3H3MA

Crystal structure of flagellar protein flit from bordetella bronchiseptica
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
APVLEIYQDIANLTSRMLAAANASNWDLVLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of flagellar protein FliT from Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics
molecule keywords Flagellar protein FliT
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05400 FliT Flagellar protein FliT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Flagellar protein flit. 3h3mA00
3A7MA 3H3MA 3NKZA
chains in the Genus database with same CATH superfamily
4WBNE 3VRAA 5L4EA 1HR0T 4ZI3C 1SE7A 3UUBA 1YQ3A 4JI3T 1Z8UA 4UV9B 1XWMA 4YTMA 2YDRA 5AQNB 1WCRA 1HG2A 2W67A 3RKOA 4ADZA 3FB2A 2VL8A 5FXWA 3ETVA 4LF9T 1N34T 2XAHB 4WW0A 2WB5A 5FP3A 3IBPA 3H37A 2J1DG 3NWIA 4QWNB 1D1BA 3ZT6A 1IJ6A 2V8SV 4TV8E 3OTOT 4UEMA 5FXZA 1SA0E 2JRKA 1SUMB 5AQGB 2XZEA 3P4PA 1UX4A 2V5CA 1XDPA 3IHRA 2LSKA 2YU1A 3KFWX 3MZKB 4I0UA 2DLRA 3RLFF 1U5PA 2BDEA 4A56A 2Z6EA 4J2CA 2FBWA 3RRWA 5JREA 5LCYA 4JI7T 2XAQB 4KHPT 4AKIA 4QX8B 4ZS2A 4TN7B 1BR1A 2CWYA 4GK5E 4ZI7E 5L2LA 1HS7A 1XDOA 1OWAA 1UK5A 2BBHA 3H3AA 4GYSA 3UU8A 1KNRA 3AE2A 5HEUA 4DBRA 4EGWA 1NENA 4TX5A 3ZN1B 4ZEYA 2XQ7A 3CWZB 1T8BA 1AJ3A 2LJLA 2XQ5A 5AQVB 2V1DB 3ZEFB 4GK0E 3C4ZA 4DO0A 4IDPA 4X1IE 1FMVA 3EVYA 3I9YA 3LK42 3P4SA 1I94T 1M7KA 1G8XA 1D0XA 3EUHA 3A5XA 3FZLB 3P7IA 3SFDA 3C51A 5HEHA 5JVDE 3HR0A 3LSVA 4EOZB 2LOPA 2F4VT 2UXDT 1UGOA 5LA6E 4IGUA 4OFZA 5LJNA 2FJEA 5AQUB 2UUBT 3QNUA 4U2ZA 5M4YA 5AQSB 4QHOA 3NZPA 5LHGB 2UXCT 2V6YB 2ACXA 4UVAB 3BQLA 4LMJA 4QXCB 2WWVA 3UFGA 3FXDB 1QUUA 4B3ST 1VOMA 2JMHA 2D5UA 2KWIB 2XAGB 2ZMAA 1D1AA 2KWHA 4IE4A 4PFPA 3AEBA 1ZV4X 3ONLC 2OLTA 4X1YE 4YTNA 4ERRA 3CQGB 5BR8T 3HKCE 5L3EB 4TV9E 2D0UA 3FHNA 2BG9C 3N9LA 4LF6T 1MMGA 2VVSA 2LHRA 3IF8B 3O4XE 4Z91A 5FVLA 4EYYR 2E2AA 2WWUA 3VR9A 4DR6T 2JIWA 2AE9A 3UQ7A 2J47A 2LKGA 3RRCA 5AQHB 3DTOA 3B5MA 2NP9A 3M65A 2ACZA 4H9PC 3QB5K 4LMKA 3AEFA 4WYVA 3ZYKA 5JDHA 5JH7E 1HNWT 3CX7B 2JQ9A 4O2AE 4WBOA 3AB3B 2VWAA 2XQ4A 4NUVA 2M6IA 3RIAA 3RYCE 1J5ET 5HCJA 2WBLA 3ZPOA 4DR5T 4I55E 3N9QA 4V1Av 4Z8XA 2CCQA 2IDOB 4KUMB 3O1JA 1HX8A 1UURA 1Y64B 4TWHA 5ABEA 4DV2T 4U74A 3Q2MA 3FXEB 3A8YC 3IA3A 4QH5A 4O2BE 3SOLA 4KX6A 2V7KA 4BJMA 1ZOYA 5AQIB 3PUQA 5L3CB 5J2UE 5CJ5A 1U4QA 2MOZA 5LGTB 2VQET 4AQYT 1MIVA 4OYKA 3AE6A 3NVOA 1T7SA 4HWIB 2W4XA 2XY8B 4P0BA 2FJAA 2KNDA 3DP7A 4AKRB 1BR4A 3LBXA 2CXFA 2HH7A 2QA7A 4TUYE 3AE5A 5HEOA 4ZS3A 2BS3A 5HXHA 3UUNA 1HG5A 3K3QC 3ZT5A 3JCFA 3SFEA 1HX1B 2HHHT 1WLXA 1KEYA 2M67A 4QH4A 2CHNA 2VB6A 4YSZA 4JI4T 2PJQA 1S94A 1CUNA 1LKXA 2VKHA 4X65T 3EI0A 2M6BA 5EK4A 2LOSA 5FYMA 5JRCB 4IREA 4DMVA 1M62A 