3H3TA

Crystal structure of the cert start domain in complex with hpa-16
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
236
Chain Sequence
GTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Goodpasture antigen binding protein
publication title Crystal structures of the CERT START domain with inhibitors provide insights into the mechanism of ceramide transfer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 62
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3h3tA00
1XFSA 3OTLA 2E3NA 2LCGA 3TVQA 4C9IA 4DS8A 1T27A 1ICXA 2KF2A 2K7HA 3F08A 3K90A 2EJXA 2BK0A 2LE1A 1T17A 4XRTA 3TVRA 1BTVA 3FO5A 1LN1A 4IGXA 5E46A 4JHHA 3NMHA 3PU2A 4REJA 2N4AA 2R55A 4A8UA 3NS2A 2QIMA 2Z9YA 2IL5A 2PCSA 3KB3A 2E3QA 2D4RA 4A80A 5E4DA 3RT2A 5E4BA 3CNWA 4JDAA 4BKCA 5I9JA 1IFVA 2L65A 2PSOA 3NEFA 2KEWA 2E3OA 2REZA 3TL1A 1QMRA 4LA7A 4DSCA 4BKDA 4FPWA 4A83A 5JO1A 2MOUA 3NMTA 5JO2A 3P0LA 4A86A 3H3RA 4BK6A 2L9PA 2FFSA 2A1LA 2LDKA 4QIPA 2K5GA 2L8OA 1JSSA 2LPXA 3NI8A 4REHA 1BV1A 3KDIA 3KLXA 3UIDA 3KAYA 4JHIA 4Y31A 4A8VA 4IH0A 2N4BA 2M47A 2E3MA 4BK7A 4M9BA 1X53A 3Q64A 1XN6A 4A88A 1TW0A 3QSZA 4WVOA 3NMNA 3NJ1A 3GGNA 4IGVA 3ZVUA 4R7KA 1XUVA 2E3RA 2E3SA 3E85A 4XRWA 2GKDA 4GY9A 4RYVA 3OQUA 5I8FA 4LGBA 3R6PA 3H3SA 3PUTA 2NN5A 1FSKA 4C9CA 4LG5A 3P51A 4B9RA 4A87A 1XN5A 1B6FA 4N0GC 3K3KA 4MA6A 3IE5A 4Z3LA 3NMVA 4IGYA 3H3TA 3TFZA 3W9RA 1Z94A 3UJLA 2LUZA 2VNEA 3W9KA 2LEQA 4A81A 4OICA 4C94A 3NJ0A 4A84A 3OH8A 1EM2A 2LF2A 2QPVA 4IGWA 4Q0KA 3JRSA 4IH2A 4MNSA 4A8GA 2RESA 3KDHA 3NMPA 4DSBA 3NEGA 1TXCA 2I9YA 4JDLA 4PSBA 3UQHA 2M89A 1ZXFA 3ELIA 4IHRA 1E09A 1UW5A 3KB0A 4M9WA 3KAZA 1LN2A 5JNNA 2LGHA 2VQ5A 1XDFA 3H3QA 2RERA 3KDJA 4LGAA 3RT0C 1FM4A 5E4MA 4N3EA 3WG8A 3JRQB 3NJOA 3IJTA 1KCMA 2FLHA 4MAPA 5C9YA 2LIOA 2KTEA 4REIA 3OJIA 4A85A 2E3PA 1VJHA 3RD6A 5BRLA 2WQLA 3NR4A 3P9VA 3Q6AA 4JHGA 3QN1A 5AMWA 4BTZA 3KL1A 3Q63A 1LN3A 2NS9A 1H2OA 1LLTA 2KCZA 3C0VA 2Z9ZA 2Q3QA 2LAKA
chains in the Genus database with same CATH superfamily
