3H3MA

Crystal structure of flagellar protein flit from bordetella bronchiseptica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
b'APVLEIYQDIANLTSRMLAAANASNWDLVLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein FliT
publication title Crystal structure of flagellar protein FliT from Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3h3mA00
3NKZA 3A7MA 3H3MA
chains in the Genus database with same CATH superfamily
4IE0A 2WWUA 3OJAA 4AKLA 3FZLB 2IIUA 2VL8A 2ZM2A 2WDVA 4PFPA 2F4VT 4O4LE 1HS7A 3DTOA 2NTXA 1N32T 4O4JE 3PURA 4E7ZA 3P8CD 4MLKA 2WQYA 2CCQA 4V1Av 3I0OA 4IE5A 4PK4A 2ZLYA 4FI5A 2BKPA 4UR9A 2UUAT 3RI5A 2ZMAA 3UUMA 2RA1A 1FMVA 1OWAA 1S94A 1IJ5A 5JDQA 2QGSA 3AE6A 1MMGA 3QNUA 3E22E 3WI3A 5HXRA 5HYAA 4X66T 5FXVA 2VB6A 2BBJA 4HE8A 3N2KE 2XAFB 1FIOA 2X9WA 3VR8A 4IDZA 4MBQA 4DBQA 4HWDA 2KINB 3AXJB 1MNDA 3OBVE 1HNWT 4PK6A 1JNZA 4PJNA 2KSRA 5L4EA 4XAXB 1YKHB 5HXCA 4HFHA 2IHR1 4QXCB 2B76A 1UX5A 3PUSA 5LJMA 4ASKA 3AAEB 4K0KT 2CWYA 3RKGA 3HR0A 3MZKB 3CX8B 3KV9A 5H6QB 4OX9T 2V26A 4ZZCA 4YFSA 2X9HA 3PU8A 4O2BE 4BJMA 4MFRA 3TLWA 2BG9E 5L2LA 4HFBA 1E7PA 4IDQA 5C3JA 5L3BB 3B5MA 2KT9A 3GN5B 4AQGA 3R6NA 4YTNA 2EHOD 4JI6T 2CLYC 3SFDA 2NP9A 2WWVA 1ZKEA 3JCFA 3RF1A 3VKHA 3P7IA 4CI2B 5JQGE 2LRLA 3KVAA 5LGUB 4PW8A 3CPZA 4QH4A 3I9WA 1IJ6A 4H9NC 1MIVA 4EZ4A 5JDLA 3MACA 3PUXF 2WU2A 3CKDA 5FL1A 3A8YC 3PUWF 2C5KT 4CQIA 3UQ4A 3AE2A 2DI4A 5L3DB 2EHOA 1D0YA 3ONLC 3PUAA 5AQMB 4LMLA 2BS2A 2W0GA 3BQIA 3CQCB 4UVCB 2CM0A 2BKOA 4JI0T 3CQXC 3MJXA 1KEYA 4WYVA 4TUYE 4CI3B 1YXRA 4EOZB 3ZT5A 3EDVA 2A72A 4F8HA 4CZZB 2ZM6T 4DR7T 4IL4A 2PJQA 2IDOB 5HWYA 4Z91A 3PUVF 1KNRA 2DHRA 4LF8T 2V6XA 3QB5A 1W0AA 2Y48B 4ILBA 2WBLA 4CXYA 3ZMSB 1U4QA 4NIQA 2ODUA 4ANJA 2RPAA 2XQ4A 4OYKA 1NWMX 4L0RA 4WW0A 2XQ8A 5IUXA 2YKSA 4IHJE 2E9XD 3RIFA 1KNZA 5L4HA 3LK2B 1XZYA 5AQOB 2VVSA 4HFVA 2PBIA 5KX5E 5F3JA 2XY8B 4DV0T 4EXTA 2NTYA 1OEDC 1EZ3A 3LDQB 4I55E 3QC9A 2XAHB 3AA6B 3ONJA 3UU3A 2E9XA 1ZP0A 1UK5A 4KUMB 1D1AA 3AEFA 3VHLA 2KXPB 2H7OA 5HEGA 5AQFB 4PJMA 4O4IE 2YU2A 4C90A 3H3AA 4HN9A 2LSJA 5J1GA 4DBRA 3HL6A 2CA5A 3Q5WA 2VVNA 2WB5A 4CXWA 1SA0E 2MPKA 5F5WA 3K3OA 3L8RA 4U7IA 4GK5E 2XQ7A 2BVMA 2LKHA 4QXHB 4A5XA 1D0XA 1XDPA 4GIWA 2BS3A 1HFAA 2XTLA 4ISTA 3IA3A 2I6HA 5FXXA 2AE9A 2YEVC 3AE8A 3FZFB 4EIWA 4HFIA 3AVRA 5HEJA 5AQQB 3I1AA 3AECA 4QX7B 2YDRA 5M4YA 3N2OA 3N9OA 4H9PC 2A2FX 1HTJF 4YLHA 4JI8T 2LSYA 3ZJ2A 3GWHA 3FB2A 2M67A 4TX5A 5AQGB 4U3CA 1CHUA 4EYYR 1X79A 3BQLA 2I59A 2V6YA 4H63H 4DMVA 2H7VC 4FJOA 5LMUT 4K0UA 5L3FB 3RX6A 2K3WA 3V5UA 1VCTA 3KFWX 2HN1A 5HCJA 1YQ3A 5JH7E 2VKHA 1HX1B 1I94T 4EEDA 5AQJB 3F31A 4X62T 4UEMA 1US7B 1XNRT 2IAKA 4TWHA 3P4SA 3ZT7A 3AB3B 