3H3RA

Crystal structure of the cert start domain in complex with hpa-14
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
b'GTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Goodpasture antigen binding protein
publication title Crystal structures of the CERT START domain with inhibitors provide insights into the mechanism of ceramide transfer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 63
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3h3rA00
2WQLA 2LCGA 1XDFA 3JRQB 3KAZA 1TW0A 2BK0A 5C9YA 3KB3A 2KEWA 2PSOA 3RT0C 4A8UA 5JO2A 3TVQA 2I9YA 4MNSA 3H3QA 3KL1A 2E3MA 2L65A 4M9BA 4Z3LA 1XUVA 2K5GA 4IGXA 3PUTA 1KCMA 3Q64A 4JHHA 4A87A 3RD6A 4PSBA 2LIOA 2Q3QA 1VJHA 3K3KA 2MOUA 3H3SA 4REJA 4A83A 4IHRA 1UW5A 2REZA 3NS2A 5I8FA 5E4MA 2A1LA 2LEQA 4BK7A 1B6FA 4REIA 3KDHA 4MA6A 2E3PA 4JDLA 1Z94A 4XRTA 2LE1A 3NR4A 3PU2A 4GY9A 3NMTA 4RYVA 4A81A 3F08A 3QSZA 2LF2A 4IH0A 4WVOA 3H3TA 3ZVUA 3WG8A 5BRLA 1QMRA 3IE5A 5E4BA 4N0GC 2D4RA 2Z9ZA 3NI8A 4M9WA 4BKCA 4BKDA 4BTZA 2N4AA 4FPWA 1XFSA 1E09A 2K7HA 2E3OA 3RT2A 1LN2A 3ELIA 3KB0A 4LA7A 1XN5A 2N4BA 4A88A 3TL1A 3KAYA 4OICA 3UJLA 1TXCA 3GGNA 2EJXA 5JO1A 1LN1A 3UIDA 1FSKA 1JSSA 3W9RA 4C9CA 3Q63A 2PCSA 2RESA 4A8GA 2GKDA 2IL5A 2Z9YA 2QPVA 4DSCA 2VNEA 4A8VA 2KF2A 3CNWA 4JHIA 4DSBA 3NEGA 2NS9A 3KLXA 4Q0KA 3OTLA 2M89A 2NN5A 1H2OA 2M47A 3OQUA 2LGHA 3P9VA 4JHGA 3FO5A 2LPXA 3Q6AA 4IH2A 4BK6A 4R7KA 5AMWA 3NMPA 3UQHA 2RERA 4C9IA 4DS8A 3C0VA 3OH8A 5JNNA 3NEFA 4IGYA 2KTEA 2E3SA 3E85A 2LAKA 4QIPA 4XRWA 2FLHA 4Y31A 3NJOA 5E46A 1XN6A 2E3NA 3QN1A 4C94A 4A85A 3TFZA 4A80A 4B9RA 1LLTA 1BV1A 3NJ1A 3P51A 5E4DA 2LUZA 2L8OA 2LDKA 5I9JA 3NJ0A 3P0LA 4LG5A 3JRSA 3TVRA 2VQ5A 3NMHA 3IJTA 3KDJA 3KDIA 1LN3A 4IGWA 4REHA 4A86A 2E3RA 1IFVA 4IGVA 2QIMA 3NMNA 4MAPA 1ZXFA 1T17A 2KCZA 1X53A 3K90A 3OJIA 4LGBA 4A84A 3NMVA 3H3RA 4LGAA 2L9PA 1T27A 4JDAA 1EM2A 2FFSA 3R6PA 1BTVA 3W9KA 4N3EA 2E3QA 1ICXA 2R55A 1FM4A
chains in the Genus database with same CATH superfamily
