3H3MA

Crystal structure of flagellar protein flit from bordetella bronchiseptica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
APVLEIYQDIANLTSRMLAAANASNWDLVLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein FliT
publication title Crystal structure of flagellar protein FliT from Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3h3mA00
3A7MA 3H3MA 3NKZA
chains in the Genus database with same CATH superfamily
4GKKT 5J2UE 1KF6A 2RA1A 5KX5E 2JRKA 4O2AE 1X79A 1D0YA 4YHJA 1JNZA 4UVBB 5CA0E 3AAIA 3KV5A 5L4EA 2XSBA 3SWHA 5LMNT 1IJ5A 4I50E 2LKHA 4IREA 5LHIB 5ABHA 3P4SA 3MZKB 3UUBA 5HEGA 2WB5A 2XM2A 3OPCA 3ANWA 2XHEB 4HGAA 3VRAA 2VVSA 5JDHA 4BA9A 3QC9A 4I55E 4Z8XA 1CUNA 4ZI2C 1IBKT 3M65A 5FXXA 2WCAA 3UUMA 5HXSA 4QX7B 3ZCIA 3UU6A 5E0OA 4AKGA 1O3XA 4UEMA 3ETUA 3CQCB 1WRDA 2DCFA 2VK9A 4UELA 4LMKA 3A5XA 4TX5A 5AQQB 5LMUT 2YEVC 3AA6B 3UU3A 3N9OA 3A7MA 1XZYA 2CA5A 2MOZA 2XTLA 3ZN0B 2XQ3A 4QH5A 4IDPA 3GMIA 1D0ZA 4DV0T 2VL8A 3NRYA 2XQ9A 5EK3A 4YXDA 5KMGP 4IE4A 3CQGB 1W09A 2KSRA 2LSJA 3UUXB 5AQIB 3AAAB 5L3FB 4IDZA 1U5PA 2B76A 4LF4T 3KVAA 5L3DB 3CX7B 2XQAA 4G2AA 4HN9A 4UVCB 2H7OA 1IAPA 1T7SA 5JVDE 1WYCA 3FHNA 4WNKA 3Q5DA 3G06A 1YKHB 1YW0A 1VCTA 2EHOC 3J9X1 2V8SV 2Y48B 4L0RA 3AECA 4CI3B 2HN1A 4EYUA 3CKDA 1CHUA 2E9XD 3MK7C 4PFPA 2WBLA 5HXEA 4CI1B 3N5LA 1KK7A 2W62A 5J1GA 2D9DA 2CMRA 3C4ZA 2LKGA 3A8YC 3FBZA 1VRBA 3IEEA 2CHNA 3OKQA 1GQEA 3L3PA 3SFDA 2WP9A 2Z6EA 4UV9B 3BQIA 3PU3A 2VKDA 2KLQA 4AXPA 4JEHB 3ZMZB 2CWYA 1NENA 1Y01A 1H7CA 2LE8A 3RX6A 2KWIB 1BR1A 2JQQA 2XAFB 2CE7A 2V5DA 2H7VC 1ZOYA 3TLUA 1LRZA 4HWCA 2VB6A 4IHJE 2BKPA 2W00A 3PUAA 3NZQA 4NXNT 4YSYA 4JI8T 4IDOA 1OEDB 3ZSTA 4ZHQE 3FZLB 5JR9B 2XQ4A 2W66A 4DR1T 4PFOA 5HCMA 4FJOA 5HWXA 1N34T 4UXNB 4PW8A 2B1EA 3HKBE 2HPJA 3ZT7A 2P9BA 3K3QC 2V6XA 4I0UA 2X9YA 2NW8A 3PURA 5FXZA 2W63A 2JQHA 3RYFE 2BZBA 5LB7B 2VURA 3EVYA 3NKZA 2ZLYA 2VVNA 2BDEA 2BG9C 3AEFA 3PDYA 3TLTA 2N2NA 4PJLA 1OEDE 2D2SA 3K1SA 3LDQB 2D0TA 3O1IA 1WR6A 2A72A 4H9OC 4GK5E 3ZMTB 4HE8A 3Q5WA 1XDOA 3KBTA 3RIUC 5FL1A 2X9HA 1Z0PA 5CGMA 1MMDA 4YTPA 1NWMX 1KNPA 4LMJA 2BKOA 3U3IA 4AKHA 2V7JA 4GYSA 4ILUA 1HCIA 2WY2A 4HFCA 2V1DB 2MYSA 4IE5A 3SFEA 2HHHT 3L09A 4HFHA 3IF8B 4JI3T 3CPZA 1MMGA 1I94T 3PUYF 2X9XA 3PUGA 1E1HB 2ZM2A 3I9YA 4NUUA 4TNVA 4YJ2E 3FXEB 3RI5A 4HKAA 4X66T 4HFEA 4IDNA 4KX6A 5HAXA 3AEGA 4AQFC 1OEDA 2XQ6A 5JR9A 2XY8B 5L3CB 3UU5A 2UUAT 3KVBA 3VHLA 2HN2A 1ZHCA 4NXMT 4DMVA 2CEAA 2JMKA 4PK6A 1XDPA 1US7B 5LHGB 5CJ5A 4JI7T 4CZZB 3ZCJA 2WDRA 3BQLA 2E5LT 5A1LA 4P0BA 3P4QA 5HWYA 5DABA 3NZPA 4TZ4C 3P8CD 4DV5T 5AQKB 5CB4E 4LF5T 4U31A 2IIUA 3EUHA 2DLRA 2XM1A 1J5ET 2R6GF 4PK5A 3OJAA 4UIGA 3ZYKA 4EV6A 1HG2A 