3H3MA

Crystal structure of flagellar protein flit from bordetella bronchiseptica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
b'APVLEIYQDIANLTSRMLAAANASNWDLVLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein FliT
molecule tags Structural genomics
source organism Bordetella bronchiseptica
publication title Crystal structure of flagellar protein FliT from Bordetella bronchiseptica
rcsb
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3h3mA00
3H3MA 3NKZA 3A7MA
chains in the Genus database with same CATH superfamily
4O4HE 3L39A 3V5SA 3AAAB 5GONE 3AA1B 5JDFA 2IUBA 1J5ET 1KNZA 3PU8A 5KX5E 1HFAA 5HEHA 5CA1E 1US7B 2IC9A 1LRZA 2L8KA 3QOFA 1R8IA 4O4LE 2WMOA 3T8OA 1OEDC 3A7MA 2NOXA 2KXPB 3ANWA 4GK0E 4I0UA 1UX4A 3FBLA 4UXNB 2OV9A 1KF6A 5HWYA 4UF0B 2PG8A 1MNDA 2LE8A 4IL9A 4CXYA 4LF6T 3QK6A 2WDQA 4AKLA 2CHOA 3EABA 3T1HT 2CRBA 4U74A 2JMKA 3RI5A 4YSYA 5EK2A 4ILUA 2J47A 4HWIB 3N9QA 4DV4T 2H89A 5HXEA 2NP9A 4FJOA 4JI3T 4TWDA 3H37A 2C5KT 4WNKA 2BDEA 4ZI2C 3RC8A 2XASB 3LK42 2RA1A 1KEYA 3NWIA 2KT9A 2XM1A 3VRBA 2DWGA 3NKZA 2BKOA 2D2SA 2UXNB 4E7ZA 5A1LA 3BQKA 1DU2A 3CMLA 2V8SV 4KX6A 4CZZB 5JDHA 4X64T 1S94A 4P0BA 2CE7A 2OLTA 5HWXA 4WZXA 1WCRA 2WS3A 2X66A 3AA6B 3HKEE 3KBTA 4HTEA 3DJBA 1YKEB 2XHEB 3C50A 2CPTA 2H7OA 3F57A 3L3PA 3C4ZA 1YW0A 2LKGA 1W0BA 1HCIA 2CHNA 2W2UA 3C4WA 3DP7A 3OYXA 4IE6A 5C3JA 5ADXL 5KDMC 5L3GB 4JI4T 5L4HA 4DUZT 3Q9DA 2LOPA 3EI0A 2YDQA 1HTJF 3J9X1 2BZBA 4YT0A 5L3EB 1ZP0A 4B3ST 3PTRB 4JI7T 2ZMAA 3UUXB 1U4QA 2A72A 2B76A 2YEVC 3AE7A 3L8RA 3TLTA 5FVLA 3A5XA 4IIJE 3O1IA 3K8PC 2ZLYA 4IDZA 3ZT5A 5J0ZA 4DR6T 3NRYA 3N2GE 1IJ6A 5AQSB 2Q9QD 4H9NC 2MAWA 4CI2B 5AQFB 5LP6E 3ZMTB 5L47A 2J1DG 3I1AA 2YDSA 4AISA 5AQUB 3UU8A 5LHHB 2Q9QB 2W62A 4JI6T 5FXVA 4TNWA 3ONXA 4X20E 3AEAA 3I9YA 4PJJA 2BS2A 5HXCA 3ZC1A 4F6RC 4F8HA 4YTPA 5LXTE 4ANJA 3UU4A 2K3WA 4UELA 5DABA 3RIAA 3RYIE 3VR8A 4PJLA 1T8BA 5JDQA 2CMRA 4GIWA 3PJAA 1QLBA 3VKGA 2YU2A 4HFCA 4NIQA 5FL0A 4X1YE 3K3NA 3RF1A 2DHRA 4IT4A 3VU7H 4COFA 2FJDA 4EEDA 4DR5T 1YQ3A 1N33T 3ZN0B 2W4XA 5LGNB 2NTYA 2VL8A 4AKGA 2UXBT 4HFDA 5F5WA 3N2KE 5C2TA 2CBJA 3CK6A 2IAKA 4ZI7E 3Q5XA 1GQEA 3RPUA 2CWYA 2WY2A 5LBMA 1U5PA 1ZHCA 3N9LA 4A97A 1M62A 2ACXA 2D0TA 3P4RA 4XZCA 1HS7A 1W09A 3K1SA 2LKHA 2A9UA 3FXEB 4HWHA 4CXWA 4BJNA 3LBXA 1HR0T 2XPKA 1SE7A 5L3BB 4AIUA 5LHIB 5EK3A 2E9XB 2D0UA 2IDOB 2HHHT 4UVBB 5E0OA 2Q9QC 3UU3A 3ZMZB 4AQFA 2WZIA 2VQET 3SRZA 4DV6T 3RYCE 4DR2T 4U33A 3RHWA 4H63H 3FBZA 3PUQA 3QC9A 2K48A 3W15B 1G73A 3AE9A 1IAPA 2KMFA 2W00A 3RC3A 5FL1A 3KV6A 1J5WA 3MK7C 3SFEA 5LGUB 3ABVA 5JH7E 2V7LA 1H7CA 2Y6XA 2HN1A 1YXRA 2V7KA 2X9WA 4H9RC 4MHCA 2XQ7A 4A5XA 3ESLA 1FJGT 3N5LA 4JI2T 3UTKA 1W0AA 