2WQLA 2LCGA 1XDFA 3JRQB 3KAZA 1TW0A 2BK0A 5C9YA 3KB3A 2KEWA 2PSOA 3RT0C 4A8UA 5JO2A 3TVQA 2I9YA 4MNSA 3H3QA 3KL1A 2E3MA 2L65A 4M9BA 3HJFA 3GB4A 4Z3LA 1XUVA 4N47A 2K5GA 4IGXA 3PUTA 4KPYA 1KCMA 3Q64A 4JHHA 4A87A 3RD6A 4PSBA 2LIOA 2Q3QA 1VJHA 3K3KA 2MOUA 3H3SA 4REJA 4A83A 3HO1A 4IHRA 1UW5A 2REZA 3NS2A 5I8FA 4QDFA 2A1LA 2LEQA 5E4MA 4BK7A 1B6FA 4REIA 3KDHA 4MA6A 2E3PA 4JDLA 2ZYLA 1Z94A 4XRTA 2LE1A 3NQNA 3NR4A 3PU2A 4GY9A 3NMTA 4RYVA 4A81A 3F08A 3QSZA 2LF2A 4IH0A 4WVOA 3GTSA 3H3TA 3ZVUA 4NCBA 3WG8A 5BRLA 1QMRA 3IE5A 5E4BA 4N0GC 2D4RA 2Z9ZA 3F73A 3NI8A 4M9WA 4BKCA 4BKDA 4BTZA 3GOBA 2N4AA 3GTEA 4FPWA 1XFSA 1E09A 2K7HA 2E3OA 3RT2A 1LN2A 3ELIA 3KB0A 4LA7A 1XN5A 2N4BA 4A88A 3TL1A 3KAYA 4OICA 3UJLA 1TXCA 3GGNA 2EJXA 5JO1A 1LN1A 3UIDA 1FSKA 1JSSA 3W9RA 4C9CA 3DLBA 3Q63A 2PCSA 2RESA 4A8GA 2GKDA 2IL5A 2Z9YA 2QPVA 4DSCA 2VNEA 4A8VA 2KF2A 3DLHA 3HK2A 3CNWA 5EKQC 4E6FA 4JHIA 5I9JA 4DSBA 3NEGA 2NS9A 3KLXA 4Q0KA 3OTLA 2M89A 4QDDA 2NN5A 1H2OA 2M47A 3OQUA 2LGHA 3P9VA 4JHYA 4JHGA 3FO5A 2LPXA 3Q6AA 4IH2A 4BK6A 3HVRA 4R7KA 5AMWA 3NMPA 3UQHA 2RERA 4C9IA 4DS8A 4QDCA 3C0VA 3OH8A 5JNNA 3NEFA 4IGYA 4QDFB 2KTEA 2E3SA 2YH6A 3E85A 2LAKA 4QIPA 3GL0A 4XRWA 2FLHA 4Y31A 3NJOA 5E46A 1XN6A 2E3NA 3QN1A 4C94A 4A85A 3TFZA 4A80A 4B9RA 1LLTA 1BV1A 3NJ1A 3P51A 5E4DA 2LUZA 2L8OA 2LAFA 2LDKA 3NJ0A 3P0LA 3GKEA 3JRSA 4LG5A 3GL2A 2VQ5A 3TGOC 3NMHA 4QCKA 3IJTA 4NCAA 3KDJA 3KDIA 1LN3A 4IGWA 4REHA 4A86A 2E3RA 1IFVA 4IGVA 2QIMA 3NMNA 4MAPA 1ZXFA 3TVRA 1T17A 2KCZA 1X53A 3K90A 3OJIA 4LGBA 4A84A 3NMVA 3H3RA 4LGAA 2L9PA 3HXMA 3HM9A 1T27A 4JDAA 1EM2A 2FFSA 3R6PA 1BTVA 3W9KA 4N41A 4N3EA 2E3QA 4N76A 1ICXA 2R55A 1FM4A
chains in the Genus database with same CATH topology
2WQLA 2LCGA 1XDFA 3JRQB 3KAZA 1TW0A 2BK0A 5C9YA 3KB3A 2KEWA 2PSOA 3RT0C 4A8UA 5JO2A 3TVQA 2I9YA 4MNSA 3H3QA 3KL1A 2E3MA 2L65A 4M9BA 3HJFA 3GB4A 4Z3LA 1XUVA 4N47A 2K5GA 4IGXA 3PUTA 4KPYA 1KCMA 3Q64A 4JHHA 4A87A 3RD6A 4PSBA 2LIOA 2Q3QA 1VJHA 3K3KA 2MOUA 3H3SA 4REJA 4A83A 3HO1A 4IHRA 1UW5A 2REZA 3NS2A 5I8FA 4QDFA 2A1LA 2LEQA 5E4MA 4BK7A 1B6FA 4REIA 3KDHA 4MA6A 2E3PA 4JDLA 2ZYLA 1Z94A 4XRTA 2LE1A 3NQNA 3NR4A 3PU2A 4GY9A 3NMTA 4RYVA 4A81A 3F08A 3QSZA 2LF2A 4IH0A 4WVOA 3GTSA 3H3TA 3ZVUA 4NCBA 3WG8A 5BRLA 1QMRA 