5 A;  1AVB A;  1WD4 A;  4JDM A;  3PTY A;  4S2F A;  5FLH A;  1JZ3 A;  1V0A A;  3V56 A;  2K46 A;  3VD4 A;  1EV1 1;  2RR1 3;  2W1Q A;  4ATE A;  1L3J A;  5I0T A;  2VC9 A;  1BZW A;  1JOD A;  1IQA A;  1QOS A;  3GAL A;  1YJK A;  1DYK A;  3ELN A;  4C0B A;  4D7S A;  5DUV A;  3M3Q A;  3MW3 A;  1CX4 A;  4CDQ A;  3OPW A;  4KMQ A;  2VMG A;  1QJX 1;  1CAX A;  2RE9 A;  2O8O A;  3GCX A;  4YZ2 A;  4AED B;  5A7P A;  1G7Y A;  5FIX A;  4XQW A;  2R04 1;  5F32 A;  2ZGT A;  3ZDV A;  4RR3 C;  2W1U A;  1HJF A;  3E97 A;  4AQ2 A;  3WOG A;  1SMV A;  2D6L X;  2V5Y A;  2JDP A;  3LE0 A;  4QPW A;  4BPZ A;  4K21 A;  1H8V A;  1XND A;  3N36 A;  2J1U A;  2I07 B;  1URX A;  5FRE A;  1GLH A;  2D6N A;  4MUV A;  3WP3 A;  1RJ7 A;  1AR8 3;  4IV1 C;  3TNP B;  4AGR A;  3MV0 1;  1C8M 1;  4JQT A;  3VHO A;  4EE2 A;  1SBF A;  3HQU A;  1COV 1;  1ZBE 3;  3ABZ A;  4XAA A;  2KXL A;  1AJK A;  1SCR A;  5F3C A;  2FBE A;  1NCR A;  2G9Z A;  5JIU A;  3RZK A;  2J1V A;  4KH9 A;  3JB8 A;  4MGT A;  2WS9 3;  4QMA A;  4AEK A;  5BNQ A;  2RJ2 A;  2WFP A;  4YVW A;  2ZAC A;  4TSV A;  3CU7 A;  2EID A;  1LGB A;  1OUX A;  4XDO A;  3DV8 A;  5DQ0 A;  2RS5 1;  1AYM 3;  1HRV 3;  2HWC 1;  3RZZ A;  4CPB A;  2B42 B;  2C1F A;  4UFM A;  3BUC A;  2RM2 2;  3TEZ A;  5E6H A;  5AFB A;  5GZD A;  1KJR A;  1NX9 A;  1XNK A;  4OYU A;  5FZ3 A;  2CV6 A;  4PLO A;  5IW0 A;  2F6B A;  1NCR C;  4PQQ A;  1ND2 A;  2D6M A;  3U14 A;  1HB3 A;  3O14 A;  2IXC A;  1MS9 A;  3H8R A;  4D3W A;  5BY5 A;  4NRO A;  1QMJ A;  5J98 B;  3VDD C;  1PIV 1;  1GNY A;  3OF1 A;  5BNO A;  1GQP A;  4IES A;  2IUW A;  5KHJ A;  3UNP A;  2NPI A;  5LBF A;  4ZU5 A;  3F2Z A;  4JTN A;  1F4H A;  4W50 A;  3BPS A;  3EO6 A;  1GZW B;  3DYP A;  1VAK A;  4FOW A;  4IEW A;  1JYC A;  1W6N A;  3KQR A;  4Q0P A;  3MIH A;  1Z78 A;  5LCW L;  3PVO A;  2E26 A;  3BGA A;  3KSC A;  1QXJ A;  1Q3E A;  2RDS A;  2WZE A;  1YQ5 A;  1W0O A;  4AI8 A;  1WW5 A;  4AR2 A;  2XVL A;  4YM3 A;  4NMI A;  4M4R A;  2WZR 1;  4GH4 B;  1EPW A;  1AYN 2;  4Q8L A;  2JJ6 A;  3MEP A;  2F17 A;  4YW1 A;  4CPB D;  4LO6 B;  4QKD A;  3EBR A;  1OBN A;  2ZGR A;  5EPA A;  1ACC A;  3AMP A;  4B1M A;  1W8W A;  3OPT A;  2ZOE B;  4OVE A;  1S0C A;  3SKJ E;  4CTE A;  2RDN A;  1DDL A;  2BOI A;  2VOX A;  2YDE A;  3C7E A;  1J3Q A;  