4G63A 2UUCT 4I55E 4J2CA 4HFHA 3C64A 4QHOA 5EZYE 3ZT6A 1HNZT 1CHUA 5LA6E 3HKBE 3O4XE 3RX6A 3NZPA 1G8XA 1JNRA 3QB5A 2M6BA 2NR4A 4U3CA 4AI6A 2XQ8A 2OA5A 2NW9A 4HN9A 2E9XC 4O4IE 4DNDA 1ZEEA 2H88A 1BR1A 2I6HA 2VB6A 4QKNA 4JI5T 3CQXC 3RIUA 5CB4E 1BR2A 3K3OA 3OKQA 3OPCA 2MBGA 4DR1T 3X1DA 2CXLA 4DMVA 1BR0A 2WMNA 2YOEA 1MIVA 2KWIB 2LSJA 2B1EA 3GWHA 1KK7A 2VASA 3VHLA 5DJQC 2Z6EA 3N9PA 5HEUA 1D0YA 2K5BB 2AXDS 3E22E 4WYVA 5CGMA 3CX8B 3Q5DA 4JYAT 3JC6D 2V1DB 2WDRA 2EHOC 4HE8A 4Z91A 4X1KE 1Y64B 1NAFA 5FXZA 3H3MA 2DCFA 3P4PA 2FBWA 4IE4A 2KLQA 3PURA 3J7Yq 1HG5A 3O9XA 4KMCA 5FXXA 4HWFA 3N9OA 4HWCA 4WBOA 4LFBT 2QVAA 5FP3A 4TUYE 2BKNA 2QA7A 2XSBA 3RIUC 2WU2A 5FKYA 4IE7A 2CXFA 5LBQB 3UT5E 3PUVF 4CI3B 1N36T 2NW8A 3BQIA 1VCSA 3QB5K 1WRDA 2VURA 1V9DA 3CIRA 3KV5A 1CUNA 4TZ4C 3TLUA 3UFEA 4YXDA 5L3DB 3AAEB 2I59A 2XY8B 3Q2MA 3RYFE 5LMUT 5M4YA 3FHNA 3IA3A 2KWHA 2SPCA 3KDSE 5L3FB 3GMIA 3ZYKA 4ZHQE 4JI8T 3VKHA 4GOUA 2VKOA 5HYAA 2FUPA 4DV1T 4DMWA 3O1JA 2Y48B 5IHYA 4DV0T 4U31A 1E7PA 2X9YA 3PV0F 5JR9C 1S35A 2E5VA 2G0UA 4EYUA 3BQLA 3MZKB 3P4WA 4DR7T 1KFYA 4IDNA 5HEOA 3ZC0A 3RRCA 4L5GA 1XMOT 1ZKEA 2V7JA 2VVSA 5LNKA 3JCFA 2JPFA 4X5TA 4DV3T 5IYZE 1BR4A 3EHZA 2HPJA 3SFDA 2LEHA 4PW8A 5LYJE 4QX7B 3HI2A 3Q5EA 4ZZCA 3C4XA 2LSYA 3KVBA 4UVCB 4ERRA 2X9HA 3KV4A 5LJMA 3F2EA 4CN1A 2N1GA 2MOZA 3KBUA 3LFMA 4M1PA 4LFAT 1HNWT 3T1YT 4V1Av 2XTLA 4H9SE 1FMVA 2FJAA 2HPLA 3IF8B 4YHHT 1D1AA 2WWUA 1L0VA 2DI4A 3KVAA 3ETUA 4K0UA 5LOVE 4WW0A 1X79A 5J2UE 4X62T 4PJMA 2KZ7B 1W9RA 4KI0F 4G2AA 4OHFA 4X66T 2YDRA 4IDOA 3UUNA 5JDGA 2EHOA 5LG3A 3AAIA 2L9QA 4IL4A 2W66A 4HFIA 5JR9A 4PFOA 4DV2T 4CN6A 3M65A 3I9WA 3KFWX 3N2OA 5AQJB 4YY3T 5KXJA 4EYYR 2GK9A 4HFBA 5JDMA 1XDPA 3P4QA 3IEEA 4OX9T 2LJLA 1KNRA 4OK0A 2VWAA 3HR0A 4YJ2E 2DLRA 3AVSA 2X0LB 3N9MA 5JR9B 2XQ3A 4CI1B 3BK9A 2PJQA 5ETWA 2V26A 3OJAA 3P4SA 3WI3A 3MJXA 3P8CD 4TV8E 2JQKA 2VKHA 5CA0E 2X0YA 4ZS2A 5ABEA 2WAUA 3HKDE 4IGUA 3ZPOA 2LM9A 1HG2A 3EDVA 4IE0A 2XAQB 1JNZA 3TLSA 1J1JA 1XDOA 5HEJA 2L3LA 5LGTB 3AEDA 4A56A 4CXXA 3CPZA 5AQTB 3NRXA 1MIWA 5FMNA 4DVDA 1AJ3A 4OFZA 3U3IA 4P0AA 4JI1T 4EEBA 3ANWB 4PK5A 4U72A 3RYHE 2D9DA 2H7VC 2VKDA 1FMWA 3R6NA 4B3TT 3JC6C 2E2AA 3R84B 4H9OC 2LHRA 3AECA 1ZV4X 5F3JA 3ZJ2A 4HEAA 4AKRB 4IREA 1EZ3A 1N34T 4NUVA 4DBRA 2V7IA 3AE2A 3CWZB 2YU1A 3LDQB 5H6RB 4LF8T 2VVNA 4O8SA 4HGAA 4YTMA 4O2BE 2FJEA 1O3XA 3CQCB 3LJCA 3HL6A 3AEEA 2BBHA 5JREA 4PJNA 5HXSA 4YSXA 2WU5A 4ILCA 4LF5T 1YQ4A 4EGWA 2VK9A 3K3QC 4LMJA 5HCJA 4X65T 2WBLA 4GKKT 1Y01A 3TLWA 4DUYT 5FY0A 4TX5A 4ADZA 3AA0B 4C91A 4QXBB 2XQ9A 3PUGA 5BMVE 2CWOA 2PBIA 1VOMA 2IHR1 2JMHA 2V7MA 1D0ZA 2YN6A 3AXJA 4JEHB 4N78D 5AQOB 2IW5B 3NZQA 4DIDB 3PUZF 3SWHA 5H6QB 4DR4T 2N9DA 