2CXDA 2UXXB 2X9YA 4LMLA 2VVNA 2YINA 2H7OA 3Q5WA 4XZCA 3EABA 5F5WA 1QSDA 3AE3A 4IDZA 5LG3A 4H63H 5LMUT 3GN5B 4UIGA 4DR1T 2IUBA 2GK9A 5LNKA 3AE9A 4H9OC 2YDQA 2XJ7A 5FMNA 4CXXA 3VR8A 4DR3T 3CKDA 4FJOA 5LBQB 3FZFB 3AXJA 3E0ZA 3I1AA 3P4WA 4QKNA 2H88A 4ILUA 2X67A 2CEAA 4BA9A 3T1YT 2UU9T 3UULA 4DNDA 4DV4T 4CN6A 4ZZCA 3PUVF 1JNRA 3ONJA 2KZ7B 4JEUB 2E5LT 2AXDS 3CVRA 3MKDA 2UXNB 3QB5A 5LB7B 4AKHA 3N9MA 3AVRA 2C0SA 3ETUA 3ZSSA 1WYBA 2XPKA 5C8YE 3ZMTB 4CZZB 5JTGA 5JQGE 4O4HE 5JR9B 2IHR1 2HN2A 4HTEA 1VCSA 4YSYA 4JV5T 2QGSA 2V7IA 1W0AA 2LE8A 3AXJB 4I4TE 4H9NC 5AQQB 1LVKA 2N1GA 3ANWB 4I43B 4ZXLA 2JJ9A 5JR9A 4ZHQE 5JR9C 5L3GB 5C2TA 3AE7A 2CHOA 3OYZA 4QXHB 1MMAA 3ESLA 3TLSA 4ASKA 2CE7A 1OEDC 2W63A 2WDRA 2KMFA 3ANWA 4HFEA 2QYWA 4UV8B 3TLUA 5KX5E 4DR2T 3X1DA 1T72A 2KINB 2KT9A 4HN9A 5CB4E 4U7IA 3PTRB 3AAEB 4PJNA 2H3RA 2YK0A 2YU2A 3P50A 5AQJB 3PUSA 5AQLB 3ZMUB 3UUMA 3ZMSB 4BAYB 4CQIA 4IDNA 3F2EA 3L39A 4HFVA 1IBKT 3ZN0B 3JC6D 2DWGA 3B57A 3O1HA 3C98B 3Q9DA 5LYJE 3OYXA 2VURA 1E1HB 4LF7T 2B1EA 2DWKA 3U78A 3J9X1 1E2AA 2XSBA 4COFA 5J0ZA 4DV5T 1YQ4A 2CWOA 4B6XA 1HNXT 2JQHA 4AIUA 4KHZF 2PG8A 4EXTA 4ILAA 4EYUA 1US7B 4YJ2E 5ABFA 5HYAA 2XQYA 4L9IA 2HN1A 4NXNT 3AAAB 4TZ4C 4H9RC 5GONE 4ZOLE 2WSSV 4DBQA 2V26A 3N2OA 4YFSA 2VQFT 2XQ8A 2X9WA 2C5JA 3RGLA 4O8SA 3RQWA 1Z0PA 3V5SA 1KNPA 1UCUA 3N9NA 4EV6A 2N2NA 4UVCB 3UQ4A 2E9XB 3EDUA 2G0UA 2K24A 3JAEA 3PV0F 3KV9A 2VK9A 2Y6XA 2R6GF 3TLTA 2XM2A 2DI4A 5ADXL 4LF8T 4DV3T 1SHZC 4O4LE 4L5GA 1KFYA 4MFRA 4H9SE 2VASA 3UU4A 2LM9A 1FJGT 3ZCJA 4A98A 1NAFA 4PK6A 5LXTE 4TNWA 3J7Yq 1HF8A 2K9AA 5IYZE 3VU7H 3KV6A 5FY1A 3PUAA 1HCIA 4B3MT 4ZZBA 2BS2A 2MPKA 3AE8A 4HFBA 1XZYA 2CMRA 2A3DA 3N2KE 2VL0A 4CXWA 1XMOT 3TLWA 4CI1B 2I0MA 3Q5EA 4AQFC 2Y8DA 4MLKA 3UUXB 4Q25A 2WS3A 3E08A 3LG7A 2KSRA 3FBLA 2YEVC 4LF4T 2ZM2A 4UF0A 2XHEB 3U3IA 2L9QA 2PTFA 3HA4A 4IE0A 4DMWA 4YXDA 3CIRA 4K0KT 2UUCT 3RYIE 4A5XA 3L8RA 4DV7T 2XSAA 2ODVA 4H9QC 4ISSA 4FI5A 2BBJA 4DVDA 3T8OA 1S35A 1LRZA 2LRLA 3PU8A 4YSXA 3L3PA 3CQXC 1W0BA 4DV0T 2WU2A 4JBWF 2D2SA 2YOEA 3W15B 4YTPA 2YKSA 3HKBE 3ZJ2A 1J1JA 5HXSA 4U3CA 4GOUA 4E7ZA 2CA5A 3PJAJ 2W2UA 5CFBA 2PFVA 4UELA 1XNRT 3CQCB 3PE0A 2X0YA 5LHIB 1BR0A 4F8HA 5LGNB 2D9DA 2NTYA 1VRBA 3OPCA 4P1NA 4CI2B 3I0QA 3N5LA 4C90A 3ZYMA 2X0LB 2WDQA 2X9XA 2LSGA 2WY2A 3AA0B 3NZQA 5FXVA 5ABGA 3TKLB 2HPLA 2HPJA 4JI2T 1W9RA 4X5TA 4U2YA 4NIQA 3ZC0A 3G06A 3N9OA 4MHCA 4AXPA 1NWMX 4PJLA 1N32T 2BG9B 4IE6A 2RPAA 3AA6B 4U72A 1OEDE 1MIWA 3AEEA 4PFOA 5J2TE 2LSIA 2ZM6T 1IAPA 3O1IA 4G2AA 5A1LA 2UXBT 3RIUA 2WAUA 5L3DB 2FUPA 4OHFA 3FZMB 2BZBA 5EZYE 2BVLA 2K5BB 1L0VA 3D0TA 4YHJA 1V9DA 1WFDA 4C91A 2C5KT 4ILCA 3F31A 3QOFA 5ETWA 2NW8A 3ZC1A 1OEDA 5HEJA 1GQEA 3AEDA 