3H3SA

Crystal structure of the cert start domain in complex with hpa-15
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
236
structure length
236
Chain Sequence
GTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Goodpasture antigen binding protein
publication title Crystal structures of the CERT START domain with inhibitors provide insights into the mechanism of ceramide transfer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 63
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3h3sA00
3K90A 1KCMA 3FO5A 3IE5A 4DSBA 3R6PA 1T17A 4Q0KA 1B6FA 3KB3A 3ZVUA 2LF2A 4LA7A 1ICXA 2E3SA 3RT0C 3K3KA 4LG5A 4REJA 2BK0A 2LEQA 2KEWA 4N3EA 5I8FA 2IL5A 3NMHA 4A88A 4A83A 4JHIA 2RESA 3KLXA 3PUTA 5BRLA 1FM4A 4A84A 4A8VA 5E4MA 3KAYA 3IJTA 4C9IA 2E3PA 2Z9YA 4A80A 3RT2A 2LUZA 3C0VA 1T27A 3NS2A 4IGXA 2M47A 2N4AA 2FLHA 2LE1A 4IH0A 4IGYA 3KDIA 4XRTA 4IHRA 5JO1A 1IFVA 4MAPA 2E3OA 2LDKA 3NMTA 4REHA 1E09A 3TFZA 4A85A 4RYVA 3CNWA 3NMNA 5E4DA 4A8GA 4REIA 1Z94A 2QPVA 5AMWA 5I9JA 1JSSA 3TVQA 2K7HA 4GY9A 3H3RA 1TW0A 4JDAA 1X53A 1XUVA 2MOUA 2KF2A 3KDJA 3F08A 2D4RA 3OQUA 2VQ5A 3W9RA 2LIOA 3E85A 4JHHA 1ZXFA 1XN5A 4QIPA 3NJOA 5JO2A 2LPXA 4LGBA 2QIMA 1VJHA 5E4BA 2KTEA 2K5GA 2PSOA 3TL1A 3P0LA 2REZA 2LCGA 1EM2A 3KAZA 4BKCA 4MA6A 2A1LA 3NJ0A 4BK7A 1LN1A 4Y31A 4Z3LA 3OJIA 2Q3QA 4B9RA 3H3QA 3KL1A 2PCSA 3GGNA 3H3SA 1XN6A 4R7KA 3PU2A 2Z9ZA 2WQLA 4LGAA 3OTLA 3RD6A 2KCZA 3NMVA 3TVRA 3NEFA 4JDLA 2GKDA 1BTVA 4N0GC 1LN3A 4MNSA 3Q63A 3UIDA 4M9BA 4A86A 2I9YA 3KDHA 4C94A 2R55A 4BTZA 1BV1A 1XDFA 3NI8A 1TXCA 2E3QA 2LAKA 2E3NA 4WVOA 3W9KA 3P51A 1H2OA 2LGHA 4BKDA 1QMRA 1XFSA 2FFSA 2L8OA 4DSCA 2E3RA 3ELIA 3Q6AA 4A81A 5C9YA 3KB0A 4M9WA 3NR4A 4BK6A 3JRQB 3QN1A 3Q64A 4A87A 4FPWA 4IGWA 4XRWA 3NEGA 4PSBA 4JHGA 5E46A 1FSKA 2NS9A 4IGVA 1LN2A 4IH2A 2N4BA 2VNEA 3NMPA 5JNNA 3UQHA 3QSZA 3UJLA 3NJ1A 4C9CA 3JRSA 2L65A 4A8UA 2E3MA 4OICA 3H3TA 2NN5A 1LLTA 2RERA 3P9VA 2EJXA 4DS8A 3OH8A 2M89A 3WG8A 1UW5A 2L9PA
chains in the Genus database with same CATH superfamily