2MBGA 2QRXA 4ILCA 5ABFB 2BKNA 1T98A 2SPCA 2ZM8A 3AE6A 4HWFA 5JTGA 3FBLA 2LRLA 1MIWA 2J62A 4DR7T 2BG9B 5C3JA 4IT4A 1HS7A 3EI0A 3VKHA 3DTOA 1FEWA 2QA7A 3I9WA 5GONE 4HEAA 5LHHB 4AQGA 3N9QA 4EAHA 4MHCA 3PUVF 1LVFA 1AJ3A 4B3TT 4HTEA 2ZMAA 2Q9QB 4QH1A 4YTNA 4X20E 4LFCT 3T8OA 1IJ6A 3P4PA 3VU7H 4DR4T 2LEHA 4E7SA 2XJ7A 2UUCT 4X5TA 3MXZA 1D1BA 5J0ZA 3NWIA 4YLHA 2UXDT 3JC6C 4ANJA 1MNEA 1T8BA 3ZSSA 5L4HA 5AQUB 5TAOA 3ZYMA 1OWAA 2M67A 5FKYA 5FL0A 4GYRA 2XASB 2VKOA 2WU5A 3RGLA 2JQKA 1G8XA 3UULA 1UK5A 5LBQB 3PU8A 5FXVA 3UUNA 4KUMB 5DQWA 4HFVA 1QLBA 2K24A 4X62T 3VKGA 1YXRA 4DBRA 1QUUA 1D0XA 2E2AA 2VQET 4KBMB 5JREA 3OVUA 4ZI7E 3PE0A 5ABFA 2N9DA 3TLSA 3EAMA 4U3CA 3DJBA 4EGWA 4LF9T 3KINB 2DL1A 1LKXA 2LHRA 4DUYT 4NPPA 5AQGB 2WZIA 2X9WA 5LJNA 2DI4A 3RC8A 2BG9A 5L47A 2Q9QD 4PNIA 2WMOA 3F57A 2XQ7A 4NUVA 4CXYA 4EB6E 2UU9T 3QB5K 5JDMA 2CM0A 4BJNA 3JCFA 3RIUA 2CWOA 4EIWA 3QB5A 2XAHB 4BAYB 5LP6E 3Q9DA 2YDRA 2Q9QA 5JRCB 2LT3A 4EOZB 3AVSA 2V7MA 3C64A 4UVAB 4IL4A 2PBIA 4DVDA 2H88A 1QSDA 2ZM6T 2FJDA 3ZKRA 4YY3T 1UX5A 3AE5A 3V5SA 2J4GA 3NRXA 4JI4T 4ILBA 4K0UA 4PJJA 2XAGB 4OX9T 2XQYA 2H89A 5F3JA 2XSAA 3H3AA 2LSGA 5AQTB 1HTJF 3P4RA 4ZZBA 5H6RB 4AQFA 3GWHA 1S94A 3SRZA 4O4HE 5FYMA 2I6HA 5L3GB 4GKJT 2V7KA 4DIDB 3UU4A 2XAQB 2YU2A 5CFBA 2YU1A 4HFDA 4AIUA 4JUYA 2ZM0A 5LOVE 4H63H 2WDQA 1DU2A 2WMNA 3M3ZB 4A5XA 5LG3A 5FY1A 2BS2A 2WDVA 5AQSB 2BBJA 4OYJA 3MA9A 3UFEA 2OA5A 3CVRA 4JI2T 2UXNB 2LM2A 4AQYT 4FI5A 3I1AA 4KHPT 4WZXA 4ZS2A 3RQUA 3E22E 2J1DG 2NTYA 3ZLIA 4KMCA 3N9NA 5BR8T 4GIWA 2NR4A 3KV4A 4H63V 4MFRA 3HKDE 3WI3A 5JDGA 4YJ3E 3ETVA 3N2OA 5HCJA 2W67A 3V5UA 5ABEA 4X65T 1NAFA 2VASA 2MPKA 5ADXL 1YD8G 5F8PA 4JI6T 4DV1T 4MLKA 3AA0B 3TKLB 2PTFA 1YQ3A 3P7IA 2BS3A 3HL6A 3O1HA 3UQ4A 3OYZA 3AE2A 3AB3B 3RPUA 4ZXLA 3L39A 1HNWT 4DV2T 4JYAT 4L9IA 2CLYC 4O8SA 3K3NA 1WCRA 2L9QA 1KFYA 2LSYA 3CK6A 4U33A 4EZ4A 1XNRT 3FB2A 1XMQT 4PK4A 3OBVE 4J2CA 1FMWA 4GOUA 4IIJE 3HKCE 5LYJE 1XWMA 3LFMA 2NP9A 3QUJA 1HX8A 3AE7A 4LF7T 5M4YA 1SA0E 2DWKA 3RKOA 5LXTE 2WSSV 3ESLA 2W4XA 3LK2B 1UX4A 5L3EB 1IBMT 2A2FX 3PJAA 3RIAA 1ZKEA 2LM9A 2A9UA 2K9AA 3UU8A 4ZI2D 4YSZA 5L3BB 3ABVA 4ADZA 2NW7A 5LCYA 2ES0A 4DR6T 5FMNA 2WAUA 5AQNB 2EHOB 2VWAA 3FZKB 4JBWF 4CXWA 3ZJ1A 2M6BA 3AA1B 3O1JA 3ZMUB 4EXTA 4QWNB 3NBXX 4AKRB 2ODVA 4DV6T 3IBPA 3O4XE 3RRWA 2YK0A 2KMFA 3RF1A 4Z91A 4DNDA 1FMVA 2CBJA 3KDSE 4CQIA 2KWHA 1Y64B 3RYCE 2CXLA 4DV3T 2VKJA 2ODUA 1G73A 2IW5B 2D0UA 5AQVB 3F31A 3C50A 4TNWA 2NOXA 5LNKA 4DO0A 2JQ9A 3ZYLA 3J7Yq 4K0KT 2QGSA 2KNDA 2MTQA 3Q5XA 2GK9A 3AE3A 4JV5T 2JMHA 4AKLA 4XZCA 4TWFA 1N33T 4HWIB 3RQWA 1D1CA 3IHRA 2C0SA 2PJQA 2WWVA 3QK6A 2FJBA 2LLYA 3LG7A 1IBLT 2QVAA 2I59A 5FNVE 1N32T 4IL9A 