3WAKA 5DQVA 4JBWF 1ZOYA 3CX7B 5AQNB 1E2AA 3RQUA 2CBIA 2XQAA 3EVYA 4L9IA 2K24A 4LMLA 1IBLT 3B57A 3LSVA 3JADA 2VL0A 3LK2B 3PUSA 1MMNA 3RKGA 5ABFB 3F31A 1T98A 2JJ9A 5JRCB 2E9XA 3UFGA 3L09A 3PU3A 1XNRT 3A8YC 2A3DA 5C8YE 3RQWA 1I94T 2XAFB 1MIYA 2CA5A 3B13A 3MA9A 4MALA 4IE5A 4U2ZA 3U78A 4BA9A 2XQ6A 3AXJB 5AQMB 3AE4A 1HX1B 4ASKA 3RH3A 2IIUA 3MACA 1OEDE 4GYRA 3ONJA 3NVOA 4I43B 5ABGA 5J1GA 5LMNT 2W63A 2ODVA 4KP3C 3UULA 3GA8A 4LMKA 4GYSA 1UURA 3FZMB 4NUUA 4LF9T 4H9PC 3ZMSB 2XAJB 4QH1A 4O2AE 2CCQA 2XAHB 5EK4A 2WCAA 5BR8T 2AE9A 3TLVA 1E1HB 4QWNB 3PUAA 4UV8B 2LSGA 3VRAA 1I6ZA 5AQIB 2WSSV 2KNDA 2NWBA 3H3AA 1WR0A 4EIWA 4LF4T 3B5MA 4WBNE 4IDPA 3PUWF 3TKLB 2C0SA 3M3ZB 3ZMVB 2IC6A 2V6YA 1XWMA 1OXZA 2ES0A 2JQQA 4ISSA 3ZCIA 4UR9A 2X9XA 2RP4A 2E8IA 4MLKA 4PK6A 1X9BA 4DV7T 2XM2A 2JRKA 4Z8XA 4ZXLA 4IDQA 2IMLA 4EZ4A 3SS1A 1MMGA 2A2FX 4ZI3D 3ZYMA 4QXHB 3S4UA 3LBXB 3G06A 3JAFA 4B6XA 4EB6E 2C5JA 2DL1A 1HF8A 4PK4A 2K9AA 2V6YB 4ZS3A 3UQ7A 2UXCT 1YKHB 4AQFC 4HFEA 1IJ5A 1D0XA 3OYZA 3ZEFB 3GN5B 3RRWA 2XJ7A 3CKDA 5HXHA 3P7IA 2KINB 5AQLB 2LT3A 1HNXT 4DBQA 3ZLIA 5L2LA 1UK5A 1SUMB 2LRLA 1NWMX 4YJ3E 3AE1A 4TWHA 4UVAB 1KNPA 3ZJ1A 2ODUA 3FZFB 2YKSA 1M7KA 3AEGA 2YK0A 4P09A 3ZMUB 3IBPA 2ZM6T 4NXMT 2UXDT 2LLYA 5CJ5A 4HWDA 5FYMA 5LJNA 2YINA 3ZKRA 4YTNA 1NENA 3CQGB 1QSDA 2WDVA 3AE8A 2H3RA 3EDUA 4QXCB 1LKXA 2XQ4A 3RIFA 4OYJA 4EOZB 5LG4A 2ZM2A 1D1BA 4KBMB 4MBQA 5IUXA 5JQGE 5LCYA 3ZSSA 3OTOT 2CLYB 2UXXB 4JEUB 2QGSA 4PAGA 2BVMA 4U2YA 4EV6A 5KMGP 1WYCA 2BS4A 1NEKA 2EHOB 2LM2A 4OYKA 4Q25A 5CFBA 2HH7A 1XNQT 2WM9A 2WZHA 3Q5WA 4H63V 4QH5A 4E7SA 4UF0A 4KHPT 5JRCA 5JVDE 1OWAA 3CVRA 4LFCT 3KINB 4BAYB 1FEWA 3E08A 4I50E 5AFUL 5J2TE 1UCUA 1VRBA 5HAXA 1T72A 3MKDA 2X67A 3PUYF 2BKPA 2D5UA 3OBVE 3AB3B 3DTOA 2E5LT 4TN7B 5AQGB 3AE3A 3ZT7A 4JI0T 2W61A 3FZLB 2LSKA 3PJAJ 3ZN1B 5AQHB 2F4VT 2RPAA 1T7SA 4XAXB 5FVKA 4EXTA 2C5IT 2CXDA 2LOSA 4TNVA 5LHGB 2MTQA 4FI5A 2UU9T 5AQKB 1Z0PA 3WAJA 2BS3A 5JDLA 3C51A 3FB2A 4U7YA 4JLEA 2ZM0A 1YD8G 3D0TA 3FZHB 5LB7B 3ZCJA 4IHJE 2PFVA 4A98A 4B3RT 4GKJT 3VR9A 2R6GF 2WQYA 4YFSA 2CLYC 1UX5A 4ISTA 4HFVA 3QNUA 4ILBA 2E9XD 4PNIA 1N32T 3EUHA 5HCMA 4O4JE 2BG9B 3FZKB 4AQGA 4GK5E 3UUBA 5IWAT 2MPKA 4DR3T 3RGLA 1IBMT 4JV5T 1SA0E 1HX8A 3FXDB 1WLXA 3LK3B 4YLHA 2WWVA 3N9NA 3E0ZA 1UUSA 3ZSTA 1MMAA 2BG9A 1QUUA 3O1HA 3PUXF 4H9QC 2DNXA 2J62A 2XUEA 4L0RA 2XZEA 3JAEA 4B3MT 1MNEA 1OEDA 4JUYA 4UEMA 5HEGA 3I0QA 1B7TA 2FJBA 4ZOLE 1LVFA 3AA7B 5FXWA 4LF7T 2Q9QA 3UU6A 1IBKT 2MYSA 5FY1A 5JDNA 2UUBT 5AQPB 5FY7A 3EAMA 3PE0A 2HN2A 2BG9E 2ACZA 4YHJA 3OVUA 1IZNB 2XQYA 4X1IE 3SOLA 4CQIA 2CM0A 2W0GA 2EHOD 2V5CA 3I0OA 4ZI3C 1FIOA 1SHZC 1Z8UA 2CEAA 2X68A 3IHRA 2XQ5A 4ILAA 4NPPA 4KUMB 1MMDA 