3K90A 1KCMA 3FO5A 3IE5A 4DSBA 3R6PA 1T17A 4Q0KA 1B6FA 3KB3A 3ZVUA 2LF2A 4LA7A 1ICXA 2E3SA 3RT0C 3K3KA 4LG5A 4REJA 2BK0A 3HM9A 2LEQA 2KEWA 4N3EA 5I8FA 2IL5A 3NMHA 4A88A 4A83A 4JHIA 2ZYLA 3HJFA 2RESA 3KLXA 3PUTA 5BRLA 1FM4A 4A84A 4A8VA 5E4MA 3KAYA 3IJTA 4N41A 4C9IA 2E3PA 2Z9YA 4A80A 3RT2A 2LUZA 3C0VA 1T27A 3NS2A 4IGXA 2M47A 2N4AA 2FLHA 2LE1A 4IH0A 4IGYA 3KDIA 4XRTA 4NCAA 4IHRA 5JO1A 1IFVA 4MAPA 2E3OA 2LDKA 3NMTA 4REHA 1E09A 3TFZA 4A85A 4N47A 4RYVA 3CNWA 3NMNA 4QDFB 5E4DA 4A8GA 4REIA 4KPYA 1Z94A 2QPVA 5AMWA 5I9JA 1JSSA 3TVQA 2K7HA 2LAFA 4GY9A 4QDFA 4QCKA 3H3RA 1TW0A 4JDAA 4JHYA 1X53A 3HO1A 1XUVA 2MOUA 2KF2A 3KDJA 3F08A 2D4RA 3OQUA 2VQ5A 3W9RA 2LIOA 3E85A 4JHHA 3DLHA 5EKQC 1ZXFA 1XN5A 4QIPA 3NJOA 5JO2A 2LPXA 4LGBA 2QIMA 2YH6A 1VJHA 5E4BA 2KTEA 2K5GA 2PSOA 3TL1A 3P0LA 2REZA 2LCGA 1EM2A 3KAZA 4N76A 4BKCA 4MA6A 4QDCA 2A1LA 3NJ0A 4BK7A 1LN1A 4QDDA 4Y31A 4Z3LA 3GL0A 3GTSA 3OJIA 2Q3QA 4B9RA 3H3QA 3KL1A 2PCSA 3GGNA 3H3SA 1XN6A 3GTEA 4R7KA 3PU2A 2Z9ZA 2WQLA 4LGAA 3OTLA 3RD6A 2KCZA 3NMVA 3TVRA 3DLBA 3TGOC 3HVRA 3NEFA 4JDLA 2GKDA 3F73A 1BTVA 3GOBA 4N0GC 1LN3A 4MNSA 3Q63A 3UIDA 4M9BA 4A86A 2I9YA 3KDHA 3HK2A 4C94A 2R55A 3GL2A 4BTZA 1BV1A 1XDFA 3NI8A 1TXCA 2E3QA 2LAKA 2E3NA 4WVOA 3W9KA 3P51A 1H2OA 2LGHA 4BKDA 1QMRA 1XFSA 2FFSA 2L8OA 4DSCA 2E3RA 3ELIA 3Q6AA 4A81A 5C9YA 3KB0A 4M9WA 3NR4A 4BK6A 3JRQB 3QN1A 3Q64A 4A87A 4FPWA 4IGWA 4XRWA 3NEGA 4PSBA 4JHGA 5E46A 1FSKA 2NS9A 4IGVA 1LN2A 4IH2A 3GB4A 2N4BA 2VNEA 3GKEA 3NMPA 5JNNA 3UQHA 4NCBA 3QSZA 3NQNA 3NJ1A 3UJLA 3HXMA 4C9CA 3JRSA 4E6FA 2L65A 4A8UA 2E3MA 4OICA 3H3TA 2NN5A 1LLTA 2RERA 3P9VA 2EJXA 4DS8A 3OH8A 2M89A 3WG8A 1UW5A 2L9PA
chains in the Genus database with same CATH topology
3K90A 1KCMA 3FO5A 3IE5A 4DSBA 3R6PA 1T17A 4Q0KA 1B6FA 3KB3A 3ZVUA 2LF2A 4LA7A 1ICXA 2E3SA 3RT0C 3K3KA 4LG5A 4REJA 2BK0A 3HM9A 2LEQA 2KEWA 4N3EA 5I8FA 2IL5A 3NMHA 4A88A 4A83A 4JHIA 2ZYLA 3HJFA 2RESA 3KLXA 3PUTA 5BRLA 1FM4A 4A84A 4A8VA 5E4MA 3KAYA 3IJTA 4N41A 4C9IA 2E3PA 2Z9YA 4A80A 3RT2A 2LUZA 3C0VA 1T27A 3NS2A 4IGXA 2M47A 2N4AA 2FLHA 2LE1A 4IH0A 4IGYA 3KDIA 4XRTA 4NCAA 4IHRA 5JO1A 1IFVA 4MAPA 2E3OA 2LDKA 3NMTA 4REHA 1E09A 3TFZA 4A85A 4N47A 4RYVA 3CNWA 3NMNA 4QDFB 5E4DA 4A8GA 4REIA 