3MA9A 3JADA 4HFDA 4PJMA 1YXRA 5LG4A 2UUAT 4KBMB 1D0YA 2EHOB 2XASB 5L4HA 2PBIA 5FXXA 5AQOB 1WYCA 4JI5T 2E9XA 3BQKA 2N9DA 4OYJA 4PJJA 5H6RB 1XNQT 4QX7B 2Q9QC 4IDQA 3T1HT 3LK2B 4LFBT 2EHOA 4EIWA 2QRXA 5L3FB 1IJ5A 2JQKA 4GKJT 5L47A 5JRCA 4IE7A 3UTKA 3I0OA 2NW7A 5JDNA 2EHOD 3K3NA 2RP4A 1X79A 4NUUA 2ZM8A 4GKKT 4IHJE 3LJCA 2X0HA 4Z90A 3UU5A 3TLVA 3NKZA 1HFAA 1UX5A 2IMLA 3ZT7A 2Q9QD 4EAHA 1G73A 3ZSTA 4P0AA 1HTJF 3C64A 4CI3B 3Q5XA 4IIJE 4E7SA 3PUYF 2E9XD 2DNXA 3CK6A 1CHUA 3JAFA 2XTLA 2V7MA 2XQ9A 3MACA 4MBQA 3ZCIA 3RYFE 1XMQT 2EHOC 3GMIA 3EHZA 4GIWA 3R84B 5CGMA 2W62A 3IEEA 4B3RT 3A7MA 4HWHA 2LHNA 5HWYA 2NW9A 2E8IA 2Q9QB 2WCAA 3ZMVB 1X9BA 5ABFB 4XAXB 5HWXA 3KVAA 3N9PA 5KDMC 2E9XC 4K0UA 3CX6B 4QH1A 2XAJB 3OVUA 5LHHB 2KLQA 2JPFA 3LDQB 4IDOA 1MIYA 3AEAA 3E22E 4N78D 3ZLIA 1YKHB 2WMNA 2CM0A 4UXNB 3RIFA 3UU6A 4P09A 2BVMA 5DJQC 4ZI3D 3HKDE 3I9WA 2IIUA 2P9BA 2A9UA 3JC6C 3QC9A 5J1GA 4AKLA 2CPTA 3CX8B 5JDGA 4JI8T 3OBVE 3KVBA 2ODUA 3FZHB 4EB6E 5HAXA 3RYHE 5AQKB 4ZI2C 4EEDA 3QUJA 3SWHA 1YKEB 2LSYA 2W66A 5JDQA 2WM9A 2DCFA 3MK7C 4PK5A 5CA1E 1YD8G 2A72A 4ISTA 3LFMA 4LF5T 2V6YA 5AQTB 1MNEA 1B7TA 3NRXA 3RKGA 4DV6T 3EAMA 4JEHB 4PNIA 1KK7A 4TWFA 4EZ4A 5FL0A 3KDSE 5JDLA 1N33T 2I59A 4M1PA 4ZI2D 4OK0A 2JQQA 2DL1A 5FKYA 4DIDB 4EZHA 1HNZT 1ZP0A 2YN6A 3KBUA 5DABA 4XBFB 3L09A 3MXZA 3ZKRA 3C4WA 4YT0A 2BKNA 3PU3A 2MAWA 2MYSA 1R8IA 2FJDA 2A2FX 2LLYA 2V7LA 2WZHA 2Y48B 2VKOA 3AE4A 4IE5A 2ZLYA 3FZKB 5EK3A 5AQRB 3RPUA 4A97A 3RQUA 1T98A 4CN1A 2ES0A 1NEKA 1LVFA 3UFEA 2LRKA 4U33A 2IAKA 4HFHA 2LT3A 4YHHT 1UUSA 3ABVA 3PURA 1WR0A 2V6XA 4TNVA 3RX6A 3UT5E 5L3BB 3CPZA 1WRDA 3AECA 1JNZA 2VKDA 1FMWA 2NWBA 4HE8A 5AFUL 2IC6A 4DR4T 2NR4A 2K3WA 3N2GE 1D1CA 3SRZA 1OEDB 4KP3C 3HKEE 3RHWA 3S4UA 5C3JA 5E0OA 3RC8A 4KI0F 2CRBA 3WI3A 4HGAA 5LOVE 4NXMT 1MNDA 1OXZA 4X62T 3EDVA 3LBXB 4DUZT 2XQ3A 5H6QB 4I50E 4EEBA 4X66T 3M3ZB 2KXPB 3P4QA 1ZEEA 5IUXA 2W00A 3PUZF 4IL4A 4H63V 2LSJA 3ONXA 3V5UA 4YY3T 3PUWF 5KXJA 5IWAT 3H3MA 4AQFA 1IBMT 4OX9T 3VKHA 5FL1A 2CBJA 3PUGA 4O4JE 1KNZA 2CLYB 2XM1A 3RIUC 3NRYA 4HFCA 1ZKEA 3KBTA 3LK3B 2MTQA 4HFIA 2J4GA 4AISA 2K48A 4PAGA 4YLHA 3K1SA 3MJXA 4BJNA 4X20E 3UU3A 3AE1A 3PDYA 3NBXX 2BG9E 5DQVA 4DR7T 4G63A 4HEAA 1E7PA 3RI5A 2LEHA 5LJMA 1IZNB 3VHLA 3O9XA 4AI6A 2CXLA 2FJBA 1ZHCA 3PUXF 5LGUB 3B13A 4B3TT 2NOXA 1O3XA 1H7CA 2CBIA 1MMNA 3AVSA 3FBZA 3GA8A 2RA1A 4X64T 4UR9A 3BK9A 3OKQA 5F3JA 5JDMA 2Q9QA 5LBMA 4ILBA 4UVBB 1W09A 4U7YA 2WP9A 2B76A 4PW8A 1J5WA 5HXEA 3CMLA 5IHYA 2X68A 2WQYA 4ANJA 5HCMA 5KMGP 2ZM0A 2L8KA 3AEGA 5ABHA 3WAJA 1VCTA 4DUYT 2E5VA 2XQAA 1EZ3A 4O4IE 4JYAT 3K8PC 2OA5A 3KINB 4X1KE 2MBGA 3VKGA 3BQIA 2L3LA 3SS1A 4F6RC 2SPCA 5AQFB 1MMDA 1IBLT 2LM2A 2YDSA 1FIOA 