2F4P A;  2WAB A;  4GMP 3;  4CCM A;  2AEZ A;  1L7L A;  1AR6 1;  4FAG A;  1DFQ A;  2HWE 3;  1S0G A;  2QUO A;  4MV2 A;  3AMH A;  2JWP A;  3SNM A;  5T5O A;  3NW4 A;  3TOJ A;  2XXZ A;  1GP6 A;  3POG A;  4Y3O A;  1RUI 3;  3VHP A;  3RMY A;  2QE3 A;  5A6Q A;  1LOF A;  5A3M A;  3PLQ A;  5L19 A;  2XL7 A;  3VKN A;  1VBD 1;  4QX3 A;  4Y1Z A;  2Y6J A;  4AVT A;  3VBU C;  2JDH A;  1NUK A;  3M3I A;  3WZ1 A;  4MYE A;  4CUG A;  2VOW A;  5KHI A;  2A3W A;  3P3P A;  4UW6 A;  4QXB A;  4HPK B;  2VTX J;  5KXD A;  4O65 A;  1OPM A;  2PAK A;  4L92 A;  4DY3 A;  5E8A A;  4AI0 A;  2FDJ A;  4Q8K A;  5B2G B;  5KXE A;  1O4Y A;  3FLP A;  2JE9 A;  4FTS A;  3HQR A;  5FYS A;  1LTE A;  3AYA A;  1W6P A;  4HLT A;  4AW7 A;  5FMB A;  3MIG A;  1OKQ A;  2ORZ A;  5F1R A;  2KA3 A;  1XBF A;  2RR1 2;  3AP4 A;  4Q4Y 1;  5FZ7 A;  3H1W A;  1ODM A;  3AL5 A;  5FY1 A;  4E9K A;  4TN7 A;  4XMA A;  1CGP A;  3VD3 A;  4QPG C;  2Q1M A;  5A70 A;  1A8M A;  1ENX A;  1JW6 A;  3J7N A;  5LY2 A;  2VR4 A;  3QH7 A;  1PM4 A;  3PIG A;  1W8F A;  5FBZ A;  1UOG A;  2NLR A;  4PDW B;  1TME 2;  4NIA A;  2AUY A;  4LOT A;  2MEV 2;  4I3G A;  5DAX A;  3S5Q A;  1OVS A;  1W05 A;  2PA7 A;  3TBD A;  3ACH A;  1PIV 3;  2DU1 A;  2UU8 A;  3ALQ A;  4KI5 M;  4FP3 A;  1I1E A;  2UWB A;  4I0A A;  2WDB A;  4QXH A;  4FPK A;  2JKB A;  2QQI A;  2YC4 A;  1HXS 2;  1J83 A;  2JKX A;  1LOG A;  2XWJ B;  2QCS B;  4QX8 A;  4XFH A;  4XFG A;  4IET A;  1IQD C;  1VBB 3;  2GNM A;  3TRS B;  4E4D X;  3TN9 3;  2DVB A;  5KC6 A;  4RD7 A;  3AJY A;  2A7A A;  3QH6 A;  2EAL A;  3RZJ A;  5FMD A;  1K5M A;  3I3E A;  4AQS A;  2HWC 3;  4RL7 A;  4CCD A;  3V0B B;  4PJY A;  2VZP A;  3KWV A;  2EAA A;  2Y0O A;  4E2G A;  2QDN A;  2JDA A;  5FPU A;  1LR5 A;  2EXJ A;  3U11 A;  5DMY A;  4YFZ A;  4HVO A;  2ADD A;  2PN5 A;  1J84 A;  1PMH X;  2ATF A;  2IFW A;  2DV9 A;  3LIG A;  3MBW A;  5FYV A;  4B3N A;  5EIY B;  2HWB 2;  2FHR A;  4CCC A;  2GU9 A;  1QDO A;  2V73 A;  2WWJ A;  2F4L A;  5L9R A;  3OGG A;  3VV1 A;  1QXR A;  5FMO L;  4LK6 A;  2VVD A;  3LA3 A;  5CKQ A;  1K5M C;  5C5T A;  2XML A;  2OZJ A;  1Q56 A;  1OOP B;  4XUQ A;  3WUD A;  5FZ4 A;  2JXA A;  1YQ2 A;  2XQR A;  5CAD A;  2WAA A;  5JSR A;  2BDR A;  2H0V A;  1JS9 A;  4LE4 A;  3U78 A;  4XFF A;  4AI2 A;  1SFN A;  1NZI A;  