4KPYA 1Z94A 2QPVA 5AMWA 5I9JA 1JSSA 3TVQA 2K7HA 2LAFA 4GY9A 4QDFA 4QCKA 3H3RA 1TW0A 4JDAA 4JHYA 1X53A 3HO1A 1XUVA 2MOUA 2KF2A 3KDJA 3F08A 2D4RA 3OQUA 2VQ5A 3W9RA 2LIOA 3E85A 4JHHA 3DLHA 5EKQC 1ZXFA 1XN5A 4QIPA 3NJOA 5JO2A 2LPXA 4LGBA 2QIMA 2YH6A 1VJHA 5E4BA 2KTEA 2K5GA 2PSOA 3TL1A 3P0LA 2REZA 2LCGA 1EM2A 3KAZA 4N76A 4BKCA 4MA6A 4QDCA 2A1LA 3NJ0A 4BK7A 1LN1A 4QDDA 4Y31A 4Z3LA 3GL0A 3GTSA 3OJIA 2Q3QA 4B9RA 3H3QA 3KL1A 2PCSA 3GGNA 3H3SA 1XN6A 3GTEA 4R7KA 3PU2A 2Z9ZA 2WQLA 4LGAA 3OTLA 3RD6A 2KCZA 3NMVA 3TVRA 3DLBA 3TGOC 3HVRA 3NEFA 4JDLA 2GKDA 3F73A 1BTVA 3GOBA 4N0GC 1LN3A 4MNSA 3Q63A 3UIDA 4M9BA 4A86A 2I9YA 3KDHA 3HK2A 4C94A 2R55A 3GL2A 4BTZA 1BV1A 1XDFA 3NI8A 1TXCA 2E3QA 2LAKA 2E3NA 4WVOA 3W9KA 3P51A 1H2OA 2LGHA 4BKDA 1QMRA 1XFSA 2FFSA 2L8OA 4DSCA 2E3RA 3ELIA 3Q6AA 4A81A 5C9YA 3KB0A 4M9WA 3NR4A 4BK6A 3JRQB 3QN1A 3Q64A 4A87A 4FPWA 4IGWA 4XRWA 3NEGA 4PSBA 4JHGA 5E46A 1FSKA 2NS9A 4IGVA 1LN2A 4IH2A 3GB4A 2N4BA 2VNEA 3GKEA 3NMPA 5JNNA 3UQHA 4NCBA 3QSZA 3NQNA 3NJ1A 3UJLA 3HXMA 4C9CA 3JRSA 4E6FA 2L65A 4A8UA 2E3MA 4OICA 3H3TA 2NN5A 1LLTA 2RERA 3P9VA 2EJXA 4DS8A 3OH8A 2M89A 3WG8A 1UW5A 2L9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K90 A;  1KCM A;  3FO5 A;  3IE5 A;  4DSB A;  3R6P A;  1T17 A;  4Q0K A;  1B6F A;  3KB3 A;  3ZVU A;  2LF2 A;  4LA7 A;  1ICX A;  2E3S A;  3RT0 C;  3K3K A;  4LG5 A;  4REJ A;  2BK0 A;  2LEQ A;  2KEW A;  4N3E A;  5I8F A;  2IL5 A;  3NMH A;  4A88 A;  4A83 A;  4JHI A;  2RES A;  3KLX A;  3PUT A;  5BRL A;  1FM4 A;  4A84 A;  4A8V A;  5E4M A;  3KAY A;  3IJT A;  4C9I A;  2E3P A;  2Z9Y A;  4A80 A;  3RT2 A;  2LUZ A;  3C0V A;  1T27 A;  3NS2 A;  4IGX A;  2M47 A;  2N4A A;  2FLH A;  2LE1 A;  4IH0 A;  4IGY A;  3KDI A;  4XRT A;  4IHR A;  5JO1 A;  1IFV A;  4MAP A;  2E3O A;  2LDK A;  3NMT A;  4REH A;  1E09 A;  3TFZ A;  4A85 A;  4RYV A;  3CNW A;  3NMN A;  5E4D A;  4A8G A;  4REI A;  1Z94 A;  2QPV A;  5AMW A;  5I9J A;  1JSS A;  3TVQ A;  2K7H A;  4GY9 A;  3H3R A;  1TW0 A;  4JDA A;  1X53 A;  1XUV A;  2MOU A;  2KF2 A;  3KDJ A;  3F08 A;  2D4R A;  3OQU A;  2VQ5 A;  3W9R A;  2LIO A;  3E85 A;  4JHH A;  