3C50A 5FY7A 5LP6E 2X51A 2BG9A 4U31A 4AQGA 4PK4A 2V5DA 2X66A 4WNKA 5F8PA 4JUYA 3KV4A 2WMOA 5AQMB 2NTXA 3HI2A 3GN5A 4QXBB 5AQPB 5FNVE 5HXRA 3WAKA 4LFCT 3ZMZB 3OJAA 3DJBA 5TAOA 2X9HA 1BR2A 2H7VC 2WDVA 3PJAA 2BKOA 4HWCA 4IL9A 2V7JA 5BMVE 3QK6A 2VKJA 2XQ6A 4NPPA 1KF6A 4JI0T 2DHRA 3ZJ1A 2WZIA 4GYRA 3AA1B 3C4XA 3AAIA 4TWDA 2LKHA 3R6NA 5HEGA 3ZYLA 1D0ZA 4JI1T 5LMNT 3VRBA 2CLYC 4HWFA 2WU5A 1N36T 2XAFB 3P8CD 2IW5B 5HXCA 5CA0E 4CN4A 3F57A 2J62A 4LFAT 5FY0A 2W61A 4YJ3E 1WR6A 1DU2A 4HWDA 1Y01A 2BKPA 5DQWA 2D0TA 2JMKA 2QVAA 4UF0B 3HL6A 1FEWA 4KMCA 4JLEA 2IC9A 4JI6T 1QLBA 1I6ZA 2BS4A 2W0GA 4HKAA 2OV9A 4IT4A 4WZXA 5JDFA 3P4RA 3RF1A 3RH3A 5FVKA 3RC3A 2XUEA 2C5IT 3GWHA 3K3OA 3Q5DA 4DV1T 4CXYA 3AA7B 4L0RA 4MALA 2I6HA 4AKGA 3KV5A 2H89A 1YW0A 5EK2A
chains in the Genus database with same CATH topology
3A7MA 3H3MA 3NKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7M A;  3H3M A;  3NKZ A; 
#chains in the Genus database with same CATH topology
 4WBN E;  3VRA A;  5L4E A;  1HR0 T;  4ZI3 C;  1SE7 A;  3UUB A;  1YQ3 A;  4JI3 T;  1Z8U A;  4UV9 B;  1XWM A;  4YTM A;  2YDR A;  5AQN B;  1WCR A;  1HG2 A;  2W67 A;  3RKO A;  4ADZ A;  3FB2 A;  2VL8 A;  5FXW A;  3ETV A;  4LF9 T;  1N34 T;  2XAH B;  4WW0 A;  2WB5 A;  5FP3 A;  3IBP A;  3H37 A;  2J1D G;  3NWI A;  4QWN B;  1D1B A;  3ZT6 A;  1IJ6 A;  2V8S V;  4TV8 E;  3OTO T;  4UEM A;  5FXZ A;  1SA0 E;  2JRK A;  1SUM B;  5AQG B;  2XZE A;  3P4P A;  1UX4 A;  2V5C A;  1XDP A;  3IHR A;  2LSK A;  2YU1 A;  3KFW X;  3MZK B;  4I0U A;  2DLR A;  3RLF F;  1U5P A;  2BDE A;  4A56 A;  2Z6E A;  4J2C A;  2FBW A;  3RRW A;  5JRE A;  5LCY A;  4JI7 T;  2XAQ B;  4KHP T;  4AKI A;  4QX8 B;  4ZS2 A;  4TN7 B;  1BR1 A;  2CWY A;  4GK5 E;  4ZI7 E;  5L2L A;  1HS7 A;  1XDO A;  1OWA A;  1UK5 A;  2BBH A;  3H3A A;  4GYS A;  3UU8 A;  1KNR A;  3AE2 A;  5HEU A;  4DBR A;  4EGW A;  1NEN A;  4TX5 A;  3ZN1 B;  4ZEY A;  2XQ7 A;  3CWZ B;  1T8B A;  1AJ3 A;  2LJL A;  2XQ5 A;  5AQV B;  2V1D B;  3ZEF B;  4GK0 E;  3C4Z A;  4DO0 A;  4IDP A;  4X1I E;  1FMV A;  3EVY A;  3I9Y A;  3LK4 2;  3P4S A;  1I94 T;  1M7K A;  1G8X A;  1D0X A;  3EUH A;  3A5X A;  3FZL B;  3P7I A;  3SFD A;  3C51 A;  5HEH A;  5JVD E;  3HR0 A;  3LSV A;  4EOZ B;  2LOP A;  2F4V T;  2UXD T;  1UGO A;  5LA6 E;  4IGU A;  4OFZ A;  5LJN A;  2FJE A;  5AQU B;  2UUB T;  3QNU A;  4U2Z A;  5M4Y A;  5AQS B;  4QHO A;  3NZP A;  5LHG B;  2UXC T;  2V6Y B;  2ACX A;  4UVA B;  3BQL A;  4LMJ A;  4QXC B;  2WWV A;  3UFG A;  3FXD B;  1QUU A;  4B3S T;  1VOM A;  2JMH A;  2D5U A;  2KWI B;  2XAG B;  2ZMA A;  1D1A A;  2KWH A;  4IE4 A;  4PFP A;  3AEB A;  1ZV4 X;  3ONL C;  2OLT A;  4X1Y E;  4YTN A;  4ERR A;  3CQG B;  5BR8 T;  