3C4WA 2QYWA 3LK42 5HEHA 5AQJB 2EHOD 2CLYB 5FY0A 3VR9A 2L8KA 3RKGA 4F8HA 1VCSA 1HR0T 2X67A 2UXBT 3CQXC 5LG4A 2WQYA 2Y6XA 2DHRA 1IZNB 3FZMB 3PJAJ 4ASKA 2E5VA 1HNZT 4B3MT 2E9XC 3ANWB 4DMWA 3N9MA 4UV8B 1MMAA 4DR2T 3W15B 4CN6A 3AEAA 3PUQA 1EZ3A 3FZFB 2EHOA 2VKHA 5DQVA 3ZPOA 3GN5B 2HPLA 2L3LA 1M7KA 4P1NA 2LOSA 2V26A 3PUXF 4O4JE 3RIFA 5JDFA 2FJAA 4MBQA 4ISSA 3RYIE 3AE9A 3U78A 4CN4A 2I0MA 4WBOA 3LBXB 2BG9E 3PUZF 1HNXT 4XAXB 3BK9A 4HWDA 2X66A 1MNDA 1VOMA 4ISTA 4HWHA 4IE6A 3RLFF 4CXXA 1ZV4X 2CCQA 4QHOA 1J1JA 3ZMVB 5C8YE 2WM9A 2UXCT 3ZT5A 2XAJB 4YFSA 3H3MA 3C4XA 2K5BB 5FY7A 3AEEA 1R8IA 1T72A 4JLEA 3HKEE 4TV9E 4H9NC 2UXXB 2NTXA 2H3RA 4P0AA 5JH7E 2WU2A 4OYKA 1E2AA 3AXJB 1BR4A 4U7IA 2FUPA 2N1GA 3P4WA 3AVRA 1J5WA 2X68A 4IGUA 1FJGT 2W61A 4WBNE 1KNZA 3C98B 2ACZA 2YDSA 2XUEA 5EK4A 2CXDA 3LK3B 2CPTA 3SOLA 4A98A 3OYXA 3VR8A 1I6ZA 2X0LB 5KXJA 5FVKA 5AQRB 3B5MA 4KHZF 4OHFA 4IE0A 4TWHA 2W0GA 3E0ZA 2K3WA 3B13A 2D5UA 5HEUA 2FBWA 4ZZCA 1KNRA 4LFBT 2XQ8A 2VQFT 1UURA 3GN5A 2A3DA 4DUZT 2DWGA 3T1HT 4X1IE 4TV8E 1OEDC 4HFIA 4UF0B 4AISA 4H9SE 5JR9C 2E9XB 4E7ZA 2X0YA 4A97A 1JNRA 3IA3A 4NIQA 4Q25A 3C51A 3LBXA 3Q5EA 1BR0A 2OV9A 2V7IA 4LMLA 1UGOA 2KZ7B 3CWZB 3PUSA 3KFWX 3I0OA 4YHHT 2X51A 4PJNA 4I43B 3MJXA 3R6NA 3H37A 4QXHB 2PFVA 4O4IE 4TUYE 2BVMA 5JDLA 2C5JA 4H9RC 2VL0A 5F5WA 5LA6E 4QXCB 5IUXA 1MIYA 3ONXA 5HYAA 3OTOT 2CHOA 3N9PA 2JPFA 3DP7A 4QKNA 4ILAA 4A56A 3AXJA 4YSXA 1LVKA 3HA4A 3F2EA 2IAKA 2G0UA 2YINA 3EDVA 2WWUA 4V1Av 5J2TE 1U4QA 5HEJA 3RC3A 4WYVA 3ZC1A 2C5IT 2KXPB 3PUWF 3ONLC 4OFZA 1XNQT 4C91A 4F6RC 3EABA 3ZC0A 1B7TA 5FP3A 3CX8B 4QH4A 2J47A 2M6IA 1WLXA 3N9LA 3UFGA 3KBUA 4H9PC 4X64T 4B3RT 4ZI3D 2UUBT 3AEBA 2YOEA 3RYHE 5FXWA 2FJEA 5KDMC 1HX1B 4DV7T 5EZYE 2PG8A 1MMNA 2ACXA 4H9QC 3KV6A 4DR3T 5IYZE 3FXDB 2W2UA 3O9XA 3I0QA 4EZHA 4N78D 4X1YE 4WW0A 2LOPA 4UF0A 5HXCA 1HG5A 4JI5T 4M1PA 2E9XA 2WS3A 5JRCA 1W0BA 3UQ7A 1SE7A 2YDQA 4XBFB 3RH3A 1L0VA 2JIWA 1SHZC 2IHR1 2IUBA 2IMLA 5AQHB 4U7YA 1HF8A 5ETWA 4OK0A 3VRBA 3D0TA 3JC6D 3SS1A 3ONJA 4UR9A 2AE9A 2IC9A 5HEOA 4U72A 3K8PC 4U74A 5JDNA 3AAEB 4LF8T 4O4LE 4GK0E 4L5GA 2XQ5A 2WZHA 1N36T 5AQPB 4COFA 3CX6B 1SUMB 5JQGE 5LGUB 3L8RA 3MACA 3GA8A 3AEDA 3ZT6A 3R84B 2K48A 5LGNB 2MAWA 2RP4A 4G63A 1UUSA 2Y8DA 4P09A 3AA7B 5BMVE 3WAKA 4DV4T 5JDQA 3ZJ2A 4IE7A 3ZEFB 4DR5T 4BJMA 2V6YB 4IDQA 4PAGA 2IDOB 4MALA 3RRCA 3LJCA 4KP3C 3AE4A 3BQKA 1YKEB 3TLVA 1OXZA 2BS4A 3KV9A 3AE1A 1D1AA 2X0HA 4B3ST 4B6XA 4YT0A 2Q9QC 2NW9A 4ZEYA 2XZEA 1WYBA 4U2YA 2CXFA 2BVLA 1WR0A 3N2KE 5EK2A 1W0AA 4LF6T 3NVOA 2JJ9A 2RPAA 2C5KT 1FIOA 5HXRA 4X1KE 1S35A 3N2GE 2LRKA 5HXHA 3WAJA 5LJMA 4JI0T 3K3OA 4ERRA 4I4TE 3EHZA 3MKDA 3RHWA 3UTKA 3X1DA 2LSKA 