1ZXF A;  1XN5 A;  4QIP A;  3NJO A;  5JO2 A;  2LPX A;  4LGB A;  2QIM A;  1VJH A;  5E4B A;  2KTE A;  2K5G A;  2PSO A;  3TL1 A;  3P0L A;  2REZ A;  2LCG A;  1EM2 A;  3KAZ A;  4BKC A;  4MA6 A;  2A1L A;  3NJ0 A;  4BK7 A;  1LN1 A;  4Y31 A;  4Z3L A;  3OJI A;  2Q3Q A;  4B9R A;  3H3Q A;  3KL1 A;  2PCS A;  3GGN A;  3H3S A;  1XN6 A;  4R7K A;  3PU2 A;  2Z9Z A;  2WQL A;  4LGA A;  3OTL A;  3RD6 A;  2KCZ A;  3NMV A;  3TVR A;  3NEF A;  4JDL A;  2GKD A;  1BTV A;  4N0G C;  1LN3 A;  4MNS A;  3Q63 A;  3UID A;  4M9B A;  4A86 A;  2I9Y A;  3KDH A;  4C94 A;  2R55 A;  4BTZ A;  1BV1 A;  1XDF A;  3NI8 A;  1TXC A;  2E3Q A;  2LAK A;  2E3N A;  4WVO A;  3W9K A;  3P51 A;  1H2O A;  2LGH A;  4BKD A;  1QMR A;  1XFS A;  2FFS A;  2L8O A;  4DSC A;  2E3R A;  3ELI A;  3Q6A A;  4A81 A;  5C9Y A;  3KB0 A;  4M9W A;  3NR4 A;  4BK6 A;  3JRQ B;  3QN1 A;  3Q64 A;  4A87 A;  4FPW A;  4IGW A;  4XRW A;  3NEG A;  4PSB A;  4JHG A;  5E46 A;  1FSK A;  2NS9 A;  4IGV A;  1LN2 A;  4IH2 A;  2N4B A;  2VNE A;  3NMP A;  5JNN A;  3UQH A;  3QSZ A;  3UJL A;  3NJ1 A;  4C9C A;  3JRS A;  2L65 A;  4A8U A;  2E3M A;  4OIC A;  3H3T A;  2NN5 A;  1LLT A;  2RER A;  3P9V A;  2EJX A;  4DS8 A;  3OH8 A;  2M89 A;  3WG8 A;  1UW5 A;  2L9P A; 
#chains in the Genus database with same CATH topology
 3K90 A;  1KCM A;  3FO5 A;  3IE5 A;  4DSB A;  3R6P A;  1T17 A;  4Q0K A;  1B6F A;  3KB3 A;  3ZVU A;  2LF2 A;  4LA7 A;  1ICX A;  2E3S A;  3RT0 C;  3K3K A;  4LG5 A;  4REJ A;  2BK0 A;  3HM9 A;  2LEQ A;  2KEW A;  4N3E A;  5I8F A;  2IL5 A;  3NMH A;  4A88 A;  4A83 A;  4JHI A;  2ZYL A;  3HJF A;  2RES A;  3KLX A;  3PUT A;  5BRL A;  1FM4 A;  4A84 A;  4A8V A;  5E4M A;  3KAY A;  3IJT A;  4N41 A;  4C9I A;  2E3P A;  2Z9Y A;  4A80 A;  3RT2 A;  2LUZ A;  3C0V A;  1T27 A;  3NS2 A;  4IGX A;  2M47 A;  2N4A A;  2FLH A;  2LE1 A;  4IH0 A;  4IGY A;  3KDI A;  4XRT A;  4NCA A;  4IHR A;  5JO1 A;  1IFV A;  4MAP A;  2E3O A;  2LDK A;  3NMT A;  4REH A;  1E09 A;  3TFZ A;  4A85 A;  4N47 A;  4RYV A;  3CNW A;  3NMN A;  4QDF B;  5E4D A;  4A8G A;  4REI A;  4KPY A;  1Z94 A;  2QPV A;  5AMW A;  5I9J A;  1JSS A;  3TVQ A;  2K7H