4YSZA 4AQYT 1LVKA 4I4TE 3AE5A 2XAGB 5L4EA 3GN5A 3ONLC 2PTFA 3ZYLA 2QYWA 2QRXA 2BVLA 2V5DA 4QX8B 5L3CB 2UUAT 2WB5A 2VKJA 3PDYA 3C98B 2NW7A 2BG9C 2KSRA 3HA4A 4MFRA 4ZI2D 4EAHA 3MXZA 1XZYA 4DO0A 4ZZBA 3RKOA 1OEDB 2N2NA 1WFDA 4PFPA 5HXRA 4DV5T 2NTXA 4AKHA 2JQHA 4EZHA 2J4GA 4NXNT 4K0KT 4QH4A 3HKCE 5DQWA 4ZEYA 4TWFA 2JIWA 1WYBA 2V6XA 3CX6B 5F8PA 4AXPA 4C90A 5ABHA 3V5UA 3ETVA 1D1CA 1VCTA 4Z90A 2XSAA 3RLFF 3UUMA 3AE6A 1XMQT 2W67A 2X51A 2DWKA 4BJMA 3P50A 2Y8DA 2X0HA 2WP9A 4P1NA 2I0MA 5AQVB 5FNVE 4CN4A 4TV9E 3KV9A 3NBXX 3LG7A 3QUJA 2LHNA 4HKAA 3UQ4A 5JTGA 3AEBA 3AVRA 4XBFB 5AQQB 4U7IA 4UV9B 2P9BA 3AEFA 2BBJA 2JQ9A 4UIGA 5AQRB 1UGOA 2ZM8A 4KHZF 5TAOA 2LSIA 2LRKA 2M6IA 5ABFA 2VQFT 4AKIA 1WR6A 3UU5A 2M67A
chains in the Genus database with same CATH topology
3H3MA 3NKZA 3A7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3M A;  3NKZ A;  3A7M A; 
#chains in the Genus database with same CATH topology
 4O4H E;  3L39 A;  3V5S A;  3AAA B;  5GON E;  3AA1 B;  5JDF A;  2IUB A;  1J5E T;  1KNZ A;  3PU8 A;  5KX5 E;  1HFA A;  5HEH A;  5CA1 E;  1US7 B;  2IC9 A;  1LRZ A;  2L8K A;  3QOF A;  1R8I A;  4O4L E;  2WMO A;  3T8O A;  1OED C;  3A7M A;  2NOX A;  2KXP B;  3ANW A;  4GK0 E;  4I0U A;  1UX4 A;  3FBL A;  4UXN B;  2OV9 A;  1KF6 A;  5HWY A;  4UF0 B;  2PG8 A;  1MND A;  2LE8 A;  4IL9 A;  4CXY A;  4LF6 T;  3QK6 A;  2WDQ A;  4AKL A;  2CHO A;  3EAB A;  3T1H T;  2CRB A;  4U74 A;  2JMK A;  3RI5 A;  4YSY A;  5EK2 A;  4ILU A;  2J47 A;  4HWI B;  3N9Q A;  4DV4 T;  2H89 A;  5HXE A;  2NP9 A;  4FJO A;  4JI3 T;  4TWD A;  3H37 A;  2C5K T;  4WNK A;  2BDE A;  4ZI2 C;  3RC8 A;  2XAS B;  3LK4 2;  2RA1 A;  1KEY A;  3NWI A;  2KT9 A;  2XM1 A;  3VRB A;  2DWG A;  3NKZ A;  2BKO A;  2D2S A;  2UXN B;  4E7Z A;  5A1L A;  3BQK A;  1DU2 A;  3CML A;  2V8S V;  4KX6 A;  4CZZ B;  5JDH A;  4X64 T;  1S94 A;  4P0B A;  2CE7 A;  2OLT A;  5HWX A;  4WZX A;  1WCR A;  2WS3 A;  2X66 A;  3AA6 B;  3HKE E;  3KBT A;  4HTE A;  3DJB A;  1YKE B;  2XHE B;  3C50 A;  2CPT A;  2H7O A;  3F57 A;  3L3P A;  3C4Z A;  1YW0 A;  2LKG A;  1W0B A;  1HCI A;  2CHN A;  2W2U A;  3C4W A;  3DP7 A;  3OYX A;  4IE6 A;  5C3J A;  5ADX L;  5KDM C;  5L3G B;  4JI4 T;  5L4H A;  4DUZ T;  3Q9D A;  2LOP A;  3EI0 A;  2YDQ A;  1HTJ F;  3J9X 1;  2BZB A;  4YT0 A;  5L3E B;  1ZP0 A;  4B3S T;  3PTR B;  4JI7 T;  2ZMA A;  3UUX B;  1U4Q A;  2A72 A;  2B76 A;  2YEV C;  3AE7 A;  3L8R A;  3TLT A;  5FVL A;  3A5X A;  4IIJ E;  3O1I A;  3K8P C;  2ZLY A;  4IDZ A;  3ZT5 A;  5J0Z A;  4DR6 T;  3NRY A;  3N2G E;  1IJ6 A;  5AQS B;  2Q9Q D;  4H9N C;  2MAW A;  4CI2 B;  5AQF B;  5LP6 E;  3ZMT B;  5L47 A;  2J1D G;  3I1A A;  2YDS A;  4AIS A;  5AQU B;  