3H3UA

Crystal structure of crp (camp receptor protein) from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
216
Chain Sequence
DEILARAGIFQGAIAALTQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
total genus 61
structure length 216
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3uA01
4HV6A 1R5GA 3FZ3A 1FSHA 4DNCA 1NHAA 4IERA 4ZYEA 3RZZA 5FLJA 1XE7A 5LBQA 1Z7UA 2IXIA 5FD6A 3TO6A 3FJSA 1OYWA 2FA5A 4KMFA 4FX4A 1IXRC 3VFZA 1FYKA 3O14A 3R0JA 5DEQA 2QZ8A 1FP2A 5BPDA 2Z69A 1QO0D 5FGMA 2HKOA 3RI4A 4L9NA 4MGYE 1BBYA 4P96A 1U12A 3Q5FA 3OGJA 3CF6E 1MD0A 2JRTA 1Q1HA 2JPCA 3EQLF 4XFIA 2JPBA 2E7WA 4QGMA 1LR5A 3FFQA 1A04A 1XCBA 2XKOA 3VEPA 1G3YA 4MUVA 1ZRRA 1H0MA 2YX4A 4L9VA 3K1NA 1ZREA 3E6MA 4HDVA 2A6EF 2V79A 3WW4A 3ZMVA 5C8WA 3IRQA 3DF8A 2O0YA 3KZZA 2ZKZA 3ZMZA 2K4JA 2B9UA 1YLLA 3SFZA 3ZMSA 2HYGD 3F8CA 5HDGA 1Z91A 4LLGF 5I91A 4YSFA 1KU9A 2O8QA 4XEZA 2HR3A 5HLHA 3T1BA 4ENMA 5D8KB 1I6XA 2VE9A 3REOA 4I98B 1HSTA 3EJKA 1USSA 3RYKA 4ORFA 4HN1A 5HDNA 2DI3A 1ZGJA 1JE8A 1YFYA 1I1GA 4KL1A 4IEYA 1ZG3A 3EYYA 2P8TA 2M45A 1XSVA 1W4MA 5DV5A 4WVZA 2H0VA 3I58A 2HYFA 3D0SA 4L9TA 1ZRFA 1LRHA 2ET7A 1J3PA 5CVIA 5H6RA 1FYMA 2EVXA 2ZFWA 3OF1A 2ZNYA 2PMUA 1Y0UA 1QY4A 4EM2A 3CUQB 2Q4SA 1AWCA 5FLHA 4LK1F 5ICGA 5FPXA 1XD7A 3G3ZA 2IA2A 1YWKA 2MBFA 2XAFA 3F8FA 4PIZA 1JHFA 4EWDA 1Q5OA 1IXSB 3QAHA 3WG9A 1STZA 4H0EA 3AAFA 4AVCA 4FX0A 4I7HA 4RD7A 5LEJA 4EVIA 3GYHX 4KWKA 1K78A 2PFBA 1WGPA 4P9FA 3T0YA 1DZTA 2R7DA 3ERED 4XSZF 2GC2A 1F5TA 4S04A 4B09A 2HGCA 3T8RA 1HW5A 1UCRA 4LLNA 4FHTA 4IEOA 3GW2A 5HLIA 5IT9Z 2LSOA 4IVNA 5E1XA 3D5LA 1YHFA 1R00A 3CJNA 4ONUA 3O6BB 1ZARA 4LB5A 3QOPA 2YSRA 1WA4A 3WW2A 5FO5A 2NAZA 4XLNF 1SD7A 4Q5SF 2FE3A 4CHUA 3HRUA 4FT8A 3T8TA 3QPHA 1O7FA 1WI9A 3VOEA 2A07F 3RTRA 2UZKA 4I02A 1BJAA 1Z6TA 3H1MA 3BPXA 5DCMA 1ZX5A 2F5DA 5L3GA 5JAXA 5L3BA 4XFAA 1D8KA 4XF3A 1IN6A 1YW7A 3M8EA 4HBNA 5E17F 1U5TA 1ZN2A 5FB2A 4Q48A 1O3QA 1ZYRF 1HW2A 2GC3A 4XFCA 4NB5A 3DN7A 2BGCA 2KXLA 4QM9A 4I09A 3KEOA 3GWZA 3GYDA 3U2RA 4UV8A 1YFWA 3SXWA 3J7AO 3IRRA 3RIRA 1CGPA 2ATFA 2OD5A 1RGSA 3L2HA 3M70A 1UB9A 3QP5A 2YPRA 4PJYA 4PDKA 4EV0A 2PAKA 2PMHA 5AIPA 2VQAA 2H27A 3J80K 2EK5A 3ZQ7A 1XDSA 4QWQA 4B8XA 2QYOA 1YYVA 4WXCA 4Q0UA 1MDMB 2XL7A 1T38A 1ZZBA 2AS5F 3DEUA 1XGMA 5CVVA 1REPC 2ESNA 2VECA 3R4KA 3C7JA 4HF1A 3N4MA 2PHLA 4BIFA 1GVJA 1ON2A 5FLIA 5L3DA 3M7GA 5D1IA 2CV6A 4MTDA 3KP3A 2XLGA 3K69A 4R79A 3CDHA 4OMYA 1FLIA 4G6DA 4KIFA 3KGLA 3RPUA 4IEQA 4HAMA 4F8AA 1C0WA 3QU6A 4HSJA 2YX7A 4KMUX 1B9MA 3GVAA 3KCCA 4RGRA 3HIFA 3WGHA 2W85A 3RPQA 2PFWA 1VJ2A 3TNPB 1LVAA 1Z1DA 3HSRA 5DYMA 2FQ3A 2H94A 2A6HF 2VC0A 3KE2A 3T5XA 3M3IA 1YG2A 5ED4A 3LSTA 4LB6B 2VT2A 4XRFA 4IRIA 5F6FA 2F5FA 1CAWA 2FNPA 3JSPA 1XGSA 2ISZA 4LLOA 2FNAA 4OIRF 1JHHA 2P6TA 3OOPA 4UNOA 1FBUA 4KICA 4Q47A 3M8FA 2B0LA 1J58A 1Y9QA 1HSJA 1LJ9A 4U7BA 2BBYA 4CICA 1B59A 4RB2C 3OV8A 3HT1A 1S7OA 1V4RA 4EROA 2F5CA 3KSCA 1XSDA 4ZH4F 5E1ZB 3U11A 5LLQA 5CU1A 1RNLA 1OFNA 5H20A 3S0MA 3ZMUA 3H1WA 5DDGA 1ZRDA 1FP1D 3WTYC 2QDRA 3LAGA 3IHUA 3PQJA 2F2EA 4A2UA 1CAWB 5DCFA 1S29A 1TTYA 3WTZA 4A0ZA 4PGGA 4AD9A 1WWXA 4JQFA 5I8TA 4EJOA 2E7XA 3F8NA 2XASA 3F72A 1FI2A 4ESBA 3P9KA 4EJVA 4RB0A 2DPDA 1P6RA 1IPJA 2ETEA 1SMTA 3BALA 2EV0A 5BOXA 3E5UA 3ULQB 2RVCA 2RKHA 1B6AA 3I7DA 2GXBA 1SD5A 1TLHB 4YNIA 2ZBKA 4ESJA 4L11A 2B5HA 3EQEA 1U5TB 3LFKA 2C6YA 5C6CA 2ZXJA 1CX4A 2VC1A 2V6CA 3L00A 5D4RA 2Z99A 3W6JB 3M1EA 5I0SA 1TQPA 3J80Z 4M73A 1YW9A 2XIGA 1VR3A 1LNWA 3LA3A 3E6DA 4CYDA 3TQNA 3COAC 1U78A 2ACJA 5A2QZ 3ZPLA 2NNYA 5J3UA 3PVBB 3FXQA 3IWFA 2JTVA 2BE5F 4HV5A 3CL1A 2A3SA 2W24A 3F21A 1HKSA 3VHRA 4G9YA 2FQPA 5H6QA 4JVAA 4XF9A 3BP8A 3DV8A 1G6NA 2HQRA 5KHGA 1RTVA 4K8FA 2RNJA 1J59A 2WTEA 5LHIA 4OIPF 1J2XA 2COMA 5E8IA 3F22A 1D3YA 3ELNA 3FMQA 2QVSB 2IA1A 1ZG5A 3EUHA 1CAVB 5DUIA 1R36A 1FYLA 1TQ5A 1IUYA 1T39A 5JSPA 4D0PA 1F9NA 3ROUA 2XVCA 1BM9A 2BNOA 3HSEA 1H1MA 2MLGA 1E17A 5LGTA 5LRSA 3WTSC 2UXNA 4IRHA 4E2QA 4M6YA 1MZBA 3HRTA 1ZRCA 3GX4X 2OU2A 3F3XA 4M9XA 4TLFA 2VT3A 1HW1A 4GYIA 2AXLA 2PAEA 2K9ZA 4I2OA 5E16A 4XBFA 2XUBA 4UVBA 4HOBA 5D5VB 2DQLA 2H6CA 3WE3A 2XAHA 4U0WA 4BHBA 1IPKA 2XAGA 4CO8A 4KIGA 2ZNZA 4IEPA 1J7KA 1NYWA 5TJJA 1U2WA 2XROA 4Y13A 1DGWA 2IXKA 1TW3A 1W5SA 3PNAA 1O3TA 2FF4A 3MZYA 1MDMA 4O3MA 3RYPA 2HFHA 1EH8A 1HQCA 4GXOA 1ZG1A 3J81K 1RI7A 4S05A 2YR2A 4L2NA 2UY8A 5JSOA 3B73A 4K2EA 2RC4A 5J48A 2IW5A 2JT1A 1MJ9A 4AIHA 5L3CA 1OYIA 1UPIA 2VBWA 1SFUA 2CGPA 2QCSB 2NNNA 4WF2A 4A0YA 4HQMA 4AXOA 2CW0F 1LEBA 3H3ZA 4OMZA 4HYEA 2HQNA 2STWA 4P9UA 4Z07A 1OPCA 1FNNA 2A5YB 2E9QA 3MZHA 4L18B 2M1BA 2X4HA 1W7PB 1PDNC 4G7HF 1DDNA 3HSFA 2IT0A 2Y75A 2K02A 3C18A 4RAYA 3RKYA 1H9TA 4EWEA 1X7NA 3MPBA 2P5VA 4LUMA 3MEXA 5BMZA 2GH2A 3WODF 5E1RA 2P7VB 3LA2A 4CDGA 3I5UA 1GHCA 2UYAA 2IPQX 5CLSA 2D5FA 4J1XA 2EFQA 4MQ9F 2MH9A 4LUKA 4MH0E 2PQ8A 2NYXA 1YS6A 1XB4A 3TDZC 2Y0MA 3RKXA 4ENJA 1J5YA 4EQQA 1YFUA 2CG4A 