3H3SA

Crystal structure of the cert start domain in complex with hpa-15
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
b'GTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Goodpasture antigen binding protein
publication title Crystal structures of the CERT START domain with inhibitors provide insights into the mechanism of ceramide transfer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 63
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3h3sA00
3NMPA 2QPVA 3KB3A 4A80A 2L65A 2KEWA 4BTZA 2N4BA 1VJHA 3JRSA 3H3RA 3TVRA 3QN1A 4Y31A 4REJA 4JDAA 4C94A 1X53A 3KDHA 2A1LA 4JHGA 2KCZA 1BTVA 2Q3QA 4IH0A 3H3QA 1FSKA 1ZXFA 2E3OA 2VNEA 3KAYA 4LGBA 1LN1A 4XRWA 3ELIA 4BKCA 1E09A 1IFVA 1KCMA 3PU2A 3H3TA 3ZVUA 4DSCA 4N3EA 2R55A 2L9PA 2LIOA 3K90A 3K3KA 4JDLA 3UQHA 1UW5A 4LA7A 2KTEA 4M9WA 1TW0A 4LGAA 3FO5A 2E3QA 5C9YA 2D4RA 4A81A 2K5GA 1XN5A 4BK6A 2Z9YA 2Z9ZA 1FM4A 4DSBA 3RT2A 4IGWA 2BK0A 2E3NA 4A88A 5JNNA 3P9VA 2PCSA 3NEGA 2LDKA 3R6PA 4LG5A 2M89A 3TVQA 2LUZA 3NMTA 4IHRA 4OICA 5E4BA 1XDFA 5BRLA 1TXCA 4IH2A 2E3SA 2I9YA 3NJ0A 5E4MA 3NI8A 3NJ1A 4C9IA 2MOUA 1LN2A 2E3PA 5E46A 1ICXA 3NJOA 3NMVA 2K7HA 3OTLA 3C0VA 4WVOA 4BK7A 2EJXA 2NN5A 3Q63A 4RYVA 2LCGA 2LF2A 5I9JA 1XN6A 4DS8A 1T17A 3P0LA 3KDJA 4R7KA 2GKDA 2IL5A 2LE1A 3NEFA 4PSBA 3CNWA 3P51A 4A83A 4A8VA 4IGYA 2RERA 3NMNA 2LPXA 1Z94A 2QIMA 3NR4A 3KAZA 4QIPA 1JSSA 3NS2A 4MNSA 3NMHA 4A8GA 3Q6AA 2E3MA 2PSOA 4JHIA 3QSZA 5E4DA 4REHA 4XRTA 5I8FA 4GY9A 4Z3LA 4IGVA 4IGXA 4M9BA 4N0GC 4A8UA 2WQLA 2M47A 3OJIA 3OQUA 5AMWA 2L8OA 1T27A 2KF2A 4Q0KA 3IJTA 3RD6A 4BKDA 2FFSA 4C9CA 1B6FA 2LEQA 4JHHA 1XFSA 3KL1A 4A87A 5JO1A 4A86A 4A84A 2FLHA 2E3RA 1XUVA 4A85A 3Q64A 3F08A 1EM2A 5JO2A 3KB0A 4REIA 3TL1A 3WG8A 3KLXA 3W9KA 2VQ5A 3OH8A 4MAPA 4FPWA 4MA6A 2NS9A 2RESA 2REZA 3W9RA 3KDIA 3UIDA 3H3SA 3RT0C 3IE5A 2LAKA 2N4AA 3E85A 3JRQB 3PUTA 3UJLA 2LGHA 1LN3A 1BV1A 4B9RA 3TFZA 1H2OA 1QMRA 3GGNA 1LLTA
chains in the Genus database with same CATH superfamily