3P50A 3PV0F 4AKIA 5IWAT 4JI1T 2YKSA 3UT5E 2KINB 5ABGA 4TN7B 4QXBB 5DJQC 3JAFA 3EDUA 3HR0A 4DBQA 3TLWA 4C90A 4AI6A 5AQFB 5H6QB 2NWBA 4TWDA 2CRBA 3LSVA 2E8IA 3HI2A 1WFDA 1KEYA 1ZEEA 3QOFA 2V6YA 3CIRA 1M62A 2LSIA 5LGTB 3PTRB 2XPKA 5FVLA 3ZMSB 1HFAA 2KT9A 3JADA 4QX8B 4YTMA 1BR2A 1V9DA 3Q2MA 2IC6A 4PJMA 3E08A 1W9RA 4ZI3C 2BBHA 1MIVA 2OLTA 5C2TA 2V7LA 3ZN1B 1ZP0A 2DNXA 4Z90A 3QNUA 3S4UA 2V5CA 4CN1A 5AQOB 5AQLB 3B57A 5LBMA 3AE8A 1YQ4A 1UCUA 4HFBA 4ZS3A 3FZHB 2YN6A 4EEBA 4EEDA 3JAEA 4U2ZA 2LJLA 2AXDS 3CMLA 5CA1E 3T1YT 4KI0F 1XMOT 4EYYR 2HH7A 5AFUL 1X9BA 4LFAT 4CI2B 2LHNA 4ZOLE 1Z8UA 5IHYA 2F4VT 1E7PA 4O2BE 5L2LA 4JEUB 2CBIA 5AQMB 1NEKA
chains in the Genus database with same CATH topology
3A7MA 3H3MA 3NKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7M A;  3H3M A;  3NKZ A; 
#chains in the Genus database with same CATH topology
 4GKK T;  5J2U E;  1KF6 A;  2RA1 A;  5KX5 E;  2JRK A;  4O2A E;  1X79 A;  1D0Y A;  4YHJ A;  1JNZ A;  4UVB B;  5CA0 E;  3AAI A;  3KV5 A;  5L4E A;  2XSB A;  3SWH A;  5LMN T;  1IJ5 A;  4I50 E;  2LKH A;  4IRE A;  5LHI B;  5ABH A;  3P4S A;  3MZK B;  3UUB A;  5HEG A;  2WB5 A;  2XM2 A;  3OPC A;  3ANW A;  2XHE B;  4HGA A;  3VRA A;  2VVS A;  5JDH A;  4BA9 A;  3QC9 A;  4I55 E;  4Z8X A;  1CUN A;  4ZI2 C;  1IBK T;  3M65 A;  5FXX A;  2WCA A;  3UUM A;  5HXS A;  4QX7 B;  3ZCI A;  3UU6 A;  5E0O A;  4AKG A;  1O3X A;  4UEM A;  3ETU A;  3CQC B;  1WRD A;  2DCF A;  2VK9 A;  4UEL A;  4LMK A;  3A5X A;  4TX5 A;  5AQQ B;  5LMU T;  2YEV C;  3AA6 B;  3UU3 A;  3N9O A;  3A7M A;  1XZY A;  2CA5 A;  2MOZ A;  2XTL A;  3ZN0 B;  2XQ3 A;  4QH5 A;  4IDP A;  3GMI A;  1D0Z A;  4DV0 T;  2VL8 A;  3NRY A;  2XQ9 A;  5EK3 A;  4YXD A;  5KMG P;  4IE4 A;  3CQG B;  1W09 A;  2KSR A;  2LSJ A;  3UUX B;  5AQI B;  3AAA B;  5L3F B;  4IDZ A;  1U5P A;  2B76 A;  4LF4 T;  3KVA A;  5L3D B;  3CX7 B;  2XQA A;  4G2A A;  4HN9 A;  4UVC B;  2H7O A;  1IAP A;  1T7S A;  5JVD E;  1WYC A;  3FHN A;  4WNK A;  3Q5D A;  3G06 A;  1YKH B;  1YW0 A;  1VCT A;  2EHO C;  3J9X 1;  2V8S V;  2Y48 B;  4L0R A;  3AEC A;  4CI3 B;  2HN1 A;  4EYU A;  3CKD A;  1CHU A;  2E9X D;  3MK7 C;  4PFP A;  2WBL A;  5HXE A;  4CI1 B;  3N5L A;  1KK7 A;  2W62 A;  5J1G A;  2D9D A;  2CMR A;  3C4Z A;  2LKG A;  3A8Y C;  3FBZ A;  1VRB A;  3IEE A;  2CHN A;  3OKQ A;  1GQE A;  3L3P A;  3SFD A;  2WP9 A;  2Z6E A;  4UV9 B;  3BQI A;  3PU3 A;  2VKD A;  2KLQ A;  4AXP A;  4JEH B;  3ZMZ B;  2CWY A;  1NEN A;  1Y01 A;  1H7C A;  2LE8 A;  3RX6 A;  2KWI B;  1BR1 A;  2JQQ A;  2XAF B;  2CE7 A;  2V5D A;  2H7V C;  1ZOY A;  3TLU A;  1LRZ A;  4HWC A;  2VB6 A;  4IHJ E;  2BKP A;  2W00 A;  3PUA A;  3NZQ A;  4NXN T;  4YSY