3UU8 A;  5LHH B;  2Q9Q B;  2W62 A;  4JI6 T;  5FXV A;  4TNW A;  3ONX A;  4X20 E;  3AEA A;  3I9Y A;  4PJJ A;  2BS2 A;  5HXC A;  3ZC1 A;  4F6R C;  4F8H A;  4YTP A;  5LXT E;  4ANJ A;  3UU4 A;  2K3W A;  4UEL A;  5DAB A;  3RIA A;  3RYI E;  3VR8 A;  4PJL A;  1T8B A;  5JDQ A;  2CMR A;  4GIW A;  3PJA A;  1QLB A;  3VKG A;  2YU2 A;  4HFC A;  4NIQ A;  5FL0 A;  4X1Y E;  3K3N A;  3RF1 A;  2DHR A;  4IT4 A;  3VU7 H;  4COF A;  2FJD A;  4EED A;  4DR5 T;  1YQ3 A;  1N33 T;  3ZN0 B;  2W4X A;  5LGN B;  2NTY A;  2VL8 A;  4AKG A;  2UXB T;  4HFD A;  5F5W A;  3N2K E;  5C2T A;  2CBJ A;  3CK6 A;  2IAK A;  4ZI7 E;  3Q5X A;  1GQE A;  3RPU A;  2CWY A;  2WY2 A;  5LBM A;  1U5P A;  1ZHC A;  3N9L A;  4A97 A;  1M62 A;  2ACX A;  2D0T A;  3P4R A;  4XZC A;  1HS7 A;  1W09 A;  3K1S A;  2LKH A;  2A9U A;  3FXE B;  4HWH A;  4CXW A;  4BJN A;  3LBX A;  1HR0 T;  2XPK A;  1SE7 A;  5L3B B;  4AIU A;  5LHI B;  5EK3 A;  2E9X B;  2D0U A;  2IDO B;  2HHH T;  4UVB B;  5E0O A;  2Q9Q C;  3UU3 A;  3ZMZ B;  4AQF A;  2WZI A;  2VQE T;  3SRZ A;  4DV6 T;  3RYC E;  4DR2 T;  4U33 A;  3RHW A;  4H63 H;  3FBZ A;  3PUQ A;  3QC9 A;  2K48 A;  3W15 B;  1G73 A;  3AE9 A;  1IAP A;  2KMF A;  2W00 A;  3RC3 A;  5FL1 A;  3KV6 A;  1J5W A;  3MK7 C;  3SFE A;  5LGU B;  3ABV A;  5JH7 E;  2V7L A;  1H7C A;  2Y6X A;  2HN1 A;  1YXR A;  2V7K A;  2X9W A;  4H9R C;  4MHC A;  2XQ7 A;  4A5X A;  3ESL A;  1FJG T;  3N5L A;  4JI2 T;  3UTK A;  1W0A A;  4G63 A;  2UUC T;  4I55 E;  4J2C A;  4HFH A;  3C64 A;  4QHO A;  5EZY E;  3ZT6 A;  1HNZ T;  1CHU A;  5LA6 E;  3HKB E;  3O4X E;  3RX6 A;  3NZP A;  1G8X A;  1JNR A;  3QB5 A;  2M6B A;  2NR4 A;  4U3C A;  4AI6 A;  2XQ8 A;  2OA5 A;  2NW9 A;  4HN9 A;  2E9X C;  4O4I E;  4DND A;  1ZEE A;  2H88 A;  1BR1 A;  2I6H A;  2VB6 A;  4QKN A;  4JI5 T;  3CQX C;  3RIU A;  5CB4 E;  1BR2 A;  3K3O A;  3OKQ A;  3OPC A;  2MBG A;  4DR1 T;  3X1D A;  2CXL A;  4DMV A;  1BR0 A;  2WMN A;  2YOE A;  1MIV A;  2KWI B;  2LSJ A;  2B1E A;  3GWH A;  1KK7 A;  2VAS A;  3VHL A;  5DJQ C;  2Z6E A;  3N9P A;  5HEU A;  1D0Y A;  2K5B B;  2AXD S;  3E22 E;  4WYV A;  5CGM A;  3CX8 B;  3Q5D A;  4JYA T;  3JC6 D;  2V1D B;  2WDR A;  2EHO C;  4HE8 A;  4Z91 A;  4X1K E;  1Y64 B;  1NAF A;  5FXZ A;  3H3M A;  2DCF A;  3P4P A;  2FBW A;  4IE4 A;  2KLQ A;  3PUR A;  3J7Y q;  1HG5 A;  3O9X A;  4KMC A;  5FXX A;  4HWF A;  3N9O A;  4HWC A;  4WBO A;  4LFB T;  2QVA A;  5FP3 A;  4TUY E;  2BKN A;  2QA7 A;  2XSB A;  3RIU C;  2WU2 A;  5FKY A;  4IE7 A;  2CXF A;  5LBQ B;  3UT5 E;  3PUV F;  4CI3 B;  1N36 T;  2NW8 A;  3BQI A;  1VCS A;  3QB5 K;  1WRD A;  2VUR A;  1V9D A;  3CIR A;  3KV5 A;  1CUN A;  4TZ4 C;  3TLU A;  3UFE A;  4YXD A;  5L3D B;  3AAE B;  