1XFSA 3OTLA 2E3NA 2LCGA 3TVQA 4C9IA 4DS8A 4N41A 1T27A 1ICXA 2KF2A 2K7HA 3F08A 3K90A 2EJXA 2BK0A 2LE1A 1T17A 4XRTA 3TVRA 1BTVA 3FO5A 1LN1A 4IGXA 5E46A 4JHHA 3NMHA 3PU2A 4REJA 2N4AA 2R55A 2YH6A 4A8UA 3NS2A 2QIMA 2LAFA 3TGOC 2Z9YA 2IL5A 2PCSA 3KB3A 3HXMA 2E3QA 2D4RA 4A80A 5E4DA 3RT2A 5E4BA 3CNWA 4JDAA 4BKCA 5I9JA 1IFVA 2L65A 4NCBA 2PSOA 3NEFA 2KEWA 2E3OA 2REZA 3DLBA 3TL1A 1QMRA 4LA7A 4DSCA 4BKDA 4FPWA 4A83A 5JO1A 2MOUA 3NMTA 5JO2A 3P0LA 4A86A 3H3RA 4BK6A 2L9PA 2FFSA 2A1LA 2LDKA 4QIPA 2K5GA 2L8OA 1JSSA 2LPXA 3NI8A 4REHA 1BV1A 3KDIA 3KLXA 3UIDA 3KAYA 4JHIA 4Y31A 4A8VA 4IH0A 4NCAA 2N4BA 2M47A 2E3MA 4BK7A 4M9BA 3HM9A 1X53A 4JHYA 3Q64A 1XN6A 4A88A 1TW0A 3QSZA 4WVOA 3HVRA 3NMNA 3NJ1A 3GGNA 4IGVA 3ZVUA 4R7KA 1XUVA 2E3RA 2E3SA 3HJFA 3E85A 3GB4A 4XRWA 2GKDA 3HO1A 4QCKA 4QDFB 4GY9A 4RYVA 4E6FA 3OQUA 5I8FA 4LGBA 3R6PA 3H3SA 3PUTA 2NN5A 1FSKA 4C9CA 4LG5A 3P51A 4B9RA 4A87A 1XN5A 1B6FA 3NQNA 4N0GC 3K3KA 4MA6A 3IE5A 4Z3LA 3NMVA 4IGYA 3H3TA 3TFZA 3W9RA 1Z94A 3UJLA 2LUZA 2VNEA 3W9KA 2LEQA 4A81A 4OICA 4C94A 3NJ0A 4A84A 3OH8A 1EM2A 2LF2A 2QPVA 4IGWA 4QDCA 4Q0KA 3F73A 3JRSA 3GTEA 4IH2A 4MNSA 2ZYLA 4A8GA 4N47A 4KPYA 2RESA 3KDHA 3NMPA 4DSBA 3NEGA 1TXCA 2I9YA 4JDLA 4PSBA 3UQHA 2M89A 1ZXFA 3ELIA 3GL0A 3GTSA 4IHRA 1E09A 1UW5A 3KB0A 4M9WA 3KAZA 5EKQC 1LN2A 4QDDA 2LGHA 5JNNA 2VQ5A 1XDFA 3H3QA 2RERA 3KDJA 4LGAA 3RT0C 1FM4A 5E4MA 4N3EA 3WG8A 3JRQB 3NJOA 3IJTA 1KCMA 2FLHA 4QDFA 4MAPA 5C9YA 2LIOA 2KTEA 4REIA 3DLHA 3OJIA 4A85A 2E3PA 1VJHA 3GKEA 3RD6A 5BRLA 2WQLA 3NR4A 3P9VA 3Q6AA 4JHGA 3QN1A 3GL2A 5AMWA 3KL1A 4BTZA 3Q63A 4N76A 1LN3A 2NS9A 1H2OA 1LLTA 2KCZA 3GOBA 3C0VA 2Z9ZA 2Q3QA 2LAKA 3HK2A
chains in the Genus database with same CATH topology
1XFSA 3OTLA 2E3NA 2LCGA 3TVQA 4C9IA 4DS8A 4N41A 1T27A 1ICXA 2KF2A 2K7HA 3F08A 3K90A 2EJXA 2BK0A 2LE1A 1T17A 4XRTA 3TVRA 1BTVA 3FO5A 1LN1A 4IGXA 5E46A 4JHHA 3NMHA 3PU2A 4REJA 2N4AA 2R55A 2YH6A 4A8UA 3NS2A 2QIMA 2LAFA 3TGOC 2Z9YA 2IL5A 2PCSA 3KB3A 3HXMA 2E3QA 2D4RA 4A80A 5E4DA 3RT2A 5E4BA 3CNWA 4JDAA 4BKCA 5I9JA 1IFVA 2L65A 4NCBA 2PSOA 3NEFA 2KEWA 2E3OA 2REZA 3DLBA 3TL1A 1QMRA 4LA7A 4DSCA 4BKDA 4FPWA 4A83A 5JO1A 2MOUA 3NMTA 5JO2A 3P0LA 4A86A 3H3RA 4BK6A 2L9PA 2FFSA 2A1LA 2LDKA 4QIPA 2K5GA 2L8OA 