2O03A 4YFXF 3GO5A 1OD5A 1GXQA 5K5QA 3DPLC 3DL3A 1K79A 2J5PA 3IDCB 2CWEA 1D8JA 4XF4A 1LDKB 2PN6A 3WTXC 3ZMTA 4U88A 4L5IA 2WV0A 2BNNA 3Q9SA 4ZU4A 2QJVA 1MKMA 2GXGA 5I0RA 1SFEA 5ICCA 4JV4A 4HVQA 2XLFA 2QENA 3HHGA 2EFNA 4M72A 1RC6A 2Q30A 1PP8F 3RYRA 5T3NA 1W5TA 1G3WA 3E6CC 1KU3A 1WSUA 5KK1A 5BPXA 4LLLA 3P9IA 3MWMA 2CQKA 5J6XA 3KGZA 4A5MA 4M9SA 4UVAA 3EDPA 2Q1ZB 2DLLA 1P92A 2RQPA 2ADUA 3NJZA 2OQRA 1Y3TA 1USTA 3NL1A 4XETA 1OI6A 3FM5A 4XSXF 4A12A 2N7GA 4WZCA 2IXHA 4M71A 4WXDA 1YQAA 5DUKA 4KNYA 2I45A 1ZAOA 4HLXA 3BCWA 1IW7F 2K4BA 5JHUA 2WC2A 4ZYGA 4LD5A 4Q0SA 4UBGA 3V4GA 4E70A 1XGNA 4P5OA 5D5WB 3CJXA 3HHHA 5BV6A 1KU2A 1X3UA 3ZN0A 2VODA 1MJBA 1DGRA 4AVBA 3ES4A 2W25A 1IZ1A 1SFNA 2VPVA 5HI0A 5A2QK 3PQKA 4RGXA 5D5XB 2RV8A 3UKTA 1ZHFA 4YG2F 3R61A 3JTGA 2OZJA 4HX8A 1XDUA 3LA7A 3U10A 4P9GA 2IA0A 1FX7A 1IN7A 4BH9A 4QGLA 1EH7A 1SQ4A 4Q4ZF 1O5UA 1SD4A 4MNUA 3GBFA 1R1TA 4L9JA 4G7ZF 3ACLA 3LAPA 1Q43A 4WWCA 4KWJA 2GU9A 3E3VA 1KGSA 1TW2A 2QBYB 2M8EA 4Y15A 2FRHA 4X6QB 1EH6A 4XFBA 3H9AA 1LKNA 3GFIA 1F4KA 2D93A 3UKNA 1ON1A 4RGUA 3NVCA 4HVRA 1BI0A 2OZ6A 4E2GA 2R7FA 2ETHA 1X82A 3ES1A 4KFCA 1Z9CA 1ZLJA 3WTTC 1BOAA 2DCTA 5BPIA 2IXCA 4IHSA 1BN5A 2EJRA 1Z05A 2MNGA 3HOSA 4EGYA 1QPMA 1CAXB 1V3FA 1ULYA 1KQ0A 4HVOA 3F6VA 3ML6A 5KBFA 3FZVA 1G3SA 1DPRA 5L3FA 2G9WA 3BDDA 5D6FA 1ZZ9A 3H1YA 2DK8A 1HKTA 5E18F 4H7LA 1J0RA 3SZPA 1OMIA 1BI1A 3SCFA 4UBHA 4EM0B 4CZZA 1HBXG 5I8YA 4D7SA 1UIKA 4Y17A 2FSWA 2UXXA 4BYYA 5HS8A 2XLAA 1F1ZA 5JCTA 3TNQA 3KMHA 2L3DA 3IL2A 4O9EA 5D6EA 4ZYHA 1T2KA 4I01A 3IWZA 2XKPA 4HF0A 2PA7A 2Y48A 2FBHA 4AIKA 3D0JA 4NVPA 1WQ2A 3IC7A 3H50A 2C0ZA 5AIQA 4MX3A 2HWVA 3ZN1A 4FBFA 4ASNA 1O4TA 1FY7A 1E2XA 2H09A 1IAWA 4QM8A 1XN7A 4O5VA 1S6LA 3QP6A 1P4WA 4R1HA 3K2ZA 2D5HA 3BJOA 3BZ6A 1LQ1A 1LDDA 1PP7U 5JFRA 4HBLA 3V8LA 2JZYA 3BROA 1EV7A 1LB2A 1J1LA 4OOIA 1ZZCA 4Q0PA 1O7LA 5HOOA 1D5VA 4QLCU 2BNMA 4IEUA 3WU0A 4Z82A 3BB6A 4QGNA 2FBKA 4OLLA 5BUVA 4YIIA 2O61A 1EY2A 4AVPA 2EFPA 1O3SA 3TOAA 2UYBA 4RGSA 1T0FA 1X8MA 2HTSA 2M87A 2YU3A 3DQVC 4EM1A 4OIOF 5CJ9A 3N97A 4IXAA 4YIFA 3JAMZ 2CAUA 3WTWC 1FZPB 3HT2A 4HW0A 3MDPA 3DKWA 2Z9OA 2EV5A 5FFZA 4O6JA 5EFUA 3SHFA 3F8MA 2DFIA 4F7ZA 1FBSA 1KYWA 3WTVC 1K78B 5BXXA 2VONA 2X0LA 2KIFA 1NE4A 3BJ6A 4L0ZB 2ZO4A 2VN2A 4DINB 3GF2A 2L02A 1KQ8A 1XE8A 4JTNA 1IXCA 4HDUA 2IP2A 2PJPA 1WKMA 2HJIA 4ENNA 2EWNA 2K27A 1UD1A 4OFGA 1DZRA 3LZZA 2D1HA 1MJAA 3GFLA 2J5OA 4HLTA 3FHZA 4MEYF 1IF1A 3CLOA 1O3RA 3E5XA 2Z3YA 3USSA 1EYBA 4IETA 1SAXA 1OR7A 4LULA 5E8GA 3BWGA 5KHIA 4ZZLA 3FM3A 5DD8A 4RS8A 4A5NA 3KP6A 2EB7A 3O3KA 3BPVA 4U0VA 3IKTA 3I54A 2IC1A 2P17A 2V1XA 2PEXA 2M5WA 1R58A 2V1DA 2EA2A 3SQNA 1SEFA 3F6OA 3VODA 5CADA 3CEWA 4GYGA 4A0XA 2NRAC 4M9ZA 3CUQC 5KHHA 4GULA 4ON0A 4MGZE 5BQTA 3I59B 3L2CA 1XRUA 3RKWA 1Q3EA 2L4MA 1XMAA 5JSRA 2DO7A 3FMRA 5FD5A 2FOKA 3MYXA 4KIBA 4A6DA 1CF7A 4ETSA 2RDPA 2DAOA 1YW8A 3KLNA 4NQWA 1KYZA 2WFPA 3TGNA 2O8XA 1B1BA 3V7SA 1G3TA 4MV2A 4LG0A 5JR7B 3B02A 1R23A 2XV4S 2F5EA 4JK1X 5I0TA 1S3JA 4WCGA 1YTYA 3KEQA 2OA4A 4MZUA 3KZYA 1B4AA 1MGTA 2KKOA 2Y0OA 3I4PA 5TRDA 3SCGA 2P5LC 5I8SA 1SMYF 4IEVA 3OTFA 4E2SA 3SZTA 2FBIA 1RL3A 1I27A 5FLXK 4X6RB 3BJAA 3FXUA 2HS5A 2L4AA 4NHJA 5LRRA 3BY6A 2OYZA 5HS7A 3KP2A 1KQ9A 4YFNF 1ZLKA 4BNCA 2ISYA 4LFUA 1S8NA 5FQ0B 4BHPA 2D1VA 1DPUA 4JBAA 2GA2A 2HDCA 1J75A 3S7IA 3FHIB 1QZZA 4EGZA 3CO2A 2OBPA 2PG4A 4L0YB 5HLGA 3J81Z 2R3SA 1K7AA 2Q0AA 3H92A 4ENKA 2O3FA 5D5UB 1BIBA 2IXJA 4IEZA 3C3WA 3G73A 4R52A 2PHDA 4LTAA 5KHJA 5D8LB 5BS6A 4U0YA 1I5ZA 2BEOA 3GFJA 1H1IA 1R1VA 1VTNC 1ZZ8A 2CFXA 1SFXA 1FSEA 4MTEA 2KRFA 2KIUA 5AONA 4ZZDA 1QXJA 1XMKA 3M9AA 1B9NA 1T6SA 2ESHA 5JR3A 1HXDA 3SCHA 1R1UA 5E1WA 1Z6RA 1QWRA 2A68F 3I64A 5K1YA 5IT9K 3I53A 1X8EA 1QZYA 4O9GA 2TDXA 4UUVA 2EAAA 2Z2SB 5JVTA 2EA4A 3GZ5A 4IPAA 3NEUA 3O2PE 4LGWA 5FFXA 1U6GA 2Z5UA 4UXAA 1PUEE 4MGIE 5E20A 2B8MA 3V8KA 3VB2A 4D7TA 3TKYA 2PQQA 3H7JA 2MHFA 2DTRA 4U7DA 2QUFA 1IN5A 4UHTA 3JTHA 2L54A 3OD0A 3HQXA 2DW4A 1ZVFA 5LEKA 2DU9A 2EA7A 2F4PA 3F23A 4IRGA 1U8RA 2XHKA 2G7UA 3TDUC 2Q0OA 5I0UA 5I93A 2P7CB 4PCQA 1OYYA 1GQGA 3BPZA 1QQIA 3IBMA 4Q0QA 1H9GA 2W84A 5CVRA 2UY9A 1QNTA 2XGXA 1W7PD 2D2WA 4HA8A 5K5OA 2DPUA 4LA2A 3CUOA 3E6BA 3CO7C 1K6OA 2RN7A 3EETA 2XAQA 5AVPA 3HTUA 2Z33A 5FDBA 4KDPA 2O1QA 1R7JA 3V7RA 1GXPA 4YFKF 3GFMA 3KP4A 1J3QA 2CSOA 3OCPA 2XRNA 2V9VA 1QGPA 3PFIA 2RGVA 2VBYA 3QRFF 1UIJA 4LMYA 5ICEA 3ST7A 3WTUC 2QBYA 4Q0VA 5F1RA 3IKVA 4XFHA 4UVCA 4GO1A 3WGIA 1L3LA 1TNSA 4ZU7A 4MHGA 1GQHA 3ZMDA 4P55A 1BI2A 5K8SA 3DFGA 3Q9VA 2QNKA 1U5TC 1EP0A 4HLYA 1U3EM 3U0ZA 4BXUA 3FE5A 1S7AA 2ZCWA 4KU8A 4ZYDA 4CXFA 4YARA 4EJUA 2PAMA 5IT3A 1CF7B 4R8HA 1TNTA 2PBIA 3BU7A 3MAJA 1FT9A 1PMIA 2GC0A 4BQAA 2ELHA 2OPKA 3DP7A 4N9IA 2V09A 5DD4A 1YLFA 3E5QA 5LHHA 3EYIA 3RDIA 4MGRA 1JUHA 5LGNA 3JAMK 3E97A 5J8CA 2DT5A 2BYVE 4AIJA 4N9HA 4ZU5A 4HX4A 1XCVA 4AWXB 3W6KB 4LJZF 2MPFA 3K1PA 2QQ9A 3KP5A 3EBRA 4HN0A 