3H3UA

Crystal structure of crp (camp receptor protein) from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
216
Chain Sequence
DEILARAGIFQGAIAALTQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
total genus 61
structure length 216
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3uA01
1FPQA 2DPUA 1OFNA 5E8IA 5A2QK 2P5VA 1HSJA 3F8MA 2VT3A 2ESNA 3MPBA 2QBYB 3SCGA 1YUDA 1R5HA 2CYYA 2K27A 1U3EM 4L9NA 2AS5F 1BOAA 2NRAC 1G3WA 4O6JA 2PQQA 3FE5A 5I91A 2ZBKA 1HKQA 3WTZA 3S2WA 2MBFA 3CO7C 4IEUA 1TLHB 3ZQ7A 4AVPA 1RL3A 4DINB 2N7GA 3GW2A 3SZTA 3U1DA 1MGTA 4P5OA 4NHJA 3OV8A 2ADUA 3J80K 4ZU5A 4LFUA 2YPRA 2Z9OA 1Y0UA 4L11A 2ISZA 2RNJA 3T8TA 3KGZA 3ST7A 4U7BA 2QUFA 4G7HF 4KN7X 3LQRA 3QPTA 3CJXA 4QM9A 5TRDA 1V70A 4EJOA 5ILUA 2HEOA 3IWFA 5I0TA 2K0GA 1ZZBA 1U78A 4O9EA 3QOPA 4NB5A 4XFIA 3F8NA 3T5XA 4RGXA 3WODF 2VONA 2HFHA 3QACA 2XKOA 3LA7A 2UZKA 4KU8A 1XD7A 2WC2A 2Q4SA 2W57A 4Q0PA 2KKOA 2UY8A 4IESA 4IEXA 2IA0A 4UV9A 3QRFF 3E97A 3HHHA 4XFGA 2Z99A 3FM3A 1G3SA 2VECA 1ZZ6A 1S7OA 4XLPF 2Y48A 5DUKA 3T1BA 5I0SA 1QQIA 4EJTA 1FXZA 4MTDA 1ZG3A 3LAGA 2Q1ZB 4UUVA 4I7HA 3N97A 2X0LA 1UIKA 2I45A 5BQTA 1UHMA 2R7DA 2ZXJA 5FLXK 3M70A 1I27A 5FPXA 2ATFA 5JSRA 1ZZCA 4ASNA 3K9TA 2IXJA 3QAHA 2FRHA 2MD5A 2QYOA 3ZMVA 4KN4X 5CJ9A 2IA2A 2PBIA 1SFUA 2A6EF 5D8LB 5D5WB 4M9SA 4Z07A 6PAXA 2O1QA 3NVCA 2BNMA 4IRHA 2BNOA 4L0YB 2P7CB 3ML6A 5CVUA 3E6MA 4XETA 1QY4A 2LSOA 5J3UA 1DGWA 1ZYRF 1BI0A 1Q1HA 2FQPA 4JQFA 4MQVA 3GFMA 3BPXA 2RC4A 3TO7A 2XV4S 4QM8A 3ERED 4MGIE 5LHGA 4G7ZF 4YRDA 2W84A 1UD1A 1CAWA 3DFGA 1XGNA 1I1GA 4LB5A 2H6BA 2JZYA 2HQRA 1S6LA 1V3FA 3DF8A 5FFZA 3IDCB 4BAYA 1AOYA 3HYIA 1U8RA 5KHGA 3Q9SA 1H9TA 4H7LA 4RB3C 4CDGA 3WGHA 1ZRCA 1OYIA 4XF9A 2CQKA 3ZMZA 4AQ2A 3ISPA 3RPUA 2ZO4A 1CAUA 1F5TA 4E2SA 4MNUA 4WX9A 2IPQX 3KP2A 1HSTA 2GC0A 3WTWC 1G3YA 4S04A 4A2UA 4J1WA 3MYXA 1R1VA 1W5SA 3TO6A 1V4RA 5CVJA 2UXXA 2PEXA 3NL1A 4LJZF 4G8XA 3QP6A 2COMA 1Q3EA 3IWZA 4U88A 1O3SA 3DPLC 1FZPB 2VBYA 5HS8A 2KIFA 2DCTA 3WTVC 2PN6A 3F72A 2FNAA 3IBMA 5K5OA 5D5UB 1OD5A 1KQ8A 4WXCA 5DV5A 4L9VA 4BHCA 4RD7A 2HKOA 3CUQB 1OPCA 5FPZA 3IKVA 1UB9A 1X7NA 2GQQA 1R5GA 2DQLA 1UFMA 3BU7A 3RIRA 4Q0VA 2CV6A 5T3NA 5JSPA 4U0WA 1YS6A 2OQRA 4FX0A 1ZZ9A 4CICA 1FLIA 3D0JA 1WQ2A 3HTSB 3SMHA 2HDCA 3I7DA 2PFWA 2HKXA 3WU1B 2C6YA 2OA2A 1HXDA 2FF4A 1J3PA 5C6CA 5K5QA 2NAZA 3CF6E 3QPHA 3UKNA 2M87A 2H09A 2BYVE 3JZVA 4Y13A 4FAHA 3S0MA 3F3XA 4XSXF 3GFIA 4U0VA 5IT9Z 5ICEA 3KETA 3BROA 1IN6A 3IKTA 2JRTA 4OMYA 2DFIA 3V4GA 1J3QA 2BNNA 5J6XA 2J5OA 2P6TA 1TBXA 2EFPA 2JT1A 2GXBA 2G7HA 2K86A 2VOOA 2MA3A 4UVCA 3WU0A 1D3YA 3G73A 4ESFA 1YFUA 5FCCA 4OLLA 1L3LA 5D6EA 1MKMA 4HX4A 1L0OC 1QZZA 1MZBA 1J7KA 1XSVA 1QGPA 1E17A 1J2XA 1ON2A 3GXOA 4XBFA 2MLKA 1H9GA 4XFCA 1WA4A 1XCVA 5BPDA 4YFNF 4I0AA 4PIYA 4HQMA 5BPIA 4M6YA 2ET1A 2TDXA 5ERIA 4AWXB 4Q29A 3MWMA 1ZNPA 4BQAA 1TQMA 2V1DA 4RS8A 1IUYA 4E2QA 1ZRRA 3K1NA 2MC3A 2HS5A 2H0VA 2FEZA 2CAVA 4JK1X 4L9TA 4IHTA 3LAPA 3C7JA 1S3JA 2L01A 2FBHA 5FD6A 1YFHA 2D40A 5I0UA 3MQ0A 1F1ZA 2DW4A 4DQ2A 1P92A 4GYGA 2JSCA 2Z33A 4BXUA 2HQNA 2V9VA 2IC1A 1LDKB 4BH9A 4EJVA 1KYWA 3PQJA 1W5TA 4WF2A 3NKTA 3D0SA 2DTRA 1P4WA 1J58A 4I09A 2RDPA 3L2HA 5ILSA 3ECHA 1Z6RA 1GXPA 4MTEA 1VP6A 1KYZA 2R3SA 4KFCA 3SZPA 4R1HA 1W7PD 2RN7A 5HLHA 1UHWA 3IL2A 4LTAA 1JHHA 3EQEA 4EVIA 2DT5A 3WGIA 2DLLA 3TGNA 4EV0A 1WI9A 4BHPA 3PNAA 2QJVA 3FX3A 5BUVA 4LLOA 2R7FA 2GA2A 1UW8A 1BI1A 3DPTA 3BPVA 2P5LC 4JVAA 4WVZA 2LF7A 3E5UA 4RB0A 3WW1A 2QNKA 4EQQA 4IF4A 5ICGA 1T6SA 5LHIA 5E18F 4K2EA 2Q2EA 4PZJA 2CSOA 5FLXZ 1K78A 4YG2F 2Y0MA 3QP5A 4MGRA 3TNPB 3Q5FA 3HSRA 1ZZ8A 3IRRA 2ZMEA 3HT1A 3HOTA 2QQBA 5AVPA 1XE7A 3EYIA 1PUEE 4CGZA 2QVSB 3L00A 4RGRA 4RB1A 1J59A 3ZDSA 2GC2A 2QQAA 4YFKF 1X8EA 4XF0A 4Q4ZF 1F9NA 2WWYA 2B8MA 3DXJF 4LULA 2LNBA 2P8TA 2OD5A 3V7RA 3N4MA 2LDUA 4OMZA 3S7IA 4D0PA 5LLQA 1TQIA 2PFBA 1QNTA 4L0ZB 3U0ZA 1RZ4A 5E1ZB 3DEUA 4ESJA 3TOBA 5LBQA 4MGYE 3ABTA 2Y75A 3ULQB 3R6SA 1JHFA 2IXKA 2NYXA 4HDUA 3K1MA 4XFHA 1HW5A 3LSTA 2ETEA 1Z91A 2B0LA 4HLYA 2EFWA 4MHGA 1RUOA 1WGPA 4EWEA 5LEJA 1B9MA 3FF5A 1GXQA 1SD6A 4WWCA 3RYPA 2OZJA 4QXKA 4EWDA 1MJBA 2DPDA 2O0YA 4IXAA 4PCQA 3OD0A 1Z1DA 3NJZA 5H6QA 4CYDA 3RYKA 1CAWB 1JUHA 5DDGA 4MGZE 1ONVA 4A6DA 1DGRA 3T8RA 1T38A 2VOPA 2ET7A 1BIAA 3WTYC 1EP0A 3HHGA 4I98B 4A5MA 3HOSA 4Q0SA 2HWVA 4LK1F 1BN5A 4E70A 1QXRA 4ZYDA 4JTNA 5EFUA 4HA8A 4QMAA 1SD5A 3JTGA 3W6KB 4QGLA 2QZ8A 3NW4A 4WZCA 2FOKA 5F1RA 1LB2A 2EV0A 3K2ZA 1IF1A 1CAUB 3ROUA 3CUQC 2DO7A 4GYIA 1R00A 4WCGA 2VT2A 1OKRA 2PAKA 3C1DA 2GXGA 2OPKA 5KHJA 1FC3A 2K7LA 1E2XA 2EA7A 3I64A 2HJIA 3EUHA 2MPFA 1TW2A 3CEWA 5EEGA 4EJWA 4YSFA 3EJKA 1FY7A 1CGPA 2DK5A 3M8FA 4M9ZA 2IVMA 3KEOA 1S7AA 3HRTA 1A04A 1L3JA 1YW8A 3CTAA 3V8KA 3F21A 2Z2SB 1IN7A 2EWNA 4CXFA 2Y0OA 1ZGAA 4IEWA 1PDNC 2NNNA 2YX4A 2HOEA 4HVOA 5JHUA 5LRSA 1LJ9A 4LEJA 5JR3A 4Z2YA 3S7EA 2O03A 2XL9A 1R1TA 2PA7A 4XLNF 2P4WA 4AD9A 2IRFG 1TQ5A 4I01A 3MDPA 4G6DA 4Q0QA 1C0WA 2F5DA 4XF1A 2DI3A 2UWMA 1HBXG 4LLLA 3I71A 2Q30A 3EO6A 3ES1A 4KMUX 1TNSA 2A07F 1GQHA 3HRSA 3LAJA 2EFOA 2L4MA 2E7XA 5ILVA 