1UCUA 5JTGA 3A7MA 4YHJA 2BG9B 4NXNT 1SE7A 4Z90A 4PK5A 2LJLA 1VOMA 4TZ4C 1ZV4X 4IDOA 4XZCA 1YD8G 4M1PA 3K8PC 3VRBA 2L8KA 1SHZC 2BZBA 2M6BA 3H3MA 5EK4A 5FY1A 2UUBT 2IMLA 4YSXA 4ZI7E 4DR2T 4HEAA 3RRWA 4I43B 2V7JA 4KMCA 5LJNA 3ZMVB 4IE6A 4P09A 3PE0A 4TNWA 4NXMT 4HFEA 4JI5T 2Q9QB 4QX8B 4DV1T 1WR0A 4DO0A 5JREA 5FXWA 2QRXA 3ZKRA 3NWIA 3C51A 1KFYA 5DQWA 1NENA 3ABVA 4GOUA 4F6RC 5BR8T 4AQFA 3LK42 3Q5DA 3ZT6A 2YDSA 4TNVA 2WMOA 3IHRA 4DNDA 5JDMA 5J2TE 2LRKA 3EUHA 4CN6A 2JQ9A 2X0YA 4OK0A 4U33A 1OEDE 3QOFA 3PV0F 1J5ET 1N36T 5EK2A 4JI1T 3ZEFB 1JNRA 4YTPA 3UTKA 2IC9A 3X1DA 4UF0A 1HNZT 2A3DA 1NAFA 3HKEE 4U7YA 4QKNA 2V8SV 2NWBA 3UUXB 2P9BA 5JR9B 2N1GA 2E2AA 2MTQA 2BVLA 2NR4A 2E5LT 5HEHA 2YK0A 3P4PA 5AQRB 2WAUA 4EGWA 2MYSA 3UU6A 2VKJA 3UU4A 4DV4T 5HXEA 3CIRA 3NZQA 4HTEA 4EV6A 3RLFF 3KV6A 2QYWA 1MIYA 2W4XA 1X9BA 3JC6C 5LNKA 2WZHA 4IREA 2G0UA 2CEAA 3ETVA 2L3LA 4ZI2C 3T8OA 4KP3C 2ACZA 4IL9A 1XNQT 2CRBA 4AI6A 5HEOA 2CBJA 2X9YA 1WRDA 4JEHB 5AFUL 2E8IA 2JQKA 4LMJA 3Q5XA 5FXZA 3RIAA 2LSGA 4IGUA 4U2ZA 2HHHT 3HI2A 4LFCT 5HEUA 5J0ZA 4X1IE 4CN4A 1DU2A 5LHIB 4UXNB 1QUUA 4L9IA 3NVOA 5F8PA 3ZMTB 5LBQB 4JI7T 5LB7B 4QHOA 5KDMC 3I9YA 5FKYA 3UU8A 2QVAA 5HAXA 3SRZA 3N9PA 3NRXA 1BR2A 2K9AA 2VWAA 4ILCA 5HXSA 3E08A 2QA7A 5JRCA 3VR9A 2WSSV 2NOXA 4WBOA 3RQWA 1E2AA 2FJBA 3UFEA 5JDFA 3ZLIA 2KMFA 3B57A 3ZCIA 4I0UA 5FP3A 2JMKA 3H37A 5ABGA 3TKLB 2WDRA 4KX6A 3RYCE 1KNPA 4ZS3A 2LOSA 3AE4A 4DR1T 4AISA 4JV5T 1HG5A 3Q2MA 3PU3A 2LT3A 3OYZA 5TAOA 1W09A 5L47A 4ZS2A 2UU9T 2Y6XA 1HF8A 1QSDA 2CHNA 2XHEB 5ADXL 3PUQA 3PTRB 2CLYB 2X68A 4LFAT 5L3EB 5LGTB 2UXBT 3GMIA 2SPCA 1KK7A 3LJCA 4IIJE 5CA1E 1CUNA 3A5XA 3ZC1A 2LE8A 2VQET 3UT5E 3ZYLA 4YSZA 3LBXB 4DIDB 5AQUB 2XM2A 3O4XE 2PTFA 3ZMZB 2I0MA 4PJJA 2W63A 2UXCT 5LXTE 3F57A 4UV9B 3QUJA 3EI0A 5HCMA 5FVLA 1WLXA 1XDOA 3C64A 2CWOA 3HKBE 3TLVA 3MA9A 4KHZF 1FJGT 4IE4A 2W66A 3AA0B 1FEWA 2ES0A 3RIUA 2XQYA 3CK6A 4TWFA 1WCRA 4YJ3E 4ERRA 3UFGA 4J2CA 2EHOC 4LF5T 4DR3T 3RC8A 4E7SA 3VRAA 2CHOA 1YW0A 2X9XA 2JIWA 2YDQA 5CB4E 2V1DB 2K48A 1H7CA 2D0UA 5CGMA 2PG8A 3PUZF 2JJ9A 2LHNA 1B7TA 5HXHA 2D2SA 3P4QA 5LGNB 4YSYA 1O3XA 1ZHCA 1OEDB 2XAGB 5AQPB 4IDPA 3RC3A 1E1HB 4U2YA 2BG9A 2HH7A 4IE7A 3M3ZB 4EZHA 5LP6E 5FVKA 3U78A 4BJNA 4COFA 1HCIA 2Z6EA 4UV8B 3AE9A 2XAQB 4PNIA 2J1DG 4ZI3D 2H88A 2NW7A 2KWHA 4B3MT 3EABA 1R8IA 4GYSA 3AEEA 3ZCJA 4XBFB 3UQ7A 1G73A 4YTMA 3L3PA 3UULA 2VL0A 3N2GE 4LMKA 2JPFA 3AE1A 3CQGB 2NW8A 2DLRA 2E9XC 3LSVA 3KBTA 4LF4T 4X65T 3CVRA 4DV5T 2R6GF 3ETUA 2PFVA 3RYIE 3QB5K 2LOPA 4LF9T 1IBLT 1YKEB 3O1HA 2A9UA 5HWXA 2K24A 2M6IA 3RRCA 4DVDA 4ZEYA 4KI0F 3UU5A 4X20E 2JMHA 4YJ2E 1IZNB 5ABFA 3BQKA 3N9QA 3C4XA 2J47A 4JI4T 3FBZA 1WFDA 3OVUA 