1RXG A;  2ENR A;  4D7T A;  3WV6 A;  3T2O A;  4XFB A;  4AHX A;  4IXL A;  1GQG A;  2VE1 A;  3PTR B;  3SH4 A;  2R06 2;  1K45 A;  4J1X A;  3ZN5 A;  3JD7 3;  4XET A;  5IVC A;  1BXH A;  3WW1 A;  1F2N A;  4TWT A;  3POW A;  3VBF C;  2WQ8 A;  1CZT A;  3OGR A;  2D3R A;  5C3Q A;  4E4S A;  2ZMN A;  1W6Q B;  5EYY A;  1UYX A;  3OPZ A;  4MET A;  1RTV A;  4UBH A;  1JYX A;  2E7T A;  5JPN B;  1MEC 3;  1EAH 1;  2E33 A;  4F83 A;  1ASJ 2;  2YV8 A;  5HCA A;  2XJV A;  2D6P A;  5DAQ A;  2RS5 2;  3RJ2 X;  1H6Y A;  1SDW A;  1WLW A;  5T52 A;  1TG7 A;  2QQJ A;  4LA3 A;  1YWK A;  2AEN A;  1YFX A;  1HDK A;  2QQV A;  3HAG A;  4AQ6 A;  2VCA A;  3III A;  3TYJ A;  4DB5 A;  5IAT A;  1REF A;  1FAY A;  2WJS A;  2ZGM A;  1OI6 A;  3VL8 A;  3K46 A;  3IMN A;  1UU6 A;  3HN3 A;  1VRB A;  3K3N A;  1FPN 2;  1YNA A;  1AR9 2;  2E7A A;  2RV9 A;  2UYA A;  1RUC 3;  2B9V A;  2Q4S A;  1V6J A;  2ZGL A;  3ZYB A;  3CZU A;  1I9R A;  5GLT A;  3K48 A;  4HET A;  3WD5 A;  1PIV 2;  5AVP A;  4BJ0 A;  5JDB A;  4LBK A;  1W90 A;  2XQX A;  2G19 A;  3AX4 A;  5F5C A;  4MGI E;  3LQC A;  3U4S A;  2GAU A;  2OZ6 A;  1CZS A;  2QQN A;  4M00 A;  4NHM A;  5LA1 A;  2QKD A;  4GWJ A;  3C8X A;  4GWN A;  4DZG A;  4DXS A;  5FYC A;  1GV9 A;  1UL9 A;  3GDB A;  3IT8 A;  4QQP A;  2Y26 A;  3NV4 A;  5FCC A;  1QJF A;  3KV6 A;  5ACA 1;  1OT5 A;  1UMI A;  2TUN A;  3PVB B;  5AVA A;  2XWB B;  4D94 A;  3RRD A;  2DVA A;  3I54 A;  2RS1 3;  4FVV A;  3J26 N;  3AZX A;  1WA6 X;  4QGM A;  4XHB A;  3P1I A;  4Y5S A;  5FO8 B;  3RZM A;  4H55 A;  1QQP 2;  4UT5 A;  5C4W C;  5KHK A;  1ZBA 3;  3FHA A;  4IEZ A;  1N1V A;  5DPN A;  3ZYI B;  4O9G A;  1LED A;  1HN0 A;  1UKR A;  4IEP A;  2ZPX A;  4UFK A;  4X6R B;  1O3Q A;  1R08 1;  1BK0 A;  3VGI A;  2CDO A;  3MGU A;  4X8N A;  3CQO A;  1CR7 A;  1YUD A;  2HEV F;  3K77 A;  2BWA A;  2WQ4 A;  4FOV A;  4K8F A;  1US3 A;  2R1D A;  3ITQ A;  4OCT A;  4PI0 A;  1A8D A;  1H2N A;  4WM7 B;  1SLA A;  1QQP 1;  4QX5 A;  1RUJ 1;  4WZF A;  1OMI A;  2DBN A;  2EXK A;  1RUE 1;  4AE2 A;  5K9Y A;  3LPG A;  4TYS A;  3D6E A;  2YMZ A;  4UWD A;  2GNB A;  2XON A;  3JU9 A;  5CFD B;  1RUG 2;  2RS3 3;  4BU2 A;  2CU5 A;  1OOP C;  4R9A A;  4B8E A;  4BLI A;  4BOW A;  3WF4 A;  2Z2S B;  1OD3 A;  3ACF A;  5DXD A;  4LOS A;  4ZPI A;  1C8M 3;  