3HKC E;  5L3E B;  4TV9 E;  2D0U A;  3FHN A;  2BG9 C;  3N9L A;  4LF6 T;  1MMG A;  2VVS A;  2LHR A;  3IF8 B;  3O4X E;  4Z91 A;  5FVL A;  4EYY R;  2E2A A;  2WWU A;  3VR9 A;  4DR6 T;  2JIW A;  2AE9 A;  3UQ7 A;  2J47 A;  2LKG A;  3RRC A;  5AQH B;  3DTO A;  3B5M A;  2NP9 A;  3M65 A;  2ACZ A;  4H9P C;  3QB5 K;  4LMK A;  3AEF A;  4WYV A;  3ZYK A;  5JDH A;  5JH7 E;  1HNW T;  3CX7 B;  2JQ9 A;  4O2A E;  4WBO A;  3AB3 B;  2VWA A;  2XQ4 A;  4NUV A;  2M6I A;  3RIA A;  3RYC E;  1J5E T;  5HCJ A;  2WBL A;  3ZPO A;  4DR5 T;  4I55 E;  3N9Q A;  4V1A v;  4Z8X A;  2CCQ A;  2IDO B;  4KUM B;  3O1J A;  1HX8 A;  1UUR A;  1Y64 B;  4TWH A;  5ABE A;  4DV2 T;  4U74 A;  3Q2M A;  3FXE B;  3A8Y C;  3IA3 A;  4QH5 A;  4O2B E;  3SOL A;  4KX6 A;  2V7K A;  4BJM A;  1ZOY A;  5AQI B;  3PUQ A;  5L3C B;  5J2U E;  5CJ5 A;  1U4Q A;  2MOZ A;  5LGT B;  2VQE T;  4AQY T;  1MIV A;  4OYK A;  3AE6 A;  3NVO A;  1T7S A;  4HWI B;  2W4X A;  2XY8 B;  4P0B A;  2FJA A;  2KND A;  3DP7 A;  4AKR B;  1BR4 A;  3LBX A;  2CXF A;  2HH7 A;  2QA7 A;  4TUY E;  3AE5 A;  5HEO A;  4ZS3 A;  2BS3 A;  5HXH A;  3UUN A;  1HG5 A;  3K3Q C;  3ZT5 A;  3JCF A;  3SFE A;  1HX1 B;  2HHH T;  1WLX A;  1KEY A;  2M67 A;  4QH4 A;  2CHN A;  2VB6 A;  4YSZ A;  4JI4 T;  2PJQ A;  1S94 A;  1CUN A;  1LKX A;  2VKH A;  4X65 T;  3EI0 A;  2M6B A;  5EK4 A;  2LOS A;  5FYM A;  5JRC B;  4IRE A;  4DMV A;  1M62 A;  2CXD A;  2UXX B;  2X9Y A;  4LML A;  2VVN A;  2YIN A;  2H7O A;  3Q5W A;  4XZC A;  3EAB A;  5F5W A;  1QSD A;  3AE3 A;  4IDZ A;  5LG3 A;  4H63 H;  5LMU T;  3GN5 B;  4UIG A;  4DR1 T;  2IUB A;  2GK9 A;  5LNK A;  3AE9 A;  4H9O C;  2YDQ A;  2XJ7 A;  5FMN A;  4CXX A;  3VR8 A;  4DR3 T;  3CKD A;  4FJO A;  5LBQ B;  3FZF B;  3AXJ A;  3E0Z A;  3I1A A;  3P4W A;  4QKN A;  2H88 A;  4ILU A;  2X67 A;  2CEA A;  4BA9 A;  3T1Y T;  2UU9 T;  3UUL A;  4DND A;  4DV4 T;  4CN6 A;  4ZZC A;  3PUV F;  1JNR A;  3ONJ A;  2KZ7 B;  4JEU B;  2E5L T;  2AXD S;  3CVR A;  3MKD A;  2UXN B;  3QB5 A;  5LB7 B;  4AKH A;  3N9M A;  3AVR A;  2C0S A;  3ETU A;  3ZSS A;  1WYB A;  2XPK A;  5C8Y E;  3ZMT B;  4CZZ B;  5JTG A;  5JQG E;  4O4H E;  5JR9 B;  2IHR 1;  2HN2 A;  4HTE A;  1VCS A;  4YSY A;  4JV5 T;  2QGS A;  2V7I A;  1W0A A;  2LE8 A;  3AXJ B;  4I4T E;  4H9N C;  5AQQ B;  1LVK A;  2N1G A;  3ANW B;  4I43 B;  4ZXL A;  2JJ9 A;  5JR9 A;  4ZHQ E;  5JR9 C;  5L3G B;  5C2T A;  3AE7 A;  2CHO A;  3OYZ A;  4QXH B;  1MMA A;  3ESL A;  3TLS A;  4ASK A;  2CE7 A;  1OED C;  2W63 A;  2WDR A;  2KMF A;  3ANW A;  4HFE A;  2QYW A;  4UV8 B;  3TLU A;  5KX5 E;  4DR2 T;  3X1D A;  1T72 A;  2KIN B;  2KT9 A;  4HN9 A;  5CB4 E;  4U7I A;  3PTR B;  3AAE B;  4PJN A;  2H3R A;  2YK0 A;  2YU2 A;  3P50 