2KIMA 3I71A 4HSLA 3R60A 4XLPF 4MEXF 2GA1A 3WU1B 2OZUA 2GIVA 4L5JA 1W7PA 1V70A 1FC3A 3RJPA 4YRDA 2ZKLA 2LF7A 2IXLA 3LQQA 2VBXA 3KP7A 3HRSA 4TV7A 2A61A 1J3RA 4OU0A 2IRFG 5CYVA 2HKXA 4KU7A 2CYYA 3V8JA 1R5HA 5F64A 1NXMA 3LOIA 4PIYA 1UHMA 4HZFA 3ELKA 5JI6A 2P4WA 1ODDA 2P5KA 3QACA 5KVRA 2O6GE 1YIOA 2KJBA 4QX5A 3JSOA 1FOKA 3TO9A 4KT5C 2WWYA 5J8FA 4IEWA 3S2WA 3D82A 2K7LA 1KA8A 1L3JA 5EEGA 5EEHA 1TQMA 3CLPA 3WW1A 2ZMEA 5FCCA 4B29A 1YFHA 3L7WA 3SHRA 3JW4A 3LQRA 2LKPA 5EZWA 3V7CA 3GZ6A 1PM7A 3HYIA 4OIQF 2EFWA 2OAZA 1R22A 4LG0B 3C1DA 1WLTA 2OQGA 3QU3A 3U1DA 1XSXA 1IN8A 5ILSA 2QQAA 5CVJA 3K9TA 3ABUA 1QBJA 3P7NA 2FMLA 3WE2A 1AOYA 3HRMA 3H7YA 2JSCA 2VOOA 4KA4A 3GEZA 1YUDA 3ECHA 4WXHA 3FX3A 3QPTA 1WRJA 2DK5A 2DBBA 1ZNPA 4J1WA 2GZWA 1UHWA 2HOEA 1HKQA 1T98A 2CAVA 3IIAA 3CO6C 4XFFA 4KYWA 4BHCA 1BI3A 1UCXA 4QXKA 1P4XA 3DXJF 4PZJA 5BY5A 4EMSA 4FAGA 1DUXC 4FAHA 2PLYA 1XGOA 1VP6A 2LNBA 3I0TA 2E1NA 2STTA 4IEXA 3FF5A 3FWEA 2GWRA 3GUDA 2V1UA 2PYTA 5FPZA 2GC1A 5DCMB 4XF0A 3KLOA 5CVUA 2E1CA 3NSTA 2VE8A 1FXZA 3S7EA 3NKTA 5ILVA 2W57A 3P9CA 4LA3A 1FBQA 1FPQA 2XAJA 4HF2A 3EHKA 2MH2A 3K0LA 2QM3A 3CUQA 1YO5C 3I59A 4QMAA 1NE6A 1G4DA 2A69F 2ZMEB 4EWAA 3H3UA 4WK8F 2ZJ2A 2BV6A 2GAUA 4RB3C 4Q29A 2MC3A 4WX9A 3KETA 1QXRA 5ERIA 3TOBA 1BC8C 4KN7X 1IN4A 3HUGA 3TO7A 1RZ4A 4EJTA 2KJCA 4G8XA 3RNSA 3R0AA 3SXYA 4LEJA 4DQ2A 4KUMA 3NW4A 2K86A 4JTOA 5ICFA 3MCZA 1EPZA 4I0AA 4LK0F 4UV9A 4IESA 3LAJA 2L01A 4AVAA 3NRVA 1RIOH 1O57A 4Z2YA 4XFGA 1DP7P 1UW8A 2FU4A 3GXOA 1RUOA 1P4AA 4ESFA 4G6QA 2HZTA 3HTSB 1ZZ7A 2MLKA 3UKVA 4PGHA 2K0GA 2HTJA 2LDUA 2IJLA 1BIAA 2XL9A 3G7DA 2D45A 3C3VA 4PIXA 4UXNA 4MQVA 3ECOA 4RB1A 1ZH5A 2VXZA 2MA3A 1CAUB 2FEZA 1CAXA 3R6SA 4HMZA 1BC7C 4BAYA 2OA2A 4MGKE 4CGZA 3ABTA 3MFKA 3LWFA 3DPTA 5HVQC 3PLQA 1TBXA 4YYOA 1O5LA 3MQ0A 2P6SA 4G7OF 2FXAA 5K5RA 2ET1A 3CTAA 2Q8KA 2MD5A 1NZCA 3WW3A 3U9GA 2QVOA 2Q2EA 3BOQA 4HX7A 1P2FA 1UFMA 2UWMA 2QWWA 4M6XA 5D4SA 2G7HA 2D40A 3WGGA 2VBZA 5HS9A 1JGSA 1ONVA 2H6BA 1SD6A 4IHTA 1CAVA 1JXSA 3SMHA 1OKRA 4GGGA 3L09A 2GQQA 1FWZA 5LGUA 2EV6A 4I0BA 5LHGA 2PI0A 3ZP5A 3KFWX 5KHKA 2VOPA 4M74A 4N0BA 4AQ6A 2NS0A 1ZZ6A 4RAZA 4G94A 2IVMA 5FLXZ 4AQ2A 3JZVA 4IF4A 2EFOA 1LDJA 1L0OC 3FMSA 4IJAA 3ETQA 1ZGAA 3F8BA 1IRGA 4A6EA 1J9IA 1CAUA 1RUNA 3K1MA 1KU7A 4WBBA 5J7MA 2HEOA 4I3PA 2LF8A 4META 2M30A 4KN4X 2QLZA 3HOTA 3L9FA 2FMYA 2QQBA 1LEAA 2PTMA 6PAXA 4XF1A 3IDBB 4HQEA 4KWLA 1YS7A 3NQOA 1I1SA 1IRFA 2DQRA 3ZDSA 5ILUA 4OINF 3H8UA 3LWCA 1YFXA 3ISPA 5HDKA 3GLXA 4EJWA 3FXRA 3EO6A 5FQ0A 5L3EA 4GCVA 1TQIA 2CO5A
chains in the Genus database with same CATH superfamily
2XF5A 1R5GA 1S9HA 1FSHA 2K3PA 4DNCA 5EIYB 3ZXKA 1X9PA 2V4JC 2IXIA 5FD6A 4CXXA 3TO6A 1IPSA 1OYWA 5IY5H 1C8M2 4XOGA 2P1BA 4R9DA 4KMFA 1NLQA 2BFUL 3AKQA 4QB1A 1IXRC 3HC7A 3VFZA 4ASLA 3O14A 1NCRA 4YW2A 1UELB 4GH4B 4L9NA 4MGYE 1BBYA 4P96A 1U12A 5KWRA 1ACCA 4AI0A 2VMIA 2OTJI 3CF6E 1MD0A 2JRTA 3O0XA 3R4UA 4EN7B 4XFIA 4PLOA 2E7WA 1LR5A 1AZDA 3ZFGB 1JMUB 1LU1A 2XKOA 2HWD2 3KT1A 1UY1A 1H0MA 3K1NA 4QQ2A 4HDVA 5GZCA 2D98A 3MIEA 5C8WA 3M7AA 3IRQA 1A34A 3ZMZA 2VMGA 1UY4A 4BQYA 2YZ4A 3P3PA 4XN3A 2BWAA 4LLGF 1VMHA 5I91A 4B43A 4AVSA 2P5BA 1VQNI 3MFAA 5FJ8J 3Q8AA 5D8KB 2VE9A 3REOA 1NG0A 3AVSA 4NDLA 2DYRH 3S30A 1USSA 4RGKA 1T33A 3T08A 2DA6A 2XH6A 4QPYA 2Q8DA 3U1XA 1MZEA 1SLBA 2VTXA 1XSVA 1BLZA 3CDZB 2OVUA 3I58A 3PUIA 3T2QA 2VVEA 5HCAA 2R7OA 5CVIA 5H6RA 1FYMA 2EVXA 2ZFWA 1Q8PA 3N35A 3CUQB 2C9KA 2XSDC 2Y6FA 3A03A 4PJMA 4OYUA 4M6VA 5ICGA 5FPXA 2WSVA 5FBZA 1N3OA 2JENA 4LBKA 2BHZA 3G3ZA 3FHQA 5ACA2 4Q8KA 2MBFA 1JHFA 1LGCA 4EWDA 5F0FA 2W39A 3BG5A 1AX0A 1WJBA 1IXSB 4QX3A 4CU7A 1GP5A 2Y60A 2WV1A 3HB9A 4AVCA 2YDEA 2GN7A 4I76A 2DURA 4RD7A 1GDTA 4KWKA 2PFBA 2GMEA 1DZTA 1SPPA 3TN92 4WZFA 3NWTA 4XSZF 5GLWA 3B7MA 5FOJB 3HAGA 4B09A 3T8RA 1VRH2 1HW5A 2KRCA 2QQ8A 1GP6A 3SEEA 3GW2A 5HLIA 2HDDA 5IT9Z 2LSOA 5E1XA 3J7YJ 3AKPA 3J8F3 5IVCA 2A6ZA 3BUCA 4BQ4A 1V00A 3JB8A 3D5LA 3CJNA 4ONUA 2VIXA 1PO12 1HLCA 3WW2A 5FO5A 2IWGB 2JDMA 2YBKA 4KI5M 4QKDA 3W2VA 3T8TA 3O0WA 1HV0A 2UZKA 1JI8A 2CDPA 1BVP1 4CYCA 2W3JA 5JDBA 1DYOA 3H1MA 3HBLA 5JAXA 2D3SA 1IN6A 1YW7A 4HBNA 4KQ7A 2XR4A 5FB2A 4Q48A 5GJ6A 4Q4W3 4XFCA 1H8AC 3N3HA 4BLIA 2BGCA 4I09A 1WMEA 3KEOA 1AX1A 3GWZA 5F6LB 1UOGA 3LSPA 1Q8VA 2WY7Q 4UF0A 5FZKA 2ATFA 2CRGA 1RMU2 3L2HA 4D5CA 4DY5A 4N7UA 3S16J 2PHFA 5B66C 4PJYA 1VBB2 4AGVA 4Q4V1 3ZYGA 2EIKH 3T2TA 4B8XA 3G1LA 3LDKA 5FY8A 4Q0UA 2E1MC 1T38A 1R1A2 2AS5F 3DEUA 5CVVA 2DTYA 3R4KA 2HEYF 4AEKA 1UY2A 4CSWA 2PHLA 1COV3 4AHZA 1ON2A 1DU3D 4HSTA 4YG3A 5FLIA 3ZKYA 4BOWA 4R79A 3CIHA 4RR3B 3WQ0A 2CQQA 1KZHA 3FXJA 4IEQA 3P5JA 4HAMA 4QPIA 3GVAA 2VCAA 3ZFEC 3LOCA 2JG8B 1ULPA 2W85A 4B3XA 1VJ2A 3AL6A 1Z1DA 3KT4A 2BY2A 5ED4A 3LSTA 4LB6B 2VT2A 4XRFA 4IRIA 1RKWA 2FNPA 1PVC2 1XGSA 2ISZA 2PQSA 2NN8A 1S0JA 5C4WA 2JQ7A 1JHHA 2P6TA 3OOPA 5EZHA 4UNOA 3VDDB 3ZR6A 3RZMA 4KICA 3LQCA 3M8FA 4NUBA 2B0LA 