2GU9A 3FMQA 5H6RA 5E1RA 3LWFA 3VFZA 3BJAA 1QBJA 2ZMEB 1SD7A 1EY2A 2BGCA 1HKSA 1NHAA 2DQRA 1EH6A 1HW1A 2D5HA 3JTHA 2M8EA 5FQ0B 2VXZA 3JAMK 2ZFWA 1XB4A 3HIFA 1ZG5A 4LUMA 1IXRC 5CVVA 2HR3A 4WXHA 1WSUA 3PQKA 2FQ3A 1KU9A 5BV6A 1VJ2A 1T0FA 2W25A 1CF7A 3TNQA 1PP8F 1VR3A 4ONUA 4Q47A 4Q48A 2XROA 1Q5OA 2YR2A 2GC3A 3H1YA 3EBRA 5DYMA 2KXLA 1MDMB 4KWLA 1EH8A 2FBIA 3R4KA 1P6RA 2IT0A 2EK5A 3VODA 3L2CA 1GVJA 1K78B 5F6FA 4FT8A 3M9AA 5FLJA 2XLGA 1D8KA 3MCZA 2ETHA 4Q0UA 5JFRA 3ACLA 1ZN2A 2HZTA 5JSOA 3TDZC 2MLGA 4LB6B 4F8AA 1H1MA 5CLSA 2XAQA 4F7ZA 5DUIA 1J0RA 2Q0AA 3F8CA 3GZ6A 2OA4A 2Q0OA 2G9WA 2FSWA 3SCHA 1D5VA 2XLAA 2UY9A 3NEUA 4LA3A 4OINF 3BZ6A 2XLFA 1KU3A 2VODA 3EHKA 2ZCWA 1BBYA 5JI6A 2QLZA 1YW9A 1ZG1A 4JTOA 4MEYF 4B29A 4OIPF 1J9IA 3H3ZA 2K02A 3SXYA 5BMZA 3L9FA 5LRRA 3IRQA 4EGYA 4FHTA 3RKYA 4B09A 3WTUC 4MQ9F 1USSA 2M5WA 4UVAA 1Y9QA 5A2QZ 2V79A 1Z6TA 1O3RA 4KWKA 3WE3A 2PAMA 3PFIA 4P55A 2QENA 4I02A 3NRVA 2D93A 3GYHX 3F22A 3RKXA 1T98A 3MZYA 2ISYA 1P4XA 1IXSB 3D5LA 4ETSA 2YU3A 1SAXA 2XAFA 1TW3A 3NQOA 3P7NA 4XF3A 2ZNZA 2EFNA 1SFEA 5FFXA 2JPBA 2GC1A 1LR5A 2B5HA 2QM3A 3O14A 5CADA 5D1IA 1IN8A 1KU7A 3VB2A 3EETA 4HF0A 3GFJA 3KGLA 4P9GA 3WTTC 3ELKA 2IP2A 3LQQA 4XFAA 2A61A 1PP7U 3TOAA 3EYYA 2A5YB 2M45A 2BE5F 2ZJ2A 2E1NA 1FI2A 1FSEA 4KT5C 5I8SA 1DZRA 2RQPA 3ZMSA 4UNOA 4I3PA 4JV4A 4EM2A 1YYVA 1NE4A 1VTNC 3KP6A 2O8QA 4LUKA 3T0YA 4L5IA 4P9FA 3R0AA 5LGUA 3OTFA 2V1UA 1X82A 4IEOA 4M71A 5D5XB 3R0JA 1NYWA 1R23A 3MZHA 4RB2C 5E8GA 4IHSA 2CAUA 4HF1A 1YTYA 3ZMDA 1K7AA 3M3IA 3TQNA 5J8CA 3VEPA 1J3RA 2EFQA 3I59A 3P9CA 3USSA 4GGGA 4DNCA 4ZZLA 1DUXC 4JBAA 3IHUA 1BM9A 3K1PA 2OYZA 4BIFA 2ELHA 3HT2A 4HSLA 3WW4A 4UXNA 1J1LA 4KU7A 4QGMA 2MH9A 1YFXA 1IN5A 1JXSA 2C0ZA 5K1YA 5ICFA 3H3UA 3FXRA 4I2OA 1OYWA 4HW0A 1R58A 3E6DA 1GHCA 4HBLA 2VQAA 3SHFA 3KLNA 1PM7A 4MZUA 1SFXA 3FHZA 3E5QA 2EA2A 1K6OA 1ZGJA 4Y15A 5FO5A 2F5EA 1EYBA 2V1XA 1EH7A 2ACJA 4Q5SF 1IPKA 4KICA 2RVCA 3QU6A 3BALA 3KSCA 2F5FA 3ELNA 5I8YA 4QWQA 5KHHA 4QLCU 2QWWA 1FBUA 3H50A 1YW7A 3F6OA 2ZKZA 2P17A 1HQCA 2VN2A 1IRFA 4IVNA 4OOIA 2IW5A 2K4BA 2D5FA 3GX4X 1CF7B 1XE8A 4KYWA 4KIFA 3UKVA 3E6BA 4L9JA 2KJCA 4AQ6A 3P9IA 2D45A 4WXDA 4AIJA 1CX4A 5E16A 1W7PB 1YLFA 2EV5A 2L54A 5I93A 1DPRA 3J81Z 2ZKLA 3R60A 5D4SA 1SMYF 1ZREA 4O5VA 2L4AA 2IXLA 5E20A 1KU2A 2YSRA 4OFGA 4AVAA 2D1VA 3I59B 1G6NA 4N9HA 4O9GA 4S05A 2GZWA 2PG4A 4MH0E 1O3TA 5ICCA 3ZN1A 1P2FA 1OMIA 2PI0A 5HI0A 4TV7A 4YARA 3WW2A 4HX7A 3WTXC 2L3DA 1IZ1A 3MEXA 4IEPA 1DDNA 5KK1A 5LHHA 4ON0A 3KE2A 2O6GE 1QZYA 1T39A 1TTYA 5FGMA 4KL1A 1OYYA 2CGPA 1XGOA 4PIXA 3ZMUA 5HVQC 2M1BA 1MD0A 5K5RA 4XFFA 1SQ4A 1LQ1A 4HLTA 3BWGA 4ZU4A 3GBFA 1U5TA 5J48A 4X6QB 5JVTA 2CFXA 3BOQA 3EQLF 1UCRA 3HTUA 3D82A 5HOOA 2PJPA 3U11A 4WK8F 2EJRA 1BC7C 2XHKA 1YG2A 2DBBA 4GCVA 1QPMA 4HN0A 1REPC 3AAFA 2H27A 1YWKA 4NVPA 3UKTA 4FX4A 2M30A 3KP5A 2Z69A 4LMYA 4IEZA 4X6RB 1G3TA 2BBYA 4KIBA 3WG9A 1YS7A 3KP4A 3BP8A 2DK8A 4G6QA 2AXLA 5L3GA 5CU1A 1DZTA 4NQWA 2J5PA 1LVAA 4MUVA 2K4JA 2F2EA 3GFLA 5HLGA 3U10A 2RKHA 2P5KA 5BS6A 4HVQA 1STZA 1FYKA 1YFWA 2IXCA 1WKMA 1XSDA 3OF1A 4R52A 2DU9A 3F8FA 5L3EA 2STTA 4YYOA 5JCTA 1RUNA 1F4KA 3ZPLA 1YO5C 4I0BA 4RGSA 3B02A 2PAEA 4CZZA 1WWXA 1HKTA 3REOA 4G7OF 4IETA 3DKWA 4CO8A 3G7DA 1NZCA 2PTMA 3HRMA 1FWZA 3KEQA 4EM0B 4M6XA 4A12A 4AIKA 5E1WA 3LFKA 5CVIA 5J8FA 3IDBB 1D8JA 1LDDA 2MNGA 3LZZA 4HV6A 2FA5A 3KP3A 3SXWA 4ENNA 1S29A 4PDKA 2CO5A 2Q8KA 1R36A 5D5VB 3SCFA 3I0TA 5KHIA 3RI4A 4CHUA 2LKPA 3FMRA 1SD4A 3BB6A 3JSOA 2CW0F 1K79A 1GQGA 1U6GA 3ZP5A 2B9UA 1XMAA 2KIMA 1YIOA 3B73A 2XL7A 3BJ6A 3U2RA 2V09A 1W4MA 1CAXB 5CVRA 3TDUC 4YFXF 1Y3TA 1H1IA 2A3SA 1UCXA 2D1HA 4YIIA 2EV6A 2STWA 4GO1A 3FMSA 3FJSA 4HVRA 1ZLJA 1ON1A 4IPAA 4YIFA 2UYBA 2EAAA 3CJNA 4FAGA 1T2KA 1FBSA 5L3CA 1WRJA 2A69F 3I4PA 1B1BA 2GA1A 1ZH5A 3JW4A 3E3VA 2HYFA 5AIPA 3CO6C 2ZNYA 2F4PA 1XN7A 5LEKA 1O7LA 2GWRA 1ULYA 3CDHA 3RDIA 1BIBA 1FSHA 2IJLA 5L3FA 1RNLA 3O6BB 4ORFA 3VHRA 4HV5A 4G9YA 4KMFA 1EV7A 4OIOF 2OZUA 1Q43A 5K8SA 3DL3A 3KZZA 1XDUA 5E17F 2MHFA 4D7TA 1YHFA 2KRFA 3HUGA 2VC1A 2Z5UA 3NSTA 3DV8A 3KP7A 3R61A 2QCSB 3PVBB 3CL1A 1IAWA 2HTJA 4L5JA 1YQAA 1EPZA 4R8HA 4MEXF 5HS9A 1R22A 2IA1A 3J81K 3CO2A 3BDDA 3I5UA 3EDPA 1UPIA 2CG4A 4PGHA 1FOKA 1G4DA 2PMUA 2O8XA 2A68F 4P96A 4HAMA 3IIAA 1ZZ7A 1FYMA 3DN7A 3H9AA 4LGWA 3FXQA 1RGSA 1XCBA 3L09A 3COAC 3GO5A 3H1MA 2Z3YA 4Z82A 4OU0A 5HDGA 1JE8A 4ZYGA 2VBZA 4EWAA 4HX8A 1WLTA 4XSZF 3JSPA 2OU2A 2XASA 4EGZA 5HDNA 1MJ9A 3LOIA 3ZN0A 5LGTA 1OR7A 1HW2A 2P6SA 4A5NA 3KZYA 5DCMA 5I8TA 1FNNA 4ENJA 2BV6A 3U9GA 4QGNA 5F64A 1XGMA 4GXOA 5EZWA 5DD4A 2QVOA 3HSEA 4UBGA 3OCPA 3WW3A 3HQXA 1FX7A 2VBWA 1J75A 5JR7B 1I5ZA 1KGSA 2XGXA 3E5XA 3KMHA 3FFQA 1XMKA 4WBBA 2QBYA 1CAVA 4EMSA 5HDKA 4ENKA 1YLLA 4KIGA 2XKPA 4HSJA 5KHKA 1AWCA 5HLIA 5J7MA 3C3VA 3I54A 4RAZA 3RNSA 2OAZA 4KA4A 5DEQA 5E1XA 3MFKA 4LLGF 4HZFA 3LA2A 5D4RA 1TNTA 4XEZA 4BYYA 1KA8A 4AVCA 4LG0A 2HYGD 2FU4A 2H6CA 1KQ0A 2JTVA 1B6AA 4HN1A 4EM1A 5ED4A 2PYTA 3RJPA 2IXHA 5D6FA 1O57A 1QXJA 4IJAA 4KDPA 4IRIA 1TQPA 2VE9A 3RZZA 1ZVFA 2LF8A 1LEAA 2WV0A 1SFNA 