3ZPOA 4O8SA 1ZOYA 2XM1A 3RQUA 2XSBA 3L39A 2WDQA 3ZYKA 3KV5A 1Z8UA 4H9QC 5JDNA 1I6ZA 1YQ4A 4JUYA 1XMOT 3ANWB 2BDEA 5JR9A 1WYCA 3O9XA 2OLTA 4ZZBA 4DR5T 3N9MA 4LF6T 4ZI3C 2HPJA 2L9QA 3ZN1B 4DUYT 5LHGB 3DP7A 3P50A 2H89A 5JVDE 2CPTA 4MALA 3N5LA 2X67A 2VKOA 4GKJT 1LRZA 3UUNA 1WR6A 4Z8XA 2FBWA 2VKDA 4QH5A 1Z0PA 2YOEA 2OA5A 3OTOT 4B6XA 3DJBA 5IHYA 5DABA 4HFCA 2C5JA 4UELA 2Y8DA 4N78D 3JAFA 3OYXA 3AA1B 2CMRA 1Y01A 3AXJA 3Q9DA 3E0ZA 4JI2T 1T8BA 2MBGA 4AKHA 2D9DA 4YXDA 4ZHQE 3MKDA 2X0LB 3UUBA 5CFBA 4QH1A 2YU1A 2LEHA 4IDNA 4CI1B 2W61A 1D1BA 4DV3T 3GA8A 3AE5A 3KBUA 2D5UA 4EYUA 5FL0A 1T72A 4AKIA 3MXZA 1MMDA 2DWGA 3Q5EA 1M62A 2B1EA 5IWAT 3GN5A 1T98A 3RKOA 5DQVA 1D0ZA 4BA9A 5FY0A 3PJAJ 5IYZE 2LSKA 4B3ST 2HN2A 1UUSA 5ABHA 3C4WA 4P0AA 3SFEA 4YHHT 3M65A 1T7SA 4H63V 4EAHA 5LCYA 3RYFE 2YINA 4AQFC 3R84B 4H9SE 2YN6A 3JADA 1M7KA 2IUBA 4JLEA 3OKQA 5BMVE 2FJAA 4B3TT 3I0QA 4CXXA 1LKXA 3B13A 3IBPA 4HWIB 4ILAA 3AE3A 5C8YE 3MK7C 3LBXA 3PUGA 4JBWF 1BR1A 1LVKA 4U74A 4AQYT 4BAYB 1MMNA 4CN1A 2XJ7A 5FYMA 2MOZA 1WYBA 5L3GB 2ZM8A 1KF6A 2UXDT 3CWZB 3C50A 3IF8B 5AQHB 3ESLA 1Y64B 3P4RA 2W67A 4NUUA 1N34T 3CMLA 2GK9A 2H3RA 4P0BA 4DR6T 1UX4A 2OV9A 4UF0B 3AEAA 3L09A 2XQ5A 4G63A 2VK9A 3NRYA 5AQKB 2X66A 2WU5A 2FUPA 1HR0T 1ZEEA 4QWNB 2UUCT 5LYJE 5LBMA 3FXEB 4JEUB 5AQTB 2UXXB 4EB6E 2V7IA 3EAMA 2W2UA 3F2EA 3TLTA 2V7MA 1MMAA 1BR4A 5DJQC 3RPUA 3ZYMA 1W9RA 2UXNB 3KDSE 4ZXLA 3KV4A 4L5GA 4PJLA 1OXZA 2KLQA 3N9LA 4X5TA 1OEDA 5AQIB 2BS4A 2VQFT 4X64T 3S4UA 2XZEA 3ZMUB 4JYAT 3J9X1 3NZPA 2WZIA 2DNXA 4ZOLE 2N2NA 3T1YT 1XMQT 2CXDA 1L0VA 5JDHA 5CJ5A 4JI3T 3FZMB 4WNKA 1VRBA 2JQHA 4U31A 3K3QC 4ISSA 2W00A 2IW5B 3RH3A 2WY2A 2XASB 5JRCB 2X0HA 3ZJ1A 2JQQA 3FXDB 3ONXA 4GYRA 3AVSA 1S35A 2XQAA 2XAJB 3PDYA 5LG4A 4WZXA 5FMNA 1IAPA 1VCSA 4A56A 2JRKA 4DV7T 2KWIB 2DCFA 4HGAA 3W15B 3FZKB 4YT0A 2ZM0A 2E5VA 2LHRA 4PAGA 5LHHB 5AQVB 3EVYA 3FZHB 5L3CB 3VKGA 3ZC0A 3AE7A 4NUVA 4LF7T 4OYJA 4UVAB 3ZN0B 2D0TA 5LG3A 2LLYA 2EHOB 4TV9E 1HX8A 2AXDS 4HWCA 4YY3T 3HA4A 3N9NA 4Q25A 2FJDA 4A97A 2ODVA 1J5WA 2DL1A 5LOVE 3CX6B 3WAJA 4PFOA 4IT4A 2CXFA 5AQLB 3QK6A 3RIUC 3KVBA 3O1JA 3ANWA 4KBMB 4HFDA 4EEBA 2VASA 3C98B 4MHCA 1SUMB 2Q9QD 3EDUA 4TWDA 2WM9A 4I50E 2XSAA 5KMGP 1J1JA 1U5PA 4KHPT 3K3NA 3PJAA 3SWHA 2J62A 5GONE 4H9OC 3CX7B 3U3IA 2LM2A 2MAWA 4DV2T 3BK9A 2RP4A 4O4HE 3LK3B 3AA7B 2K5BB 4AKRB 2V5CA 2C5IT 1MIWA 1XWMA 3J7Yq 2Q9QA 3PUYF 2XUEA 4X1YE 1UGOA 3FBLA 3FHNA 5ETWA 2LM9A 2WMNA 5C2TA 5AQNB 3P4WA 3HKCE 2KZ7B 4DMWA 2XQ3A 2LSIA 3RGLA 5KXJA 5E0OA 2V5DA 3KINB 2LKGA 3HKDE 1GQEA 3VU7H 1LVFA 3G06A 4TN7B 4U72A 3AEDA 2V7LA 4HKAA 2BBHA 5J2UE 4GKKT 2E9XB 2X51A 5JDGA 2BG9C 1W0BA 2C0SA 3C4ZA 3IEEA 1V9DA 2WCAA 