4U7BA 1D4M2 5F5CA 2E7AA 4KBBA 4G9SB 4AW7A 2Z16A 1S55A 4ZH4F 1K4TA 1OFNA 1F36A 5LASA 1FP1D 4Z2WA 3UGHA 2E51A 1LEMA 3LAGA 3IHUA 3PQJA 3BCBA 4XE9A 3KQ4B 4JKLA 3VBHB 3BR5A 4A0ZA 4RGGA 2ZX0A 4MVTA 4CP9B 2RR13 1WWXA 1HIXA 4FPCA 5LBBA 5I8TA 4EJOA 3APBA 2XASA 3ZXAC 3K10A 2M2EA 4DBQA 2WFF3 2R7RA 2K9SA 2EV0A 4RM2A 5BOXA 1R6RA 3HG9A 2RVCA 3I7DA 5FY5A 1W8NA 2GXBA 1TLHB 4WM8C 1XOYA 4YM1A 5C4WB 1U5TB 3OUIA 4N53A 2YU1A 3RQ0A 2P6CA 3PUQA 3POJA 3UNGC 1XQNA 2JJ6A 3M1EA 2WNVB 1U5XA 5DZEA 1QJFA 1CIYA 1LNWA 2JG8A 4XPVA 4C30A 2LK2A 1NTCA 4FTBA 3TQNA 5K0UB 1RVF2 2ACJA 3ILFA 3P5BA 1F35A 4KG0A 5LA1A 3H8RA 3LL7A 3URFA 4NIHA 2DT7B 5FPBA 1UWWA 5J1UA 4WVVA 2BE5F 2YUSA 2A3SA 3PFYA 1QNYA 1IV8A 1U0AA 2WZEA 2VW2A 2ILMA 1VMFA 1FOYA 1FX5A 2DA3A 5DAQA 4YEJA 3U07A 2RNJA 5C8CC 5LHIA 4OIPF 2VTXJ 4RR3A 5FREA 2COMA 5E8IA 4HKWA 4XCBA 1AR71 1QVUA 5EGOB 2QVSB 4CXWA 5JXGA 2HU9A 4COZA 1R36A 1TQ5A 3WDYA 1T39A 4IUGA 2VQ0A 1FPN3 3VKFC 2ORXA 2IBDA 1OOPA 1RUD2 1UO9A 2XPJA 2JA6J 3T1MA 5LK7B 1BM9A 1ST8A 2MLGA 1E17A 3DXTA 5CFDA 1UMIA 1IKPA 4IRHA 2W5FA 1VPHA 3KYDB 1MZBA 3HRTA 3GX4X 2OU2A 2VT3A 4QWNA 5LA2A 2VC9A 1VQLI 1T2XA 3GNEA 1UXZA 5E16A 2XUBA 2OJED 5D5VB 3AP6A 2DQLA 3KV4A 4QQHA 4U0WA 2Q8CA 3I3MA 4KIGA 5K7ZA 4HXCA 2JG8C 5G04L 3ME2A 1C8M1 1VF9A 3ABZA 2CQNA 2IXKA 4Q4V3 2VOKA 3HM5A 2IVIB 1O3TA 4DIQA 3MZYA 3AJYA 3IKWA 2IFRA 4BGDA 2K9QA 1UPSA 1ZG1A 4L92A 4IE4A 4S05A 1S72I 2DCYA 3CLQA 2UY8A 1V5GA 4FISA 4K2EA 3AYCA 1K5JA 2RC4A 5J48A 5LK5A 3HOWJ 2JT1A 4JRLA 4B4QA 1MJ9A 4CDQA 5K7PA 4QX0A 3Q8BA 1H4GA 1LHVA 1ETVA 2VBWA 2NNNA 3POIA 5BNNA 4F52A 1WW4A 4A0YA 2CW0F 4OMZA 4HYEA 2E60A 2BY0A 2STWA 4P9UA 1OPCA 4JKMA 5L73A 1W9WA 3MZHA 2XPWA 4URAA 5BNOB 1R093 5GAGJ 3ZFGC 1V5FA 4A3ZA 1UOJA 2DTWA 5FZIA 4RAYA 3C18A 3OY8B 1LEDA 5C3PA 1X7NA 2FJ1A 4LUMA 5BMZA 1IG7A 4YVSA 4CDGA 2RS32 2E2HJ 1VB2A 3I5UA 5CLSA 4J1XA 3LDRA 4H3WA 2L9LA 2Y26A 4XKBA 4QDRA 3TDZC 1X2MA 4JAAA 4YFXF 3GO5A 3A23A 2WUHA 1OD5A 2VZTA 1GXQA 4QX2A 2EINH 3DPLC 1U5IA 5A80A 1ZA7A 5EEAA 4CU6A 3IDCB 1W3VA 3OBRA 3MHZA 5JIUA 1K42A 2WV0A 2QJVA 3K4AA 3RGBA 3VDCA 5FZOA 3LSHA 3BG6A 1SFEA 2L7MP 1R083 2VKHA 5ICCA 2JA7J 3PNTA 4JV4A 3PNYA 5J40A 4M72A 2Q30A 4A3CJ 1NCQA 2W68A 4CUGA 3KD4A 1BJQA 1G3WA 2Z79A 1KU3A 5KK1A 4LLLA 4PF5A 2Y6KA 4H7MA 3KGZA 5IYDJ 4A5MA 3POBA 2GSYA 4ASKA 3A7QA 4M9SA 2GXAA 4N4NB 3EDPA 4D7MA 1RUI3 3BI3A 3JRBA 2RQPA 5JOXA 3Q8EA 3F0CA 4A12A 1NK3P 5JIAA 2NMOA 2IXHA 4M71A 2RS11 5DUKA 3GM8A 1IW7F 2WC2A 4ZYGA 4LD5A 4UBGA 3OYKA 1XGNA 3CC7I 3CJXA 5FY1A 1KU2A 1QJU2 2KZVA 1UAIA 3I8TA 3HN1A 3S2DJ 1DGRA 4K8RB 3VBFA 1NCRB 2W25A 2BBVA 1MQTC 1X3ZB 3OJBA 3WP3A 2DOFA 4DO0A 3PQKA 2HWC1 4P9LA 5LFAA 1PO23 3WF2A 2X05A 2DA4A 1XDUA 2VUMJ 1KFUL 4NRQA 1FX7A 1IN7A 1LENA 3IB3A 1JU4A 1EH7A 1O5UA 4MSVA 3H9GA 1SD4A 2DCEA 4MNUA 1EV11 2HWF3 3GBFA 1R1TA 4L9JA 4XIOA 1XU2A 3ACLA 1XTAA 4FCYA 3WZ1A 3LAPA 4KWJA 4C0BA 2GU9A 5J09A 4DJAA 1BW5A 2M8EA 4X6QB 1HC8A 2WDBA 2R92J 3H9AA 1LKNA 3GFIA 5DPNA 1UZWA 1F4KA 2D93A 2QGUA 4IOAF 3NVCA 3BZCA 4GH4C 1CPMA 4QPGB 2R7FA 1Y43B 1X82A 3V0AA 3VDDA 1D0XA 3ZQLA 4GMP1 4KFCA 3RMYA 2M34A 3I49A 1AR91 3ZVXA 1BOAA 5C44J 4OULA 3TW6A 4FQGA 3KF5A 4IHSA 2H8RA 1W1WE 2EJRA 2EICA 2CV0A 3LEMA 1DGWY 4FFGA 4HSRA 2MNGA 3HOSA 1CAXB 1ZK8A 1KQ0A 4XLCA 1UQXA 3FIWA 5D6FA 2VQLA 2L7KA 1AYM3 4UI9L 1RJ8A 1J0RA 4Y33A 2WINB 4AM3A 4CZZA 3T2PA 4AI3A 2HDWA 4D7SA 1DYPA 4ARXA 1LHNA 3NKGA 1F1ZA 1QH7A 3DKYA 1R4NB 1TT0A 1VQMI 3J7AY 1T56A 2Y6JA 4Y20A 4NC8A 3IWZA 4Q4V2 5HCHA 2D6KA 2L7ZA 3QQAA 1ULEA 1V6KA 1H6YA 2X1DA 1J09A 4JC1A 5CB7A 3VZNA 2HWVA 2ID3A 3WNLA 2H09A 3BOWA 1XN7A 2DUQA 2IS1A 1Y39A 3U75A 3JRGA 4AFAA 3BZ6A 1PP7U 4CDWB 1MSFC 5JFRA 4HBLA 1OLMA 3ZYIB 1ZZCA 1GFF2 4Q0PA 2ELKA 1DQ0A 2VOWA 5HOOA 5IK4A 4QLCU 2BNMA 2DF7A 4X8PA 2FBKA 5BUVA 2OTLI 2RR12 4YW4A 2X6OA 4L9BA 1X8MA 1O4YA 2K46A 1D4VB 2P3YA 3DQVC 3DEMA 1FEXA 4YVSB 4EN9B 1S4CA 3WSOA 3N97A 3J26N 2GNBA 4YIFA 2Y2ZA 4YVWB 2CV1A 3IN9A 3K4DA 1W8OA 1MS1A 4MHUA 5IVEA 4ARYA 1FZPB 3HT2A 4HW0A 3VBRB 3HUGB 2EV5A 5FFZA 4CA9A 4A3DJ 3NQHA 2XF6A 4CCEA 1ITYA 1SANA 2ID6A 2ZC2A 5HBAA 2OXBA 2X0LA 4QU1A 1VRH1 3D6EA 2JE9A 3BJ6A 3ZQIA 2PJPA 5SV8A 4GAZA 2EWNA 3ZN6B 2C24A 5EPAA 2KL4A 3TOJA 4HLTA 2R7UA 5A1AA 3I97A 2PN5A 4P9IA 4XJUA 5A32B 4M3GA 4MEYF 1XXNA 1O3RA 2DYSH 2AXTC 4QPWA 2KDZA 3SJMA 4LULA 5KCMA 4L99A 1NCRC 4IHWA 3K4NA 4WM7C 3LPGA 3KP6A 2EB7A 2D6NA 3I54A 1VBE3 2P17A 3UR3C 4HG6B 3AXDA 2ZMKA 1SEFA 3ON7A 3VODA 4XUNA 1DU0A 2EIDA 3RFRA 2QQMA 2VB6A 3POYA 4GYGA 4LIVA 1QJX2 2WLQA 1QXPA 4CA0A 4CDXC 1BR1A 3K48A 2XB5A 4ON0A 5T5JA 1AJOA 3I59B 3L2CA 3RKWA 3VD9A 3AZWA 1AX2A 5JSRA 2DO7A 4E27A 3CKHA 4M0NA 3MYXA 4M01A 3VUOA 3KLNA 4XJ8A 2QQJA 3ASNH 3V7SA 1DP0A 4MV2A 4YW6A 2PMZN 4LG0A 4CE8A 5LA0A 1IJWC 3B02A 2A6WA 2HWF1 5I0TA 3T0AA 3LIGA 4W1UA 2B9VA 3QBQA 1IQDC 5FY0A 2OA4A 3CZJA 1C1LA 2FD8A 4XIKA 1H2MA 3U14A 3MPPG 1UNBA 2VBDA 1AR73 2ZGOA 5F37A 4A41A 3S17J 3I2GA 1AR83 2FBIA 1I27A 