2I59 A;  2XY8 B;  3Q2M A;  3RYF E;  5LMU T;  5M4Y A;  3FHN A;  3IA3 A;  2KWH A;  2SPC A;  3KDS E;  5L3F B;  3GMI A;  3ZYK A;  4ZHQ E;  4JI8 T;  3VKH A;  4GOU A;  2VKO A;  5HYA A;  2FUP A;  4DV1 T;  4DMW A;  3O1J A;  2Y48 B;  5IHY A;  4DV0 T;  4U31 A;  1E7P A;  2X9Y A;  3PV0 F;  5JR9 C;  1S35 A;  2E5V A;  2G0U A;  4EYU A;  3BQL A;  3MZK B;  3P4W A;  4DR7 T;  1KFY A;  4IDN A;  5HEO A;  3ZC0 A;  3RRC A;  4L5G A;  1XMO T;  1ZKE A;  2V7J A;  2VVS A;  5LNK A;  3JCF A;  2JPF A;  4X5T A;  4DV3 T;  5IYZ E;  1BR4 A;  3EHZ A;  2HPJ A;  3SFD A;  2LEH A;  4PW8 A;  5LYJ E;  4QX7 B;  3HI2 A;  3Q5E A;  4ZZC A;  3C4X A;  2LSY A;  3KVB A;  4UVC B;  4ERR A;  2X9H A;  3KV4 A;  5LJM A;  3F2E A;  4CN1 A;  2N1G A;  2MOZ A;  3KBU A;  3LFM A;  4M1P A;  4LFA T;  1HNW T;  3T1Y T;  4V1A v;  2XTL A;  4H9S E;  1FMV A;  2FJA A;  2HPL A;  3IF8 B;  4YHH T;  1D1A A;  2WWU A;  1L0V A;  2DI4 A;  3KVA A;  3ETU A;  4K0U A;  5LOV E;  4WW0 A;  1X79 A;  5J2U E;  4X62 T;  4PJM A;  2KZ7 B;  1W9R A;  4KI0 F;  4G2A A;  4OHF A;  4X66 T;  2YDR A;  4IDO A;  3UUN A;  5JDG A;  2EHO A;  5LG3 A;  3AAI A;  2L9Q A;  4IL4 A;  2W66 A;  4HFI A;  5JR9 A;  4PFO A;  4DV2 T;  4CN6 A;  3M65 A;  3I9W A;  3KFW X;  3N2O A;  5AQJ B;  4YY3 T;  5KXJ A;  4EYY R;  2GK9 A;  4HFB A;  5JDM A;  1XDP A;  3P4Q A;  3IEE A;  4OX9 T;  2LJL A;  1KNR A;  4OK0 A;  2VWA A;  3HR0 A;  4YJ2 E;  2DLR A;  3AVS A;  2X0L B;  3N9M A;  5JR9 B;  2XQ3 A;  4CI1 B;  3BK9 A;  2PJQ A;  5ETW A;  2V26 A;  3OJA A;  3P4S A;  3WI3 A;  3MJX A;  3P8C D;  4TV8 E;  2JQK A;  2VKH A;  5CA0 E;  2X0Y A;  4ZS2 A;  5ABE A;  2WAU A;  3HKD E;  4IGU A;  3ZPO A;  2LM9 A;  1HG2 A;  3EDV A;  4IE0 A;  2XAQ B;  1JNZ A;  3TLS A;  1J1J A;  1XDO A;  5HEJ A;  2L3L A;  5LGT B;  3AED A;  4A56 A;  4CXX A;  3CPZ A;  5AQT B;  3NRX A;  1MIW A;  5FMN A;  4DVD A;  1AJ3 A;  4OFZ A;  3U3I A;  4P0A A;  4JI1 T;  4EEB A;  3ANW B;  4PK5 A;  4U72 A;  3RYH E;  2D9D A;  2H7V C;  2VKD A;  1FMW A;  3R6N A;  4B3T T;  3JC6 C;  2E2A A;  3R84 B;  4H9O C;  2LHR A;  3AEC A;  1ZV4 X;  5F3J A;  3ZJ2 A;  4HEA A;  4AKR B;  4IRE A;  1EZ3 A;  1N34 T;  4NUV A;  4DBR A;  2V7I A;  3AE2 A;  3CWZ B;  2YU1 A;  3LDQ B;  5H6R B;  4LF8 T;  2VVN A;  4O8S A;  4HGA A;  4YTM A;  4O2B E;  2FJE A;  1O3X A;  3CQC B;  3LJC A;  3HL6 A;  3AEE A;  2BBH A;  5JRE A;  4PJN A;  5HXS A;  4YSX A;  2WU5 A;  4ILC A;  4LF5 T;  1YQ4 A;  4EGW A;  2VK9 A;  3K3Q C;  4LMJ A;  5HCJ A;  4X65 T;  2WBL A;  4GKK T;  1Y01 A;  3TLW A;  4DUY T;  5FY0 A;  4TX5 A;  4ADZ A;  3AA0 B;  4C91 A;  4QXB B;  2XQ9 A;  3PUG A;  5BMV E;  2CWO A;  2PBI A;  1VOM A;  2IHR 1;  2JMH A;  2V7M A;  1D0Z A;  2YN6 A;  3AXJ A;  4JEH