A;  4JI8 T;  4IDO A;  1OED B;  3ZST A;  4ZHQ E;  3FZL B;  5JR9 B;  2XQ4 A;  2W66 A;  4DR1 T;  4PFO A;  5HCM A;  4FJO A;  5HWX A;  1N34 T;  4UXN B;  4PW8 A;  2B1E A;  3HKB E;  2HPJ A;  3ZT7 A;  2P9B A;  3K3Q C;  2V6X A;  4I0U A;  2X9Y A;  2NW8 A;  3PUR A;  5FXZ A;  2W63 A;  2JQH A;  3RYF E;  2BZB A;  5LB7 B;  2VUR A;  3EVY A;  3NKZ A;  2ZLY A;  2VVN A;  2BDE A;  2BG9 C;  3AEF A;  3PDY A;  3TLT A;  2N2N A;  4PJL A;  1OED E;  2D2S A;  3K1S A;  3LDQ B;  2D0T A;  3O1I A;  1WR6 A;  2A72 A;  4H9O C;  4GK5 E;  3ZMT B;  4HE8 A;  3Q5W A;  1XDO A;  3KBT A;  3RIU C;  5FL1 A;  2X9H A;  1Z0P A;  5CGM A;  1MMD A;  4YTP A;  1NWM X;  1KNP A;  4LMJ A;  2BKO A;  3U3I A;  4AKH A;  2V7J A;  4GYS A;  4ILU A;  1HCI A;  2WY2 A;  4HFC A;  2V1D B;  2MYS A;  4IE5 A;  3SFE A;  2HHH T;  3L09 A;  4HFH A;  3IF8 B;  4JI3 T;  3CPZ A;  1MMG A;  1I94 T;  3PUY F;  2X9X A;  3PUG A;  1E1H B;  2ZM2 A;  3I9Y A;  4NUU A;  4TNV A;  4YJ2 E;  3FXE B;  3RI5 A;  4HKA A;  4X66 T;  4HFE A;  4IDN A;  4KX6 A;  5HAX A;  3AEG A;  4AQF C;  1OED A;  2XQ6 A;  5JR9 A;  2XY8 B;  5L3C B;  3UU5 A;  2UUA T;  3KVB A;  3VHL A;  2HN2 A;  1ZHC A;  4NXM T;  4DMV A;  2CEA A;  2JMK A;  4PK6 A;  1XDP A;  1US7 B;  5LHG B;  5CJ5 A;  4JI7 T;  4CZZ B;  3ZCJ A;  2WDR A;  3BQL A;  2E5L T;  5A1L A;  4P0B A;  3P4Q A;  5HWY A;  5DAB A;  3NZP A;  4TZ4 C;  3P8C D;  4DV5 T;  5AQK B;  5CB4 E;  4LF5 T;  4U31 A;  2IIU A;  3EUH A;  2DLR A;  2XM1 A;  1J5E T;  2R6G F;  4PK5 A;  3OJA A;  4UIG A;  3ZYK A;  4EV6 A;  1HG2 A;  2MBG A;  2QRX A;  4ILC A;  5ABF B;  2BKN A;  1T98 A;  2SPC A;  2ZM8 A;  3AE6 A;  4HWF A;  5JTG A;  3FBL A;  2LRL A;  1MIW A;  2J62 A;  4DR7 T;  2BG9 B;  5C3J A;  4IT4 A;  1HS7 A;  3EI0 A;  3VKH A;  3DTO A;  1FEW A;  2QA7 A;  3I9W A;  5GON E;  4HEA A;  5LHH B;  4AQG A;  3N9Q A;  4EAH A;  4MHC A;  3PUV F;  1LVF A;  1AJ3 A;  4B3T T;  4HTE A;  2ZMA A;  2Q9Q B;  4QH1 A;  4YTN A;  4X20 E;  4LFC T;  3T8O A;  1IJ6 A;  3P4P A;  3VU7 H;  4DR4 T;  2LEH A;  4E7S A;  2XJ7 A;  2UUC T;  4X5T A;  3MXZ A;  1D1B A;  5J0Z A;  3NWI A;  4YLH A;  2UXD T;  3JC6 C;  4ANJ A;  1MNE A;  1T8B A;  3ZSS A;  5L4H A;  5AQU B;  5TAO A;  3ZYM A;  1OWA A;  2M67 A;  5FKY A;  5FL0 A;  4GYR A;  2XAS B;  2VKO A;  2WU5 A;  3RGL A;  2JQK A;  1G8X A;  3UUL A;  1UK5 A;  5LBQ B;  3PU8 A;  5FXV A;  3UUN A;  4KUM B;  5DQW A;  4HFV A;  1QLB A;  2K24 A;  4X62 T;  3VKG A;  1YXR A;  4DBR A;  1QUU A;  1D0X A;  2E2A A;  2VQE T;  4KBM B;  5JRE A;  3OVU A;  4ZI7 E;  3PE0 A;  5ABF A;  2N9D A;  3TLS A;  3EAM A;  4U3C A;  3DJB A;  4EGW A;  4LF9 T;  3KIN B;  2DL1 A;  1LKX A;  2LHR A;  4DUY T;  4NPP A;  5AQG B;  2WZI A;  2X9W