A;  5AQJ B;  3PUS A;  5AQL B;  3ZMU B;  3UUM A;  3ZMS B;  4BAY B;  4CQI A;  4IDN A;  3F2E A;  3L39 A;  4HFV A;  1IBK T;  3ZN0 B;  3JC6 D;  2DWG A;  3B57 A;  3O1H A;  3C98 B;  3Q9D A;  5LYJ E;  3OYX A;  2VUR A;  1E1H B;  4LF7 T;  2B1E A;  2DWK A;  3U78 A;  3J9X 1;  1E2A A;  2XSB A;  4COF A;  5J0Z A;  4DV5 T;  1YQ4 A;  2CWO A;  4B6X A;  1HNX T;  2JQH A;  4AIU A;  4KHZ F;  2PG8 A;  4EXT A;  4ILA A;  4EYU A;  1US7 B;  4YJ2 E;  5ABF A;  5HYA A;  2XQY A;  4L9I A;  2HN1 A;  4NXN T;  3AAA B;  4TZ4 C;  4H9R C;  5GON E;  4ZOL E;  2WSS V;  4DBQ A;  2V26 A;  3N2O A;  4YFS A;  2VQF T;  2XQ8 A;  2X9W A;  2C5J A;  3RGL A;  4O8S A;  3RQW A;  1Z0P A;  3V5S A;  1KNP A;  1UCU A;  3N9N A;  4EV6 A;  2N2N A;  4UVC B;  3UQ4 A;  2E9X B;  3EDU A;  2G0U A;  2K24 A;  3JAE A;  3PV0 F;  3KV9 A;  2VK9 A;  2Y6X A;  2R6G F;  3TLT A;  2XM2 A;  2DI4 A;  5ADX L;  4LF8 T;  4DV3 T;  1SHZ C;  4O4L E;  4L5G A;  1KFY A;  4MFR A;  4H9S E;  2VAS A;  3UU4 A;  2LM9 A;  1FJG T;  3ZCJ A;  4A98 A;  1NAF A;  4PK6 A;  5LXT E;  4TNW A;  3J7Y q;  1HF8 A;  2K9A A;  5IYZ E;  3VU7 H;  3KV6 A;  5FY1 A;  3PUA A;  1HCI A;  4B3M T;  4ZZB A;  2BS2 A;  2MPK A;  3AE8 A;  4HFB A;  1XZY A;  2CMR A;  2A3D A;  3N2K E;  2VL0 A;  4CXW A;  1XMO T;  3TLW A;  4CI1 B;  2I0M A;  3Q5E A;  4AQF C;  2Y8D A;  4MLK A;  3UUX B;  4Q25 A;  2WS3 A;  3E08 A;  3LG7 A;  2KSR A;  3FBL A;  2YEV C;  4LF4 T;  2ZM2 A;  4UF0 A;  2XHE B;  3U3I A;  2L9Q A;  2PTF A;  3HA4 A;  4IE0 A;  4DMW A;  4YXD A;  3CIR A;  4K0K T;  2UUC T;  3RYI E;  4A5X A;  3L8R A;  4DV7 T;  2XSA A;  2ODV A;  4H9Q C;  4ISS A;  4FI5 A;  2BBJ A;  4DVD A;  3T8O A;  1S35 A;  1LRZ A;  2LRL A;  3PU8 A;  4YSX A;  3L3P A;  3CQX C;  1W0B A;  4DV0 T;  2WU2 A;  4JBW F;  2D2S A;  2YOE A;  3W15 B;  4YTP A;  2YKS A;  3HKB E;  3ZJ2 A;  1J1J A;  5HXS A;  4U3C A;  4GOU A;  4E7Z A;  2CA5 A;  3PJA J;  2W2U A;  5CFB A;  2PFV A;  4UEL A;  1XNR T;  3CQC B;  3PE0 A;  2X0Y A;  5LHI B;  1BR0 A;  4F8H A;  5LGN B;  2D9D A;  2NTY A;  1VRB A;  3OPC A;  4P1N A;  4CI2 B;  3I0Q A;  3N5L A;  4C90 A;  3ZYM A;  2X0L B;  2WDQ A;  2X9X A;  2LSG A;  2WY2 A;  3AA0 B;  3NZQ A;  5FXV A;  5ABG A;  3TKL B;  2HPL A;  2HPJ A;  4JI2 T;  1W9R A;  4X5T A;  4U2Y A;  4NIQ A;  3ZC0 A;  3G06 A;  3N9O A;  4MHC A;  4AXP A;  1NWM X;  4PJL A;  1N32 T;  2BG9 B;  4IE6 A;  2RPA A;  3AA6 B;  4U72 A;  1OED E;  1MIW A;  3AEE A;  4PFO A;  5J2T E;  2LSI A;  2ZM6 T;  1IAP A;  3O1I A;  4G2A A;  5A1L A;  2UXB T;  3RIU A;  2WAU A;  5L3D B;  2FUP A;  4OHF A;  3FZM B;  2BZB A;  5EZY E;  2BVL A;  2K5B B;  1L0V A;  3D0T A;  4YHJ A;  1V9D A;  1WFD A;  4C91 A;  2C5K T;  4ILC A;  3F31 A;  3QOF A;  5ETW A;  2NW8 A;  