3NMPA 2QPVA 3KB3A 4A80A 2L65A 2KEWA 4BTZA 2N4BA 1VJHA 3JRSA 4QDDA 3H3RA 3TVRA 3QN1A 4Y31A 4KPYA 4REJA 3TGOC 2ZYLA 4JDAA 4C94A 1X53A 3GOBA 3KDHA 3HO1A 2A1LA 4JHGA 2KCZA 1BTVA 2Q3QA 4IH0A 4QCKA 3H3QA 1FSKA 1ZXFA 2E3OA 2VNEA 3KAYA 4LGBA 3F73A 1LN1A 4QDCA 4XRWA 3ELIA 4BKCA 1E09A 1IFVA 1KCMA 3PU2A 3H3TA 3ZVUA 4DSCA 4N3EA 2R55A 2L9PA 2LIOA 3K90A 3K3KA 4JDLA 3UQHA 1UW5A 4LA7A 2KTEA 4M9WA 3DLBA 1TW0A 3GL2A 4LGAA 2LAFA 3FO5A 2E3QA 5C9YA 2D4RA 4A81A 2K5GA 1XN5A 4BK6A 2Z9YA 3HVRA 4QDFA 2Z9ZA 1FM4A 4DSBA 3RT2A 4IGWA 2BK0A 2E3NA 4A88A 5JNNA 3P9VA 2PCSA 3GTSA 3NEGA 2LDKA 3R6PA 4LG5A 2M89A 3TVQA 2LUZA 3NMTA 4IHRA 4OICA 5E4BA 1XDFA 5BRLA 1TXCA 3GB4A 4IH2A 2E3SA 2I9YA 3NJ0A 5E4MA 3NI8A 3NJ1A 4C9IA 2MOUA 4QDFB 1LN2A 2E3PA 5E46A 1ICXA 3DLHA 3NJOA 3NMVA 2K7HA 3OTLA 3C0VA 4WVOA 4BK7A 2EJXA 2NN5A 3Q63A 4RYVA 2LCGA 4N76A 2LF2A 5I9JA 1XN6A 4DS8A 1T17A 3P0LA 3KDJA 4R7KA 2GKDA 2IL5A 2LE1A 4N41A 3NEFA 4PSBA 3CNWA 3P51A 4A83A 4A8VA 4IGYA 2RERA 3NMNA 2LPXA 1Z94A 2QIMA 3NR4A 3KAZA 4JHYA 4QIPA 1JSSA 3NS2A 4MNSA 3NMHA 4A8GA 3Q6AA 2E3MA 3GKEA 2PSOA 4JHIA 3QSZA 4NCAA 5E4DA 4REHA 4XRTA 5I8FA 4GY9A 4Z3LA 4IGVA 4IGXA 4M9BA 4N0GC 4A8UA 3GTEA 2WQLA 2M47A 3OJIA 3OQUA 5AMWA 2L8OA 1T27A 2KF2A 4Q0KA 3IJTA 3RD6A 4BKDA 3HM9A 4NCBA 2FFSA 4C9CA 4E6FA 1B6FA 2LEQA 4JHHA 1XFSA 3KL1A 4A87A 5JO1A 4A86A 4A84A 2FLHA 2E3RA 1XUVA 3GL0A 3HXMA 4A85A 3Q64A 3F08A 1EM2A 5JO2A 3KB0A 4REIA 3TL1A 3WG8A 3KLXA 3W9KA 2VQ5A 3OH8A 4MAPA 4FPWA 4MA6A 2NS9A 2RESA 2REZA 3NQNA 3W9RA 2YH6A 3KDIA 3UIDA 3HK2A 5EKQC 3H3SA 3RT0C 3IE5A 2LAKA 2N4AA 3E85A 3JRQB 3PUTA 4N47A 2LGHA 3UJLA 1LN3A 1BV1A 4B9RA 3HJFA 3TFZA 1H2OA 1QMRA 3GGNA 1LLTA
chains in the Genus database with same CATH topology
3NMPA 2QPVA 3KB3A 4A80A 2L65A 2KEWA 4BTZA 2N4BA 1VJHA 3JRSA 4QDDA 3H3RA 3TVRA 3QN1A 4Y31A 4KPYA 4REJA 3TGOC 2ZYLA 4JDAA 4C94A 1X53A 3GOBA 3KDHA 3HO1A 2A1LA 4JHGA 2KCZA 1BTVA 2Q3QA 4IH0A 4QCKA 3H3QA 1FSKA 1ZXFA 2E3OA 2VNEA 3KAYA 4LGBA 3F73A 1LN1A 4QDCA 4XRWA 3ELIA 4BKCA 1E09A 1IFVA 1KCMA 3PU2A 3H3TA 3ZVUA 4DSCA 4N3EA 2R55A 2L9PA 2LIOA 3K90A 3K3KA 4JDLA 3UQHA 1UW5A 4LA7A 2KTEA 4M9WA 3DLBA 1TW0A 3GL2A 4LGAA 2LAFA 3FO5A 2E3QA 5C9YA 2D4RA 4A81A 2K5GA 1XN5A 4BK6A 2Z9YA 3HVRA 4QDFA 2Z9ZA 1FM4A 4DSBA 3RT2A 4IGWA 