A;  5LJN A;  2DI4 A;  3RC8 A;  2BG9 A;  5L47 A;  2Q9Q D;  4PNI A;  2WMO A;  3F57 A;  2XQ7 A;  4NUV A;  4CXY A;  4EB6 E;  2UU9 T;  3QB5 K;  5JDM A;  2CM0 A;  4BJN A;  3JCF A;  3RIU A;  2CWO A;  4EIW A;  3QB5 A;  2XAH B;  4BAY B;  5LP6 E;  3Q9D A;  2YDR A;  2Q9Q A;  5JRC B;  2LT3 A;  4EOZ B;  3AVS A;  2V7M A;  3C64 A;  4UVA B;  4IL4 A;  2PBI A;  4DVD A;  2H88 A;  1QSD A;  2ZM6 T;  2FJD A;  3ZKR A;  4YY3 T;  1UX5 A;  3AE5 A;  3V5S A;  2J4G A;  3NRX A;  4JI4 T;  4ILB A;  4K0U A;  4PJJ A;  2XAG B;  4OX9 T;  2XQY A;  2H89 A;  5F3J A;  2XSA A;  3H3A A;  2LSG A;  5AQT B;  1HTJ F;  3P4R A;  4ZZB A;  5H6R B;  4AQF A;  3GWH A;  1S94 A;  3SRZ A;  4O4H E;  5FYM A;  2I6H A;  5L3G B;  4GKJ T;  2V7K A;  4DID B;  3UU4 A;  2XAQ B;  2YU2 A;  5CFB A;  2YU1 A;  4HFD A;  4AIU A;  4JUY A;  2ZM0 A;  5LOV E;  4H63 H;  2WDQ A;  1DU2 A;  2WMN A;  3M3Z B;  4A5X A;  5LG3 A;  5FY1 A;  2BS2 A;  2WDV A;  5AQS B;  2BBJ A;  4OYJ A;  3MA9 A;  3UFE A;  2OA5 A;  3CVR A;  4JI2 T;  2UXN B;  2LM2 A;  4AQY T;  4FI5 A;  3I1A A;  4KHP T;  4WZX A;  4ZS2 A;  3RQU A;  3E22 E;  2J1D G;  2NTY A;  3ZLI A;  4KMC A;  3N9N A;  5BR8 T;  4GIW A;  2NR4 A;  3KV4 A;  4H63 V;  4MFR A;  3HKD E;  3WI3 A;  5JDG A;  4YJ3 E;  3ETV A;  3N2O A;  5HCJ A;  2W67 A;  3V5U A;  5ABE A;  4X65 T;  1NAF A;  2VAS A;  2MPK A;  5ADX L;  1YD8 G;  5F8P A;  4JI6 T;  4DV1 T;  4MLK A;  3AA0 B;  3TKL B;  2PTF A;  1YQ3 A;  3P7I A;  2BS3 A;  3HL6 A;  3O1H A;  3UQ4 A;  3OYZ A;  3AE2 A;  3AB3 B;  3RPU A;  4ZXL A;  3L39 A;  1HNW T;  4DV2 T;  4JYA T;  4L9I A;  2CLY C;  4O8S A;  3K3N A;  1WCR A;  2L9Q A;  1KFY A;  2LSY A;  3CK6 A;  4U33 A;  4EZ4 A;  1XNR T;  3FB2 A;  1XMQ T;  4PK4 A;  3OBV E;  4J2C A;  1FMW A;  4GOU A;  4IIJ E;  3HKC E;  5LYJ E;  1XWM A;  3LFM A;  2NP9 A;  3QUJ A;  1HX8 A;  3AE7 A;  4LF7 T;  5M4Y A;  1SA0 E;  2DWK A;  3RKO A;  5LXT E;  2WSS V;  3ESL A;  2W4X A;  3LK2 B;  1UX4 A;  5L3E B;  1IBM T;  2A2F X;  3PJA A;  3RIA A;  1ZKE A;  2LM9 A;  2A9U A;  2K9A A;  3UU8 A;  4ZI2 D;  4YSZ A;  5L3B B;  3ABV A;  4ADZ A;  2NW7 A;  5LCY A;  2ES0 A;  4DR6 T;  5FMN A;  2WAU A;  5AQN B;  2EHO B;  2VWA A;  3FZK B;  4JBW F;  4CXW A;  3ZJ1 A;  2M6B A;  3AA1 B;  3O1J A;  3ZMU B;  4EXT A;  4QWN B;  3NBX X;  4AKR B;  2ODV A;  4DV6 T;  3IBP A;  3O4X E;  3RRW A;  2YK0 A;  2KMF A;  3RF1 A;  4Z91 A;  4DND A;  1FMV A;  2CBJ A;  3KDS E;  4CQI A;  2KWH A;  1Y64 B;  3RYC E;  2CXL A;  4DV3 T;  2VKJ A;  2ODU A;  1G73 A;  2IW5 B;  2D0U A;  5AQV B;  3F31 A;  3C50 A;  4TNW A;  2NOX A;  5LNK A;  4DO0 A;  2JQ9 A;  3ZYL A;  3J7Y q;  4K0K T;  2QGS A;  2KND A;  2MTQ A;  3Q5X A;  2GK9 A;  3AE3 A;  4JV5 T;  2JMH