4ZYHA 4PJYA 1H0MA 2PHLA 1O5UA 1FBQA 2W24A 3GYDA 3LA3A 4BHBA 2JPCA 4LA2A 3GEZA 2NNYA 4HQEA 4ZU7A 5FB2A 2F5CA 1RTVA 4HF2A 3K69A 2FBKA 2V6CA 3VOEA 4U7DA 4O3MA 1U12A 3L7WA 1LNWA 3O2PE 3H7JA 4OIQF 2KJBA 3P9KA 4GULA 4UBHA 1ZRDA 3CLPA 2G7UA 5FDBA 1IPJA 2GIVA 5D8KB 1NXMA 4ENMA 4MGKE 3GUDA 4A0XA 1MJAA 2XAHA 1IN4A 2KIUA 3Q9VA 4A6EA 3I58A 3FZ3A 1IW7F 5BXXA 5DCFA 5BY5A 4KWJA 1LKNA 5EEHA 1P4AA 2HGCA 3H92A 3V8JA 1FP1D 2E9QA 4HDVA 5KVRA 1XRUA 4FBFA 4M74A 1B9NA 3KCCA 2BEOA 3RPQA 3F8BA 4IEQA 4M73A 1W7PA 5C8WA 4UV8A 5FLIA 1RIOH 3ECOA 2EA4A 2MH2A 4M72A 4E2GA 2A6HF 1IXCA 4RGUA 3GVAA 5I0RA 2O3FA 1ZARA 5HS7A 3ZMTA 4Y17A 4M9XA 5BPXA 4LK0F 2FNPA 3G3ZA 2L02A 3BY6A 1PMIA 2OBPA 3H8UA 3GF2A 3OOPA 1UIJA 1KQ9A 3H7YA 1RI7A 1RC6A 1BC8C 4EJUA 4AVBA 2K9ZA 5KBFA 3V7SA 1ZRFA 3I53A 3LWCA 2XAGA 2VC0A 1U2WA 2X4HA 4HOBA 3J7AO 2XVCA 2UXNA 1CAVB 3CLOA 2IXIA 5H20A 1S8NA 4H0EA 2H94A 3KFWX 5FD5A 3RKWA 4XFBA 2UYAA 3M8EA 3FZVA 3V7CA 3K0LA 4UHTA 2FE3A 3W6JB 5L3BA 1B59A 4ZH4F 2VBXA 2W85A 5IT9K 4MX3A 2EB7A 1X3UA 4XF4A 3MAJA 3RTRA 3WTSC 2FXAA 3BPZA 2O61A 1XDSA 2D2WA 3F6VA 1BJAA 1LDJA 4AIHA 2CWEA 3F23A 3SQNA 3SFZA 5FQ0A 2PLYA 2XIGA 1SEFA 4UXAA 1Z7UA 3KLOA 3C3WA 1J5YA 4LD5A 2EVXA 3O3KA 2OQGA 3WE2A 3GWZA 1IRGA 4HLXA 4L2NA 1MDMA 4N9IA 4IEVA 1U5TB 2OZ6A 4UVBA 3E6CC 2GAUA 1FYLA 4L18B 3M1EA 4G94A 1SMTA 1ODDA 4IRGA 3OGJA 4IERA 2XRNA 5AONA 5BOXA 1FT9A 1DPUA 3ES4A 4IEYA 3CUOA 4ZZDA 4YNIA 3FHIB 1XSXA 3J80Z 4AXOA 2HTSA 4PGGA 3FWEA 2PMHA 5LGNA 5TJJA 2RV8A 4R79A 4LLNA 4PIZA 4ESBA 3HRUA 4D7SA 4HYEA 3SHRA 2P7VB 3GZ5A 3H1WA 1NE6A 4META 2RGVA 3WGGA 4A0ZA 2QQ9A 2PHDA 4J1XA 3BJOA 1ZAOA 4U0YA 1OI6A 4OIRF 4KNYA 3FXUA 1ZLKA 3DP7A 5AIQA 1LEBA 2E1CA 3V8LA 2DAOA 4P9UA 2GH2A 1B4AA 3HSFA 3JAMZ 1FP2A 3C18A 4LG0B 3FM5A 1JGSA 2PQ8A 2NS0A 5JAXA 1ZX5A 1O3QA 4A0YA 2WFPA 3CUQA 4TLFA 5FLHA 1X8MA 3GLXA 4MV2A 4EROA 3RYRA 1I1SA 1Z05A 1BI3A 2E7WA 3ETQA 1O4TA 2VE8A 3IC7A 4XRFA 1O5LA 3TKYA 2VPVA 4N0BA 1BI2A 5CYVA 3ABUA 4HMZA 4HBNA 4B8XA 3BCWA 1XGSA 1QWRA 2WTEA 3DQVC 1Z9CA 2XAJA 2XUBA 3PLQA 5DCMB 1I6XA 1CAXA 5DD8A 5L3DA 4ZYEA 1R1UA 1R7JA 3TO9A 1LRHA 1ZHFA 2QDRA 1YFYA 1USTA 1DP7P 2YX7A 4KUMA 1O7FA 4BNCA 3QU3A 5IT3A 2FMYA 2FMLA 1QO0D 1U5TC 4RAYA 3M7GA 4K8FA 2ESHA 4QX5A
chains in the Genus database with same CATH superfamily
2R7TA 3THDA 3WDXA 4EEFG 3LB9A 2ORZA 5E8IA 2WZR3 2V9PA 4JKLA 2WLPA 2VT3A 4GIQA 4JDOA 1XNBA 5M5XJ 2OCCH 3H9QA 2FD5A 2BGPA 3SCGA 4YW1A 2E7TA 4E6KG 5TISC 1R5HA 4XQ4A 4QHBA 1PX3A 3ONQA 2BRTA 4L9NA 4FQGA 4Y22B 1BOAA 2NRAC 1XYOA 1M1EB 2PQQA 1MPXA 4I6ZA 1HKQA 3Q0UA 3G4SI 3WTZA 4E9KA 2W87A 2SBAA 4IE6A 5CEHA 4IEUA 1TLHB 2ID3A 1RL3A 4U2AA 1UMZA 3U1DA 5FYZA 2LOOA 1KFUL 3T0DA 3OV8A 4LHNA 2ADUA 4LFUA 2L2OA 3ZMNA 2ISZA 4U7BA 4A3EJ 1GOGA 3AKRA 3LQRA 3QPTA 1N75A 4EJOA 5I0TA 1ZZBA 1JS9A 1JGGA 2FDHA 5GZGA 1TNFA 3WODF 4P08A 1KONA 4KU8A 3C2HA 2Q5TA 1QJY3 2Q4SA 3WDVA 2WT0A 1HV1A 1R1A1 4IESA 4IEXA 3ZYIB 4XAAA 1OA3A 4UV9A 3RZKA 2LALA 2LR8A 3ZXEA 5F08A 1CVNA 3J8F2 1ZZ6A 2RV9A 3AZYA 3FHNA 5EDNA 2X6WA 1FXZA 2HBTA 4MTDA 1YI2I 1ZG3A 3VGIA 3LAGA 1PGW1 1O8PA 1YQ5A 4I7HA 3LOCA 3N97A 4EN7B 2X0LA 1UIKA 4FOWA 2KL4A 1VBB2 1UHMA 2VR4A 3V0AA 2VZPA 2R7DA 4NO4A 2ZXJA 1COV1 2RM23 3IMMA 5KC5A 2DCJA 5FPXA 4ASNA 4IQJA 5T5JA 4Y7NJ 3QAHA 5JXHA 3HEIA 1JOJA 2LVSA 2O9LA 2BOLA 2BY2A 4YVSC 2E5NA 1AL23 6PAXA 4IRHA 1W6MB 3ZN6B 4L0YB 2VBDA 4EJRA 2W94A 2LFBA 2FQPA 2NVXJ 2QUOA 3ZKUA 1AX0A 1JYTA 2VZRA 5IY5H 5LHGA 4G7ZF 2ME6A 2QSHX 2ZEYA 1CAWA 2JG9A 4OHZA 4RLFA 2YGMA 2IZWA 2GBYA 5F5AA 1I1GA 5K9YA 2H6BA 4XC9A 1XYPA 1SLTA 3IDCB 1S0BA 1Z7LA 5J1RA 4BAYA 1AOYA 3HYIA 2LY2A 4RGKA 2K2SA 2OPTA 3S3NA 3O8GA 4H7LA 1PM4A 5LK5A 3W9AA 3GLLA 2OS2A 1E3PA 3CMEI 1YIFA 3RS6A 1RPWA 3WQ0A 2EH3A 5IK8A 1AHSA 3I2GA 1LTEA 2Y60A 1HQLA 4FETA 4BJ0A 5A3UA 4S04A 4A2UA 4J1WA 2BW3B 1RMU3 1SLIA 4NIIA 2KR2A 4QPYA 1WBFA 2UXXA 2PEXA 2WYFA 1NA1C 4C2UA 4IOCF 3GTKJ 2BDRA 5FXXA 1D5YA 4KBBA 2COMA 1R5ID 1COV3 2Y6GA 1JKRC 2KIFA 2DCTA 3ZQCA 2ZEWA 2OTLI 3IH4A 4XRMA 1KQ8A 3G6JB 4XUNA 4L9VA 5EF6A 1QJU3 4NRPA 4XJUA 2ARCA 2C26A 2P1BA 1F31A 4RSUA 3RIRA 4NNJA 2HQ5A 4CYCA 4Q0VA 5T3NA 4HKOA 3ZSKA 2DYCA 2XB6C 9ANTA 3PUIA 2AZ5A 3F95A 4FX0A 1ZZ9A 1FLIA 3D0JA 1ZRIA 4YPJA 5IOZA 5J3LA 3I7DA 2HKXA 4A3ZA 2B9VA 1UYYA 3N36A 4YW4A 3CF6E 1PJRA 4EN0A 1VQOI 4BE2A 2M87A 1AVBA 5FLMJ 4GALA 1AJOA 3F3XA 3GFIA 4IDZA 1HB4A 4U0VA 5IT9Z 2LTNA 2ZMEC 2UV1A 3IKTA 4OMYA 1RUJ1 5E3OA 2RM22 2WR9A 2DV9A 1TBXA 2JEMA 1PVC1 2JT1A 2GXBA 1QEXA 2G7HA 2K86A 1CIWA 3T1MA 4ZXKA 4Y1VA 1D3YA 3H0DA 2AH2A 3HJRA 4OLLA 2QQKA 2NYYA 4HX4A 1RMU1 1J2XA 3K2OA 3GXOA 1H9GA 4XFCA 1XCVA 4G12A 3M3CA 2PHXA 3VZOA 2VZQA 1QJX1 4AWXB 2IFWA 1N1YA 2VOWA 1TEIA 3AZVA 2V1DA 2YU2A 3ZQLA 4WM7A 1MBFA 2E36A 3DPRC 2HS5A 1LHWA 2H0VA 5GAHJ 2Y38A 3OBRA 3FKIJ 4A3CJ 2ORXA 3O12A 2R6QA 1AR93 2R072 5DDJ1 3I2JA 1ZBA3 5I0UA 3MQ0A 1F1ZA 1P92A 4FXKB 1QZEA 2IC1A 4E7SA 5A32B 2VVEA 1VQPI 3ZQQA 2DTRA 1J58A 2DMNA 2RDPA 1ASJ1 2X53S 3IB3A 2E34A 2W3JA 5GZDA 2R3SA 4KFCA 1SHWB 3KD4A 5AC91 2RN7A 1UHWA 2VMFA 1VLNA 4FTSA 2PJRA 4PHZA 2DLLA 4EV0A 3UJOA 1VB4A 3O0WA 3L1PA 3CC2I 