2BK0A 2E3NA 4A88A 5JNNA 3P9VA 2PCSA 3GTSA 3NEGA 2LDKA 3R6PA 4LG5A 2M89A 3TVQA 2LUZA 3NMTA 4IHRA 4OICA 5E4BA 1XDFA 5BRLA 1TXCA 3GB4A 4IH2A 2E3SA 2I9YA 3NJ0A 5E4MA 3NI8A 3NJ1A 4C9IA 2MOUA 4QDFB 1LN2A 2E3PA 5E46A 1ICXA 3DLHA 3NJOA 3NMVA 2K7HA 3OTLA 3C0VA 4WVOA 4BK7A 2EJXA 2NN5A 3Q63A 4RYVA 2LCGA 4N76A 2LF2A 5I9JA 1XN6A 4DS8A 1T17A 3P0LA 3KDJA 4R7KA 2GKDA 2IL5A 2LE1A 4N41A 3NEFA 4PSBA 3CNWA 3P51A 4A83A 4A8VA 4IGYA 2RERA 3NMNA 2LPXA 1Z94A 2QIMA 3NR4A 3KAZA 4JHYA 4QIPA 1JSSA 3NS2A 4MNSA 3NMHA 4A8GA 3Q6AA 2E3MA 3GKEA 2PSOA 4JHIA 3QSZA 4NCAA 5E4DA 4REHA 4XRTA 5I8FA 4GY9A 4Z3LA 4IGVA 4IGXA 4M9BA 4N0GC 4A8UA 3GTEA 2WQLA 2M47A 3OJIA 3OQUA 5AMWA 2L8OA 1T27A 2KF2A 4Q0KA 3IJTA 3RD6A 4BKDA 3HM9A 4NCBA 2FFSA 4C9CA 4E6FA 1B6FA 2LEQA 4JHHA 1XFSA 3KL1A 4A87A 5JO1A 4A86A 4A84A 2FLHA 2E3RA 1XUVA 3GL0A 3HXMA 4A85A 3Q64A 3F08A 1EM2A 5JO2A 3KB0A 4REIA 3TL1A 3WG8A 3KLXA 3W9KA 2VQ5A 3OH8A 4MAPA 4FPWA 4MA6A 2NS9A 2RESA 2REZA 3NQNA 3W9RA 2YH6A 3KDIA 3UIDA 3HK2A 5EKQC 3H3SA 3RT0C 3IE5A 2LAKA 2N4AA 3E85A 3JRQB 3PUTA 4N47A 2LGHA 3UJLA 1LN3A 1BV1A 4B9RA 3HJFA 3TFZA 1H2OA 1QMRA 3GGNA 1LLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMP A;  2QPV A;  3KB3 A;  4A80 A;  2L65 A;  2KEW A;  4BTZ A;  2N4B A;  1VJH A;  3JRS A;  3H3R A;  3TVR A;  3QN1 A;  4Y31 A;  4REJ A;  4JDA A;  4C94 A;  1X53 A;  3KDH A;  2A1L A;  4JHG A;  2KCZ A;  1BTV A;  2Q3Q A;  4IH0 A;  3H3Q A;  1FSK A;  1ZXF A;  2E3O A;  2VNE A;  3KAY A;  4LGB A;  1LN1 A;  4XRW A;  3ELI A;  4BKC A;  1E09 A;  1IFV A;  1KCM A;  3PU2 A;  3H3T A;  3ZVU A;  4DSC A;  4N3E A;  2R55 A;  2L9P A;  2LIO A;  3K90 A;  3K3K A;  4JDL A;  3UQH A;  1UW5 A;  4LA7 A;  2KTE A;  4M9W A;  1TW0 A;  4LGA A;  3FO5 A;  2E3Q A;  5C9Y A;  2D4R A;  4A81 A;  2K5G A;  1XN5 A;  4BK6 A;  2Z9Y A;  2Z9Z A;  1FM4 A;  4DSB A;  3RT2 A;  4IGW A;  2BK0 A;  2E3N A;  4A88 A;  5JNN A;  3P9V A;  2PCS A;  3NEG A;  2LDK A;  3R6P A;  4LG5 A;  2M89 A;  3TVQ A;  2LUZ A;  3NMT A;  4IHR A;  4OIC A;  5E4B A;  1XDF A;  5BRL A;  1TXC A;  4IH2 A;  2E3S A;  2I9Y A;  3NJ0 A;  5E4M A;  3NI8 A;  3NJ1 A;  4C9I A;  2MOU A;  