A;  4AKL A;  4XZC A;  4TWF A;  1N33 T;  4HWI B;  3RQW A;  1D1C A;  3IHR A;  2C0S A;  2PJQ A;  2WWV A;  3QK6 A;  2FJB A;  2LLY A;  3LG7 A;  1IBL T;  2QVA A;  2I59 A;  5FNV E;  1N32 T;  4IL9 A;  3C4W A;  2QYW A;  3LK4 2;  5HEH A;  5AQJ B;  2EHO D;  2CLY B;  5FY0 A;  3VR9 A;  2L8K A;  3RKG A;  4F8H A;  1VCS A;  1HR0 T;  2X67 A;  2UXB T;  3CQX C;  5LG4 A;  2WQY A;  2Y6X A;  2DHR A;  1IZN B;  3FZM B;  3PJA J;  4ASK A;  2E5V A;  1HNZ T;  4B3M T;  2E9X C;  3ANW B;  4DMW A;  3N9M A;  4UV8 B;  1MMA A;  4DR2 T;  3W15 B;  4CN6 A;  3AEA A;  3PUQ A;  1EZ3 A;  3FZF B;  2EHO A;  2VKH A;  5DQV A;  3ZPO A;  3GN5 B;  2HPL A;  2L3L A;  1M7K A;  4P1N A;  2LOS A;  2V26 A;  3PUX F;  4O4J E;  3RIF A;  5JDF A;  2FJA A;  4MBQ A;  4ISS A;  3RYI E;  3AE9 A;  3U78 A;  4CN4 A;  2I0M A;  4WBO A;  3LBX B;  2BG9 E;  3PUZ F;  1HNX T;  4XAX B;  3BK9 A;  4HWD A;  2X66 A;  1MND A;  1VOM A;  4IST A;  4HWH A;  4IE6 A;  3RLF F;  4CXX A;  1ZV4 X;  2CCQ A;  4QHO A;  1J1J A;  3ZMV B;  5C8Y E;  2WM9 A;  2UXC T;  3ZT5 A;  2XAJ B;  4YFS A;  3H3M A;  3C4X A;  2K5B B;  5FY7 A;  3AEE A;  1R8I A;  1T72 A;  4JLE A;  3HKE E;  4TV9 E;  4H9N C;  2UXX B;  2NTX A;  2H3R A;  4P0A A;  5JH7 E;  2WU2 A;  4OYK A;  1E2A A;  3AXJ B;  1BR4 A;  4U7I A;  2FUP A;  2N1G A;  3P4W A;  3AVR A;  1J5W A;  2X68 A;  4IGU A;  1FJG T;  2W61 A;  4WBN E;  1KNZ A;  3C98 B;  2ACZ A;  2YDS A;  2XUE A;  5EK4 A;  2CXD A;  3LK3 B;  2CPT A;  3SOL A;  4A98 A;  3OYX A;  3VR8 A;  1I6Z A;  2X0L B;  5KXJ A;  5FVK A;  5AQR B;  3B5M A;  4KHZ F;  4OHF A;  4IE0 A;  4TWH A;  2W0G A;  3E0Z A;  2K3W A;  3B13 A;  2D5U A;  5HEU A;  2FBW A;  4ZZC A;  1KNR A;  4LFB T;  2XQ8 A;  2VQF T;  1UUR A;  3GN5 A;  2A3D A;  4DUZ T;  2DWG A;  3T1H T;  4X1I E;  4TV8 E;  1OED C;  4HFI A;  4UF0 B;  4AIS A;  4H9S E;  5JR9 C;  2E9X B;  4E7Z A;  2X0Y A;  4A97 A;  1JNR A;  3IA3 A;  4NIQ A;  4Q25 A;  3C51 A;  3LBX A;  3Q5E A;  1BR0 A;  2OV9 A;  2V7I A;  4LML A;  1UGO A;  2KZ7 B;  3CWZ B;  3PUS A;  3KFW X;  3I0O A;  4YHH T;  2X51 A;  4PJN A;  4I43 B;  3MJX A;  3R6N A;  3H37 A;  4QXH B;  2PFV A;  4O4I E;  4TUY E;  2BVM A;  5JDL A;  2C5J A;  4H9R C;  2VL0 A;  5F5W A;  5LA6 E;  4QXC B;  5IUX A;  1MIY A;  3ONX A;  5HYA A;  3OTO T;  2CHO A;  3N9P A;  2JPF A;  3DP7 A;  4QKN A;  4ILA A;  4A56 A;  3AXJ A;  4YSX A;  1LVK A;  3HA4 A;  3F2E A;  2IAK A;  2G0U A;  2YIN A;  3EDV A;  2WWU A;  4V1A v;  5J2T E;  1U4Q A;  5HEJ A;  3RC3 A;  4WYV A;  3ZC1 A;  2C5I T;  2KXP B;  3PUW F;  3ONL C;  4OFZ A;  1XNQ T;  4C91 A;  4F6R C;  3EAB A;  3ZC0 A;  1B7T A;  5FP3 A;  3CX8 B;  4QH4 A;  2J47 A;  2M6I A;  1WLX A;  3N9L A;  3UFG A;  3KBU A;  4H9P