1A6CA 3NARA 1FX5A 1MZ6A 2XDVA 4E7KA 4LLOA 4HKWA 2R7FA 2RR12 3CDIA 1UW8A 1BI1A 4UFLA 2HWD3 3BPVA 2P5LC 1FYUA 3B00A 4RB0A 2BZTA 5HCHA 1OBNA 3BGAA 4AW7A 1T6SA 2R7OA 2DDBA 1DYPA 3S17J 4P5HA 3A1YA 1VPHA 1JU4A 2XAUA 2RDQA 2ZMEA 4PFOA 1QJX3 2QQBA 1JHJA 2C6SA 2HWB1 3QCWA 3HOXJ 1UZCA 1XE7A 2ZGUA 4Q26A 4AG4A 2QVSB 4RGRA 4RB1A 1J59A 1YI9A 3ZDSA 4CA9A 1Z0HA 1Y9GA 5IAVA 3VBOB 1SLAA 2I10A 1QNYA 1IJWC 3HOVJ 3B7MA 4OMZA 3D5OA 3S7IA 3JRGA 1JOPA 1TQIA 3TMOA 1UKRA 4L0ZB 3U0ZA 4CZCA 2Y0IA 2OW4A 4Q4X1 1HLCA 2DUOA 3TOBA 5LBQA 2RM21 2Y75A 2FDKA 1W6OB 2WABA 4LIVA 3K1MA 5J1XA 4CXXA 2W91A 2ETEA 3W5NA 1UY4A 2Q1MA 2XF7A 1W8NA 3LSJA 1GXQA 3BR0A 3U37A 4OULA 5A7WA 2OZJA 4XLCA 4QXKA 3LSKA 1GUIA 3WNLA 3CDLA 3HNBM 4XMAA 4EWDA 1MJBA 2O0YA 2ZJRF 2ZEZA 3OYKA 3OD0A 4RGGA 1KDMA 3WZ1A 1TVGA 1YXWA 1PIV2 4NN0A 1ONVA 2A05A 2X8KA 1FMD2 5A32A 1TE1B 2HWD1 3BTAA 4X8NA 1D2QA 1BIAA 1EP0A 4A5MA 3FC0A 4Q0SA 1W9SA 2JD9A 1Y8QB 4LK1F 1Z67A 4JTNA 3BPSA 3W6KB 2VZOA 2MFZA 3AP6A 3HOZJ 2EPFA 5F1RA 2GDFA 5CFDB 5DDJ2 2EV0A 2FX0A 5GZCA 1XG1A 2OV7A 4AEJA 2HWB3 3CUQC 4YVWA 4QX8A 2J1EA 3J7MA 1R00A 1RUG2 2GXGA 5ACA1 3FMGA 5EEGA 4EJWA 4YSFA 4UFMA 3EJKA 3KVBA 3HRTA 1GV9A 3F21A 4AM3A 5K7FA 2Z2SB 1IN7A 2VXJA 4CXFA 1MBHA 1ZGAA 1DHKB 1QH7A 5LRSA 5JHFA 1LJ9A 4LEJA 4LBQD 1HDDC 2ID6A 5LZ6A 2PA7A 2A6VA 2IRFG 1W8HA 1X4PA 3LPGA 1QJU1 4V1PA 1MACA 2H8WA 2GOMA 5BNQA 3LQCA 1DGRN 4YGDA 1UOFA 1YYNA 4YVSA 3FFZA 1YRNB 1LOFA 5ILVA 1YQCA 3ZSMA 1G59A 4V2WA 3FMQA 5H6RA 1LOCA 2FBEA 5E1RA 1UN1A 5A1AA 1JZ5A 4BXSV 3WG3A 2ZXHA 4W6YA 2BGCA 1HKSA 4Q27A 1EH6A 4LOCA 1HW1A 5A7PA 1JH5A 5FQ0B 1GT0C 3SITA 4CEWA 3HIFA 1ZG5A 1SDWA 2WNVA 1IG3A 3FBYA 1WUVA 2WNVC 4NE9A 1B35B 5CQEA 3ZN5A 2R7WA 2W25A 2AGSA 2V73A 1YJKA 1N25A 1PP8F 3K3NA 5ACA3 3KYCB 1Q5OA 4IQPA 2YR2A 4DNYA 3CLQA 3EBRA 2YUSA 4WV8A 2FBIA 1P6RA 2IT0A 2A3XA 5L9VA 1K78B 5F6FA 2RS32 4V19K 3GF6A 1HXS2 2XJSA 2ZTNA 2EIJH 3JCIA 3LF7A 4LBKA 3WD5A 2ZX0A 2D44A 5DQ0A 5JFRA 4QPWA 2WL1A 2HZTA 3ALQA 3TDZC 2MLGA 5A7QA 2IGNA 3NJXA 3LCPA 4F7ZA 5DUIA 2DCEA 2IS4A 1J0RA 5CBLA 1X1AA 3ACHA 4C2MJ 3G71I 1RUH2 1VE0A 3QYBA 1OVSA 4QKBA 5DDJ3 3VBHA 5JLWA 1ZBA1 1IS3A 3EHKA 2ZCWA 4L99A 3VBHC 2QLZA 2P6CA 4RFRB 4JTOA 3UGHA 1QDOA 2ZC2A 5FYBA 3M1HA 3K4NA 1BEV1 3H3ZA 3L9FA 4EGYA 3RKYA 5T52A 1NKGA 1USSA 4UVAA 1LHOA 5A2QZ 2V79A 1Z6TA 2DCKA 2VUMJ 3WE3A 4L92A 3Q0VA 1T98A 3A4CA 1W3XA 1P4XA 3X29B 4HK9A 4QQOA 1SAXA 2XAFA 3NQOA 4NQWB 5L19A 4CEWB 4XF3A 3ZKYA 2P3KA 1SFEA 3EXUA 2WNVB 2JPBA 1H4HA 1LR5A 1UJ8A 2VGDA 1TWHJ 1QU3A 2HYKA 5FKOA 2DODA 1IGOA 1OXCA 3HBZA 5D1IA 2K46A 1IN8A 3G2BA 4BBRJ 5CKMA 4C30A 1CONA 1WCSA 3LSMA 1S5LC 2NZ9A 2PHUA 3LQQA 4D94A 1OA2A 3KT4A 4XFAA 5M3FJ 1PP7U 3EYYA 1FTZA 2OC6A 3EUKL 2VZ1A 3VL8A 1YJ9I 3VHNA 4EM2A 4P9IA 3OGGA 4LUKA 3OL3A 3T0YA 4P9FA 1H8TB 1IG0A 4P1WA 5F7UA 2BY1A 3JRBA 4FTEA 1DYOA 4IEOA 3ZXKA 3CF5F 4M71A 5GPCA 2XJRA 5E8GA 4IHSA 2CAUA 4WM8A 4HF1A 3H8OA 3TEYA 1K7AA 1Y6IA 4K8RB 1R6RA 1WCDJ 1BEV3 3BODA 3WUDA 2EFQA 3P9CA 3O1TA 3MI8A 1QH6A 1WW7A 3B6CA 4ZZLA 3RKQA 3IHUA 3IKWA 3KYLA 2AHQA 1YRZA 4GH4B 4UFJA 4UF0B 3KT1A 4KU7A 5LBEA 2MH9A 3P5BA 1X1CA 2PX9A 3ZFFA 1JXSA 4HPKB 5ICFA 5FYCA 2D6OX 3N9LA 1R58A 5CG8A 2OT7A 4C1WA 3KLNA 1PM7A 2G4IA 1WJBA 3E5QA 2BUKA 4NIHA 2WO1A 1ZGJA 1ZA4A 5FO5A 4E7IA 4RGAA 4CUAA 4Q5SF 2L0KA 4KICA 1GZWB 1D0YA 2ARAA 3OUHA 3BTLA 4QWQA 3G1MA 2HLEA 4GDFA 3F6OA 2P17A 1GV5A 2Z42A 1JYVA 4D7NA 3MF9A 2ZPXA 4OOIA 3Q8BA 3AZXA 5FZAA 1ETQA 1W04A 3VKNA 2QEXI 3UKVA 3E6BA 4Y20A 4L9JA 2CTVA 4EZHA 5I0DA 5FJKA 1JZ6A 1MBKA 5FY1A 1OQDA 1VBB3 4RHV3 4W4ZA 4CZSA 1YLFA 1HDKA 1LESA 2RJKA 2ICWG 4XICA 2GNDA 4OUEA 2M2EA 1SMYF 1ZREA 3AL5A 4FQZA 2K9MA 1AX1A 4Q4W3 1EA3A 1WFXA 2D1VA 3I59B 2AYHA 1SDDB 1FMD3 4AK3A 5LATA 2DA6A 1O3TA 5ICCA 2DVBA 2VOTA 1P2FA 1K83J 4IGOA 5DUUA 4FSJA 1B72A 3WW2A 3S16J 4AOCA 1NQDA 2L3DA 3U78A 3UGGA 5KK1A 3MKZA 5K7HA 2RS31 4KGQA 4A93J 1JT6A 3HDDA 1DGWX 1Y0NA 4QXBA 2VZSA 3VLBB 2V4JC 1JW6A 3KIOA 2PN5A 4QPIB 3CCEI 1IV8A 3BWGA 5FYSA 5C9AB 2PLV2 1AYN2 4QQLA 1UCRA 3HTUA 3D82A 3JRFA 5HOOA 3WNOA 4A3XA 1WJAA 3U11A 2EJRA 2XHKA 2N8GA 2DBBA 1LKXA 2XF6A 4XRSG 4GCVA 3L2WA 4C0HA 2ENRA 4QQHA 1REEA 2M30A 4HG2A 4LMYA 2JG8C 1G3TA 2BBYA 1D1AA 3H9GA 3FXJA 4KIBA 3CMMA 3KP4A 3WG9A 1A31A 3BP8A 2CQQA 5FO7B 2J22A 2AO9A 4BU2A 3GBGA 2J5PA 1LVAA 4JGYA 3DKXA 3USUB 3GFLA 2RKHA 4B44A 2P5KA 5BS6A 1HIXA 4R52A 1ENXA 5K4LA 2STTA 5JCTA 4XIDA 4FQ4A 1HB1A 4RGSA 3JRCA 2X10A 3D5SC 1Y4WA 4Q4W1 5FMBA 1QF3A 5C9AC 2VNOA 1UXZA 1MEC3 3TEDA 5F0CA 2D6LX 4K21A 2FOWA 3DKWA 1NZCA 3HRMA 2IGKA 5E88A 3KEQA 4NHMA 4AIKA 5E1WA 3LFKA 2CQNA 4YLZA 3G6EI 3WNPA 3KP3A 2LLKA 1UY2A 3OYDA 4BBSJ 4YELA 2E2IJ 2WJSA 5ABJA 5FZEA 1R36A 4NDLA 5D5VB 3SCFA 3I0TA 2WNUB 2KLOA 4CHUA 2LKPA 1A6QA 3NWKA 1APLC 1CPNA 2MYSA 4PJ0C 1YIOA 1DF0A 1O8SA 2DFEA 4DXZA 1CAXB 1Y3TA 3TDUC 3O1SA 2EXIA 4N43C 5FZIA 2WZR1 1UCXA 2DDUA 2LM3A 1S7EA 3F2ZA 2EV6A 2M8GX 3Q3SA 5LFAA 2JDUA 1T95A 4YIFA 2EAAA 1LU1A 1Y43B 1S0DA 3ZOIA 4CP2A 4X0GA 2WQZC 3POWA 5DS9A 3I4PA 1NCRA 2V26A 3E3VA 2CY6A 2HYFA 3KPHA 1UU6A 4RR3C 5J40A 4AYUA 2R061 1X36A 1DQ6A 4MYEA 4HK8A 