1LN2 A;  2E3P A;  5E46 A;  1ICX A;  3NJO A;  3NMV A;  2K7H A;  3OTL A;  3C0V A;  4WVO A;  4BK7 A;  2EJX A;  2NN5 A;  3Q63 A;  4RYV A;  2LCG A;  2LF2 A;  5I9J A;  1XN6 A;  4DS8 A;  1T17 A;  3P0L A;  3KDJ A;  4R7K A;  2GKD A;  2IL5 A;  2LE1 A;  3NEF A;  4PSB A;  3CNW A;  3P51 A;  4A83 A;  4A8V A;  4IGY A;  2RER A;  3NMN A;  2LPX A;  1Z94 A;  2QIM A;  3NR4 A;  3KAZ A;  4QIP A;  1JSS A;  3NS2 A;  4MNS A;  3NMH A;  4A8G A;  3Q6A A;  2E3M A;  2PSO A;  4JHI A;  3QSZ A;  5E4D A;  4REH A;  4XRT A;  5I8F A;  4GY9 A;  4Z3L A;  4IGV A;  4IGX A;  4M9B A;  4N0G C;  4A8U A;  2WQL A;  2M47 A;  3OJI A;  3OQU A;  5AMW A;  2L8O A;  1T27 A;  2KF2 A;  4Q0K A;  3IJT A;  3RD6 A;  4BKD A;  2FFS A;  4C9C A;  1B6F A;  2LEQ A;  4JHH A;  1XFS A;  3KL1 A;  4A87 A;  5JO1 A;  4A86 A;  4A84 A;  2FLH A;  2E3R A;  1XUV A;  4A85 A;  3Q64 A;  3F08 A;  1EM2 A;  5JO2 A;  3KB0 A;  4REI A;  3TL1 A;  3WG8 A;  3KLX A;  3W9K A;  2VQ5 A;  3OH8 A;  4MAP A;  4FPW A;  4MA6 A;  2NS9 A;  2RES A;  2REZ A;  3W9R A;  3KDI A;  3UID A;  3H3S A;  3RT0 C;  3IE5 A;  2LAK A;  2N4A A;  3E85 A;  3JRQ B;  3PUT A;  3UJL A;  2LGH A;  1LN3 A;  1BV1 A;  4B9R A;  3TFZ A;  1H2O A;  1QMR A;  3GGN A;  1LLT A; 
#chains in the Genus database with same CATH topology
 3NMP A;  2QPV A;  3KB3 A;  4A80 A;  2L65 A;  2KEW A;  4BTZ A;  2N4B A;  1VJH A;  3JRS A;  4QDD A;  3H3R A;  3TVR A;  3QN1 A;  4Y31 A;  4KPY A;  4REJ A;  3TGO C;  2ZYL A;  4JDA A;  4C94 A;  1X53 A;  3GOB A;  3KDH A;  3HO1 A;  2A1L A;  4JHG A;  2KCZ A;  1BTV A;  2Q3Q A;  4IH0 A;  4QCK A;  3H3Q A;  1FSK A;  1ZXF A;  2E3O A;  2VNE A;  3KAY A;  4LGB A;  3F73 A;  1LN1 A;  4QDC A;  4XRW A;  3ELI A;  4BKC A;  1E09 A;  1IFV A;  1KCM A;  3PU2 A;  3H3T A;  3ZVU A;  4DSC A;  4N3E A;  2R55 A;  2L9P A;  2LIO A;  3K90 A;  3K3K A;  4JDL A;  3UQH A;  1UW5 A;  4LA7 A;  2KTE A;  4M9W A;  3DLB A;  1TW0 A;  3GL2 A;  4LGA A;  2LAF A;  3FO5 A;  2E3Q A;  5C9Y A;  2D4R A;  4A81 A;  2K5G A;  1XN5 A;  4BK6 A;  2Z9Y A;  3HVR A;  4QDF A;  2Z9Z A;  1FM4 A;  4DSB A;  3RT2 A;  4IGW A;  2BK0 A;  2E3N A;  4A88 A;  5JNN A;  3P9V A;  