B;  4N78 D;  5AQO B;  2IW5 B;  3NZQ A;  4DID B;  3PUZ F;  3SWH A;  5H6Q B;  4DR4 T;  2N9D A;  3WAK A;  5DQV A;  4JBW F;  1ZOY A;  3CX7 B;  5AQN B;  1E2A A;  3RQU A;  2CBI A;  2XQA A;  3EVY A;  4L9I A;  2K24 A;  4LML A;  1IBL T;  3B57 A;  3LSV A;  3JAD A;  2VL0 A;  3LK2 B;  3PUS A;  1MMN A;  3RKG A;  5ABF B;  3F31 A;  1T98 A;  2JJ9 A;  5JRC B;  2E9X A;  3UFG A;  3L09 A;  3PU3 A;  1XNR T;  3A8Y C;  2A3D A;  5C8Y E;  3RQW A;  1I94 T;  2XAF B;  1MIY A;  2CA5 A;  3B13 A;  3MA9 A;  4MAL A;  4IE5 A;  4U2Z A;  3U78 A;  4BA9 A;  2XQ6 A;  3AXJ B;  5AQM B;  3AE4 A;  1HX1 B;  4ASK A;  3RH3 A;  2IIU A;  3MAC A;  1OED E;  4GYR A;  3ONJ A;  3NVO A;  4I43 B;  5ABG A;  5J1G A;  5LMN T;  2W63 A;  2ODV A;  4KP3 C;  3UUL A;  3GA8 A;  4LMK A;  4GYS A;  1UUR A;  3FZM B;  4NUU A;  4LF9 T;  4H9P C;  3ZMS B;  2XAJ B;  4QH1 A;  4O2A E;  2CCQ A;  2XAH B;  5EK4 A;  2WCA A;  5BR8 T;  2AE9 A;  3TLV A;  1E1H B;  4QWN B;  3PUA A;  4UV8 B;  2LSG A;  3VRA A;  1I6Z A;  5AQI B;  2WSS V;  2KND A;  2NWB A;  3H3A A;  1WR0 A;  4EIW A;  4LF4 T;  3B5M A;  4WBN E;  4IDP A;  3PUW F;  3TKL B;  2C0S A;  3M3Z B;  3ZMV B;  2IC6 A;  2V6Y A;  1XWM A;  1OXZ A;  2ES0 A;  2JQQ A;  4ISS A;  3ZCI A;  4UR9 A;  2X9X A;  2RP4 A;  2E8I A;  4MLK A;  4PK6 A;  1X9B A;  4DV7 T;  2XM2 A;  2JRK A;  4Z8X A;  4ZXL A;  4IDQ A;  2IML A;  4EZ4 A;  3SS1 A;  1MMG A;  2A2F X;  4ZI3 D;  3ZYM A;  4QXH B;  3S4U A;  3LBX B;  3G06 A;  3JAF A;  4B6X A;  4EB6 E;  2C5J A;  2DL1 A;  1HF8 A;  4PK4 A;  2K9A A;  2V6Y B;  4ZS3 A;  3UQ7 A;  2UXC T;  1YKH B;  4AQF C;  4HFE A;  1IJ5 A;  1D0X A;  3OYZ A;  3ZEF B;  3GN5 B;  3RRW A;  2XJ7 A;  3CKD A;  5HXH A;  3P7I A;  2KIN B;  5AQL B;  2LT3 A;  1HNX T;  4DBQ A;  3ZLI A;  5L2L A;  1UK5 A;  1SUM B;  2LRL A;  1NWM X;  4YJ3 E;  3AE1 A;  4TWH A;  4UVA B;  1KNP A;  3ZJ1 A;  2ODU A;  3FZF B;  2YKS A;  1M7K A;  3AEG A;  2YK0 A;  4P09 A;  3ZMU B;  3IBP A;  2ZM6 T;  4NXM T;  2UXD T;  2LLY A;  5CJ5 A;  4HWD A;  5FYM A;  5LJN A;  2YIN A;  3ZKR A;  4YTN A;  1NEN A;  3CQG B;  1QSD A;  2WDV A;  3AE8 A;  2H3R A;  3EDU A;  4QXC B;  1LKX A;  2XQ4 A;  3RIF A;  4OYJ A;  4EOZ B;  5LG4 A;  2ZM2 A;  1D1B A;  4KBM B;  4MBQ A;  5IUX A;  5JQG E;  5LCY A;  3ZSS A;  3OTO T;  2CLY B;  2UXX B;  4JEU B;  2QGS A;  4PAG A;  2BVM A;  4U2Y A;  4EV6 A;  5KMG P;  1WYC A;  2BS4 A;  1NEK A;  2EHO B;  2LM2 A;  4OYK A;  4Q25 A;  5CFB A;  2HH7 A;  1XNQ T;  2WM9 A;  2WZH A;  3Q5W A;  4H63 V;  4QH5 A;  4E7S A;  4UF0 A;  4KHP T;  5JRC A;  5JVD E;  1OWA A;  3CVR A;  4LFC T;  3KIN B;  4BAY B;  1FEW A;  3E08 A;  4I50 E;  5AFU L;  5J2T E;  1UCU A;  1VRB A;  5HAX A;  1T72 A;  3MKD A;  2X67 A;  3PUY F;  