3IE5A 5E4BA 4N0GC 2D4RA 2Z9ZA 3F73A 3NI8A 4M9WA 4BKCA 4BKDA 4BTZA 3GOBA 2N4AA 3GTEA 4FPWA 1XFSA 1E09A 2K7HA 2E3OA 3RT2A 1LN2A 3ELIA 3KB0A 4LA7A 1XN5A 2N4BA 4A88A 3TL1A 3KAYA 4OICA 3UJLA 1TXCA 3GGNA 2EJXA 5JO1A 1LN1A 3UIDA 1FSKA 1JSSA 3W9RA 4C9CA 3DLBA 3Q63A 2PCSA 2RESA 4A8GA 2GKDA 2IL5A 2Z9YA 2QPVA 4DSCA 2VNEA 4A8VA 2KF2A 3DLHA 3HK2A 3CNWA 5EKQC 4E6FA 4JHIA 5I9JA 4DSBA 3NEGA 2NS9A 3KLXA 4Q0KA 3OTLA 2M89A 4QDDA 2NN5A 1H2OA 2M47A 3OQUA 2LGHA 3P9VA 4JHYA 4JHGA 3FO5A 2LPXA 3Q6AA 4IH2A 4BK6A 3HVRA 4R7KA 5AMWA 3NMPA 3UQHA 2RERA 4C9IA 4DS8A 4QDCA 3C0VA 3OH8A 5JNNA 3NEFA 4IGYA 4QDFB 2KTEA 2E3SA 2YH6A 3E85A 2LAKA 4QIPA 3GL0A 4XRWA 2FLHA 4Y31A 3NJOA 5E46A 1XN6A 2E3NA 3QN1A 4C94A 4A85A 3TFZA 4A80A 4B9RA 1LLTA 1BV1A 3NJ1A 3P51A 5E4DA 2LUZA 2L8OA 2LAFA 2LDKA 3NJ0A 3P0LA 3GKEA 3JRSA 4LG5A 3GL2A 2VQ5A 3TGOC 3NMHA 4QCKA 3IJTA 4NCAA 3KDJA 3KDIA 1LN3A 4IGWA 4REHA 4A86A 2E3RA 1IFVA 4IGVA 2QIMA 3NMNA 4MAPA 1ZXFA 3TVRA 1T17A 2KCZA 1X53A 3K90A 3OJIA 4LGBA 4A84A 3NMVA 3H3RA 4LGAA 2L9PA 3HXMA 3HM9A 1T27A 4JDAA 1EM2A 2FFSA 3R6PA 1BTVA 3W9KA 4N41A 4N3EA 2E3QA 4N76A 1ICXA 2R55A 1FM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQL A;  2LCG A;  1XDF A;  3JRQ B;  3KAZ A;  1TW0 A;  2BK0 A;  5C9Y A;  3KB3 A;  2KEW A;  2PSO A;  3RT0 C;  4A8U A;  5JO2 A;  3TVQ A;  2I9Y A;  4MNS A;  3H3Q A;  3KL1 A;  2E3M A;  2L65 A;  4M9B A;  4Z3L A;  1XUV A;  2K5G A;  4IGX A;  3PUT A;  1KCM A;  3Q64 A;  4JHH A;  4A87 A;  3RD6 A;  4PSB A;  2LIO A;  2Q3Q A;  1VJH A;  3K3K A;  2MOU A;  3H3S A;  4REJ A;  4A83 A;  4IHR A;  1UW5 A;  2REZ A;  3NS2 A;  5I8F A;  5E4M A;  2A1L A;  2LEQ A;  4BK7 A;  1B6F A;  4REI A;  3KDH A;  4MA6 A;  2E3P A;  4JDL A;  1Z94 A;  4XRT A;  2LE1 A;  3NR4 A;  3PU2 A;  4GY9 A;  3NMT A;  4RYV A;  4A81 A;  3F08 A;  3QSZ A;  2LF2 A;  4IH0 A;  4WVO A;  3H3T A;  3ZVU A;  3WG8 A;  5BRL A;  1QMR A;  3IE5 A;  5E4B A;  4N0G C;  2D4R A;  2Z9Z A;  3NI8 A;  4M9W A;  4BKC A;  4BKD A;  4BTZ A;  2N4A A;  4FPW A;  1XFS A;  1E09 A;  2K7H A;  2E3O A;  3RT2 A;  1LN2 A;  3ELI A;  3KB0 A;  4LA7 A;  1XN5 A;  2N4B A;  4A88 A;  3TL1 A;  