1JSSA 2LPXA 3NI8A 4REHA 1BV1A 3KDIA 3KLXA 3UIDA 3KAYA 4JHIA 4Y31A 4A8VA 4IH0A 4NCAA 2N4BA 2M47A 2E3MA 4BK7A 4M9BA 3HM9A 1X53A 4JHYA 3Q64A 1XN6A 4A88A 1TW0A 3QSZA 4WVOA 3HVRA 3NMNA 3NJ1A 3GGNA 4IGVA 3ZVUA 4R7KA 1XUVA 2E3RA 2E3SA 3HJFA 3E85A 3GB4A 4XRWA 2GKDA 3HO1A 4QCKA 4QDFB 4GY9A 4RYVA 4E6FA 3OQUA 5I8FA 4LGBA 3R6PA 3H3SA 3PUTA 2NN5A 1FSKA 4C9CA 4LG5A 3P51A 4B9RA 4A87A 1XN5A 1B6FA 3NQNA 4N0GC 3K3KA 4MA6A 3IE5A 4Z3LA 3NMVA 4IGYA 3H3TA 3TFZA 3W9RA 1Z94A 3UJLA 2LUZA 2VNEA 3W9KA 2LEQA 4A81A 4OICA 4C94A 3NJ0A 4A84A 3OH8A 1EM2A 2LF2A 2QPVA 4IGWA 4QDCA 4Q0KA 3F73A 3JRSA 3GTEA 4IH2A 4MNSA 2ZYLA 4A8GA 4N47A 4KPYA 2RESA 3KDHA 3NMPA 4DSBA 3NEGA 1TXCA 2I9YA 4JDLA 4PSBA 3UQHA 2M89A 1ZXFA 3ELIA 3GL0A 3GTSA 4IHRA 1E09A 1UW5A 3KB0A 4M9WA 3KAZA 5EKQC 1LN2A 4QDDA 2LGHA 5JNNA 2VQ5A 1XDFA 3H3QA 2RERA 3KDJA 4LGAA 3RT0C 1FM4A 5E4MA 4N3EA 3WG8A 3JRQB 3NJOA 3IJTA 1KCMA 2FLHA 4QDFA 4MAPA 5C9YA 2LIOA 2KTEA 4REIA 3DLHA 3OJIA 4A85A 2E3PA 1VJHA 3GKEA 3RD6A 5BRLA 2WQLA 3NR4A 3P9VA 3Q6AA 4JHGA 3QN1A 3GL2A 5AMWA 3KL1A 4BTZA 3Q63A 4N76A 1LN3A 2NS9A 1H2OA 1LLTA 2KCZA 3GOBA 3C0VA 2Z9ZA 2Q3QA 2LAKA 3HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFS A;  3OTL A;  2E3N A;  2LCG A;  3TVQ A;  4C9I A;  4DS8 A;  1T27 A;  1ICX A;  2KF2 A;  2K7H A;  3F08 A;  3K90 A;  2EJX A;  2BK0 A;  2LE1 A;  1T17 A;  4XRT A;  3TVR A;  1BTV A;  3FO5 A;  1LN1 A;  4IGX A;  5E46 A;  4JHH A;  3NMH A;  3PU2 A;  4REJ A;  2N4A A;  2R55 A;  4A8U A;  3NS2 A;  2QIM A;  2Z9Y A;  2IL5 A;  2PCS A;  3KB3 A;  2E3Q A;  2D4R A;  4A80 A;  5E4D A;  3RT2 A;  5E4B A;  3CNW A;  4JDA A;  4BKC A;  5I9J A;  1IFV A;  2L65 A;  2PSO A;  3NEF A;  2KEW A;  2E3O A;  2REZ A;  3TL1 A;  1QMR A;  4LA7 A;  4DSC A;  4BKD A;  4FPW A;  4A83 A;  5JO1 A;  2MOU A;  3NMT A;  5JO2 A;  3P0L A;  4A86 A;  3H3R A;  4BK6 A;  2L9P A;  2FFS A;  2A1L A;  2LDK A;  4QIP A;  2K5G A;  2L8O A;  1JSS A;  2LPX A;  3NI8 A;  4REH A;  1BV1 A;  3KDI A;  3KLX A;  3UID A;  3KAY A;  4JHI A;  4Y31 A;  4A8V A;  4IH0 A;  2N4B A;  2M47 A;  2E3M A;  4BK7 A;  4M9B A;  1X53 A;  3Q64 A;  1XN6 A;  4A88 A;  1TW0 A;  