C;  4X64 T;  4B3R T;  4ZI3 D;  2UUB T;  3AEB A;  2YOE A;  3RYH E;  5FXW A;  2FJE A;  5KDM C;  1HX1 B;  4DV7 T;  5EZY E;  2PG8 A;  1MMN A;  2ACX A;  4H9Q C;  3KV6 A;  4DR3 T;  5IYZ E;  3FXD B;  2W2U A;  3O9X A;  3I0Q A;  4EZH A;  4N78 D;  4X1Y E;  4WW0 A;  2LOP A;  4UF0 A;  5HXC A;  1HG5 A;  4JI5 T;  4M1P A;  2E9X A;  2WS3 A;  5JRC A;  1W0B A;  3UQ7 A;  1SE7 A;  2YDQ A;  4XBF B;  3RH3 A;  1L0V A;  2JIW A;  1SHZ C;  2IHR 1;  2IUB A;  2IML A;  5AQH B;  4U7Y A;  1HF8 A;  5ETW A;  4OK0 A;  3VRB A;  3D0T A;  3JC6 D;  3SS1 A;  3ONJ A;  4UR9 A;  2AE9 A;  2IC9 A;  5HEO A;  4U72 A;  3K8P C;  4U74 A;  5JDN A;  3AAE B;  4LF8 T;  4O4L E;  4GK0 E;  4L5G A;  2XQ5 A;  2WZH A;  1N36 T;  5AQP B;  4COF A;  3CX6 B;  1SUM B;  5JQG E;  5LGU B;  3L8R A;  3MAC A;  3GA8 A;  3AED A;  3ZT6 A;  3R84 B;  2K48 A;  5LGN B;  2MAW A;  2RP4 A;  4G63 A;  1UUS A;  2Y8D A;  4P09 A;  3AA7 B;  5BMV E;  3WAK A;  4DV4 T;  5JDQ A;  3ZJ2 A;  4IE7 A;  3ZEF B;  4DR5 T;  4BJM A;  2V6Y B;  4IDQ A;  4PAG A;  2IDO B;  4MAL A;  3RRC A;  3LJC A;  4KP3 C;  3AE4 A;  3BQK A;  1YKE B;  3TLV A;  1OXZ A;  2BS4 A;  3KV9 A;  3AE1 A;  1D1A A;  2X0H A;  4B3S T;  4B6X A;  4YT0 A;  2Q9Q C;  2NW9 A;  4ZEY A;  2XZE A;  1WYB A;  4U2Y A;  2CXF A;  2BVL A;  1WR0 A;  3N2K E;  5EK2 A;  1W0A A;  4LF6 T;  3NVO A;  2JJ9 A;  2RPA A;  2C5K T;  1FIO A;  5HXR A;  4X1K E;  1S35 A;  3N2G E;  2LRK A;  5HXH A;  3WAJ A;  5LJM A;  4JI0 T;  3K3O A;  4ERR A;  4I4T E;  3EHZ A;  3MKD A;  3RHW A;  3UTK A;  3X1D A;  2LSK A;  3P50 A;  3PV0 F;  4AKI A;  5IWA T;  4JI1 T;  2YKS A;  3UT5 E;  2KIN B;  5ABG A;  4TN7 B;  4QXB B;  5DJQ C;  3JAF A;  3EDU A;  3HR0 A;  4DBQ A;  3TLW A;  4C90 A;  4AI6 A;  5AQF B;  5H6Q B;  2NWB A;  4TWD A;  2CRB A;  3LSV A;  2E8I A;  3HI2 A;  1WFD A;  1KEY A;  1ZEE A;  3QOF A;  2V6Y A;  3CIR A;  1M62 A;  2LSI A;  5LGT B;  3PTR B;  2XPK A;  5FVL A;  3ZMS B;  1HFA A;  2KT9 A;  3JAD A;  4QX8 B;  4YTM A;  1BR2 A;  1V9D A;  3Q2M A;  2IC6 A;  4PJM A;  3E08 A;  1W9R A;  4ZI3 C;  2BBH A;  1MIV A;  2OLT A;  5C2T A;  2V7L A;  3ZN1 B;  1ZP0 A;  2DNX A;  4Z90 A;  3QNU A;  3S4U A;  2V5C A;  4CN1 A;  5AQO B;  5AQL B;  3B57 A;  5LBM A;  3AE8 A;  1YQ4 A;  1UCU A;  4HFB A;  4ZS3 A;  3FZH B;  2YN6 A;  4EEB A;  4EED A;  3JAE A;  4U2Z A;  2LJL A;  2AXD S;  3CML A;  5CA1 E;  3T1Y T;  4KI0 F;  1XMO T;  4EYY R;  2HH7 A;  5AFU L;  1X9B A;  4LFA T;  4CI2 B;  2LHN A;  4ZOL E;  1Z8U A;  5IHY A;  2F4V T;  1E7P A;  4O2B E;  5L2L A;  4JEU B;  2CBI A;  5AQM B;  1NEK A; 
#chains in the Genus database with same CATH homology
 3A7M A;  3H3M A;  3NKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...