A;  2LAF A;  4GY9 A;  4QDF A;  4QCK A;  3H3R A;  1TW0 A;  4JDA A;  4JHY A;  1X53 A;  3HO1 A;  1XUV A;  2MOU A;  2KF2 A;  3KDJ A;  3F08 A;  2D4R A;  3OQU A;  2VQ5 A;  3W9R A;  2LIO A;  3E85 A;  4JHH A;  3DLH A;  5EKQ C;  1ZXF A;  1XN5 A;  4QIP A;  3NJO A;  5JO2 A;  2LPX A;  4LGB A;  2QIM A;  2YH6 A;  1VJH A;  5E4B A;  2KTE A;  2K5G A;  2PSO A;  3TL1 A;  3P0L A;  2REZ A;  2LCG A;  1EM2 A;  3KAZ A;  4N76 A;  4BKC A;  4MA6 A;  4QDC A;  2A1L A;  3NJ0 A;  4BK7 A;  1LN1 A;  4QDD A;  4Y31 A;  4Z3L A;  3GL0 A;  3GTS A;  3OJI A;  2Q3Q A;  4B9R A;  3H3Q A;  3KL1 A;  2PCS A;  3GGN A;  3H3S A;  1XN6 A;  3GTE A;  4R7K A;  3PU2 A;  2Z9Z A;  2WQL A;  4LGA A;  3OTL A;  3RD6 A;  2KCZ A;  3NMV A;  3TVR A;  3DLB A;  3TGO C;  3HVR A;  3NEF A;  4JDL A;  2GKD A;  3F73 A;  1BTV A;  3GOB A;  4N0G C;  1LN3 A;  4MNS A;  3Q63 A;  3UID A;  4M9B A;  4A86 A;  2I9Y A;  3KDH A;  3HK2 A;  4C94 A;  2R55 A;  3GL2 A;  4BTZ A;  1BV1 A;  1XDF A;  3NI8 A;  1TXC A;  2E3Q A;  2LAK A;  2E3N A;  4WVO A;  3W9K A;  3P51 A;  1H2O A;  2LGH A;  4BKD A;  1QMR A;  1XFS A;  2FFS A;  2L8O A;  4DSC A;  2E3R A;  3ELI A;  3Q6A A;  4A81 A;  5C9Y A;  3KB0 A;  4M9W A;  3NR4 A;  4BK6 A;  3JRQ B;  3QN1 A;  3Q64 A;  4A87 A;  4FPW A;  4IGW A;  4XRW A;  3NEG A;  4PSB A;  4JHG A;  5E46 A;  1FSK A;  2NS9 A;  4IGV A;  1LN2 A;  4IH2 A;  3GB4 A;  2N4B A;  2VNE A;  3GKE A;  3NMP A;  5JNN A;  3UQH A;  4NCB A;  3QSZ A;  3NQN A;  3NJ1 A;  3UJL A;  3HXM A;  4C9C A;  3JRS A;  4E6F A;  2L65 A;  4A8U A;  2E3M A;  4OIC A;  3H3T A;  2NN5 A;  1LLT A;  2RER A;  3P9V A;  2EJX A;  4DS8 A;  3OH8 A;  2M89 A;  3WG8 A;  1UW5 A;  2L9P A; 
#chains in the Genus database with same CATH homology
 3K90 A;  1KCM A;  3FO5 A;  3IE5 A;  4DSB A;  3R6P A;  1T17 A;  4Q0K A;  1B6F A;  3KB3 A;  3ZVU A;  2LF2 A;  4LA7 A;  1ICX A;  2E3S A;  3RT0 C;  3K3K A;  4LG5 A;  4REJ A;  2BK0 A;  3HM9 A;  2LEQ A;  2KEW A;  4N3E A;  5I8F A;  2IL5 A;  3NMH A;  4A88 A;  4A83 A;  4JHI A;  2ZYL A;  3HJF A;  2RES A;  3KLX A;  3PUT A;  5BRL A;  1FM4 A;  4A84 A;  4A8V A;  5E4M A;  3KAY A;  3IJT A;  4N41 A;  4C9I A;  