4A98A 4UIGA 5AQSB 3JAEA 1IBMT 4OFZA 1BR0A 3ZSTA 1HG2A 3NBXX 5A1LA 1D1CA 5EZYE 4DUZT 4B3RT 2IC6A 4NPPA 3ZSSA 5FNVE 4QXBB 4WBNE 3EHZA 3LFMA 5ABEA 1FMWA 1AJ3A 3LG7A 4C91A 2ACXA 4G2AA 2Q9QC 3AAAB 3OPCA 1G8XA 3RHWA 2N9DA 2W62A 2KNDA 4AKGA 3RYHE 4UVBB 4P1NA 3T1HT 4HWFA 3AAIA 4DR4T 4ADZA 3K1SA 5LA6E 2BKNA 4ILUA 1QLBA 2XQ6A 2FJEA 5FY7A 3JC6D 5H6RB 2CXLA 4X1KE 1MNEA 2V6YB 3SOLA 1IBKT 1UURA 2J4GA 2VURA 4ZI2D 2CBIA 4I4TE 5EK3A 4HWHA 4O2AE 3TLSA 3O1IA 3D0TA 4H9RC 2V7KA 2XQ9A 2WS3A 1NEKA 4AXPA 2NW9A 5CA0E 3SS1A 5JR9C 4AIUA 4GK0E 5ABFB 5LMNT 3V5SA 3AEBA 1N33T 2CE7A 4TV8E 2DWKA 1HNXT 2HPLA 4DV6T 3WAKA 4LFBT 4OHFA 3TLUA 2XPKA 3AEGA 3NKZA 2WP9A
chains in the Genus database with same CATH topology
3NKZA 3A7MA 3H3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKZ A;  3A7M A;  3H3M A; 
#chains in the Genus database with same CATH topology
 4IE0 A;  2WWU A;  3OJA A;  4AKL A;  3FZL B;  2IIU A;  2VL8 A;  2ZM2 A;  2WDV A;  4PFP A;  2F4V T;  4O4L E;  1HS7 A;  3DTO A;  2NTX A;  1N32 T;  4O4J E;  3PUR A;  4E7Z A;  3P8C D;  4MLK A;  2WQY A;  2CCQ A;  4V1A v;  3I0O A;  4IE5 A;  4PK4 A;  2ZLY A;  4FI5 A;  2BKP A;  4UR9 A;  2UUA T;  3RI5 A;  2ZMA A;  3UUM A;  2RA1 A;  1FMV A;  1OWA A;  1S94 A;  1IJ5 A;  5JDQ A;  2QGS A;  3AE6 A;  1MMG A;  3QNU A;  3E22 E;  3WI3 A;  5HXR A;  5HYA A;  4X66 T;  5FXV A;  2VB6 A;  2BBJ A;  4HE8 A;  3N2K E;  2XAF B;  1FIO A;  2X9W A;  3VR8 A;  4IDZ A;  4MBQ A;  4DBQ A;  4HWD A;  2KIN B;  3AXJ B;  1MND A;  3OBV E;  1HNW T;  4PK6 A;  1JNZ A;  4PJN A;  2KSR A;  5L4E A;  4XAX B;  1YKH B;  5HXC A;  4HFH A;  2IHR 1;  4QXC B;  2B76 A;  1UX5 A;  3PUS A;  5LJM A;  4ASK A;  3AAE B;  4K0K T;  2CWY A;  3RKG A;  3HR0 A;  3MZK B;  3CX8 B;  3KV9 A;  5H6Q B;  4OX9 T;  2V26 A;  4ZZC A;  4YFS A;  2X9H A;  3PU8 A;  4O2B E;  4BJM A;  4MFR A;  3TLW A;  2BG9 E;  5L2L A;  4HFB A;  1E7P A;  4IDQ A;  5C3J A;  5L3B B;  3B5M A;  2KT9 A;  3GN5 B;  4AQG A;  3R6N A;  4YTN A;  2EHO D;  4JI6 T;  2CLY C;  3SFD A;  2NP9 A;  2WWV A;  1ZKE A;  3JCF A;  3RF1 A;  3VKH A;  3P7I A;  4CI2 B;  5JQG E;  2LRL A;  3KVA A;  5LGU B;  4PW8 A;  3CPZ A;  4QH4 A;  3I9W A;  1IJ6 A;  4H9N C;  1MIV A;  4EZ4 A;  5JDL A;  3MAC A;  3PUX F;  2WU2 A;  3CKD A;  5FL1 A;  3A8Y C;  3PUW F;  2C5K T;  4CQI A;  3UQ4 A;  3AE2 A;  2DI4 A;  5L3D B;  2EHO A;  1D0Y A;  3ONL C;  3PUA A;  5AQM B;  4LML A;  2BS2 A;  2W0G A;  3BQI A;  3CQC B;  4UVC B;  2CM0 A;  2BKO A;  4JI0 T;  3CQX C;  3MJX A;  1KEY A;  4WYV A;  4TUY E;  4CI3 B;  1YXR A;  4EOZ B;  3ZT5 A;  3EDV A;  2A72 A;  4F8H A;  4CZZ B;  2ZM6 T;  4DR7 T;  4IL4 A;  2PJQ A;  2IDO B;  5HWY A;  4Z91 A;  3PUV F;  1KNR A;  