3QSZ A;  4WVO A;  3NMN A;  3NJ1 A;  3GGN A;  4IGV A;  3ZVU A;  4R7K A;  1XUV A;  2E3R A;  2E3S A;  3E85 A;  4XRW A;  2GKD A;  4GY9 A;  4RYV A;  3OQU A;  5I8F A;  4LGB A;  3R6P A;  3H3S A;  3PUT A;  2NN5 A;  1FSK A;  4C9C A;  4LG5 A;  3P51 A;  4B9R A;  4A87 A;  1XN5 A;  1B6F A;  4N0G C;  3K3K A;  4MA6 A;  3IE5 A;  4Z3L A;  3NMV A;  4IGY A;  3H3T A;  3TFZ A;  3W9R A;  1Z94 A;  3UJL A;  2LUZ A;  2VNE A;  3W9K A;  2LEQ A;  4A81 A;  4OIC A;  4C94 A;  3NJ0 A;  4A84 A;  3OH8 A;  1EM2 A;  2LF2 A;  2QPV A;  4IGW A;  4Q0K A;  3JRS A;  4IH2 A;  4MNS A;  4A8G A;  2RES A;  3KDH A;  3NMP A;  4DSB A;  3NEG A;  1TXC A;  2I9Y A;  4JDL A;  4PSB A;  3UQH A;  2M89 A;  1ZXF A;  3ELI A;  4IHR A;  1E09 A;  1UW5 A;  3KB0 A;  4M9W A;  3KAZ A;  1LN2 A;  5JNN A;  2LGH A;  2VQ5 A;  1XDF A;  3H3Q A;  2RER A;  3KDJ A;  4LGA A;  3RT0 C;  1FM4 A;  5E4M A;  4N3E A;  3WG8 A;  3JRQ B;  3NJO A;  3IJT A;  1KCM A;  2FLH A;  4MAP A;  5C9Y A;  2LIO A;  2KTE A;  4REI A;  3OJI A;  4A85 A;  2E3P A;  1VJH A;  3RD6 A;  5BRL A;  2WQL A;  3NR4 A;  3P9V A;  3Q6A A;  4JHG A;  3QN1 A;  5AMW A;  4BTZ A;  3KL1 A;  3Q63 A;  1LN3 A;  2NS9 A;  1H2O A;  1LLT A;  2KCZ A;  3C0V A;  2Z9Z A;  2Q3Q A;  2LAK A; 
#chains in the Genus database with same CATH topology
 1XFS A;  3OTL A;  2E3N A;  2LCG A;  3TVQ A;  4C9I A;  4DS8 A;  4N41 A;  1T27 A;  1ICX A;  2KF2 A;  2K7H A;  3F08 A;  3K90 A;  2EJX A;  2BK0 A;  2LE1 A;  1T17 A;  4XRT A;  3TVR A;  1BTV A;  3FO5 A;  1LN1 A;  4IGX A;  5E46 A;  4JHH A;  3NMH A;  3PU2 A;  4REJ A;  2N4A A;  2R55 A;  2YH6 A;  4A8U A;  3NS2 A;  2QIM A;  2LAF A;  3TGO C;  2Z9Y A;  2IL5 A;  2PCS A;  3KB3 A;  3HXM A;  2E3Q A;  2D4R A;  4A80 A;  5E4D A;  3RT2 A;  5E4B A;  3CNW A;  4JDA A;  4BKC A;  5I9J A;  1IFV A;  2L65 A;  4NCB A;  2PSO A;  3NEF A;  2KEW A;  2E3O A;  2REZ A;  3DLB A;  3TL1 A;  1QMR A;  4LA7 A;  4DSC A;  4BKD A;  4FPW A;  4A83 A;  5JO1 A;  2MOU A;  3NMT A;  5JO2 A;  3P0L A;  4A86 A;  3H3R A;  4BK6 A;  2L9P A;  2FFS A;  2A1L A;  2LDK A;  4QIP A;  2K5G A;  2L8O A;  1JSS A;  2LPX A;  3NI8 A;  4REH A;  1BV1 A;  3KDI A;  