2PMW B;  2PLV 1;  4DPN A;  5JZG C;  1AR7 1;  2AR6 A;  3Q8B A;  2ZTN A;  4GMP 0;  4A7Z A;  1QOT A;  1POQ A;  4R8H A;  2XBO 1;  3IZO A;  2AC1 A;  2XDV A;  1HJG A;  4W65 A;  3KB5 A;  2VNG A;  4Z92 B;  4AVC A;  4TXW A;  5JSO A;  1VMH A;  2X05 A;  3MLJ A;  2RDQ A;  1QNW A;  1HRI 1;  4JTO A;  1G9A A;  3KCY A;  2BW8 A;  2RMU 3;  4AAP A;  3K4Z A;  4XF3 A;  3N7M A;  2GP5 A;  1W6O A;  3ACG A;  3AZY A;  1ULG A;  1ZRE A;  3S57 A;  2R07 1;  2Z79 A;  3DXT A;  3DEM A;  4HON A;  3W5N A;  2RG4 A;  3BTY A;  4YPJ A;  2GAL A;  3TEY A;  3PU3 A;  2ZHK A;  2JG9 C;  4COU A;  5CYY A;  4QGL A;  4CU8 A;  3WDV A;  1NY7 1;  4LKF A;  1GYK A;  5A7O A;  3JD7 1;  4WBB A;  1XE8 A;  3MPP G;  3OD4 A;  1O5L A;  3P6B A;  3Q8A A;  1S0B A;  5BNP B;  4GIQ A;  4IV3 B;  2XJP A;  2E32 A;  2FMD A;  5FRA A;  2WFF 3;  2CGP A;  1SLI A;  4LE3 A;  1AYN 1;  1C4R A;  2G9F A;  2WZR 2;  3FWE A;  2ET1 A;  2VOK A;  2JE7 A;  1J59 A;  3ROU A;  2YBS A;  1KFU L;  1MZ5 A;  3ILR A;  3LEG A;  1ZX5 A;  4N8M A;  4X6Q B;  4XCA A;  3VBO C;  4B1L A;  3QLQ A;  5FYM A;  1X9P A;  1XQN A;  3AKR A;  4RSU A;  1EY2 A;  4WVM B;  4XQ4 A;  1AYM 2;  1HRV 2;  4AOC A;  4QX2 A;  3MIC A;  4WM8 B;  1VMJ A;  3WDX A;  1O3S A;  1SAC A;  4QT6 A;  3WW3 A;  4AI9 A;  1ULF A;  2I74 A;  1VE0 A;  1YFW A;  3HT1 A;  4NHK A;  4YW7 A;  5FK7 A;  4JRL A;  3ZYG A;  1FMD 3;  1K5M B;  1WGP A;  1RUJ 3;  1LU2 A;  4HT1 T;  1H1A A;  4A7K A;  1D2Q A;  1X36 A;  1ND3 A;  2JX9 A;  3PVE A;  4URT A;  2CYF A; 
#chains in the Genus database with same CATH homology
 3LF7 A;  3KF5 A;  4FFI A;  2QQU A;  3UGF A;  3UGH A;  1Y9M A;  2AEY A;  5FMB A;  3SC7 X;  4EQV A;  1UYP A;  4AZZ A;  4HXC A;  4B1L A;  2QQW A;  3RWK X;  5ANN A;  2XQR A;  1Y9G A;  3KF3 A;  1W2T A;  3PIJ A;  3U14 A;  3H3L A;  3ZR6 A;  1ST8 A;  4JQT A;  5FK8 A;  2OXB A;  4UFL A;  4UFI A;  4UFK A;  5FMD A;  4CCD A;  4UFH A;  4FFG A;  3HBK A;  3LDK A;  3PIG A;  5FKB A;  4QHZ A;  2ADE A;  4B1M A;  2QQV A;  4UFJ A;  3U1X A;  5FK7 A;  2AC1 A;  3S5Q A;  2ADD A;  3LIG A;  3UGG A;  5FKC A;  3U75 A;  5FIX A;  3LIH A;  3LEM A;  3IMM A;  3LFI A;  4FFF A;  2AEZ A;  5FMC A;  4CCE A;  3NMB A;  4CCC A;  3ZR5 A;  4FFH A;  1Y4W A;  3LDR A;  3OSD A;  4UFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...