2PCS A;  3GTS A;  3NEG A;  2LDK A;  3R6P A;  4LG5 A;  2M89 A;  3TVQ A;  2LUZ A;  3NMT A;  4IHR A;  4OIC A;  5E4B A;  1XDF A;  5BRL A;  1TXC A;  3GB4 A;  4IH2 A;  2E3S A;  2I9Y A;  3NJ0 A;  5E4M A;  3NI8 A;  3NJ1 A;  4C9I A;  2MOU A;  4QDF B;  1LN2 A;  2E3P A;  5E46 A;  1ICX A;  3DLH A;  3NJO A;  3NMV A;  2K7H A;  3OTL A;  3C0V A;  4WVO A;  4BK7 A;  2EJX A;  2NN5 A;  3Q63 A;  4RYV A;  2LCG A;  4N76 A;  2LF2 A;  5I9J A;  1XN6 A;  4DS8 A;  1T17 A;  3P0L A;  3KDJ A;  4R7K A;  2GKD A;  2IL5 A;  2LE1 A;  4N41 A;  3NEF A;  4PSB A;  3CNW A;  3P51 A;  4A83 A;  4A8V A;  4IGY A;  2RER A;  3NMN A;  2LPX A;  1Z94 A;  2QIM A;  3NR4 A;  3KAZ A;  4JHY A;  4QIP A;  1JSS A;  3NS2 A;  4MNS A;  3NMH A;  4A8G A;  3Q6A A;  2E3M A;  3GKE A;  2PSO A;  4JHI A;  3QSZ A;  4NCA A;  5E4D A;  4REH A;  4XRT A;  5I8F A;  4GY9 A;  4Z3L A;  4IGV A;  4IGX A;  4M9B A;  4N0G C;  4A8U A;  3GTE A;  2WQL A;  2M47 A;  3OJI A;  3OQU A;  5AMW A;  2L8O A;  1T27 A;  2KF2 A;  4Q0K A;  3IJT A;  3RD6 A;  4BKD A;  3HM9 A;  4NCB A;  2FFS A;  4C9C A;  4E6F A;  1B6F A;  2LEQ A;  4JHH A;  1XFS A;  3KL1 A;  4A87 A;  5JO1 A;  4A86 A;  4A84 A;  2FLH A;  2E3R A;  1XUV A;  3GL0 A;  3HXM A;  4A85 A;  3Q64 A;  3F08 A;  1EM2 A;  5JO2 A;  3KB0 A;  4REI A;  3TL1 A;  3WG8 A;  3KLX A;  3W9K A;  2VQ5 A;  3OH8 A;  4MAP A;  4FPW A;  4MA6 A;  2NS9 A;  2RES A;  2REZ A;  3NQN A;  3W9R A;  2YH6 A;  3KDI A;  3UID A;  3HK2 A;  5EKQ C;  3H3S A;  3RT0 C;  3IE5 A;  2LAK A;  2N4A A;  3E85 A;  3JRQ B;  3PUT A;  4N47 A;  2LGH A;  3UJL A;  1LN3 A;  1BV1 A;  4B9R A;  3HJF A;  3TFZ A;  1H2O A;  1QMR A;  3GGN A;  1LLT A; 
#chains in the Genus database with same CATH homology
 3NMP A;  2QPV A;  3KB3 A;  4A80 A;  2L65 A;  2KEW A;  4BTZ A;  2N4B A;  1VJH A;  3JRS A;  4QDD A;  3H3R A;  3TVR A;  3QN1 A;  4Y31 A;  4KPY A;  4REJ A;  3TGO C;  2ZYL A;  4JDA A;  4C94 A;  1X53 A;  3GOB A;  3KDH A;  3HO1 A;  2A1L A;  4JHG A;  2KCZ A;  1BTV A;  2Q3Q A;  4IH0 A;  4QCK A;  3H3Q A;  1FSK A;  1ZXF A;  2E3O A;  2VNE A;  3KAY A;  4LGB A;  3F73 A;  1LN1 A;  4QDC A;  4XRW A;  3ELI A;  4BKC