3KLX A;  3UID A;  3KAY A;  4JHI A;  4Y31 A;  4A8V A;  4IH0 A;  4NCA A;  2N4B A;  2M47 A;  2E3M A;  4BK7 A;  4M9B A;  3HM9 A;  1X53 A;  4JHY A;  3Q64 A;  1XN6 A;  4A88 A;  1TW0 A;  3QSZ A;  4WVO A;  3HVR A;  3NMN A;  3NJ1 A;  3GGN A;  4IGV A;  3ZVU A;  4R7K A;  1XUV A;  2E3R A;  2E3S A;  3HJF A;  3E85 A;  3GB4 A;  4XRW A;  2GKD A;  3HO1 A;  4QCK A;  4QDF B;  4GY9 A;  4RYV A;  4E6F A;  3OQU A;  5I8F A;  4LGB A;  3R6P A;  3H3S A;  3PUT A;  2NN5 A;  1FSK A;  4C9C A;  4LG5 A;  3P51 A;  4B9R A;  4A87 A;  1XN5 A;  1B6F A;  3NQN A;  4N0G C;  3K3K A;  4MA6 A;  3IE5 A;  4Z3L A;  3NMV A;  4IGY A;  3H3T A;  3TFZ A;  3W9R A;  1Z94 A;  3UJL A;  2LUZ A;  2VNE A;  3W9K A;  2LEQ A;  4A81 A;  4OIC A;  4C94 A;  3NJ0 A;  4A84 A;  3OH8 A;  1EM2 A;  2LF2 A;  2QPV A;  4IGW A;  4QDC A;  4Q0K A;  3F73 A;  3JRS A;  3GTE A;  4IH2 A;  4MNS A;  2ZYL A;  4A8G A;  4N47 A;  4KPY A;  2RES A;  3KDH A;  3NMP A;  4DSB A;  3NEG A;  1TXC A;  2I9Y A;  4JDL A;  4PSB A;  3UQH A;  2M89 A;  1ZXF A;  3ELI A;  3GL0 A;  3GTS A;  4IHR A;  1E09 A;  1UW5 A;  3KB0 A;  4M9W A;  3KAZ A;  5EKQ C;  1LN2 A;  4QDD A;  2LGH A;  5JNN A;  2VQ5 A;  1XDF A;  3H3Q A;  2RER A;  3KDJ A;  4LGA A;  3RT0 C;  1FM4 A;  5E4M A;  4N3E A;  3WG8 A;  3JRQ B;  3NJO A;  3IJT A;  1KCM A;  2FLH A;  4QDF A;  4MAP A;  5C9Y A;  2LIO A;  2KTE A;  4REI A;  3DLH A;  3OJI A;  4A85 A;  2E3P A;  1VJH A;  3GKE A;  3RD6 A;  5BRL A;  2WQL A;  3NR4 A;  3P9V A;  3Q6A A;  4JHG A;  3QN1 A;  3GL2 A;  5AMW A;  3KL1 A;  4BTZ A;  3Q63 A;  4N76 A;  1LN3 A;  2NS9 A;  1H2O A;  1LLT A;  2KCZ A;  3GOB A;  3C0V A;  2Z9Z A;  2Q3Q A;  2LAK A;  3HK2 A; 
#chains in the Genus database with same CATH homology
 1XFS A;  3OTL A;  2E3N A;  2LCG A;  3TVQ A;  4C9I A;  4DS8 A;  4N41 A;  1T27 A;  1ICX A;  2KF2 A;  2K7H A;  3F08 A;  3K90 A;  2EJX A;  2BK0 A;  2LE1 A;  1T17 A;  4XRT A;  3TVR A;  1BTV A;  3FO5 A;  1LN1 A;  4IGX A;  5E46 A;  4JHH A;  3NMH A;  3PU2 A;  4REJ A;  2N4A A;  2R55 A;  2YH6 A;  4A8U A;  3NS2 A;  2QIM A;  2LAF A;  3TGO C;  2Z9Y A;  2IL5 A;  2PCS A;  3KB3 A;  3HXM A;  2E3Q A;  2D4R A;  