3DPRA 4IE5A 3TEXA 2OUHA 3FXUA 2HS5A 2DJIA 5BYNA 4CCJA 3RJ2X 1JZ6A 3BY6A 4AL9A 2OYZA 2WQ8A 4Y52J 1KQ9A 4YRVA 1GSLA 3NWSA 4BMEA 3U21A 1W39A 1ZLKA 2WY8Q 1LU2A 2EIJH 3H0DA 1W0UA 5FQ0B 2GA2A 1N1VA 1J75A 3S7IA 3BTYA 4NPLA 3L1PA 2A5WA 4UOJA 2VQCA 4EGZA 3DEEA 2HBUA 3QYEA 4PDWB 4GDFA 3AG3H 1K7AA 3WG2A 4UFIA 2YG0A 2IXJA 3DWLE 2BVMA 1D5YA 3IPVA 3J9SA 5KHJA 1RUH2 5D8LB 2BGOA 5A6XA 2UWCA 5BS6A 1CWPA 1H1IA 4KISA 4PJLA 1FSEA 2DMQA 4DPNA 4K9SA 5AONA 1QXJA 3M9AA 1T6SA 1MPXA 1HXDA 3KCXA 4BA6A 1Z6RA 1G8WA 3JCUC 3WNMA 2A68F 3A2KA 4E4SA 3IH3A 4MO7A 4A3BJ 1X8EA 5CKMA 2TDXA 3FXLA 4UUVA 3QD6A 1G9AA 1N1YA 3CCSI 3O2PE 4K7JA 1GNZA 3GTPJ 5FMOL 5FYTA 3UKGA 2V4VA 4M3EA 5E20A 3GF6A 2VQHA 3LSEA 4D7TA 2E63A 2PQQA 3MFCA 4HPQA 1J1TA 3VHOA 1W8ZA 1TMF2 1QKQA 1IN5A 2YBSA 2VTFA 1UG0A 5EWSA 4UB6C 2XGDA 3B01A 1NG6A 2EA7A 3NRUA 2F4PA 1W2UA 2RJLA 5D21A 5A7WB 4IRGA 1U8RA 3BR6A 2P7CB 1MS3A 1N3QA 3BPZA 2L9RA 2EIBA 1H9GA 5FZ4A 4H2AA 2GP3A 1REEA 1IUFA 1VBD1 1RUE3 1C5HA 3WDVA 4HA8A 4LA2A 1WLWA 2FHRA 4GB33 3CUOA 3E6BA 2XBO3 4QPIB 3N7MA 4CU9A 5J4YA 1QRYA 4QKNA 5FXXA 5AVPA 2RMU1 3UETA 3VBUC 1AR92 3NAPB 4UW3A 3IH4A 1DZQA 4KDPA 5EG0B 2RAEA 3GFMA 3KP4A 1VBB3 2V9VA 5FKMA 3MW2A 2VMDA 1IS6A 3O0VA 3ENRA 1QZEA 4DEQA 3SEZA 2RGVA 1W6OA 2VBYA 3QRFF 5B4XA 4NIAA 3TYJA 5ACA3 2CNAA 4PI0A 2R7VA 2RM22 1HRV1 1TNSA 3I9V2 1QNWA 1GQHA 5ABJB 4P55A 1BI2A 3WINE 1O8PA 5K8SA 1G9CA 5EYXA 4NJ4A 3IP4B 4FXKB 4BJ6C 5IP7J 5BNOC 1VBB1 2WZPP 1DU6A 3ASOH 1EAH2 3A02A 4ZYDA 4CXFA 4YARA 3WLUA 1U5ZA 1YE9A 2RDSA 1WJAA 4UF0B 4R8HA 4BBRJ 2ZJCA 3JQWA 1EAH3 4LOTA 4GB31 3VWBA 3MD2A 2OPKA 3THTA 4N9IA 4QX7A 2V09A 5DD4A 3UV9A 2D6OX 4MLOA 2JDHA 5F1JA 5IVFA 3C7FA 4P9WA 3E5QA 4BL0B 2VUJA 1GANA 3LPFA 1N1SA 5J8CA 2DT5A 2BYVE 5FXWA 5LWBA 4NBQA 3USUA 3AYAA 3N9MA 5JVVA 4AWXB 4GKXA 4IX7A 4LJZF 4IOCF 1ETQA 4QKFA 3K1PA 3KP5A 1Y8QB 2OV7A 3SZGA 3W2AA 2KIMA 4HSLA 4JCKA 5BNPA 4MEXF 2ID4A 4RQPC 4WV8A 2ELJA 1YJWI 1W7PA 2EF6A 2XUEA 3SH3A 3HR9A 1A35A 1H4HA 4CVUA 4YFWA 4LE4A 4AC0A 1ND2A 3CJIB 3WDUA 3DCFA 1FMD3 1J3RA 5CYVA 4KU7A 5C70A 1TWGJ 4LBMA 1LVKA 2CYYA 1HX6A 1QDOA 3JD71 1PJRA 3BTXA 5J1YA 1R5HA 1QHDA 2EZKA 1GV5A 1H2LA 3WQBA 3DTKA 1NXMA 5EJCA 4JRAA 4S2GA 3H3VK 3ELKA 1BQPA 2P5KA 4JX5A 4PDWA 2QUOA 2WADA 1BZWA 3J7MA 2PHUA 1W6QA 1XSRA 3JSOA 4BQXA 1H9WA 5J8FA 3KIOA 3LEGA 1BR4A 4LBOA 4ZTJA 2R0FA 4EN8B 3PJQA 4Y4YA 1KA8A 1L3JA 5EEGA 3J7HA 3CLPA 1TQMA 4CPBA 5DUVA 1RUG1 1YFHA 2RR11 1XC5A 3VYTB 1UAAA 3J7LA 3HYIA 3CQZJ 1AA7A 2OAZA 2ME0A 4DW6A 2OQGA 1YITI 3IDEA 3QU3A 3U1DA 1XSXA 5ILSA 4XYXA 1HQLA 4DYQA 4AYUA 1SFKA 1QBJA 1ODMA 2W94A 3GEZA 1EV12 5K0UC 1YUDA 3ECHA 1UZYA 4WXHA 3PUAA 1YQ2A 1RUD1 3TW7A 1AL23 4NR1A 2DBBA 1ZNPA 2E2JJ 5LY2A 2GZWA 3H0GJ 2JDKA 4BHCA 3B69A 4OCTA 4FPEA 2CS3A 3CJIC 2PLYA 1ND3C 3OGSA 4QSHA 1YOVB 2E1NA 1X2NA 3VKOA 3I2HA 3DCQA 3GUDA 4FPYA 3RRDA 2DCZA 1UZCA 4XACA 3QH6A 2E1CA 2VE8A 4P9YA 2CDOA 2JE8A 5A3LA 1Y9MA 5C7GA 3S7EA 2G9FA 2HYXA 2P34A 2M0CA 3P9CA 5LA9A 1FBQA 2BVLA 4LXLA 3I4IA 4HF2A 5LBFA 2MH2A 1C8NA 1UYZA 4AFDA 2P81A 1JKQC 4EZ4A 2YBPA 4JDMA 1NG7A 2HVSA 2EAKA 4FASD 5J96B 2MC3A 3CCLI 1VQ5I 5ERIA 4Q4W2 1BEV1 5FP3A 3HOYJ 3NJVA 1WZ2A 2XUMA 2Q8EA 4YM0A 2C4XA 4KUMA 1WMDA 5BNQA 4JTOA 5ICFA 2A05A 4LK0F 3MKZA 3N9LA 3LAJA 3POSA 4QPOA 3NRVA 4NO4A 1O57A 5FKOA 1US2A 4IE0A 1UW8A 3GXOA 1BW6A 2BGPA 1VI0A 4EYUA 1RUOA 4ESFA 4BJ0A 2HZTA 5JOZA 2JB4A 4II2A 1TZOA 3WV6A 2W1WA 1OC1A 4Q4Y3 2P4EA 5F7UA 5L19A 1FOD1 2JDZA 3GZUC 4IXLA 4B48A 5LATA 1UY3A 2WB1N 3G7DA 1TVGA 3C3VA 4GQ7A 2R30A 2VM9A 4FVVA 2DXIA 1H8TC 2R7EB 4LE3A 2A7AA 4BAYA 3F9KA 3OB8A 5KR7A 3JRAA 3L2RA 1MMAA 5JOYA 4MIMA 2VJ5A 4FTSA 1X1BA 3DPTA 2CHHA 4LORA 3O1PA 2GNTA 2ET1A 4DMIA 3CTAA 4INDA 3OOUA 1NA1C 1NZCA 2AH2A 1WD3A 5FY9A 2KFDA 3CMMA 2UWMA 1V6OA 3ZFFB 4TWTA 2IGNA 3B9IA 5HS9A 4IV3C 1ONVA 1IS4A 2QKMB 1SD6A 4XUQA 4IHTA 1OKRA 4LKFA 5FMDA 3L09A 4UB8C 3VBHA 5CISA 3LSJA 1FWZA 1US3A 3BTZA 2PI0A 3KFWX 1GOHA 2L9SA 4MGTA 1QOSA 1GICA 5FLXZ 1UKGA 1C4RA 2PLV3 4XILA 2BXZA 1L0OC 3S15J 4IJAA 3RZGA 3ETQA 1ZGAA 3F8BA 2CL2A 2LROA 1RUNA 2KPMA 2A6TA 4I3PA 5GPAA 1CZVA 1DQ5A 2M30A 3T4VA 1UYYA 1F31A 5JZGC 4KN4X 2FMYA 4HQEA 4CEWC 2OCCH 4NC6A 3PUFA 1FMD2 2VASA 2YROA 4ES9A 1A8DA 3ZDSA 1DP3A 3H8UA 2JB8A 3LWCA 1Z77A 1YFXA 2W48A 2WQ4A 4Q1RA 2JD4A 1F5FA 4HV6A 2FDHA 1G8XA 4ZYEA 1QU0A 5FLJA 3AP7A 4NIIA 5J1XA 1XNCA 3AB0A 4UWDA 5DEQA 1QO0D 2O7OA 3NAUA 1LOFA 3WUDA 3OYNA 2WWJA 2HKOA 3RI4A 3ZN5A 3Q5FA 5FJKA 2BZTA 3EQLF 4Z6YA 3S5AA 2JPBA 2CGNA 5FUIA 1ULOA 1PK6A 1XCBA 3VHPA 3GHNA 3VEPA 5F39A 2GMMA 4Y5Z0 2AZ5A 4MUVA 4KGQA 4L9VA 5KAIC 1ZREA 5A32A 5E6HA 4UY8I 4DZPA 1WCMJ 3WW4A 3SEPA 2NVYJ 4MG2A 2FDKA 2ZKZA 4NWWA 2ZJRF 2FMDA 1TNFA 3ZMSA 2HYGD 1ORKA 5HDGA 4BQ3A 1RINA 4V1PA 1JYTA 1JT0A 3KX2A 2O8QA 2HR3A 3PSIA 5HLHA 3ZXFA 4ENMA 3DYPA 3LNQA 5L7OC 3CZUA 3PU8A 5DAPA 3KHCA 4GZ9A 4K3UA 3EJKA 3DUIA 5FZ8A 4ORFA 4HN1A 4YGDA 1H0BA 1I3AA 3VDXA 1ZYBA 2LVSA 1ZG3A 4UFMA 4I3GA 