3ZC1 A;  1OED A;  5HEJ A;  1GQE A;  3AED A;  3MA9 A;  3JAD A;  4HFD A;  4PJM A;  1YXR A;  5LG4 A;  2UUA T;  4KBM B;  1D0Y A;  2EHO B;  2XAS B;  5L4H A;  2PBI A;  5FXX A;  5AQO B;  1WYC A;  4JI5 T;  2E9X A;  3BQK A;  2N9D A;  4OYJ A;  4PJJ A;  5H6R B;  1XNQ T;  4QX7 B;  2Q9Q C;  4IDQ A;  3T1H T;  3LK2 B;  4LFB T;  2EHO A;  4EIW A;  2QRX A;  5L3F B;  1IJ5 A;  2JQK A;  4GKJ T;  5L47 A;  5JRC A;  4IE7 A;  3UTK A;  3I0O A;  2NW7 A;  5JDN A;  2EHO D;  3K3N A;  2RP4 A;  1X79 A;  4NUU A;  2ZM8 A;  4GKK T;  4IHJ E;  3LJC A;  2X0H A;  4Z90 A;  3UU5 A;  3TLV A;  3NKZ A;  1HFA A;  1UX5 A;  2IML A;  3ZT7 A;  2Q9Q D;  4EAH A;  1G73 A;  3ZST A;  4P0A A;  1HTJ F;  3C64 A;  4CI3 B;  3Q5X A;  4IIJ E;  4E7S A;  3PUY F;  2E9X D;  2DNX A;  3CK6 A;  1CHU A;  3JAF A;  2XTL A;  2V7M A;  2XQ9 A;  3MAC A;  4MBQ A;  3ZCI A;  3RYF E;  1XMQ T;  2EHO C;  3GMI A;  3EHZ A;  4GIW A;  3R84 B;  5CGM A;  2W62 A;  3IEE A;  4B3R T;  3A7M A;  4HWH A;  2LHN A;  5HWY A;  2NW9 A;  2E8I A;  2Q9Q B;  2WCA A;  3ZMV B;  1X9B A;  5ABF B;  4XAX B;  5HWX A;  3KVA A;  3N9P A;  5KDM C;  2E9X C;  4K0U A;  3CX6 B;  4QH1 A;  2XAJ B;  3OVU A;  5LHH B;  2KLQ A;  2JPF A;  3LDQ B;  4IDO A;  1MIY A;  3AEA A;  3E22 E;  4N78 D;  3ZLI A;  1YKH B;  2WMN A;  2CM0 A;  4UXN B;  3RIF A;  3UU6 A;  4P09 A;  2BVM A;  5DJQ C;  4ZI3 D;  3HKD E;  3I9W A;  2IIU A;  2P9B A;  2A9U A;  3JC6 C;  3QC9 A;  5J1G A;  4AKL A;  2CPT A;  3CX8 B;  5JDG A;  4JI8 T;  3OBV E;  3KVB A;  2ODU A;  3FZH B;  4EB6 E;  5HAX A;  3RYH E;  5AQK B;  4ZI2 C;  4EED A;  3QUJ A;  3SWH A;  1YKE B;  2LSY A;  2W66 A;  5JDQ A;  2WM9 A;  2DCF A;  3MK7 C;  4PK5 A;  5CA1 E;  1YD8 G;  2A72 A;  4IST A;  3LFM A;  4LF5 T;  2V6Y A;  5AQT B;  1MNE A;  1B7T A;  3NRX A;  3RKG A;  4DV6 T;  3EAM A;  4JEH B;  4PNI A;  1KK7 A;  4TWF A;  4EZ4 A;  5FL0 A;  3KDS E;  5JDL A;  1N33 T;  2I59 A;  4M1P A;  4ZI2 D;  4OK0 A;  2JQQ A;  2DL1 A;  5FKY A;  4DID B;  4EZH A;  1HNZ T;  1ZP0 A;  2YN6 A;  3KBU A;  5DAB A;  4XBF B;  3L09 A;  3MXZ A;  3ZKR A;  3C4W A;  4YT0 A;  2BKN A;  3PU3 A;  2MAW A;  2MYS A;  1R8I A;  2FJD A;  2A2F X;  2LLY A;  2V7L A;  2WZH A;  2Y48 B;  2VKO A;  3AE4 A;  4IE5 A;  2ZLY A;  3FZK B;  5EK3 A;  5AQR B;  3RPU A;  4A97 A;  3RQU A;  1T98 A;  4CN1 A;  2ES0 A;  1NEK A;  1LVF A;  3UFE A;  2LRK A;  4U33 A;  2IAK A;  4HFH A;  2LT3 A;  4YHH T;  1UUS A;  3ABV A;  3PUR A;  1WR0 A;  2V6X A;  4TNV A;  3RX6 A;  3UT5 E;  5L3B B;  3CPZ A;  1WRD A;  3AEC A;  1JNZ A;  2VKD A;  1FMW A;  2NWB A;  4HE8 A;  5AFU L;  2IC6 A;  4DR4 T;  2NR4 A;  2K3W A;  3N2G E;  1D1C A;  3SRZ A;  1OED B;  4KP3 C;  3HKE E;  3RHW A;  3S4U A;  5C3J A;  5E0O A;  3RC8 A;  4KI0 