2DHR A;  4LF8 T;  2V6X A;  3QB5 A;  1W0A A;  2Y48 B;  4ILB A;  2WBL A;  4CXY A;  3ZMS B;  1U4Q A;  4NIQ A;  2ODU A;  4ANJ A;  2RPA A;  2XQ4 A;  4OYK A;  1NWM X;  4L0R A;  4WW0 A;  2XQ8 A;  5IUX A;  2YKS A;  4IHJ E;  2E9X D;  3RIF A;  1KNZ A;  5L4H A;  3LK2 B;  1XZY A;  5AQO B;  2VVS A;  4HFV A;  2PBI A;  5KX5 E;  5F3J A;  2XY8 B;  4DV0 T;  4EXT A;  2NTY A;  1OED C;  1EZ3 A;  3LDQ B;  4I55 E;  3QC9 A;  2XAH B;  3AA6 B;  3ONJ A;  3UU3 A;  2E9X A;  1ZP0 A;  1UK5 A;  4KUM B;  1D1A A;  3AEF A;  3VHL A;  2KXP B;  2H7O A;  5HEG A;  5AQF B;  4PJM A;  4O4I E;  2YU2 A;  4C90 A;  3H3A A;  4HN9 A;  2LSJ A;  5J1G A;  4DBR A;  3HL6 A;  2CA5 A;  3Q5W A;  2VVN A;  2WB5 A;  4CXW A;  1SA0 E;  2MPK A;  5F5W A;  3K3O A;  3L8R A;  4U7I A;  4GK5 E;  2XQ7 A;  2BVM A;  2LKH A;  4QXH B;  4A5X A;  1D0X A;  1XDP A;  4GIW A;  2BS3 A;  1HFA A;  2XTL A;  4IST A;  3IA3 A;  2I6H A;  5FXX A;  2AE9 A;  2YEV C;  3AE8 A;  3FZF B;  4EIW A;  4HFI A;  3AVR A;  5HEJ A;  5AQQ B;  3I1A A;  3AEC A;  4QX7 B;  2YDR A;  5M4Y A;  3N2O A;  3N9O A;  4H9P C;  2A2F X;  1HTJ F;  4YLH A;  4JI8 T;  2LSY A;  3ZJ2 A;  3GWH A;  3FB2 A;  2M67 A;  4TX5 A;  5AQG B;  4U3C A;  1CHU A;  4EYY R;  1X79 A;  3BQL A;  2I59 A;  2V6Y A;  4H63 H;  4DMV A;  2H7V C;  4FJO A;  5LMU T;  4K0U A;  5L3F B;  3RX6 A;  2K3W A;  3V5U A;  1VCT A;  3KFW X;  2HN1 A;  5HCJ A;  1YQ3 A;  5JH7 E;  2VKH A;  1HX1 B;  1I94 T;  4EED A;  5AQJ B;  3F31 A;  4X62 T;  4UEM A;  1US7 B;  1XNR T;  2IAK A;  4TWH A;  3P4S A;  3ZT7 A;  3AB3 B;  1UCU A;  5JTG A;  3A7M A;  4YHJ A;  2BG9 B;  4NXN T;  1SE7 A;  4Z90 A;  4PK5 A;  2LJL A;  1VOM A;  4TZ4 C;  1ZV4 X;  4IDO A;  4XZC A;  1YD8 G;  4M1P A;  3K8P C;  3VRB A;  2L8K A;  1SHZ C;  2BZB A;  2M6B A;  3H3M A;  5EK4 A;  5FY1 A;  2UUB T;  2IML A;  4YSX A;  4ZI7 E;  4DR2 T;  4HEA A;  3RRW A;  4I43 B;  2V7J A;  4KMC A;  5LJN A;  3ZMV B;  4IE6 A;  4P09 A;  3PE0 A;  4TNW A;  4NXM T;  4HFE A;  4JI5 T;  2Q9Q B;  4QX8 B;  4DV1 T;  1WR0 A;  4DO0 A;  5JRE A;  5FXW A;  2QRX A;  3ZKR A;  3NWI A;  3C51 A;  1KFY A;  5DQW A;  1NEN A;  3ABV A;  4GOU A;  4F6R C;  5BR8 T;  4AQF A;  3LK4 2;  3Q5D A;  3ZT6 A;  2YDS A;  4TNV A;  2WMO A;  3IHR A;  4DND A;  5JDM A;  5J2T E;  2LRK A;  3EUH A;  4CN6 A;  2JQ9 A;  2X0Y A;  4OK0 A;  4U33 A;  1OED E;  3QOF A;  3PV0 F;  1J5E T;  1N36 T;  5EK2 A;  4JI1 T;  3ZEF B;  1JNR A;  4YTP A;  3UTK A;  2IC9 A;  3X1D A;  4UF0 A;  1HNZ T;  2A3D A;  1NAF A;  3HKE E;  4U7Y A;  4QKN A;  2V8S V;  2NWB A;  3UUX B;  2P9B A;  5JR9 B;  2N1G A;  2E2A A;  2MTQ A;  2BVL A;  2NR4 A;  2E5L T;  5HEH A;  2YK0 A;  3P4P A;  5AQR B;  2WAU A;  4EGW A;  2MYS A;  3UU6 A;  2VKJ A;  3UU4 A;  4DV4 T;  5HXE A;  3CIR A;  3NZQ A;  4HTE A;  4EV6 A;  3RLF F;  3KV6 A;  2QYW A;  1MIY A;  2W4X A;  1X9B A;  3JC6 C;  5LNK A;  2WZH A;  4IRE A;  2G0U A;  2CEA A;  3ETV A;  2L3L A;  4ZI2 C;  3T8O A;  4KP3 C;  2ACZ A;  4IL9 A;  1XNQ T;  2CRB A;  4AI6 A;  5HEO A;  2CBJ A;  2X9Y A;  1WRD A;  4JEH B;  5AFU L;  2E8I A;  2JQK A;  4LMJ A;  3Q5X A;  5FXZ A;  3RIA A;  2LSG A;  4IGU A;  4U2Z A;  2HHH T;  3HI2 A;  4LFC T;  5HEU A;  5J0Z A;  4X1I E;  4CN4 A;  1DU2 A;  5LHI B;  4UXN B;  1QUU A;  4L9I A;  3NVO A;  5F8P A;  3ZMT B;  5LBQ B;  4JI7 T;  5LB7 B;  4QHO A;  5KDM C;  3I9Y A;  5FKY A;  3UU8 A;  2QVA A;  5HAX A;  3SRZ A;  3N9P A;  3NRX A;  1BR2 A;  2K9A A;  2VWA A;  4ILC A;  5HXS A;  3E08 A;  2QA7 A;  5JRC A;  3VR9 A;  2WSS V;  2NOX A;  4WBO A;  3RQW A;  1E2A A;  2FJB A;  3UFE A;  5JDF A;  3ZLI A;  2KMF A;  3B57 A;  3ZCI A;  4I0U A;  5FP3 A;  2JMK A;  3H37 A;  5ABG A;  3TKL B;  2WDR A;  4KX6 A;  3RYC E;  1KNP A;  4ZS3 A;  2LOS A;  3AE4 A;  4DR1 T;  4AIS A;  4JV5 T;  1HG5 A;  3Q2M A;  3PU3 A;  2LT3 A;  3OYZ A;  5TAO A;  1W09 A;  5L47 A;  4ZS2 A;  2UU9 T;  2Y6X A;  1HF8 A;  1QSD A;  2CHN A;  2XHE B;  5ADX L;  3PUQ A;  3PTR B;  2CLY B;  2X68 A;  4LFA T;  5L3E B;  5LGT B;  2UXB T;  3GMI A;  2SPC A;  1KK7 A;  3LJC A;  4IIJ E;  5CA1 E;  1CUN A;  3A5X A;  3ZC1 A;  2LE8 A;  2VQE T;  3UT5 E;  3ZYL A;  4YSZ A;  3LBX B;  4DID B;  5AQU B;  2XM2 A;  3O4X E;  2PTF A;  3ZMZ B;  2I0M A;  4PJJ A;  2W63 A;  2UXC T;  5LXT E;  3F57 A;  4UV9 B;  3QUJ A;  3EI0 A;  5HCM A;  5FVL A;  1WLX A;  1XDO A;  3C64 A;  2CWO A;  3HKB E;  3TLV A;  3MA9 A;  4KHZ F;  1FJG T;  4IE4 A;  2W66 A;  3AA0 B;  1FEW A;  2ES0 A;  3RIU A;  2XQY A;  3CK6 A;  4TWF A;  1WCR A;  4YJ3 E;  4ERR A;  3UFG A;  4J2C A;  2EHO C;  4LF5 T;  4DR3 T;  3RC8 A;  4E7S A;  3VRA A;  2CHO A;  1YW0 A;  2X9X A;  2JIW A;  2YDQ A;  5CB4 E;  2V1D B;  2K48 A;  1H7C A;  2D0U A;  5CGM A;  2PG8 A;  3PUZ F;  2JJ9 A;  2LHN A;  1B7T A;  5HXH A;  2D2S A;  3P4Q A;  5LGN B;  4YSY A;  1O3X A;  1ZHC A;  1OED B;  2XAG B;  5AQP B;  4IDP A;  3RC3 A;  1E1H B;  4U2Y A;  2BG9 A;  2HH7 A;  4IE7 A;  3M3Z B;  4EZH A;  5LP6 E;  5FVK A;  3U78 A;  4BJN A;  4COF A;  1HCI A;  2Z6E A;  4UV8 B;  3AE9 A;  2XAQ B;  4PNI A;  2J1D G;  4ZI3 D;  2H88 A;  2NW7 A;  2KWH A;  4B3M T;  3EAB A;  1R8I A;  4GYS A;  3AEE A;  3ZCJ A;  4XBF B;  3UQ7 A;  1G73 A;  4YTM A;  3L3P A;  3UUL A;  2VL0 A;  3N2G E;  4LMK A;  2JPF A;  3AE1 A;  3CQG B;  2NW8 A;  2DLR A;  2E9X C;  3LSV A;  3KBT A;  4LF4 T;  4X65 T;  3CVR A;  4DV5 T;  2R6G F;  3ETU A;  2PFV A;  3RYI E;  3QB5 K;  2LOP A;  4LF9 T;  1IBL T;  1YKE B;  3O1H A;  2A9U