1ULYA 3MKWB 1Z7S2 3N9MA 3KV4A 5EG0B 3CDHA 1BIBA 3BZKA 1RNLA 3VYSB 4G9YA 1SPPB 2UWCA 5K8SA 3DL3A 1WKYA 3KCXA 5F3EA 5JIAA 1MEC1 4XCBA 3OYHA 1YHFA 3DEMA 1H8TC 2VC1A 3RZLA 2Y6LA 3DV8A 2R073 2RS11 3VDCA 1IAWA 4V2FA 2QFEA 2R92J 5C4XJ 3K70D 1R1A3 4XQDA 3BG3A 3EDPA 1XTAA 2WINB 3I2IA 4QX0A 1RYYA 5F27A 2CG4A 3HD8B 4PGHA 3SH5A 3KLSA 5FKNA 4F83A 3BC8A 2PMUA 4WVMA 3VWBA 1ZZ7A 3I2HA 2BW3A 2KIQA 3M8JA 3H3LA 3H9AA 4JCKA 4BXXJ 5EJCA 3T3YA 3FXQA 1RGSA 2E7AA 3COAC 1WD4A 1XMXA 4Z82A 5HDGA 3PJYA 4ZYGA 4FFIA 4HX8A 1QJZA 1WLTA 4F93B 2XBO2 5T5PA 1LE8A 4NPRA 1MS0A 4B4QA 2XASA 4EGZA 5HDNA 4FOQA 2RNGA 5FZ0A 1MJ9A 3OY9A 4OHYA 1HW2A 4AQSA 1UL9A 4BKXA 1FNNA 2HWD2 4FPGA 3U9GA 3MIFA 4AFBA 2EZKA 1B09A 1XGMA 1ZR4A 1GNHA 4XBNA 5DD4A 3I3LA 1AL21 3HQXA 1FX7A 2VBWA 1SANA 4PI0A 5IFPA 5JR7B 5HNFA 3KMHA 5JVVA 1XMKA 4WBBA 2XVGA 4XUTA 1R9TJ 1SC7A 4ENKA 2JG9B 2QZ3A 2Z16A 2XKPA 1X2MA 4DZGA 1ZELA 1UZWA 1W6MA 2RS53 1I39A 3ILFA 5DEQA 4LLGF 2R7VA 4ZJZA 4GJYA 3NMBA 4XEZA 3DGTA 2HYGD 2FU4A 1RKTA 1VBB1 3OPWA 3LSPA 1MS1A 4WM8C 5IT6A 2PYTA 4NPLA 3RMXA 3RJPA 5D6FA 5FPAA 3H5NA 1W06A 3PJQA 2XSJC 1T33A 3IUOA 1D2SA 1R092 1SFNA 4CCKA 4CUCA 2BVLA 1K4TA 2B9SA 5KHDA 4H55A 3LA3A 1ULFA 4BHBA 4NRMA 5LASA 3OYMA 2WT1A 4YVSB 3UESA 2V5DA 3U1KA 5BNNB 3K69A 3CCLI 2EIEA 4U7DA 1U12A 3L7WA 4QPGA 3AM2A 2HQAA 4OIQF 1V9U2 2DA2A 1ZRDA 3C7EA 1W0TA 1IPJA 4LO8A 4XKCA 3LEMA 4UYBA 4YZ5A 2XAHA 3UYJA 3DPRA 1POV0 3QBQA 2Q2EB 2E71A 1CESA 5BY5A 3PM1A 3IZOA 2M7AA 1LKNA 3O1RA 1RB8G 3V8JA 1FP1D 2E9QA 3PUSA 1MR5A 4M3DA 4M73A 1D4M2 1IOAA 1W6PA 5FLIA 4ASKA 4IUGA 2LG4A 5ABJB 3O1MA 2EA4A 4M72A 2A75A 4LKDA 1CIYA 3W6VA 5DUVA 1IXCA 1PGL1 3WG2A 1H2LA 4P9XA 3I2KA 5FMOS 4M9XA 2L02A 3QPSA 2A73B 3ZXJA 1JN2P 2ERFA 1B8IB 1WW4A 1X9TA 1RI7A 3PTRB 1OOPB 4H14A 4CU7A 1BC8C 1WMFA 1ZRFA 3I53A 3J7AO 2V4VA 2XVCA 1VF9A 4DY3A 2EZLA 4H0EA 3NNGA 1KS4A 3RKWA 3OSGA 1Y1WJ 2UYAA 3K0LA 3W6JB 4RA2A 2L7FP 5SV8A 3TEZA 3R4DB 1QRYA 3WTSC 3J7AY 1XDSA 2D2WA 3F6VA 1BJAA 4AIHA 2A7AA 4Q1RA 2VAUA 3NNLA 2DBNA 5JIUA 2R93J 1AR91 1TWFJ 4QKDA 3DXTA 4PFPA 1OA4A 3PIGA 4NRQA 3FBIB 3O3KA 4B3NA 3WE2A 5ERLA 3J7HA 1MDMA 4AVZA 3WP5A 2OZ6A 2NN8A 3N9QA 2CGOA 2EIKH 5EJZB 3TP3A 1ODDA 1GICA 4M3CA 1RUF2 2Y6HA 2WAOA 2BJSA 3OB8A 3WP6A 1GVDA 4NIAA 2A6TA 1ASJ3 5FBZA 1HN1A 3DXUA 4IEYA 4NROA 2GP5A 2JE8A 5J37A 2NM1A 5EZHA 4J19A 2DFHA 1REDA 1GP4A 2M4KA 3FWEA 1YI7A 1V9U3 4F92B 1OCOH 3TYJA 1AR73 4D7SA 3ZFGA 2XPWA 2P7VB 4RS5B 4QWNA 1EV12 4AR2A 3S6PA 2RGVA 1MS5A 3TRSB 5FZFA 3LL7A 5C4WB 3BJOA 1ZAOA 1OI6A 2LKSA 4KNYA 4HANA 3PTYA 4EZ4A 2R071 1PX4A 3DU5A 2GH2A 3AG3H 1T8IA 2E7QA 1B4AA 2TUNA 5F8PA 3RZHA 3HSFA 4L9BA 4LG0B 3SEPA 2E2JJ 1UY0A 2BP6A 3ZXAC 4UB6C 5C4WC 2CHHA 1BJZA 2VL4A 1DU3D 1BI3A 4JQRA 5C5TA 3I3MA 5GLVA 1O5LA 3C2BA 3RGBA 4M4PA 1RESA 3VBUB 3RPUD 1T6GC 4LQRA 4AYBA 2WTEA 3DQVC 3MICA 3OYNA 1MQTC 5FYYA 2KZVA 3A22A 4ZYEA 3L2VA 3ZMOA 2A5WA 3FLTA 2LK2A 1YFYA 3BR2A 2YX7A 1DBNA 3DYOA 4KUMA 4AEMA 1O7FA 4BNCA 2GNBA 4AF9A 1UPSA 3R4SA 2P3JA 3ITQA 2XGCA 2BXZA 4K8FA 1F4AA 4K6BA 3CJIB 2ESHA 2R7EB 3BLYA 2DPUA 2O8OA 3MPPG 2YDEA 4BEHA 1OFNA 3JU9A 3ZXFA 2Z5WA 4GRIA 5TSWA 2WDBA 1D1BA 2P5VA 4CDUA 3O0XA 1HSJA 3UV9A 2ESNA 1GV2A 2RREA 1AR71 3MPBA 1WJFA 3IV5A 2ZGRA 3ZXDA 1URXA 2CYYA 1SFPA 1BL0A 4CDWB 5I91A 2ZBKA 3DTEA 2ADDA 1RUI3 2MBFA 2AUYA 4LKEA 1W2TA 2LKXA 3AVRA 2QF7A 3CO7C 3B93A 3ZQ7A 3FDYA 4DINB 5KNLA 1BKZA 3GW2A 3SZTA 1BJQA 1MGTA 2VUDA 4NHJA 3N05A 2JVGA 3OS0A 1HB3A 1BEV2 1JHNA 5LY1A 1DQ2A 4GFBA 4L11A 1Q8QA 3KGZA 2GMMA 3OY8B 2PMZN 3RQ4A 3PMEA 5B3SH 4KN7X 3PUAA 1EJ9A 1H2MA 1S0FA 5TRDA 4QM9A 1V70A 3ZM8A 3DECA 5ILUA 2HEOA 3IWFA 2K0GA 1JU3A 5FP8A 3QOPA 5A3LA 5FYTA 1U8BA 3B3QE 2QCOA 1OLTA 1W6NA 1ETWA 2VONA 2HFHA 3BOPA 1WLCA 1A34A 1STMA 5ABJC 3LSIA 2H1LA 1LOFC 2KKOA 4YVWC 3P3NA 4JX5A 5FY8A 2IA0A 5FYHA 4ZY9A 2ZX1A 2W0XA 4DOUA 1D4M1 3E97A 2Z99A 3JB8A 4CUBA 4N43A 4XLPF 3IPVB 2W1UA 5FFOC 1FOXA 4EJTA 3L9JT 3PU3A 2VQCA 5C3SA 4E8CA 5CFDC 2Q1ZB 4UUVA 5FR3A 4WVVA 2JENA 4BCUA 2HBUA 5FLXK 4G6TB 3WU2C 3N35A 5DZFA 1FEXA 5LY2A 2QQJA 4AGGA 2QYOA 3HBLA 4KN4X 5CJ9A 2PBIA 1SFUA 2TNFA 2KM2A 5D5WB 3SH4A 1G86A 4Z07A 2IVJA 3V42A 3NVCA 4I99C 3SDGA 2BNMA 3Q8CA 3W20A 3S1QJ 3PIJA 4BK4A 4Q4W2 2P7CB 1IRZA 1LOGA 5GLTA 3ML6A 5CVUA 1H1AA 3CDZB 3KZIC 1QXPA 3LKJA 1AX2A 3JD71 1E0EA 4NWWA 1UO9A 3ETPA 2GIZA 4KH9A 3WUCA 4W8JA 5JI7A 4CDWA 2XV4S 3MKLA 3ERED 4QM8A 3O1VA 4MGIE 2EINH 3I9V2 2W84A 1UD1A 3NAPA 4YM0A 1ULOA 4CDWC 3DFGA 1XGNA 2VPLA 4CRQA 4DRVA 2CGNA 3ZCOA 5A3NA 2HQRA 1S6LA 2WNUA 3DF8A 1W0OA 2XB0X 2HXOA 2LH9A 2XPJA 1U8RA 3MGUA 3ZN4A 5KHGA 3Q9SA 2J1AA 4RB3C 2R7UA 3WGHA 4GMP1 1ZRCA 4LK6A 1MS3A 1D4M3 4M3BA 4XF9A 4F91B 4BXFA 3S2HJ 5LA0A 2X6YA 3BIEA 2Y31A 1LENA 1HJFA 3RPUA 2PELA 4E2SA 4WX9A 2IPQX 3KP2A 1G3YA 2YUEA 1W2NA 2R5ZB 1NA1A 3TO6A 3VHOA 1V4RA 5CVJA 3BR1A 3ZYHA 1BA5A 3ZDVA 1UZYA 1LEDA 1R082 1UELB 5BNOC 3QP6A 3AL0C 2EIMH 5FPLA 3BTIA 4U88A 5FO9B 3DPLC 1FZPB 1NG7A 2PN6A 4V2VA 2FNAA 3IBMA 4D5CA 5K5OA 5D5UB 1OD5A 4YIRX 4QPIC 4BHCA 3TL4X 4JYKA 2ZHLA 3MMYB 4RD7A 1QOTA 4CCCA 1P7IA 2DQLA 4FPJA 1RUJ3 3OUIA 4HT1T 5IVCA 1TP4A 1C8M1 2F4OB 5GADJ 1Q1VA 1XBFA 1UY3A 4OQ9A 2KHMA 2K3FA 5JSPA 4U0WA 4MGQA 5C4WA 1HJGA 4R9AA 3ZFFC 3D8CA 4W1UA 3CD6I 1VQ5I 1WQ2A 2YBKA 3HTSB 4ATFA 2CUFA 5FMOL 3A01A 1HXDA 1OCTC 5C6CA 5D8AA 5K5QA 4CDUB 4KGGA 4MVTA 1HRI1 4BEHB 2WAEA 4B1MA 3WF3A 1K3IA 2AEZA 4Y13A 2XWJB 2VW0A 5FPBA 5A1FA 3J8F3 4XSXF 2QQNA 1RVF3 2WFF3 2NOGA 1P9QC 3BROA 1ZTRA 4YFWA 3TW7A 2JRTA 2DFIA 5IPAA 3KX2A 3MN2A 3VYUB 2BNNA 1LUJB 3TOJA 3IAQA 2P6TA 1XNTA 4LOSA 1ODMA 3MIEA 2F4LA 3OOUA 3WU0A 3AKQA 5FKMA 5FCCA 2EBIA 3RWNA 2FQ4A 4ZKTB 2XRLA 3S93A 5FZHA 1RJ8A 4OHVA 1ON2A 2DA1A 4XOPA 4XBFA 1R64A 3VD7A 1YX3A 1RUH1 3TW6A 1WA4A 3HN3A 5GM0A 4PIYA 4HQMA 1AR72 4CDXA 5BPIA 3GTOJ 2WLQA 2TEPA 1AL22 2B4KA 2VJXA 3FLPA 2C9AA 3GZNB 4O61A 3MWMA 5FMDA 4JGYB 1PZ8A 1Q8OA 4HETA 4XQWA 4ZYAA 4E2QA 5ISLA 4B3XA 3BYWA 3O8HA 3RZOJ 5FY5A 2MC3A 3SKVA 2FEZA 1SLLA 3VBFB 2VKEA 1ENQA 2QQMA 2VZUA 3S57A 4QT6A 4IHTA 3LAPA 3R05A 1S3JA 4CEYB 2D3PA 2DW4A 3DTKA 4DQ2A 3SYTA 2NQYA 4OMDA 4GYGA 2Z33A 2D6NA 4EJVA 3PQJA 2Y34A 1W5TA 3NKTA 4AHWA 3ZOBA 1HRI3 4AEDC 3L2HA 3ECHA 3L2UA 5F0FA 1HQNA 2AQFA 4IOAF 1W99A 3I3QA 3SZPA 3AJZA 4R1HA 1C8M2 4DGWB 2DT5A 3WGIA 2WADA 3VBSC 3TGNA 2PQSA 1WI9A 2HVRA 5D21A 1E5HA 4V2GA 1GLHA 2A71A 5FZ4A 2JE7A 3DPTA 3T2OA 4WVZA 1T08B 1N3QA 3E5UA 4IXLA 1U0JA 3WW1A 5SV5A 3AMPA 5M0TA 2VVFA 2F17A 2Q2EA 4PZJA 2CSOA 4CEYC 2EILH 1PVEA 3Q5FA 3N7JA 3HSRA 1TL8A 3GJAA 4Q4X3 3IRRA 1WD3A 2ZGPA 1PK6B 2XR4A 4QD2A 3HOTA 3QYFA 5AVPA 1BK1A 1OQYA 1FMD1 1UAAA 2ZGOA 3LEKA 3VBFC 4LBLA 3DPRB 4CGZA 3OIOA 2M3AA 2GC2A 2GMEA 1X8EA 5ANNA 5C8CC 2R16A 2WWYA 4A3DJ 3C7FA 2B8MA 2IFRA 2LNBA 4YGEA 1VI0A 4XW3A 1LEMA 3N4MA 4PF5A 5FKCA 1VRH2 3H1CA 3QODA 1XU2A 4QPGB 5LLQA 2WKKA 2CH0A 1QNTA 1NLQA 1X1BA 3OBAA 2JG8A 1NY72 4Y1YA 3R6SA 1JHFA 1JTYA 5FZKA 3LFIA 1O4YA 1HW5A 1ND2B 4CP0A 3LSTA 5EZGA 1JYCA 2B0LA 2EFWA 4MHGA 2OQ6A 1RUOA 4P9JA 5LEJA 2AR6A 2C4XA 1U5YA 2VQUA 3AG2H 4JDMA 3DKQA 2FHRA 3HXLA 4UOJA 2DCYA 4RA0A 3SKJE 1D0XA 2DTYA 4PCQA 3M7AA 2YZ4A 4D1QA 5IFTA 5H6QA 1QOOA 3U14A 3RYKA 5EGOA 3RI8A 1NOVA 3WF2A 3OWTA 2CUZA 5IVVA 3WTYC 3HHGA 1D0ZA 3O1UA 1JTZX 1PO12 4E70A 4NC8A 1QXRA 4ZTFA 4IL6C 1SD5A 4QGLA 4BM8A 5FXWA 5C71A 2WY7Q 1N47A 4NHXA 1DQ0A 4GMP3 2JA8J 4GYIA 3PJRA 2W48A 3C1DA 1QKQA 4EYUA 1FC3A 2K7LA 4CH7A 3BG6A 2VM9A 3CEWA 1TW2A 2E26A 2HDWA 1PZ7A 1FY7A 4BL0B 1GZTA 2DK5A 2XPUA 4X6AJ 1UYPA 4PJMA 1A04A 1VQ9I 4JC1A 3CTAA 1LU2A 2EWNA 2Y0OA 3K4AA 3C2GA 4IV1B 2SLIA 2HOEA 2J42A 4FTHA 4MXWB 4XUQA 3OYWA 1UKGA 2Y69H 1R1TA 2Y0SN 4AD9A 3NV4A 4EN6B 1IDYA 3MDPA 5C33A 5EYRA 4CYCB 3AK0A 3I4MJ 2F5DA 1ULGA 1VBD2 2JDMA 2ZA9A 3AXEA 3KV9A 1BBT1 2ZHMA 3ES1A 4KMUX 3APBA 1TNSA 1JI6A 3HRSA 4N90A 3D6EA 3NV1A 2GU9A 1OLQA 1ZA7A 2BWAA 3MZ8A 3WCSA 3VFZA 2VH9A 3BJAA 1XB9A 1FIAA 1WCKA 1XU1A 1QQP2 3GCMA 1SD7A 1QJX2 3VZMA 1BMV2 1NHAA 2ZJCA 4FASD 3JTHA 3RZMA 3NAPC 2MEV2 3JAMK 3I2DA 2ZFWA 4IHXA 2R042 1VBE1 5FOJB 1IXRC 2HR3A 2ADEA 1KU9A 1KD7A 5KWRA 2WRAA 2F6CA 5HCBA 2HOAA 3BZCA 1CF7A 3TNQA 3AVSA 3F0CA 4Q47A 1K12A 4GKYA 2RS13 1G8XA 3NQHA 2XROA 1TT5B 3QYEA 1BVVA 2HNHA 5DYMA 2ZGTA 1OPOA 5C3QA 1QVUA 5IYYA 1EH8A 2EXJA 3R4KA 4BJ5C 2KZGA 4Y52J 1VBD1 1OD3A 5DTDA 1RUJ2 3L2CA 1GVJA 3GTPJ 2HEYF 2WNOA 4CXWA 2PHFA 4FT8A 1LPQA 4C9YA 3NAUA 5FLJA 2FJ1A 1D8KA 5M5WJ 4A41A 1C4RA 5FXVA 2ZGLA 2ETHA 1FPN1 2Y33A 3FLRA 4Q0UA 1VRH1 1F35A 3VBRB 2VNRA 4FPLA 2W7NA 1O4ZA 1W0PA 3PDQA 5CB7A 4DBQA 5F32A 2ZXWH 1TZOA 5CLSA 3E0JB 3AFKA 3PUQA 3GZUC 2ZKNA 4XE9A 3RFRA 2R7SA 3VD4A 2BTVC 2G9WA 3FL7A 3SCHA 4XONA 4L8QA 5GTHC 4NR1A 3NEUA 4LA3A 2HPIA 2KFDA 3BZ6A 2A6XA 2VODA 2NVQJ 2VL8A 2E53A 1DG6A 4XBLA 1ULDA 1ZG1A 4XZUG 2BGOA 4KITB 2BZDA 2R7RA 1ND2C 4OIPF 3W2AA 3SXYA 5C5UA 5BMZA 5LRRA 2YB7A 3WTUC 4RHV2 3OBZA 2M5WA 5HPOA 1O3RA 3T4VA 1JYNA 3OYLA 3IAPA 2PAMA 1XNKA 3C7GA 5CZKA 1EAH2 1L7LA 4P55A 4J00A 5BYNA 3NRVA 1G9AA 2ZHKA 2JDAA 3MZYA 1ZKGA 3VBFA 1IXSB 3D5LA 4ETSA 4G9SB 2YU3A 2XH6A 1YQ6A 1AR63 4MO3M 4ARYA 1HC8A 2GNMA 2RG4A 3ZIWA 4NIDA 2XHNA 5FFXA 1BQPA 4GAZA 4DO0A 1UY1A 5CA6A 4KMQA 4LBOA 3NKGA 5IK5A 2XG3A 2DJNA 1KU7A 2F48A 2WZR2 3KGLA 3WTTC 3ELKA 1ZR2A 5B4NA 3H0GJ 2PLV3 1BW5A 4A3MJ 5J96B 3OYFA 4BB3A 2VTXJ 3U1XA 1FPN3 2A5YB 1SLCA 2RMU2 4AAPA 2DMQA 1FSEA 1DZRA 1AYM2 2VCAA 3ZMSA 4UNOA 2A3WA 4XIOA 4I3PA 4JV4A 2Q8OA 3ZX7A 2JWTA 2BVBA 2VOXA 1NE4A 2LY9A 1VTNC 1B72B 2O8QA 2R043 4NWVA 3VDDA 4L5IA 1MMDA 4A45A 5LGUA 1Z3YA 2V1UA 1AKHA 1X82A 3BOWA 3ZFGC 4M3CB 2KMUA 3T1LA 2ARBA 3ASNH 1H9PA 1OKOA 5DN2A 4E4SA 1MH3A 5D5XB 3FBMA 4RB2C 2MG4A 3OBTA 1OLMA 2IWGB 1YTYA 1AL0G 5JUVA 3A7QA 4BE3A 5J8CA 2UU8A 1J3RA 3I59A 2LMDA 3USSA 5BNGA 4GGGA 1SAUA 4DNCA 5IP7J 1SFOJ 1RUD2 1BM9A 1DZQA 4BIFA 3VD9A 4LK7A 3HT2A 3DU6A 5J09A 3I4NJ 4C0BA 4DZJA 4QGMA 5B66C 4BPZA 4B7KA 3OS2A 1UYZA 1IN5A 2KDOA 5K1YA 1OYWA 3HKZN 2O14A 3WHCA 4HBLA 2I74A 4XJ9A 2VQAA 3SHFA 3S1RJ 4MZUA 1S0GA 3NRUA 1SFXA 4QB2A 3FHZA 2EA2A 2HWE2 4CUGA 3I49A 4Y15A 3RZGA 5FROA 2JE9A 2DMUA 3OGRA 2V1XA 1JUSA 2ZX2A 1IPKA 2TBVA 3WX5A 3KSCA 2PLV1 2JUCA 3ELNA 3ZIXA 5KHHA 1QHGA 1FBUA 2JA7J 1YW7A 1AKHB 4HPKA 4ITVA 2OTJI 2ZX4A 2ZZQA 1DIWA 4KYWA 3AB0A 5C8CA 3DYPA 