F;  2CRB A;  3WI3 A;  4HGA A;  5LOV E;  4NXM T;  1MND A;  1OXZ A;  4X62 T;  3EDV A;  3LBX B;  4DUZ T;  2XQ3 A;  5H6Q B;  4I50 E;  4EEB A;  4X66 T;  3M3Z B;  2KXP B;  3P4Q A;  1ZEE A;  5IUX A;  2W00 A;  3PUZ F;  4IL4 A;  4H63 V;  2LSJ A;  3ONX A;  3V5U A;  4YY3 T;  3PUW F;  5KXJ A;  5IWA T;  3H3M A;  4AQF A;  1IBM T;  4OX9 T;  3VKH A;  5FL1 A;  2CBJ A;  3PUG A;  4O4J E;  1KNZ A;  2CLY B;  2XM1 A;  3RIU C;  3NRY A;  4HFC A;  1ZKE A;  3KBT A;  3LK3 B;  2MTQ A;  4HFI A;  2J4G A;  4AIS A;  2K48 A;  4PAG A;  4YLH A;  3K1S A;  3MJX A;  4BJN A;  4X20 E;  3UU3 A;  3AE1 A;  3PDY A;  3NBX X;  2BG9 E;  5DQV A;  4DR7 T;  4G63 A;  4HEA A;  1E7P A;  3RI5 A;  2LEH A;  5LJM A;  1IZN B;  3VHL A;  3O9X A;  4AI6 A;  2CXL A;  2FJB A;  1ZHC A;  3PUX F;  5LGU B;  3B13 A;  4B3T T;  2NOX A;  1O3X A;  1H7C A;  2CBI A;  1MMN A;  3AVS A;  3FBZ A;  3GA8 A;  2RA1 A;  4X64 T;  4UR9 A;  3BK9 A;  3OKQ A;  5F3J A;  5JDM A;  2Q9Q A;  5LBM A;  4ILB A;  4UVB B;  1W09 A;  4U7Y A;  2WP9 A;  2B76 A;  4PW8 A;  1J5W A;  5HXE A;  3CML A;  5IHY A;  2X68 A;  2WQY A;  4ANJ A;  5HCM A;  5KMG P;  2ZM0 A;  2L8K A;  3AEG A;  5ABH A;  3WAJ A;  1VCT A;  4DUY T;  2E5V A;  2XQA A;  1EZ3 A;  4O4I E;  4JYA T;  3K8P C;  2OA5 A;  3KIN B;  4X1K E;  2MBG A;  3VKG A;  3BQI A;  2L3L A;  3SS1 A;  4F6R C;  2SPC A;  5AQF B;  1MMD A;  1IBL T;  2LM2 A;  2YDS A;  1FIO A;  3C50 A;  5FY7 A;  5LP6 E;  2X51 A;  2BG9 A;  4U31 A;  4AQG A;  4PK4 A;  2V5D A;  2X66 A;  4WNK A;  5F8P A;  4JUY A;  3KV4 A;  2WMO A;  5AQM B;  2NTX A;  3HI2 A;  3GN5 A;  4QXB B;  5AQP B;  5FNV E;  5HXR A;  3WAK A;  4LFC T;  3ZMZ B;  3OJA A;  3DJB A;  5TAO A;  2X9H A;  1BR2 A;  2H7V C;  2WDV A;  3PJA A;  2BKO A;  4HWC A;  4IL9 A;  2V7J A;  5BMV E;  3QK6 A;  2VKJ A;  2XQ6 A;  4NPP A;  1KF6 A;  4JI0 T;  2DHR A;  3ZJ1 A;  2WZI A;  4GYR A;  3AA1 B;  3C4X A;  3AAI A;  4TWD A;  2LKH A;  3R6N A;  5HEG A;  3ZYL A;  1D0Z A;  4JI1 T;  5LMN T;  3VRB A;  2CLY C;  4HWF A;  2WU5 A;  1N36 T;  2XAF B;  3P8C D;  2IW5 B;  5HXC A;  5CA0 E;  4CN4 A;  3F57 A;  2J62 A;  4LFA T;  5FY0 A;  2W61 A;  4YJ3 E;  1WR6 A;  1DU2 A;  4HWD A;  1Y01 A;  2BKP A;  5DQW A;  2D0T A;  2JMK A;  2QVA A;  4UF0 B;  3HL6 A;  1FEW A;  4KMC A;  4JLE A;  2IC9 A;  4JI6 T;  1QLB A;  1I6Z A;  2BS4 A;  2W0G A;  4HKA A;  2OV9 A;  4IT4 A;  4WZX A;  5JDF A;  3P4R A;  3RF1 A;  3RH3 A;  5FVK A;  3RC3 A;  2XUE A;  2C5I T;  3GWH A;  3K3O A;  3Q5D A;  4DV1 T;  4CXY A;  3AA7 B;  4L0R A;  4MAL A;  2I6H A;  4AKG A;  3KV5 A;  2H89 A;  1YW0 A;  5EK2 A; 
#chains in the Genus database with same CATH homology
 3A7M A;  3H3M A;  3NKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...