3KAY A;  4OIC A;  3UJL A;  1TXC A;  3GGN A;  2EJX A;  5JO1 A;  1LN1 A;  3UID A;  1FSK A;  1JSS A;  3W9R A;  4C9C A;  3Q63 A;  2PCS A;  2RES A;  4A8G A;  2GKD A;  2IL5 A;  2Z9Y A;  2QPV A;  4DSC A;  2VNE A;  4A8V A;  2KF2 A;  3CNW A;  4JHI A;  4DSB A;  3NEG A;  2NS9 A;  3KLX A;  4Q0K A;  3OTL A;  2M89 A;  2NN5 A;  1H2O A;  2M47 A;  3OQU A;  2LGH A;  3P9V A;  4JHG A;  3FO5 A;  2LPX A;  3Q6A A;  4IH2 A;  4BK6 A;  4R7K A;  5AMW A;  3NMP A;  3UQH A;  2RER A;  4C9I A;  4DS8 A;  3C0V A;  3OH8 A;  5JNN A;  3NEF A;  4IGY A;  2KTE A;  2E3S A;  3E85 A;  2LAK A;  4QIP A;  4XRW A;  2FLH A;  4Y31 A;  3NJO A;  5E46 A;  1XN6 A;  2E3N A;  3QN1 A;  4C94 A;  4A85 A;  3TFZ A;  4A80 A;  4B9R A;  1LLT A;  1BV1 A;  3NJ1 A;  3P51 A;  5E4D A;  2LUZ A;  2L8O A;  2LDK A;  5I9J A;  3NJ0 A;  3P0L A;  4LG5 A;  3JRS A;  3TVR A;  2VQ5 A;  3NMH A;  3IJT A;  3KDJ A;  3KDI A;  1LN3 A;  4IGW A;  4REH A;  4A86 A;  2E3R A;  1IFV A;  4IGV A;  2QIM A;  3NMN A;  4MAP A;  1ZXF A;  1T17 A;  2KCZ A;  1X53 A;  3K90 A;  3OJI A;  4LGB A;  4A84 A;  3NMV A;  3H3R A;  4LGA A;  2L9P A;  1T27 A;  4JDA A;  1EM2 A;  2FFS A;  3R6P A;  1BTV A;  3W9K A;  4N3E A;  2E3Q A;  1ICX A;  2R55 A;  1FM4 A; 
#chains in the Genus database with same CATH topology
 2WQL A;  2LCG A;  1XDF A;  3JRQ B;  3KAZ A;  1TW0 A;  2BK0 A;  5C9Y A;  3KB3 A;  2KEW A;  2PSO A;  3RT0 C;  4A8U A;  5JO2 A;  3TVQ A;  2I9Y A;  4MNS A;  3H3Q A;  3KL1 A;  2E3M A;  2L65 A;  4M9B A;  3HJF A;  3GB4 A;  4Z3L A;  1XUV A;  4N47 A;  2K5G A;  4IGX A;  3PUT A;  4KPY A;  1KCM A;  3Q64 A;  4JHH A;  4A87 A;  3RD6 A;  4PSB A;  2LIO A;  2Q3Q A;  1VJH A;  3K3K A;  2MOU A;  3H3S A;  4REJ A;  4A83 A;  3HO1 A;  4IHR A;  1UW5 A;  2REZ A;  3NS2 A;  5I8F A;  4QDF A;  2A1L A;  2LEQ A;  5E4M A;  4BK7 A;  1B6F A;  4REI A;  3KDH A;  4MA6 A;  2E3P A;  4JDL A;  2ZYL A;  1Z94 A;  4XRT A;  2LE1 A;  3NQN A;  3NR4 A;  3PU2 A;  4GY9 A;  3NMT A;  4RYV A;  4A81 A;  3F08 A;  3QSZ A;  2LF2 A;  4IH0 A;  4WVO A;  3GTS A;  3H3T A;  3ZVU A;  4NCB A;  3WG8 A;  5BRL A;  1QMR A;  3IE5 A;  5E4B A;  4N0G C;  2D4R A;  2Z9Z A;  