4AQ6A 4CDQB 3P9IA 4WXDA 1NT0A 2YHJA 5D8AB 3J7LA 5E16A 3A0KA 3WG1A 4UF0A 2FZ1A 1YIPA 2ZJQF 1KRIA 3I3BA 3T08A 3R60A 2L7KA 2IXLA 1H0BA 5F3IA 5E20A 1LOEA 1KU2A 3CZ6A 4AVAA 2ME0A 3CCJI 4KI5M 4GWMA 3INAA 4O9GA 2O7OA 5FY4A 2PG4A 1MMAA 1DQ5A 2OXBA 1OMIA 2K40A 4F3QA 3RWKX 4Y20B 3MIHA 4TV7A 3DF0A 3HL2A 1KGYA 5LHHA 4QKNA 5EYYA 2D6MA 3VN4A 1T39A 1L7RA 5FGMA 2LUWA 4LMFA 4PIXA 1XGOA 3MEPA 3SLIA 4GKXA 4DEQA 2NVYJ 1MD0A 4M0NA 5FOBB 2RMU3 3DBHB 4QQ2A 1FATA 1MNDA 1D0HA 2VBBA 3OEAA 4XLAA 2XSDC 4II3A 1WZ2A 4ZU4A 3GBFA 1ITYA 4KQ7A 5J48A 4X6QB 2CFXA 2JRMA 1GYKA 3BTYA 3CCSI 4GXLA 1ETYA 5A3TA 2AXTC 3AL0B 2I5UA 2VKVA 3KV5A 1VBE3 5EQUA 3AAFA 1YIJI 3DUIA 1HN0A 2Y6FA 2Z69A 1ENHA 4X6RB 1UX6A 3OD4A 2COBA 3AZWA 1KEXA 4YZ4A 5L3GA 5CU1A 1DZTA 1K42A 1WJEA 4NQWA 3GTQJ 4N7IA 1MMNA 3ACIA 2IXSA 3DKYA 1Y7BA 1CPMA 4RN5A 1Y1VJ 1W39A 1VBD3 2ZACA 1YFWA 1XSDA 1Y39A 1KJRA 3F8FA 1OJLA 4YYOA 3KEYA 4FE7A 3NAPB 4I0BA 3WY6A 5J47A 5FZ3A 1O91A 2PAEA 1HKTA 4G4FA 2X48A 4J01A 4M6VA 5G05L 3T4HB 3G7DA 1T56A 2VO5A 3UKGA 1FWZA 4FOVA 1UU4A 4LOTA 3VKFC 4A12A 1LDDA 2FA5A 3ZFEA 3WNNA 3VPRA 4ENNA 4TYSA 4XXAA 4PDKA 2PXJA 1VQLI 3WDWA 3ZFEC 4LXLA 1EF4A 2CW0F 1GQGA 4UUSB 1XMAA 2KIMA 2L9VA 1DQUA 3B73A 3U2RA 2V09A 5CVRA 3C8XA 3CQOA 2RDSA 3ABZA 2A3SA 4Y1XA 4M3CF 3CMGA 3HPNA 2BFUS 2E31A 2JVHA 5FY7A 1HCRA 1I9RA 5GAGJ 1ZLJA 1QOSA 1ON1A 4IPAA 2YC0A 3AKTA 4K1YA 1E3HA 3ZN6A 3MW3A 1JODA 3P3PA 5K0UB 4FAGA 2XB5A 3Q9OA 4QX3A 1WRJA 2A69F 1RUI1 4A6OA 2GA1A 1T0FC 1W6NB 5J4YA 5F3CA 5AIPA 3WDYA 5FRNA 3GTGJ 2F4PA 3ILRA 2R7ZJ 2CUJA 2GWRA 2C5DA 5E3LA 1W36C 3RDIA 1DFQA 3LOBA 4ORFA 3VHRA 4HV5A 3WNXA 1MBGA 3UT0A 3CJQB 2OZUA 3UNGC 3KZZA 3RQ0A 2C9KA 1SPPA 2MHFA 1AHDP 1WGXA 5JXGA 1LAJA 3MD2A 1GP6A 3KP7A 3R61A 4OMCA 2QCSB 5FWEA 3WP4A 4BY7J 2HTJA 1ND3B 4L5JA 4R8HA 2WNUC 3RI9A 4EN9B 1R22A 3VKOA 3F9KA 1NCRB 3BIWE 3D5RC 3BDDA 2HYJA 2EZIA 1OFCX 2VXRA 2ZOEB 2VQGA 1Z21A 1FOKA 4KNCA 2V4AA 2A68F 3CESA 1Q8SA 3IIAA 1AR82 3HNMA 2K9LA 3V56A 1VQ7I 1US3A 3E7LA 4LGWA 3TP0A 2EAKA 1XCBA 2AEYA 1ALYA 3OJBA 2WS92 4E7HA 4JAAA 4L5EA 3SH3A 4QB1A 5BNOA 4EWAA 2RS51 4XTPA 2XXZA 3LOIA 1OR7A 3VBOC 3FISA 4A5NA 4ENJA 1VBC1 3PL8A 3CC4I 1ZK8A 3A0NA 3HJEA 2PMWB 4GXOA 2QVOA 1Z77A 1DLCA 3CU7A 5CFDA 1JJ8C 1CQ9A 1I5ZA 3FFQA 1YITI 1CAVA 1NAEA 3VBUC 4HSJA 2HWC2 4HKLA 1AWCA 4SLIA 1ZBE1 5HLIA 5J7MA 3VKLA 4CCEA 5F2WA 2VW1A 3RNSA 2OAZA 4LBJA 5D8AC 3VDXA 5E1XA 1FMWA 3LA2A 3OOXA 1WCMJ 3FK6A 2E6VA 1TNTA 3EMRA 4IO9F 4LG0A 5FZCA 1RUD3 2H6CA 4HN1A 1VQNI 4COZA 5APAA 5ED4A 2IXHA 1GR3A 1O57A 4ZZ8A 1DLLA 3H0OA 4LHLA 1OC1A 3T0BA 2VE9A 4FE4A 1ZVFA 2NVUB 4AFCA 3LMMA 1W8TA 4I30A 4JRLA 4MGSA 4NHKA 2VJ5A 1LEAA 2PHLA 5LBFA 1FBQA 4A69C 2W24A 1TT0A 3GEZA 2YC2A 4HQEA 2VNGA 3Q0WA 2Y64A 5FB2A 1W0NA 3HBKA 4HF2A 2FBKA 2V6CA 3VOEA 2V72A 3HNYM 4AFMA 2X1CA 1Z7S3 3CLPA 5FDBA 1XNCA 4IE0A 1BW6A 5D8KB 2RJLA 4ENMA 4MGKE 5BNPC 3GUDA 4YFZA 1VBC3 3BTZA 1VFCA 3G1OA 4DYQA 3Q8AA 2DVDA 1K5MB 1H88C 3I58A 5DCFA 3WF4A 4LKFA 4LBQB 2XJUA 2HGCA 3H92A 3BG5A 4DB5A 3RSNA 1RUC3 1RUE2 5JOYA 1G2HA 4A7ZA 4D7YA 5C3RA 1XRUA 4CCJA 1WA6X 1W6QB 1ZBE3 4ZC3A 2M7BA 1IZ3A 3LGRA 5FK8A 3HG9A 3F8BA 3OSDA 1OH3A 4UV8A 2YU1A 1FAYA 1RIOH 4QAWA 5EYXA 1R091 2A6HF 5FYUA 4Y33A 5L7OA 2O3FA 3CNAA 4LK0F 3G3ZA 5A3PA 1TWAJ 3GF2A 2WQ4A 5FZOB 4Q4V1 4XDQA 1N1SA 1KQ9A 1OHFA 4Y1ZA 2VUAA 1RC6A 2V5YA 3KZ4C 4AVBA 2QA4I 2Y9YA 3V7SA 1U2WA 4ANJA 1IQAA 5DAXA 1YCIA 1CAVB 3OYBA 4MFDA 3K4BA 5H20A 2ZB9A 1OKQA 1I50J 2VY0A 3VDDB 5D2AA 3VV1A 2QBXA 2P81A 1W28A 2FE3A 5L3BA 3KT7A 5A3OA 3K4CA 1U5XA 3JQXA 1JUMA 1Z7S1 3UNPA 1A5JA 4K3UA 2EB7A 1X3UA 2L9SA 5T50A 3BPZA 2LBFB 1W6PB 1LDJA 2AC1A 1X1DA 3SQNA 2QSFX 2X1DA 1NK3P 2HWF2 1IRXA 4Q5OA 4YW5A 2PLYA 3H9JA 1PMHX 5FZMA 4AEDA 2XIGA 2DMPA 1EAH1 2WQ8A 5ACA2 2CW8A 1US2A 1J5YA 1ETKA 4RM2A 1YOVB 4ISRA 2DU1A 2IEKA 1SLBA 4CDXC 1XPXA 5KAIC 4N9IA 4IEVA 1U5TB 4WM8B 4UVBA 3E6CC 3N7LA 5FZ6A 2JJ7A 2A5ZA 4LITA 1IPSA 4G94A 1HV0A 4FFFA 4ARXA 2VZ3A 1S72I 4IERA 5AONA 1NG0A 5BOXA 1FT9A 4XHBA 1DPUA 4YGBA 5DM6F 3CUOA 2LROA 3AP7A 4BQ2A 2VOVA 3POBA 2PMHA 5TJJA 1NZIA 3HGGA 4HYEA 1Y9MA 5JXJA 4META 1YE9A 2PHDA 1C5IA 4XQFA 1FOD2 3AJYA 4J1XA 3QOEA 3FXUA 3DP7A 1LEBA 4IV3B 4P9UA 1RUC2 4GMP0 5EWSA 2XONA 1AR92 3AC0A 4BLIA 2D97A 1ZBA2 1QDCA 5JAXA 2VD7A 4BDZA 3T2QA 4BS9A 1O3QA 2WFPA 5FLHA 1X8MA 3BQYA 3AMMA 3K70C 2VULA 3GLXA 4EROA 1IO2A 3RYRA 1I1SA 3KQRA 3IC7A 1K6YA 1BI2A 5CYVA 2VIXA 2JA6J 1EAH3 4RLQA 5IVJA 1W2AX 2HYXA 5CIRA 5KR7A 5IP9J 2XQRA 2XAJA 4IZZA 4FXGB 2HDDA 3PLQA 3ZXLA 5FBJA 5L3DA 2D3RA 2WB1N 1NCRC 2P0WA 5F0HA 1ZHFA 4HPQA 5LBCA 2J1UA 4PJJA 1USTA 1DP7P 1IKPA 2I8DA 3HOYJ 5HBAA 1MW7A 3QU3A 2FMYA 2FMLA 2X1EA 2G19A 4OI0A 3V65A 4QX5A 4OVEA 4Q1PA 2YMZA 4CCMA 3LEIA 3CIHA 5A2QK 1JT0A 1FNYA 3DCQA 5M5YJ 1ONAA 1FPN2 2QBYB 1YUDA 3WQBA 3NV2A 2K27A 3PNYA 2AS5F 1G3WA 2A70A 4O6JA 4AI9A 4DXTA 1D7PM 1SVMA 4JDNA 3S2WA 3CJIA 4CP9A 3NJYA 1YQ2A 1OCPA 4QHZA 3HN1A 4JP0A 3WNMA 2KRHA 4PQ9A 3J80K 2YPRA 2ZSHB 1ND2A 3Q8EA 1Y0UA 1YJNI 2ZAAA 2VKDA 5C4JJ 5LBBA 2LTPA 2RNJA 2DFCA 3LPFA 4G7HF 4BDVB 1A35A 2VC9A 4QU2A 2CV1A 1X3ZB 2J1VA 4PQQA 1U78A 