2BKP A;  2D5U A;  3OBV E;  3AB3 B;  3DTO A;  2E5L T;  4TN7 B;  5AQG B;  3AE3 A;  3ZT7 A;  4JI0 T;  2W61 A;  3FZL B;  2LSK A;  3PJA J;  3ZN1 B;  5AQH B;  2F4V T;  2RPA A;  1T7S A;  4XAX B;  5FVK A;  4EXT A;  2C5I T;  2CXD A;  2LOS A;  4TNV A;  5LHG B;  2MTQ A;  4FI5 A;  2UU9 T;  5AQK B;  1Z0P A;  3WAJ A;  2BS3 A;  5JDL A;  3C51 A;  3FB2 A;  4U7Y A;  4JLE A;  2ZM0 A;  1YD8 G;  3D0T A;  3FZH B;  5LB7 B;  3ZCJ A;  4IHJ E;  2PFV A;  4A98 A;  4B3R T;  4GKJ T;  3VR9 A;  2R6G F;  2WQY A;  4YFS A;  2CLY C;  1UX5 A;  4IST A;  4HFV A;  3QNU A;  4ILB A;  2E9X D;  4PNI A;  1N32 T;  3EUH A;  5HCM A;  4O4J E;  2BG9 B;  3FZK B;  4AQG A;  4GK5 E;  3UUB A;  5IWA T;  2MPK A;  4DR3 T;  3RGL A;  1IBM T;  4JV5 T;  1SA0 E;  1HX8 A;  3FXD B;  1WLX A;  3LK3 B;  4YLH A;  2WWV A;  3N9N A;  3E0Z A;  1UUS A;  3ZST A;  1MMA A;  2BG9 A;  1QUU A;  3O1H A;  3PUX F;  4H9Q C;  2DNX A;  2J62 A;  2XUE A;  4L0R A;  2XZE A;  3JAE A;  4B3M T;  1MNE A;  1OED A;  4JUY A;  4UEM A;  5HEG A;  3I0Q A;  1B7T A;  2FJB A;  4ZOL E;  1LVF A;  3AA7 B;  5FXW A;  4LF7 T;  2Q9Q A;  3UU6 A;  1IBK T;  2MYS A;  5FY1 A;  5JDN A;  2UUB T;  5AQP B;  5FY7 A;  3EAM A;  3PE0 A;  2HN2 A;  2BG9 E;  2ACZ A;  4YHJ A;  3OVU A;  1IZN B;  2XQY A;  4X1I E;  3SOL A;  4CQI A;  2CM0 A;  2W0G A;  2EHO D;  2V5C A;  3I0O A;  4ZI3 C;  1FIO A;  1SHZ C;  1Z8U A;  2CEA A;  2X68 A;  3IHR A;  2XQ5 A;  4ILA A;  4NPP A;  4KUM B;  1MMD A;  4YSZ A;  4AQY T;  1LVK A;  4I4T E;  3AE5 A;  2XAG B;  5L4E A;  3GN5 A;  3ONL C;  2PTF A;  3ZYL A;  2QYW A;  2QRX A;  2BVL A;  2V5D A;  4QX8 B;  5L3C B;  2UUA T;  2WB5 A;  2VKJ A;  3PDY A;  3C98 B;  2NW7 A;  2BG9 C;  2KSR A;  3HA4 A;  4MFR A;  4ZI2 D;  4EAH A;  3MXZ A;  1XZY A;  4DO0 A;  4ZZB A;  3RKO A;  1OED B;  2N2N A;  1WFD A;  4PFP A;  5HXR A;  4DV5 T;  2NTX A;  4AKH A;  2JQH A;  4EZH A;  2J4G A;  4NXN T;  4K0K T;  4QH4 A;  3HKC E;  5DQW A;  4ZEY A;  4TWF A;  2JIW A;  1WYB A;  2V6X A;  3CX6 B;  5F8P A;  4AXP A;  4C90 A;  5ABH A;  3V5U A;  3ETV A;  1D1C A;  1VCT A;  4Z90 A;  2XSA A;  3RLF F;  3UUM A;  3AE6 A;  1XMQ T;  2W67 A;  2X51 A;  2DWK A;  4BJM A;  3P50 A;  2Y8D A;  2X0H A;  2WP9 A;  4P1N A;  2I0M A;  5AQV B;  5FNV E;  4CN4 A;  4TV9 E;  3KV9 A;  3NBX X;  3LG7 A;  3QUJ A;  2LHN A;  4HKA A;  3UQ4 A;  5JTG A;  3AEB A;  3AVR A;  4XBF B;  5AQQ B;  4U7I A;  4UV9 B;  2P9B A;  3AEF A;  2BBJ A;  2JQ9 A;  4UIG A;  5AQR B;  1UGO A;  2ZM8 A;  4KHZ F;  5TAO A;  2LSI A;  2LRK A;  2M6I A;  5ABF A;  2VQF T;  4AKI A;  1WR6 A;  3UU5 A;  2M67 A; 
#chains in the Genus database with same CATH homology
 3H3M A;  3NKZ A;  3A7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...