2P8TA 2M45A 3DTIA 2PJRA 1W4MA 3U1KA 1PUFA 3HD8B 1Q8OA 4L9TA 5FXVA 4RHV2 3ZN4A 2ET7A 1J3PA 1YQ5A 5A7WA 3OF1A 2PMUA 1FNZA 4Q8LA 2XG3A 1FV3A 3WNOA 5EP9A 2A3YA 2W2IA 4EE2A 4D1QA 4OVEA 3GDBA 3WHBA 4UUSA 4YLZA 3S14J 3BG7A 4PIZA 3F8FA 2W47A 2JXAA 3OWTA 1GWMA 1PNFA 2J1VA 3L2UA 1NXD1 2D6PA 3EMRA 4M4PA 5IYYA 1STZA 3AAFA 5ISLA 4FX0A 2R062 2JA2A 2CY6A 1K78A 1WGPA 4P9FA 4RS5A 1HJGA 1AR61 3I2DA 3CJQB 3ERED 3FBNB 1F5TA 4GB32 3V0BB 2HGCA 4PBOA 2EZHA 2BPA2 1T95A 4FHTA 3AG2H 2W52A 3BODA 5EYRA 3TEZA 2LMDA 4IVNA 2VG9A 2XJUA 4AE2A 2ZJPF 1R00A 1ZBE3 5K7FA 3O6BB 4LB5A 4PFPA 1WA4A 5FKKA 2NAZA 4XLNF 2FE3A 1KQRA 3HRUA 4FT8A 1LECA 3VBRC 2A07F 3M3YJ 4S2HA 3GZNB 3VYRB 1MS4A 1FOD3 4LK6A 4FQ4A 4YZ2A 5DCMA 1KONA 2F5DA 2E7TA 4D0QA 4XZPA 2IS2A 5L3BA 3BVCA 1D8KA 4XF3A 2X29A 3RWNA 3M8EA 3JR9A 2DJNA 1U5TA 2ZEYA 3SYTA 1O3QA 1HW2A 1G59A 2QCOA 3BTIA 2QFEA 3GYDA 3U2RA 5B3SH 3SXWA 5CFCC 3CC2I 2VKVA 5K9YA 3J7AO 3IRRA 2DA7A 4V2FA 4COYA 2OD5A 4Q4X3 1SBFA 3M70A 5C4WC 1A3KA 3WHUA 3ZQHA 4F3JA 3QP5A 2ZMNA 2JIJA 4EV0A 2DFCA 1JI6A 1MIJA 2R5YB 2EK5A 3MIDA 1C8M3 3IUOA 1MDMB 4M3CF 3E1SA 5DABA 5T50A 3PM1A 1ULDA 4A7ZA 2VECA 4HF1A 4D94A 4BIFA 2MSYA 2VO5A 4RSUA 3M7GA 5D1IA 1CN1A 1OCPA 2A70A 2HXOA 3KP3A 1RITA 2XLGA 3K69A 3CDHA 1FLIA 1RKTA 4G6DA 4Q4X1 3RPUA 2WWUA 1DLLA 2O5RA 1S5LC 4C9YA 4F8AA 1NQDA 1C0WA 3QU6A 5JR2A 1VBA1 4HSJA 2YX7A 5IWFA 1V6MA 2Q1MA 4F92B 1CPNA 3FHNA 2X5IC 2RG4A 1TE1B 1LVAA 5A3UA 2ZGQA 5A6YA 2FQ3A 2H94A 2VC0A 3M3IA 1ZELA 1FJLA 2ZGRA 3U4XA 1N75A 3RI8A 1CAWA 5DAVA 4OIRF 2VQTA 1KRIA 5F0CA 4I6ZA 4A3XA 4B4RA 4C1WA 1SMVA 2UU8A 2FX0A 2ZSIB 1ODNA 1U0JA 1L7RA 1B72A 2MD0A 5CFCA 1RHI3 1V4RA 3KSCA 5CQGA 2P37A 3O7OA 5LLQA 2ZMEC 1XYNA 3FISA 3S0MA 2DA2A 3N7LA 3H1WA 4FPGA 2NS7A 2FCUA 2X6XA 5E3NA 3OYIA 4OHYA 2F2EA 4A2UA 1CAWB 3WTZA 1HDPA 2KISA 4XR6A 5GZEA 3TEWA 4AUXA 5L9VA 3P9KA 1QQP3 3C2HA 3L2VA 4OI0A 1DQ1A 1IPJA 1SMTA 1GYKA 3ULQB 2VUDA 4YNIA 4E7LA 2YU9J 3CQOA 3PL0A 4ESJA 4Y1UA 1UF2C 3DBRB 2Y30A 1CR7A 1PVC1 2B5HA 3OBAA 3EQEA 1RXGA 1G7YA 3LFKA 1CX4A 3W20A 2CMPA 2VC1A 2HYJA 1S0DA 4Y5SA 1TQPA 3VSKA 1UJ8A 3SNMA 2VLAA 3DYOA 1VR3A 3WHCA 1F4HA 5FROA 4CYDA 3JBG2 1OA4A 3COAC 4G6TB 3FDYA 5A2QZ 2WNUC 3ZPLA 2Y31A 2XC7A 1D7PM 5J3UA 3FXQA 4AEMA 1QIQA 4XUTA 3IWFA 2JTVA 2K9LA 1VBC2 4YGBA 2JG9B 4QQLA 1BR2A 1GUUA 5JLVA 1PGSA 3F21A 4NRPA 4LKEA 1O6UA 3WD5A 4G9YA 2FQPA 3IZOA 4R9CA 4JVAA 1WMFA 4XF9A 2VJIA 3CF2A 3IPVB 5KHGA 2GNMA 2B7EA 4ATFA 4BQ2A 4FPOB 5FP7A 1J2XA 4BQWA 3VSLA 1AR81 1WJDA 3NAPC 2X6WA 4OAZA 3ELNA 3OYEA 3RG0A 4KGGA 2IA1A 2VZOA 1PIV2 2WZR2 4JQTA 1Y7BA 4EATA 4LBJA 4CDQC 2BOIA 5AC91 3FXOA 4AK3A 2XVCA 4W6XA 2JICA 5CFDC 2BNOA 2WA3A 2XBO2 4E7SA 1OUSA 2LW8A 4FPKA 2YFZA 5LGTA 2OC6A 4B1LA 4XMIA 5FOBB 1V9U2 3K7AJ 1DF0A 5A70A 4M6YA 2LBFB 2WZR3 4DXZA 4TLFA 4GYIA 5DAXA 4L5EA 4LO7A 1XMXA 1ZRIA 4PT6A 2XSJC 1W36C 1SVMA 4JX4A 3WE3A 1SLTA 4BHBA 1EA3A 5JHFA 1OA3A 2ZNZA 1FV2A 1SCRA 1TEIA 2DMUA 1J7KA 3RZHA 1UMZA 4BWOA 2ADEA 1PM4A 4Y13A 4AHXA 4DXRA 1TW3A 1YI7A 4GIQA 3ACIA 5A3WA 5F3CA 4HANA 2FF4A 1ETYA 2VCMA 4JKKA 4DRVA 1QPIA 4YIRX 1EH8A 2Y64A 4RA2A 2YR2A 4NRMA 3AZZA 2BW3A 1AYN1 1MH4A 4FO9A 4HONA 3ZN6A 1T6GC 1RUE1 4CCNA 3PHMA 5JPMB 2XHNA 4Q4W1 1SFUA 5DS9A 4BDYA 1OSGA 2PLV1 4ZJZA 2Y0IA 5E89A 1QMJA 1NCQC 4AXOA 1AKHB 2ARBA 2RQQA 1ULFA 2HLEA 1WLCA 1W28A 4FFIA 2GN3A 3OD4A 4AYBA 2A73B 4L18B 2M1BA 1H30A 4G7HF 1DDNA 1MBKA 4PDWC 4OMCA 3WG3A 5T5OA 2P5VA 3MEXA 2GH2A 4XORA 2HWE2 2WJSA 4XKCA 1WVRA 3JU9A 4XICA 3J8F1 2D5FA 5CFDB 2XQRA 1O59A 3RQIA 4LUKA 1W9YA 2WFF2 1YS6A 1WJCA 3R4SA 1ZQ3P 2W0XA 5EQUA 4EQQA 3UT0A 1QOOA 4HK8A 2E53A 1YFUA 1WFXA 4NE9A 2AGSA 3THCA 1CZTA 1LOEA 2J5PA 5DDJ2 2MW8A 4XF4A 1FOWA 1LDKB 2ZOEB 2PN6A 2Y9YA 4B44A 3LEKA 3LE0A 1W8FA 3EPZA 1OCZH 1CIWA 5JMCA 3O8HA 1Y1WJ 1DDLA 1DQUA 3MGUA 3NV3A 3S6PA 5A1FA 3KPHA 3TEDA 4ZDPA 1PP8F 5JI9A 4FOYA 1W5TA 3E6CC 1S0BA 4OZOA 2CQKA 3VGIA 4XTMA 5FP9A 1HRI3 4DBRA 1PO11 1P92A 2OQRA 1Y3TA 1USTA 2A6VA 4XETA 3ZIWA 2PX9A 4XZUG 2R49A 5IPAA 2ZGLA 4NROA 4A3IJ 1XBFA 5FZFA 2I45A 4QB2A 2K4BA 5JHUA 4LNVA 3V4GA 4EN0A 2VODA 2DA5A 2L0KA 3MICA 1MJBA 1JBCA 4YZ1A 2KDOA 1IZ1A 3D3AA 1PX3A 2VPVA 4AR2A 2LY9A 5A2QK 4RGXA 2RV8A 3UKTA 3ZXJA 1ZHFA 2X85A 4YG2F 3HNBM 4HNUA 3WCRA 3U10A 3O1RA 4P9GA 1VQ7I 2IA0A 3DF0A 2HYKA 4BH9A 4QGLA 2C9AA 4PJJA 2P3IA 2L9NA 1FIPA 3KYCB 2ZHKA 2LR8A 4XJZA 1Z7LA 4MFDA 4CDXA 4WWCA 3OSFA 3FMGA 1KGSA 2WABA 2R1BA 1IS3A 2FRHA 4UFHA 5EYYA 3AMMA 1EH6A 2P0WA 3UKNA 4LO6B 4RGUA 4HVRA 2OZ6A 3KVAA 1VBC1 3ES1A 2WNVC 2LC2A 3CCMI 1ZLJA 2X53S 4W65A 4U2AA 1XSQA 3U78A 4XXPA 3ZXLA 3ZM8A 3BR1A 3N7KA 1ZBE2 4OHXA 3OUHA 1V6LA 5J4VA 1DGRN 1V3FA 1ULYA 4HVOA 2DMNA 5L3FA 5TSWA 1ZZ9A 4P9JA 4L0PA 3OY9A 3H1YA 2Y8KA 5FR3A 5E18F 3SZPA 1PIV3 4FFFA 3W21A 1UU5A 3SCFA 4CDWC 1UIKA 4Y17A 3IT8A 5JCTA 2PMZA 4OMDA 3FC0A 3RWKX 2QQWA 2VPRA 1RVF3 4HOOA 1SHWB 3NNFA 1S0CA 2WAAA 2Y48A 1RUG3 2UV1A 5CBLA 3WP6A 4XABA 1WQ2A 4OWRB 3OSDA 4JGZB 