A;  5HWX A;  2K24 A;  2M6I A;  3RRC A;  4DVD A;  4ZEY A;  4KI0 F;  3UU5 A;  4X20 E;  2JMH A;  4YJ2 E;  1IZN B;  5ABF A;  3BQK A;  3N9Q A;  3C4X A;  2J47 A;  4JI4 T;  3FBZ A;  1WFD A;  3OVU A;  3ZPO A;  4O8S A;  1ZOY A;  2XM1 A;  3RQU A;  2XSB A;  3L39 A;  2WDQ A;  3ZYK A;  3KV5 A;  1Z8U A;  4H9Q C;  5JDN A;  1I6Z A;  1YQ4 A;  4JUY A;  1XMO T;  3ANW B;  2BDE A;  5JR9 A;  1WYC A;  3O9X A;  2OLT A;  4ZZB A;  4DR5 T;  3N9M A;  4LF6 T;  4ZI3 C;  2HPJ A;  2L9Q A;  3ZN1 B;  4DUY T;  5LHG B;  3DP7 A;  3P50 A;  2H89 A;  5JVD E;  2CPT A;  4MAL A;  3N5L A;  2X67 A;  2VKO A;  4GKJ T;  1LRZ A;  3UUN A;  1WR6 A;  4Z8X A;  2FBW A;  2VKD A;  4QH5 A;  1Z0P A;  2YOE A;  2OA5 A;  3OTO T;  4B6X A;  3DJB A;  5IHY A;  5DAB A;  4HFC A;  2C5J A;  4UEL A;  2Y8D A;  4N78 D;  3JAF A;  3OYX A;  3AA1 B;  2CMR A;  1Y01 A;  3AXJ A;  3Q9D A;  3E0Z A;  4JI2 T;  1T8B A;  2MBG A;  4AKH A;  2D9D A;  4YXD A;  4ZHQ E;  3MKD A;  2X0L B;  3UUB A;  5CFB A;  4QH1 A;  2YU1 A;  2LEH A;  4IDN A;  4CI1 B;  2W61 A;  1D1B A;  4DV3 T;  3GA8 A;  3AE5 A;  3KBU A;  2D5U A;  4EYU A;  5FL0 A;  1T72 A;  4AKI A;  3MXZ A;  1MMD A;  2DWG A;  3Q5E A;  1M62 A;  2B1E A;  5IWA T;  3GN5 A;  1T98 A;  3RKO A;  5DQV A;  1D0Z A;  4BA9 A;  5FY0 A;  3PJA J;  5IYZ E;  2LSK A;  4B3S T;  2HN2 A;  1UUS A;  5ABH A;  3C4W A;  4P0A A;  3SFE A;  4YHH T;  3M65 A;  1T7S A;  4H63 V;  4EAH A;  5LCY A;  3RYF E;  2YIN A;  4AQF C;  3R84 B;  4H9S E;  2YN6 A;  3JAD A;  1M7K A;  2IUB A;  4JLE A;  3OKQ A;  5BMV E;  2FJA A;  4B3T T;  3I0Q A;  4CXX A;  1LKX A;  3B13 A;  3IBP A;  4HWI B;  4ILA A;  3AE3 A;  5C8Y E;  3MK7 C;  3LBX A;  3PUG A;  4JBW F;  1BR1 A;  1LVK A;  4U74 A;  4AQY T;  4BAY B;  1MMN A;  4CN1 A;  2XJ7 A;  5FYM A;  2MOZ A;  1WYB A;  5L3G B;  2ZM8 A;  1KF6 A;  2UXD T;  3CWZ B;  3C50 A;  3IF8 B;  5AQH B;  3ESL A;  1Y64 B;  3P4R A;  2W67 A;  4NUU A;  1N34 T;  3CML A;  2GK9 A;  2H3R A;  4P0B A;  4DR6 T;  1UX4 A;  2OV9 A;  4UF0 B;  3AEA A;  3L09 A;  2XQ5 A;  4G63 A;  2VK9 A;  3NRY A;  5AQK B;  2X66 A;  2WU5 A;  2FUP A;  1HR0 T;  1ZEE A;  4QWN B;  2UUC T;  5LYJ E;  5LBM A;  3FXE B;  4JEU B;  5AQT B;  2UXX B;  4EB6 E;  2V7I A;  3EAM A;  2W2U A;  3F2E A;  3TLT A;  2V7M A;  1MMA A;  1BR4 A;  5DJQ C;  3RPU A;  3ZYM A;  1W9R A;  2UXN B;  3KDS E;  4ZXL A;  3KV4 A;  4L5G A;  4PJL A;  1OXZ A;  2KLQ A;  3N9L A;  4X5T A;  1OED A;  5AQI B;  2BS4 A;  2VQF T;  4X64 T;  3S4U A;  2XZE A;  3ZMU B;  4JYA T;  3J9X 1;  3NZP A;  2WZI A;  2DNX A;  4ZOL E;  2N2N A;  3T1Y T;  1XMQ T;  2CXD A;  1L0V A;  5JDH A;  5CJ5 A;  4JI3 T;  3FZM B;  4WNK A;  1VRB A;  2JQH A;  4U31 A;  3K3Q C;  4ISS A;  2W00 A;  2IW5 