3F73 A;  3NI8 A;  4M9W A;  4BKC A;  4BKD A;  4BTZ A;  3GOB A;  2N4A A;  3GTE A;  4FPW A;  1XFS A;  1E09 A;  2K7H A;  2E3O A;  3RT2 A;  1LN2 A;  3ELI A;  3KB0 A;  4LA7 A;  1XN5 A;  2N4B A;  4A88 A;  3TL1 A;  3KAY A;  4OIC A;  3UJL A;  1TXC A;  3GGN A;  2EJX A;  5JO1 A;  1LN1 A;  3UID A;  1FSK A;  1JSS A;  3W9R A;  4C9C A;  3DLB A;  3Q63 A;  2PCS A;  2RES A;  4A8G A;  2GKD A;  2IL5 A;  2Z9Y A;  2QPV A;  4DSC A;  2VNE A;  4A8V A;  2KF2 A;  3DLH A;  3HK2 A;  3CNW A;  5EKQ C;  4E6F A;  4JHI A;  5I9J A;  4DSB A;  3NEG A;  2NS9 A;  3KLX A;  4Q0K A;  3OTL A;  2M89 A;  4QDD A;  2NN5 A;  1H2O A;  2M47 A;  3OQU A;  2LGH A;  3P9V A;  4JHY A;  4JHG A;  3FO5 A;  2LPX A;  3Q6A A;  4IH2 A;  4BK6 A;  3HVR A;  4R7K A;  5AMW A;  3NMP A;  3UQH A;  2RER A;  4C9I A;  4DS8 A;  4QDC A;  3C0V A;  3OH8 A;  5JNN A;  3NEF A;  4IGY A;  4QDF B;  2KTE A;  2E3S A;  2YH6 A;  3E85 A;  2LAK A;  4QIP A;  3GL0 A;  4XRW A;  2FLH A;  4Y31 A;  3NJO A;  5E46 A;  1XN6 A;  2E3N A;  3QN1 A;  4C94 A;  4A85 A;  3TFZ A;  4A80 A;  4B9R A;  1LLT A;  1BV1 A;  3NJ1 A;  3P51 A;  5E4D A;  2LUZ A;  2L8O A;  2LAF A;  2LDK A;  3NJ0 A;  3P0L A;  3GKE A;  3JRS A;  4LG5 A;  3GL2 A;  2VQ5 A;  3TGO C;  3NMH A;  4QCK A;  3IJT A;  4NCA A;  3KDJ A;  3KDI A;  1LN3 A;  4IGW A;  4REH A;  4A86 A;  2E3R A;  1IFV A;  4IGV A;  2QIM A;  3NMN A;  4MAP A;  1ZXF A;  3TVR A;  1T17 A;  2KCZ A;  1X53 A;  3K90 A;  3OJI A;  4LGB A;  4A84 A;  3NMV A;  3H3R A;  4LGA A;  2L9P A;  3HXM A;  3HM9 A;  1T27 A;  4JDA A;  1EM2 A;  2FFS A;  3R6P A;  1BTV A;  3W9K A;  4N41 A;  4N3E A;  2E3Q A;  4N76 A;  1ICX A;  2R55 A;  1FM4 A; 
#chains in the Genus database with same CATH homology
 2WQL A;  2LCG A;  1XDF A;  3JRQ B;  3KAZ A;  1TW0 A;  2BK0 A;  5C9Y A;  3KB3 A;  2KEW A;  2PSO A;  3RT0 C;  4A8U A;  5JO2 A;  3TVQ A;  2I9Y A;  4MNS A;  3H3Q A;  3KL1 A;  2E3M A;  2L65 A;  4M9B A;  3HJF A;  3GB4 A;  4Z3L A;  1XUV A;  4N47 A;  2K5G A;  4IGX A;  3PUT A;  4KPY A;  1KCM A;  3Q64 A;  4JHH A;  4A87 A;  3RD6 A;  4PSB A;  2LIO A;  2Q3Q A;  1VJH A;  3K3K A;  2MOU A;  3H3S A;  4REJ A;  4A83 