5LZ6A 1OR7C 3H50A 2C0ZA 4LR4A 1MBJA 1E2XA 1IAWA 1GWLA 4NHKA 1S6LA 1MR5A 5FO9B 1APLC 2D5HA 2Y6HA 5EJZB 3VPRA 4FOVA 1LDDA 4XOTA 2K5CA 3D5RC 4NHLA 1RUJ3 1W6MA 4LT5A 2VKEA 1F8VA 4NHMA 4BDVB 1O7LA 1ENXA 2JDAA 1REDA 2QQLA 3OYWA 4QGNA 1Z78A 4YIIA 1OJLA 1EY2A 2MG4A 5JWPA 5IW0A 4BE1A 1YHQI 1V55H 4PJ0C 2ZFUA 5EJ1B 3KHBA 2VMCA 3JAMZ 3MDPA 3SHFA 3ACFA 3F8MA 1O4ZA 2ZGKA 4QD2A 4AI8A 3HQUA 1OISA 3ZXGA 4L0ZB 2QQUA 4DINB 1LOAA 2L02A 1KQ8A 3BC8A 3AKTA 4JTNA 2IP2A 1M4WA 2WT1A 3TL4X 2HJIA 2EALA 4OFGA 2E34A 2LP0A 1IRZA 4IL7A 5JLWA 2Y9ZA 1HA8A 4P08A 2VQGA 4HNVA 1EYBA 4IETA 5F3IA 1K45A 1OR7A 3C2BA 3LDBA 1V6IA 5DD8A 4RS8A 1SFYA 4A5NA 4N43A 3VBSB 3O3KA 3BPVA 4U0VA 4TTGA 5DM7F 2IC1A 3X29B 4LOCA 1R58A 1WZXA 2J1AA 5I0DA 2EA2A 3SQNA 3T09A 3F6OA 1JW6A 4COWA 2BWCA 3CEWA 3JRHA 4A0XA 5LD2C 1GZWA 4M9ZA 2WS91 2PMWB 3OR2C 1TWCJ 4GMP3 3KS7A 1UX7A 1HQWA 4ITVA 4IO9F 2L4MA 2ARCA 2WN3A 1XMAA 4KIBA 2RDPA 1KYZA 2WFPA 3S3NA 2Y38A 3WEZA 1X19A 2VUAA 2O8XA 1B1BA 2QE3A 2E71A 5IK7A 4ZDLA 4RFT0 1IOAA 5JR7B 3N9PA 1JZ2A 2XV4S 1Q56A 4HKLA 1S3JA 3OR1C 2KD7A 4FP3A 1ND2C 3ZXDA 1DCSA 1Y4WA 3FBYA 3KZYA 1HQNA 3PMEA 3CCRI 1WKYA 4XIDA 5TRDA 1EPWA 1OURA 1YO8A 1MBEA 2QZ2A 3OTFA 1X58A 3SZTA 4NHXA 1WJFA 4M4RA 4DZGA 1TME1 4J25A 3M8LA 4AIDA 1HXS1 2WKKA 1AL21 3M3CA 1WUVA 4L8QA 5HS7A 3KP2A 2R0HA 5A3NA 1C57A 3KWVA 2HXIA 2QEXI 5FZBA 1Y0NA 4BB3A 2ISYA 1ZA4A 4JBAA 5KXEA 2HDCA 1S0GA 1NT0A 2D3RA 1W2NA 3H35A 1OCCH 2NZ9A 2K9MA 3MIGA 3WHTA 4IE7A 4BPZA 3J81Z 2R3SA 2Q0AA 1HDKA 1OLRA 4NNJA 4ENKA 2O3FA 5D5UB 3ZXSA 1VMJA 4IEZA 5F5IA 2PHDA 2E1OA 4N43B 4CZSA 2DU0A 1BMV1 1I5ZA 2BEOA 2KRHA 4M0HA 4YG6A 1ZZ8A 2QKLB 3KB5A 1BKZA 3C8XA 1SFXA 2DBIA 2JWPA 2KRFA 3R0RA 1WBLA 5ANQA 3H5NA 2CU7A 2WN2A 2EIMH 3G1MA 1A5JA 3PSFA 4YZ5A 4XK4A 4BIOA 2WB1A 1XYPA 3JD73 1GLNA 5JZGB 3OUJA 3QPSA 2EQRA 1ZR2A 4J00A 3S93A 3CJIA 4KWUA 5JVTA 5FPAA 4B4PA 3CC4I 3QPLA 4GD4A 1U6GA 4IL6C 2KLOA 4RAFA 3VB2A 3LSKA 2JN6A 3H7JA 2MHFA 2DTRA 2XXZA 4U7DA 2ZX4A 2QUFA 4UHTA 1AVBA 1I6HJ 5D8AA 1LGBA 3WUCA 2CUZA 1W2OA 2DW4A 2CQ7A 3QCWA 2WAOA 3CD6I 1XG1A 3GTJJ 1MZFA 2OUJA 2XJSA 2XHKA 2G7UA 3TDUC 3JCIA 2Q0OA 4PCQA 1GQGA 4Q0QA 2UUZA 2GDFA 4O7XA 2R072 1BBT2 2UY9A 2W9XA 4AEDA 1QNTA 4XBLA 1FTZA 1UZVA 2D2WA 3GCMA 5K5OA 2V72A 1ERDA 3LCPA 2BXYA 4RLQA 3AP9A 1K6OA 2CWMA 3EETA 2XAQA 1JT6A 2Z33A 4Q4X2 2VL4A 3KV9A 1GXPA 4YFKF 3VD4A 2CSGA 3F2ZA 3OCPA 2VR4A 2VNGA 1MQTA 3PFIA 3ZDVA 4YELA 5ICEA 3ST7A 2QBYA 2MABA 4Y3OA 1JUMA 2HEVF 3IKVA 1LGNA 3O12A 3VHNA 4ANJA 5IFTA 4X1EA 1L3LA 4ZU7A 3L2YA 3ZMDA 4ATEA 3DECA 5EXOA 3T2OA 4NOTA 1EP0A 1W3XA 4BXUA 2V9PA 2JDYA 3FE5A 2ZCWA 1KDKA 2WL1A 1OVSA 5J37A 2M7BA 4XNFA 4XDQA 1ENHA 2JX9A 1IDZA 4IE6A 5GZGA 2PBIA 2KMUA 2B63J 1PMIA 3FUOA 4BQAA 1UMHA 3B94A 4P9XA 1N1TA 4C3JJ 2TBVA 5FP4A 1RUC1 2SBAA 5LHHA 1E57A 3QH7A 3RDIA 4MGRA 5LGNA 4D3WA 3PVNA 4ZU5A 3I4MJ 1SBDA 4HX4A 2NQYA 5C8CA 1XCVA 5LCWL 1COV2 4R4XA 1GOFA 2YV8A 3VBHC 3PL8A 4P5YA 2QQ9A 2JECA 4AWDA 2QSGX 3IAM2 4N4OB 3I71A 1W0PA 3R60A 1F4AA 4AYBN 4JGYB 3WF3A 2HNHA 3WF4A 2NVUB 1VQ4I 5KC6A 4MADA 2GIVA 4L5JA 1RUH3 2XF7A 1JN2P 1FC3A 4H4KC 3RJPA 2AHQA 4B8EA 1AU7A 3OYCA 4D6RA 4FOWA 3LQQA 3KP7A 4TV7A 4TYSA 4V2WA 1NX9A 4A3JJ 1T8IA 3TAYA 3W9AA 4OU0A 2WWSA 2HKXA 1JOPA 2I74A 1XNBA 2Z42A 3V8JA 5F64A 4HEA2 3LOIA 1UHMA 1ODDA 3WQ1A 1PVC3 2O6GE 3RZKA 2KJBA 3B00A 3TO9A 3PIGA 5FKCA 4NQWB 1ND3A 3CMAI 3MMYB 3VBFB 1H1AA 1V6NA 1VE0A 3WW1A 1I50J 4B29A 1W0NA 5CG8A 4NIDA 2FDJA 3J4UH 2F5VA 3CDLA 1W05A 3HVDA 5EZWA 4ZZ5A 4Q5OA 1RYYA 2VVFA 4OIQF 4BKXA 2EFWA 3JBG3 1WLTA 2QKDA 2BFUS 1SDWA 2WA4A 2DN0A 2VJJA 5CVJA 3K9TA 1C5IA 3ABUA 2F6BA 1E5HA 3WE2A 2IXSA 2H8WA 5FZHA 3LB9A 1N47A 4A3MJ 4AAPA 2VOOA 4QKBA 3OBTA 2K3FA 3HJRA 3Q8CA 2K40A 3FX3A 2VXDA 5BNNC 2X09A 4ASMB 1O91A 1D0YA 4QX1A 2DK5A 1O8SA 4JGYA 4J1WA 4BUPA 2V4AA 1UHWA 1AR93 1REFA 3CJRB 3I3BA 2XB0X 1QH6A 1T98A 3CO6C 1BI3A 2ZPXA 3OIQA 5BY5A 1DGRM 2ZAAA 1DUXC 1GR3A 2VD7A 4Y24A 2XJPA 5FZCA 2PYTA 5FPZA 5IFPA 4W97A 3RSNA 3ZXEA 3TRSB 5DCMB 4XF0A 1Z0HA 5CVUA 3CCQI 1YQ8A 4LQRA 3HBZA 3WXPA 1WJEA 5FZ9A 3WF0A 5CPRB 3S5QA 5FY7A 4BQ5A 4XLAA 4XM3A 1RHI2 4LA3A 1FPQA 3ZQQA 1UOBA 5FYZA 3ZX7A 2QM3A 4QAWA 1COV1 1YO5C 1G4DA 2J1EA 5CKNA 2A69F 3CZ6A 2WS93 2WIIB 4KH9A 2GAUA 2JK3A 4Q29A 4WX9A 3KETA 4E4ZA 3BR3A 2AREA 2HOSA 1JGGA 1OXCA 4EJTA 4FTEA 3THDA 3R0AA 3SXYA 5F5AA 4ZTFA 1Y56A 3NW4A 1EPZA 4UV9A 3UK9A 2QSHX 4IESA 3K4LA 1RIOH 1K61A 4IHVA 3A21A 1GNYA 4Z2YA 4XFGA 4RFRB 4FCAA 2N8GA 5EDNA 2AEYA 5HNFA 3K4MA 5T5PA 3H0OA 1JYVA 3I3LA 3BTCA 2MLKA 4P14A 2P6HA 2RM21 3KF3A 2HTJA 2XGEA 2HEWF 5GTIC 3VBSC 1DG6A 1K5MC 3FLRA 4N7IA 1P9QC 4W50A 3ZR8X 4PIXA 4UXNA 4MQVA 2HVQA 3OPWA 3ECOA 4RB1A 2QZ3A 2MFZA 5A3MA 3VBRA 4QQOA 3E0JB 1QJX1 1K4SA 5DM6F 3R6SA 1BC7C 1IDYA 2E32A 1SDDB 4CGZA 3ABTA 1ENQA 2I10A 3ZOBA 3MFKA 1HV1A 5DG1A 2E6VA 2X10A 3RZOJ 2P6SA 3MVPA 2FXAA 4AOCA 3MUZ1 3POFA 2LG4A 2QVOA 3BOQA 4HX7A 3ORJA 1P2FA 2QWWA 1HB1A 4M6XA 5D4SA 1X1CA 