B;  3RH3 A;  2WY2 A;  2XAS B;  5JRC B;  2X0H A;  3ZJ1 A;  2JQQ A;  3FXD B;  3ONX A;  4GYR A;  3AVS A;  1S35 A;  2XQA A;  2XAJ B;  3PDY A;  5LG4 A;  4WZX A;  5FMN A;  1IAP A;  1VCS A;  4A56 A;  2JRK A;  4DV7 T;  2KWI B;  2DCF A;  4HGA A;  3W15 B;  3FZK B;  4YT0 A;  2ZM0 A;  2E5V A;  2LHR A;  4PAG A;  5LHH B;  5AQV B;  3EVY A;  3FZH B;  5L3C B;  3VKG A;  3ZC0 A;  3AE7 A;  4NUV A;  4LF7 T;  4OYJ A;  4UVA B;  3ZN0 B;  2D0T A;  5LG3 A;  2LLY A;  2EHO B;  4TV9 E;  1HX8 A;  2AXD S;  4HWC A;  4YY3 T;  3HA4 A;  3N9N A;  4Q25 A;  2FJD A;  4A97 A;  2ODV A;  1J5W A;  2DL1 A;  5LOV E;  3CX6 B;  3WAJ A;  4PFO A;  4IT4 A;  2CXF A;  5AQL B;  3QK6 A;  3RIU C;  3KVB A;  3O1J A;  3ANW A;  4KBM B;  4HFD A;  4EEB A;  2VAS A;  3C98 B;  4MHC A;  1SUM B;  2Q9Q D;  3EDU A;  4TWD A;  2WM9 A;  4I50 E;  2XSA A;  5KMG P;  1J1J A;  1U5P A;  4KHP T;  3K3N A;  3PJA A;  3SWH A;  2J62 A;  5GON E;  4H9O C;  3CX7 B;  3U3I A;  2LM2 A;  2MAW A;  4DV2 T;  3BK9 A;  2RP4 A;  4O4H E;  3LK3 B;  3AA7 B;  2K5B B;  4AKR B;  2V5C A;  2C5I T;  1MIW A;  1XWM A;  3J7Y q;  2Q9Q A;  3PUY F;  2XUE A;  4X1Y E;  1UGO A;  3FBL A;  3FHN A;  5ETW A;  2LM9 A;  2WMN A;  5C2T A;  5AQN B;  3P4W A;  3HKC E;  2KZ7 B;  4DMW A;  2XQ3 A;  2LSI A;  3RGL A;  5KXJ A;  5E0O A;  2V5D A;  3KIN B;  2LKG A;  3HKD E;  1GQE A;  3VU7 H;  1LVF A;  3G06 A;  4TN7 B;  4U72 A;  3AED A;  2V7L A;  4HKA A;  2BBH A;  5J2U E;  4GKK T;  2E9X B;  2X51 A;  5JDG A;  2BG9 C;  1W0B A;  2C0S A;  3C4Z A;  3IEE A;  1V9D A;  2WCA A;  4A98 A;  4UIG A;  5AQS B;  3JAE A;  1IBM T;  4OFZ A;  1BR0 A;  3ZST A;  1HG2 A;  3NBX X;  5A1L A;  1D1C A;  5EZY E;  4DUZ T;  4B3R T;  2IC6 A;  4NPP A;  3ZSS A;  5FNV E;  4QXB B;  4WBN E;  3EHZ A;  3LFM A;  5ABE A;  1FMW A;  1AJ3 A;  3LG7 A;  4C91 A;  2ACX A;  4G2A A;  2Q9Q C;  3AAA B;  3OPC A;  1G8X A;  3RHW A;  2N9D A;  2W62 A;  2KND A;  4AKG A;  3RYH E;  4UVB B;  4P1N A;  3T1H T;  4HWF A;  3AAI A;  4DR4 T;  4ADZ A;  3K1S A;  5LA6 E;  2BKN A;  4ILU A;  1QLB A;  2XQ6 A;  2FJE A;  5FY7 A;  3JC6 D;  5H6R B;  2CXL A;  4X1K E;  1MNE A;  2V6Y B;  3SOL A;  1IBK T;  1UUR A;  2J4G A;  2VUR A;  4ZI2 D;  2CBI A;  4I4T E;  5EK3 A;  4HWH A;  4O2A E;  3TLS A;  3O1I A;  3D0T A;  4H9R C;  2V7K A;  2XQ9 A;  2WS3 A;  1NEK A;  4AXP A;  2NW9 A;  5CA0 E;  3SS1 A;  5JR9 C;  4AIU A;  4GK0 E;  5ABF B;  5LMN T;  3V5S A;  3AEB A;  1N33 T;  2CE7 A;  4TV8 E;  2DWK A;  1HNX T;  2HPL A;  4DV6 T;  3WAK A;  4LFB T;  4OHF A;  3TLU A;  2XPK A;  3AEG A;  3NKZ A;  2WP9 A; 
#chains in the Genus database with same CATH homology
 3NKZ A;  3A7M A;  3H3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...