4A80 A;  5E4D A;  3RT2 A;  5E4B A;  3CNW A;  4JDA A;  4BKC A;  5I9J A;  1IFV A;  2L65 A;  4NCB A;  2PSO A;  3NEF A;  2KEW A;  2E3O A;  2REZ A;  3DLB A;  3TL1 A;  1QMR A;  4LA7 A;  4DSC A;  4BKD A;  4FPW A;  4A83 A;  5JO1 A;  2MOU A;  3NMT A;  5JO2 A;  3P0L A;  4A86 A;  3H3R A;  4BK6 A;  2L9P A;  2FFS A;  2A1L A;  2LDK A;  4QIP A;  2K5G A;  2L8O A;  1JSS A;  2LPX A;  3NI8 A;  4REH A;  1BV1 A;  3KDI A;  3KLX A;  3UID A;  3KAY A;  4JHI A;  4Y31 A;  4A8V A;  4IH0 A;  4NCA A;  2N4B A;  2M47 A;  2E3M A;  4BK7 A;  4M9B A;  3HM9 A;  1X53 A;  4JHY A;  3Q64 A;  1XN6 A;  4A88 A;  1TW0 A;  3QSZ A;  4WVO A;  3HVR A;  3NMN A;  3NJ1 A;  3GGN A;  4IGV A;  3ZVU A;  4R7K A;  1XUV A;  2E3R A;  2E3S A;  3HJF A;  3E85 A;  3GB4 A;  4XRW A;  2GKD A;  3HO1 A;  4QCK A;  4QDF B;  4GY9 A;  4RYV A;  4E6F A;  3OQU A;  5I8F A;  4LGB A;  3R6P A;  3H3S A;  3PUT A;  2NN5 A;  1FSK A;  4C9C A;  4LG5 A;  3P51 A;  4B9R A;  4A87 A;  1XN5 A;  1B6F A;  3NQN A;  4N0G C;  3K3K A;  4MA6 A;  3IE5 A;  4Z3L A;  3NMV A;  4IGY A;  3H3T A;  3TFZ A;  3W9R A;  1Z94 A;  3UJL A;  2LUZ A;  2VNE A;  3W9K A;  2LEQ A;  4A81 A;  4OIC A;  4C94 A;  3NJ0 A;  4A84 A;  3OH8 A;  1EM2 A;  2LF2 A;  2QPV A;  4IGW A;  4QDC A;  4Q0K A;  3F73 A;  3JRS A;  3GTE A;  4IH2 A;  4MNS A;  2ZYL A;  4A8G A;  4N47 A;  4KPY A;  2RES A;  3KDH A;  3NMP A;  4DSB A;  3NEG A;  1TXC A;  2I9Y A;  4JDL A;  4PSB A;  3UQH A;  2M89 A;  1ZXF A;  3ELI A;  3GL0 A;  3GTS A;  4IHR A;  1E09 A;  1UW5 A;  3KB0 A;  4M9W A;  3KAZ A;  5EKQ C;  1LN2 A;  4QDD A;  2LGH A;  5JNN A;  2VQ5 A;  1XDF A;  3H3Q A;  2RER A;  3KDJ A;  4LGA A;  3RT0 C;  1FM4 A;  5E4M A;  4N3E A;  3WG8 A;  3JRQ B;  3NJO A;  3IJT A;  1KCM A;  2FLH A;  4QDF A;  4MAP A;  5C9Y A;  2LIO A;  2KTE A;  4REI A;  3DLH A;  3OJI A;  4A85 A;  2E3P A;  1VJH A;  3GKE A;  3RD6 A;  5BRL A;  2WQL A;  3NR4 A;  3P9V A;  3Q6A A;  4JHG A;  3QN1 A;  3GL2 A;  5AMW A;  3KL1 A;  4BTZ A;  3Q63 A;  4N76 A;  1LN3 A;  2NS9 A;  1H2O A;  1LLT A;  2KCZ A;  3GOB A;  3C0V A;  2Z9Z A;  2Q3Q A;  2LAK A;  3HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...