A;  3HO1 A;  4IHR A;  1UW5 A;  2REZ A;  3NS2 A;  5I8F A;  4QDF A;  2A1L A;  2LEQ A;  5E4M A;  4BK7 A;  1B6F A;  4REI A;  3KDH A;  4MA6 A;  2E3P A;  4JDL A;  2ZYL A;  1Z94 A;  4XRT A;  2LE1 A;  3NQN A;  3NR4 A;  3PU2 A;  4GY9 A;  3NMT A;  4RYV A;  4A81 A;  3F08 A;  3QSZ A;  2LF2 A;  4IH0 A;  4WVO A;  3GTS A;  3H3T A;  3ZVU A;  4NCB A;  3WG8 A;  5BRL A;  1QMR A;  3IE5 A;  5E4B A;  4N0G C;  2D4R A;  2Z9Z A;  3F73 A;  3NI8 A;  4M9W A;  4BKC A;  4BKD A;  4BTZ A;  3GOB A;  2N4A A;  3GTE A;  4FPW A;  1XFS A;  1E09 A;  2K7H A;  2E3O A;  3RT2 A;  1LN2 A;  3ELI A;  3KB0 A;  4LA7 A;  1XN5 A;  2N4B A;  4A88 A;  3TL1 A;  3KAY A;  4OIC A;  3UJL A;  1TXC A;  3GGN A;  2EJX A;  5JO1 A;  1LN1 A;  3UID A;  1FSK A;  1JSS A;  3W9R A;  4C9C A;  3DLB A;  3Q63 A;  2PCS A;  2RES A;  4A8G A;  2GKD A;  2IL5 A;  2Z9Y A;  2QPV A;  4DSC A;  2VNE A;  4A8V A;  2KF2 A;  3DLH A;  3HK2 A;  3CNW A;  5EKQ C;  4E6F A;  4JHI A;  5I9J A;  4DSB A;  3NEG A;  2NS9 A;  3KLX A;  4Q0K A;  3OTL A;  2M89 A;  4QDD A;  2NN5 A;  1H2O A;  2M47 A;  3OQU A;  2LGH A;  3P9V A;  4JHY A;  4JHG A;  3FO5 A;  2LPX A;  3Q6A A;  4IH2 A;  4BK6 A;  3HVR A;  4R7K A;  5AMW A;  3NMP A;  3UQH A;  2RER A;  4C9I A;  4DS8 A;  4QDC A;  3C0V A;  3OH8 A;  5JNN A;  3NEF A;  4IGY A;  4QDF B;  2KTE A;  2E3S A;  2YH6 A;  3E85 A;  2LAK A;  4QIP A;  3GL0 A;  4XRW A;  2FLH A;  4Y31 A;  3NJO A;  5E46 A;  1XN6 A;  2E3N A;  3QN1 A;  4C94 A;  4A85 A;  3TFZ A;  4A80 A;  4B9R A;  1LLT A;  1BV1 A;  3NJ1 A;  3P51 A;  5E4D A;  2LUZ A;  2L8O A;  2LAF A;  2LDK A;  3NJ0 A;  3P0L A;  3GKE A;  3JRS A;  4LG5 A;  3GL2 A;  2VQ5 A;  3TGO C;  3NMH A;  4QCK A;  3IJT A;  4NCA A;  3KDJ A;  3KDI A;  1LN3 A;  4IGW A;  4REH A;  4A86 A;  2E3R A;  1IFV A;  4IGV A;  2QIM A;  3NMN A;  4MAP A;  1ZXF A;  3TVR A;  1T17 A;  2KCZ A;  1X53 A;  3K90 A;  3OJI A;  4LGB A;  4A84 A;  3NMV A;  3H3R A;  4LGA A;  2L9P A;  3HXM A;  3HM9 A;  1T27 A;  4JDA A;  1EM2 A;  2FFS A;  3R6P A;  1BTV A;  3W9K A;  4N41 A;  4N3E A;  2E3Q A;  4N76 A;  1ICX A;  2R55 A;  1FM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...