2E3P A;  2Z9Y A;  4A80 A;  3RT2 A;  2LUZ A;  3C0V A;  1T27 A;  3NS2 A;  4IGX A;  2M47 A;  2N4A A;  2FLH A;  2LE1 A;  4IH0 A;  4IGY A;  3KDI A;  4XRT A;  4NCA A;  4IHR A;  5JO1 A;  1IFV A;  4MAP A;  2E3O A;  2LDK A;  3NMT A;  4REH A;  1E09 A;  3TFZ A;  4A85 A;  4N47 A;  4RYV A;  3CNW A;  3NMN A;  4QDF B;  5E4D A;  4A8G A;  4REI A;  4KPY A;  1Z94 A;  2QPV A;  5AMW A;  5I9J A;  1JSS A;  3TVQ A;  2K7H A;  2LAF A;  4GY9 A;  4QDF A;  4QCK A;  3H3R A;  1TW0 A;  4JDA A;  4JHY A;  1X53 A;  3HO1 A;  1XUV A;  2MOU A;  2KF2 A;  3KDJ A;  3F08 A;  2D4R A;  3OQU A;  2VQ5 A;  3W9R A;  2LIO A;  3E85 A;  4JHH A;  3DLH A;  5EKQ C;  1ZXF A;  1XN5 A;  4QIP A;  3NJO A;  5JO2 A;  2LPX A;  4LGB A;  2QIM A;  2YH6 A;  1VJH A;  5E4B A;  2KTE A;  2K5G A;  2PSO A;  3TL1 A;  3P0L A;  2REZ A;  2LCG A;  1EM2 A;  3KAZ A;  4N76 A;  4BKC A;  4MA6 A;  4QDC A;  2A1L A;  3NJ0 A;  4BK7 A;  1LN1 A;  4QDD A;  4Y31 A;  4Z3L A;  3GL0 A;  3GTS A;  3OJI A;  2Q3Q A;  4B9R A;  3H3Q A;  3KL1 A;  2PCS A;  3GGN A;  3H3S A;  1XN6 A;  3GTE A;  4R7K A;  3PU2 A;  2Z9Z A;  2WQL A;  4LGA A;  3OTL A;  3RD6 A;  2KCZ A;  3NMV A;  3TVR A;  3DLB A;  3TGO C;  3HVR A;  3NEF A;  4JDL A;  2GKD A;  3F73 A;  1BTV A;  3GOB A;  4N0G C;  1LN3 A;  4MNS A;  3Q63 A;  3UID A;  4M9B A;  4A86 A;  2I9Y A;  3KDH A;  3HK2 A;  4C94 A;  2R55 A;  3GL2 A;  4BTZ A;  1BV1 A;  1XDF A;  3NI8 A;  1TXC A;  2E3Q A;  2LAK A;  2E3N A;  4WVO A;  3W9K A;  3P51 A;  1H2O A;  2LGH A;  4BKD A;  1QMR A;  1XFS A;  2FFS A;  2L8O A;  4DSC A;  2E3R A;  3ELI A;  3Q6A A;  4A81 A;  5C9Y A;  3KB0 A;  4M9W A;  3NR4 A;  4BK6 A;  3JRQ B;  3QN1 A;  3Q64 A;  4A87 A;  4FPW A;  4IGW A;  4XRW A;  3NEG A;  4PSB A;  4JHG A;  5E46 A;  1FSK A;  2NS9 A;  4IGV A;  1LN2 A;  4IH2 A;  3GB4 A;  2N4B A;  2VNE A;  3GKE A;  3NMP A;  5JNN A;  3UQH A;  4NCB A;  3QSZ A;  3NQN A;  3NJ1 A;  3UJL A;  3HXM A;  4C9C A;  3JRS A;  4E6F A;  2L65 A;  4A8U A;  2E3M A;  4OIC A;  3H3T A;  2NN5 A;  1LLT A;  2RER A;  3P9V A;  2EJX A;  4DS8 A;  3OH8 A;  2M89 A;  3WG8 A;  1UW5 A;  2L9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...