A;  1E09 A;  1IFV A;  1KCM A;  3PU2 A;  3H3T A;  3ZVU A;  4DSC A;  4N3E A;  2R55 A;  2L9P A;  2LIO A;  3K90 A;  3K3K A;  4JDL A;  3UQH A;  1UW5 A;  4LA7 A;  2KTE A;  4M9W A;  3DLB A;  1TW0 A;  3GL2 A;  4LGA A;  2LAF A;  3FO5 A;  2E3Q A;  5C9Y A;  2D4R A;  4A81 A;  2K5G A;  1XN5 A;  4BK6 A;  2Z9Y A;  3HVR A;  4QDF A;  2Z9Z A;  1FM4 A;  4DSB A;  3RT2 A;  4IGW A;  2BK0 A;  2E3N A;  4A88 A;  5JNN A;  3P9V A;  2PCS A;  3GTS A;  3NEG A;  2LDK A;  3R6P A;  4LG5 A;  2M89 A;  3TVQ A;  2LUZ A;  3NMT A;  4IHR A;  4OIC A;  5E4B A;  1XDF A;  5BRL A;  1TXC A;  3GB4 A;  4IH2 A;  2E3S A;  2I9Y A;  3NJ0 A;  5E4M A;  3NI8 A;  3NJ1 A;  4C9I A;  2MOU A;  4QDF B;  1LN2 A;  2E3P A;  5E46 A;  1ICX A;  3DLH A;  3NJO A;  3NMV A;  2K7H A;  3OTL A;  3C0V A;  4WVO A;  4BK7 A;  2EJX A;  2NN5 A;  3Q63 A;  4RYV A;  2LCG A;  4N76 A;  2LF2 A;  5I9J A;  1XN6 A;  4DS8 A;  1T17 A;  3P0L A;  3KDJ A;  4R7K A;  2GKD A;  2IL5 A;  2LE1 A;  4N41 A;  3NEF A;  4PSB A;  3CNW A;  3P51 A;  4A83 A;  4A8V A;  4IGY A;  2RER A;  3NMN A;  2LPX A;  1Z94 A;  2QIM A;  3NR4 A;  3KAZ A;  4JHY A;  4QIP A;  1JSS A;  3NS2 A;  4MNS A;  3NMH A;  4A8G A;  3Q6A A;  2E3M A;  3GKE A;  2PSO A;  4JHI A;  3QSZ A;  4NCA A;  5E4D A;  4REH A;  4XRT A;  5I8F A;  4GY9 A;  4Z3L A;  4IGV A;  4IGX A;  4M9B A;  4N0G C;  4A8U A;  3GTE A;  2WQL A;  2M47 A;  3OJI A;  3OQU A;  5AMW A;  2L8O A;  1T27 A;  2KF2 A;  4Q0K A;  3IJT A;  3RD6 A;  4BKD A;  3HM9 A;  4NCB A;  2FFS A;  4C9C A;  4E6F A;  1B6F A;  2LEQ A;  4JHH A;  1XFS A;  3KL1 A;  4A87 A;  5JO1 A;  4A86 A;  4A84 A;  2FLH A;  2E3R A;  1XUV A;  3GL0 A;  3HXM A;  4A85 A;  3Q64 A;  3F08 A;  1EM2 A;  5JO2 A;  3KB0 A;  4REI A;  3TL1 A;  3WG8 A;  3KLX A;  3W9K A;  2VQ5 A;  3OH8 A;  4MAP A;  4FPW A;  4MA6 A;  2NS9 A;  2RES A;  2REZ A;  3NQN A;  3W9R A;  2YH6 A;  3KDI A;  3UID A;  3HK2 A;  5EKQ C;  3H3S A;  3RT0 C;  3IE5 A;  2LAK A;  2N4A A;  3E85 A;  3JRQ B;  3PUT A;  4N47 A;  2LGH A;  3UJL A;  1LN3 A;  1BV1 A;  4B9R A;  3HJF A;  3TFZ A;  1H2O A;  1QMR A;  3GGN A;  1LLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...