4O9EA 3V0AB 4XFIA 4IL7A 3T5XA 4AI1A 4DEVA 3T30A 3LA7A 2UZKA 1BR4A 3ZYGA 1BHGA 2WC2A 5FWJA 2W57A 3FIWA 3ZR5A 2VBPA 2W1SA 1CJPA 1JYXA 3IDAA 1DYKA 1PIV3 2DTZA 2DU0A 1QHDA 2HWE3 2LD5A 3HHHA 1GKBA 4XFGA 3FM3A 2ZABA 3GCXA 1G3SA 2WAQN 4XRSA 4UW3A 5DUKA 2WNEA 1BBT3 3EUHC 4ABZA 3T1BA 1QQIA 5F39A 5LD2C 5EJ3A 5A7OA 4AEDB 1W6QA 2QQIA 3ZQHA 3S2DJ 4BQYA 1WLDA 1MBEA 2OIIA 3JD73 1Q8PA 2I45A 3VSLA 2Z1DA 1DGLA 4D69A 4IE5A 3UETA 3EPZA 4JKKA 1FMVA 1I27A 2IS1A 1BR2A 4XN3A 1UMHA 5JSRA 2LRDA 1GWKA 1ZZCA 4ZHNA 3K9TA 3M4OJ 1YNAA 2I2SA 2IXJA 5GZFA 3CCYA 2QQLA 2XVLA 5EIYB 1YQ8A 3K3OA 2MD5A 3ZMVA 2WZPP 4ZDLA 5D8LB 1JKOC 4BQOA 3W2VA 2BVMA 2DYSH 1EUUA 4IGPA 2BNOA 3WINE 4HL0A 4YW6A 3E6MA 3W21A 3WSOA 1QY4A 5J3UA 1DGWA 3A21A 3CQZJ 1BI0A 4MQVA 1OQ1A 4R4XA 1JYIA 2BXYA 2JK3A 3BPXA 5B1AH 1I6HJ 4YRDA 4JRAA 4BOWA 1DGWY 2GALA 4LB5A 2QQOA 2JZYA 4YG0A 1TG7A 3OSFA 3NWSA 1K45A 1SVLA 3NO8A 4MGTA 1GFF2 2RJ2A 1H9TA 1PIV1 1HRI2 3T2TA 2D6PA 4D8MA 2F4IA 2XUMA 5FREA 1OYIA 1AXZA 4XJAA 2HWE1 3ISPA 1CAUA 4C2TA 4FPYA 5DZGA 2XVKA 4KISA 3J7YJ 1C8M3 1R1VA 1W5SA 2KQRA 4YZ2A 4JX4A 2A3YA 3ERMA 1GZWA 1QU0A 3NL1A 2GN3A 2M0MA 5FV3A 3PHMA 4DRRA 1F2NA 1S1AA 4G8XA 3K2AA 3IWZA 1H8VA 1HKDA 4JHZA 2VBYA 5HS8A 1DQ1A 5FO8B 4N7UA 4QPOA 4DUXA 3F72A 4QPIA 1IGNA 4WXCA 2CQ7A 2CUEA 1RHI1 3J8F1 2WAFA 1RVF1 2HKOA 3CUQB 2D6KA 2WV1A 2WFF1 3IKVA 5DG2A 4IQ4A 2GQQA 1R5GA 2R30A 3BG7A 1UFMA 3BU7A 1QJY2 1UXXX 1Z0XA 3FUOA 4UW6A 4Y22A 2OQRA 3VBSA 1AR61 5EJ1B 4LNVA 3TN93 4CICA 3A03A 4Y4RA 3SMHA 5BNPA 3WU1B 2C6YA 2ZBJA 2LRPA 4XMIA 1SMVA 1UG2A 2NAZA 4IX7A 1NUKA 3OR2C 2Q8EA 3ACFA 3QPHA 1M4WA 3UKNA 3JREA 1RUH3 3JZVA 4FAHA 5J1YA 2JDPA 2D7FA 1MQTA 3SQOA 2B46X 2GOXB 4IW3A 2JQ7A 3V4GA 1J3QA 2J5OA 1F36A 2EFPA 1ZQ3P 5BNNC 4QB6A 2L7ZA 2LS6A 1HRV3 2VOOA 4UVCA 4YG6A 5BNNA 5GLUA 3AXDA 2R041 2XGDA 5HNHA 5D6EA 3AMNA 1L0OC 4C91A 1MZBA 5FLVA 1J7KA 1E17A 3LE0A 1WJDA 4IEJA 3MKYB 3HQRA 2WO7A 2MLKA 1KQRA 1U5IA 2R5ZA 2TCTA 3PO3J 5BPDA 4I0AA 3LSGA 4M6YA 3KB5A 2TDXA 3HWJA 4RDUA 4AI8A 2LW8A 4NMIA 4BUPA 4Q29A 3KWVA 4PDWC 1NA1B 3BVCA 4JGYC 3VL9A 5IK4A 2ECBA 4BQAA 2VQ0A 1GZ9A 1TQMA 4RS8A 1F5JA 2F5VA 5JXIA 2B39A 3K4ZA 3LDBA 4JK1X 5CKNA 4L9TA 2ID4A 3THCA 2V6EA 4GH4A 3C7JA 3J26N 3S1NJ 2L01A 1FIPA 5FD6A 1NX9A 2J1SA 3GTMJ 2D40A 2Y26A 1QJFA 3QLQA 2Y0SA 3AYAA 2R1DA 3VZJA 3ZQGA 4A4AA 2JSCA 2HQNA 2JIGA 2V9VA 4GJZA 1LDKB 4BY1J 2CWSA 5IYBJ 2X05A 1OLME 5J98B 1CZVA 3LDRA 3IIIA 3URFA 3HMYA 4P14A 3WDUA 3ZPYA 4COVA 4FI9A 3QPLA 4MTEA 1NH3A 4F55A 3PSFA 2XJQA 1JTXA 1W7PD 2MGQA 4DUVA 2CW7A 4LTAA 5FZ7A 3EQEA 4EVIA 1KDKA 4Q4Y1 2JB4A 1CQTA 4BHPA 3FX3A 4AI2A 5A7SA 1GDTA 3ZO0B 3ORJA 1U5ZA 5FKLA 1N3OA 2X9DA 2ZGKA 4JVAA 3I4IA 2AACA 2LF7A 1OF4A 3WXPA 2QNKA 3MV01 4EQQA 4IF4A 5ICGA 5LHIA 5E18F 5FLXZ 1K78A 2V7FA 3HOUJ 2VMEA 4E7JA 3ZSLA 4ASLA 3OS1A 1YHQI 3RJRA 3HT1A 4LHKA 3ABLH 2KRCA 4D0QA 5JLXA 3L00A 3I56I 2X29A 1X4OA 2QQAA 4YFKF 4Q4ZF 3NNMA 1F9NA 1CZTA 1LFBA 1ZGWA 4LULA 2P8TA 2OD5A 5F6LB 3V7RA 4PJNA 1GNYA 4XLEA 2OUHA 1S2BA 2RMU1 2P4EA 4OQ8A 3G1LA 2CMPA 1RZ4A 5E1ZB 3DEUA 4UUSA 1HRV2 2JDKA 4M01A 1SBFA 3NWTA 3ABTA 4MXWA 4QX1A 5EG0A 4HDUA 1W9TA 2G0EA 2WSUA 2W39A 4MG2A 4IHYA 4HLYA 1Z78A 2XJTA 1YRNA 1WGPA 2EALA 1B9MA 3FF5A 1SD6A 4WWCA 1T6BX 2G9GA 3B01A 2YC4A 4BQ5A 5HLTA 4BK5A 5JPMB 1Z1DA 4TLGA 1CAWB 5DDGA 4EATA 1DGRA 4RFT0 3T8RA 1T38A 2VOPA 1S0EA 1MSFC 2ET7A 2EF6A 3UJQA 4I98B 3CP2A 3LFUA 2HWVA 3S5QA 1BN5A 1PVC2 2K5CA 4ZYDA 4HA8A 4KJZA 3JTGA 4ZS2A 2QZ8A 4FFHA 3NW4A 1AZDA 1AXKA 1LB2A 2Y30A 3AG4H 1XQNA 3JD72 4PF1A 3ZYRA 1QPIA 4Q4Y2 2DO7A 1RXFA 2GSYA 3JRHA 2VJ4A 2VT2A 1OKRA 3K4DA 2OPKA 2Y9ZA 1J1TA 2EA7A 1LFPA 3I64A 2OX0A 3WHBA 4F3JA 4M9ZA 2RDNA 4C90A 3V8KA 4Q2FA 3VBUA 3ZYJB 2W9XA 3K48A 4KG0A 2R4GA 1NK2P 4IV1C 4JX6A 5JHUA 3WQ7A 1I1EA 1C28A 5JR3A 4BZ4A 1KJLA 2DA4A 1K61A 2XL9A 3AX4A 5DG1A 2HEVF 1H30A 2GH8A 2P4WA 1TQ5A 3BG9A 4I01A 3W2WA 1OLRA 3J9SA 5GAEJ 1RHI3 4Q0QA 1XX5A 2HOSA 2LYCA 1C0WA 4XF1A 2DI3A 2UWMA 2GM4A 1HBXG 2ZEXA 4MADA 4LLLA 2Q30A 3WG4A 3RZDJ 4ASMB 3AP9A 2JUGA 1I3AA 4B47A 5DAVA 1GQHA 1JZ4A 2VASA 2L4MA 4XDPA 4ZXEA 5GTIC 1QBJA 1PK6A 1WLWA 1NXD1 2JKXA 1EY2A 4E8DA 4AWDA 5A3WA 5AC92 3HGYA 1LVKA 2DQRA 5IW0A 2D5HA 2M8EA 1UOBA 4LE3A 1X33A 1XSQA 1PUFB 4QKFA 4LUMA 5CVVA 3K77A 4WXHA 2ZFUA 3PQKA 2FCVA 2YBSA 2FQ3A 4IE7A 1VRH3 4QHOA 1VJ2A 5J36A 4D3WA 2HWF3 5C7GA 1T0FA 1OCRH 1HRV1 1VR3A 1JKPC 5H9QA 4M0HA 2OF7A 2GC3A 3H1YA 5HV0A 4DXRA 2KXLA 4UW4A 1MDMB 5B4XA 1XYNA 2EK5A 3VODA 3ASOH 1U9NA 2OPWA 5JZGA 3J7ZI 4PBPA 2XLGA 4AGRA 1S0IA 1K5MC 1A36A 3MCZA 4FPOB 5A7WB 2VI6A 1MH4A 5ANQA 4JZRA 1ZN2A 2QQUA 1RKWA 1OF3A 5JSOA 4XVHA 4LB6B 4F8AA 3PIPF 2Q0AA 3F8CA 3GZ6A 2W00A 4OZOA 1G9FA 2NPIA 4CE8A 3ZR8X 2IBDA 2FSWA 1WW6A 2FDGA 2UY9A 4OINF 2HWB2 3W5MA 1TWGJ 1KU3A 3JRDA 4E27A 1BBYA 3POJA 5JI6A 3IAS2 4P9YA 1YW9A 1PO13 2KPMA 4DQAA 2CDPA 4OUSA 4B29A 2DJIA 1J9IA 2K02A 4FHTA 4B09A 3KHCA 2G9FA 3PVNA 4A6SA 4MQ9F 5IOYA 1Y9QA 4KWKA 2M4GA 2L9LA 2D93A 3WR0A 1R1A2 3F22A 4P00B 2UUZA 2X6XA 2ISYA 2A6YA 3CCMI 3VBOA 2E60A 4GWNA 3HR9A 4FPEA 4NIGA 4NC6A 1TW3A 4WZFA 2ZNZA 2W1WA 3I97A 5JDBA 4CVUA </