3K4CA 1EJ9A 3C2UA 4RS5C 1B35A 1VBD2 2O9LA 3ZSJA 3VV1A 2VBPA 1NK2P 1CAVA 1Y1VJ 4ABZA 5DN2A 3ZFGA 2R32A 5LHGA 4FTHA 3ZP5A 3VKNA 1KS4A 2VOPA 4M74A 4AFCA 1SLLA 1ZZ6A 4G94A 3JZVA 1VAVA 4IF4A 3GBWA 1RC9A 3DBLB 5IAXA 2WZ8A 4LHNA 1J9IA 3K1MA 1KU7A 4WBBA 2M3AA 1CQ9A 2XMLA 3A4CA 1V54H 3NNLA 2OF7A 2VW1A 1FNYA 4NN0A 2PTMA 6PAXA 4XF1A 3TBDA 2R7SA 3NQOA 2A5ZA 3KQRA 3N9NA 2DQRA 4JGZC 2V1NA 4OINF 2X1CA 2GOMA 1DQ6A 1R082 1RUF1 4EJWA 5FO7B 3H36A 3EO6A 5DTDA 1T6BX 3KYLA 4XCAA 2DCJA 3FZ3A 1W8HA 5FO8B 3A1YA 4IERA 5A33B 2DUOA 3GGLA 3MKWB 5LBQA 2PHRA 3B6CA 3O1VA 2QF7A 5IAVA 2FA5A 2XJTA 3DGTA 2K2SA 3VD7A 2QZ8A 1FP2A 5BPDA 2Z69A 1HB2A 5FGMA 4P02B 2ZEWA 2WT0A 3OYGA 4N90A 1VFCA 5FYBA 4Y7NJ 4IZZA 1Q1HA 3K4JA 2VJ4A 1J84A 2IGOA 4QGMA 3AZXA 3IAPA 2BV4A 3FFQA 1FPN1 1BXHA 2CU5A 3AL5A 1RUF2 5M3FJ 3E6MA 1GT0C 3ZMVA 3DF8A 3KZZA 1YLLA 1QEXA 4Y4RA 1Z91A 2ZXWH 4XLHA 4YSFA 1KU9A 1WHUA 3THPA 1RUF3 1W90A 3T1BA 2RV9A 3Q0WA 3LFIA 4I98B 1H89C 1L7QA 1QJY2 4Q1PA 1LFBA 2UWAA 2RS13 2BBAA 5HDNA 3MO4A 3OYFA 1ZGJA 2ECBA 2DODA 3TP0A 2X51A 1I1GA 4KL1A 1OOPB 2F17A 4Y1YA 2OS2A 1QJU3 1DFQA 1RRJA 4YW5A 4WVZA 1RUI1 3DU5A 4KITB 1OFCX 1VALA 1HRI1 4XTPA 3ZMOA 4PHZA 3VBFC 5FKNA 2HYFA 3D0SA 1NY71 1LRHA 2X5IA 2ZNYA 4OHZA 1Y0UA 3IMMA 4EM2A 1PVEA 5L36A 4LK1F 4A3KJ 3K4BA 1XD7A 4B7EA 1A6CA 4ISRA 4C2MJ 1S7EA 2IA2A 3UNPA 1LULA 1MNDA 5GLZA 3WP5A 2E26A 5BNPC 3QAHA 5A3OA 4XVHA 3IH2A 3VYSB 4H0EA 4PQQA 4I7HA 5LEJA 1ZBA3 2FOWA 1WWYA 3ACGA 1X36A 2MC4A 1JTYA 1BVVA 2OQ7A 3KV6A 5GM0A 1F2NA 4F93B 2HBTA 2E36A 1OQYA 4NPRA 3C7EA 1TP4A 1Z7S2 1W9SA 1ZARA 4HL0A 3FHAA 3SEQA 4B4CA 4XUPA 2B39A 1SD7A 3M2MA 4Q5SF 1RUI2 1ZTRA 3PURA 3QPHA 1O7FA 2F4OB 1GVDA 4N43C 3VOEA 1BA5A 3RTRA 2QTWB 2QA4I 2LTNA 1HN0A 4YVWC 4J6GA 3OS2A 4WVMB 3BPXA 1ZX5A 2DFBA 2R0QC 1TME2 4XFAA 1G86A 5F8PA 2R041 5E17F 1ZN2A 3B93A 1WCSA 1H2KA 1OCRH 5FAXA 3KT7A 1XX5A 2GC3A 5FK8A 2KXLA 4QM9A 2IAIA 3AX4A 3OL4A 1G2HA 4UV8A 2R1DA 5F5QA 1YFWA 3K4ZA 1EAH1 2LREA 3KCYA 2G19A 4GMP0 5KHDA 1P7JA 2BW3B 2G4IA 5FFOC 2WQZC 5B4NA 5DDJ3 1RGSA 4L97A 2YXSA 1UYXA 4YM2A 5DZFA 1JOBA 1OKOA 2YPRA 4AG4A 4PDKA 2ZB9A 3AC0A 1OLME 3OMYA 2ERFA 2UURA 2PMHA 2WLPA 2PHWA 2H27A 3PJRA 4QWQA 4JOMA 1BEV3 2OKXA 4WXCA 2Y34A 3LGRA 3BG9A 1ZZBA 3BLYA 1ASJ2 4DB5A 5EF6A 1GKBA 1REPC 2WRAA 2GBYA 2W46A 1GVJA 1MQTB 3NAPA 5L3DA 2CV6A 3LIHA 4AGRA 1HB3A 1FOD2 2ME6A 4OMYA 2VOXA 4BU2A 1RUG2 3LFMA 4AI2A 5CZKA 2B7YA 3OIPA 3H8XA 2G1MA 1PGL2 1B9MA 3KCCA 1GLHA 1SLIA 3WGHA 2L5QA 3I2KA 2PFWA 3A4UA 4K6BA 2A6HF 2ZSHB 3T5XA 5D2AA 3DEWA 3ZSKA 4DOUA 4AAXA 3JSPA 4LLOA 2W95A 3WOGA 3HGYA 2GP5A 4IV3B 4MXWB 4Q47A 3GBGA 1RUD3 1PZ7A 4QT6A 1J58A 1LJ9A 1B59A 4RB2C 3K75B 5A7NA 1S7OA 2Q8OA 1XSDA 2JRMA 4LBQD 5E1ZB 4AHWA 4WM7A 1RNLA 3S1RJ 4A93J 5H20A 3ZMUA 4MYEA 5DDGA 1D1BA 1ZRDA 3WTYC 1ZR4A 3NO8A 2H0BA 1VIWB 2E33A 3GHMA 5DCFA 1Z67A 1S29A 4M3CA 5A7QA 3CCJI 5GKAC 3AFKA 1YX3A 2OCEA 3FKJA 4ET7A 4PGGA 3RQ4A 3BGAA 2E7XA 5FZ0A 4DXTA 3F8NA 5DXDA 5E8AA 4E9KA 1FI2A 1SBEA 2OIIA 4EJVA 2DMTA 4GWJA 3S2HJ 2I8DA 2XWJB 1P6RA 3BALA 3E5UA 1B6AA 1CONA 1SD5A 2WAQN 2ZBKA 5GAHJ 3JRFA 4CEYB 1UX6A 2R061 4L11A 2C6YA 2ZXJA 2V6CA 1YEWA 3L00A 2BDRA 2Z99A 3W6JB 4MGQA 2J1TA 1G9FA 2F6CA 3BN6A 5GLVA 3LSMA 3LA3A 2YGLA 5J98B 3E6DA 3HDDA 4RS5B 1YRNA 3HXLA 3MLLA 3ZCOA 3HNYM 1S1AA 5GP9A 3PVBB 1JYXA 1W99A 4PCRA 2R5ZB 4ZC3A 3CL1A 2W24A 5JXJA 2OQ6A 1MS0A 4B1RA 2ZXQA 3D5SC 3GXUA 1R092 1HRI2 2D6MA 5FIXA 5H6QA 3RSJA 2M9HA 4LMFA 4X8NA 4Q2FA 1OQDA 2VZVA 1U8BA 1RTVA 3H1CA 4A3EJ 1J59A 3FBMA 2WTEA 4CU8A 4XQ4A 2VZPA 3WY6A 3HEFA 1RR8C 2GMPA 4BK4A 3AKSA 4HT1T 1ZG5A 4GFBA 3ZYBA 3UYJA 5DUIA 4XQDA 3V64A 1IUYA 2CUFA 2V73A 3ROUA 4DYRA 2ZMLA 4XLFA 1LCLA 2CW7A 4CH7A 4CEWA 5FZ6A 1H1MA 2EILH 5A3TA 4IV1A 3WTSC 2LM3A 2VZQA 1R1ZA 2P2KA 3NWKA 1JS9A 2M0MA 1ZRCA 3F3XA 1JUSA 5FZ1A 1HW1A 4OI4A 1N78A 2E35A 2AXLA 4AHYA 3OBZA 1AL0G 4I2OA 3M1HA 2RDRA 4OZXA 1W04A 2FQ4A 3DKQA 4UVBA 2GOXB 4A45A 2H6CA 1LOBA 4F55A 2F48A 2D6LX 4ITCA 1P7IA 1WI3A 1MS9A 2XAGA 4CO8A 1UU4A 2K85A 1NYWA 3ZFFC 2I5UA 2OX0A 4GKYA 1SAUA 1R49A 2YU2A 1U2WA 2XROA 5H9RA 3M4OJ 3CMYA 2NS8A 2H1LA 1W5SA 4E7HA 5C33A 1U9OA 4O3MA 3S1NJ 1IHMA 3RYPA 2HFHA 5A6QA 2XOMA 3O1OA 1HQCA 4GXOA 1HXS2 1IG3A 1RI7A 4L2NA 5JSOA 3B73A 3HKZN 4KG8A 2DFHA 1H9PA 5A7OA 4AIHA 2EIGA 5L3CA 1CESA 3TMOA 1UPIA 1QHHD 2CGPA 4IHXA 4II3A 4Q27A 4EZHA 4XQFA 1UZZA 4WF2A 3FLPA 1LEBA 1ND3B 5LB6A 2O0OA 1M1EB 3BTLA 4Z07A 5HXMA 1GZWB 1BK1A 2A5YB 2E9QA 1MH3A 5AFEA 3HEIA 5BNOA 2X4HA 4M3CE 1PDNC 4JHZA 4JX0A 3EXUA 3HSFA 3OSGA 2GIZA 2RS31 3RKYA 1H9TA 4EWEA 2DWRA 4YWAA 3G6EI 3HOUJ 5J3LA 1GHCA 1QJY1 2IPQX 2NOGA 1WW5A 2EFQA 5M5WJ 4R9BA 3HZJA 4MH0E 2LBFA 1XB4A 4CCOA 2Y0MA 3RKXA 2VH9A 1J5YA 4CDWA 3DLAA 5K5QA 3DL3A 3A0HC 1K79A 2WSUA 1WH7A 2CWEA 3H5AA 4XRSG 5FY4A 3AMNA 2FDIA 3ZMTA 4L5IA 2QQVA 2PHTA 2BNNA 3Q9SA 3IAQA 2ZJQF 3KZIC 5FZAA 4XAEA 4HVQA 2Y69H 3DTEA 3HHGA 2VZUA 3OPTA 1BOBA 5C3EJ 2L7FP 1RC6A 3WR0A 4K20A 3RYRA 3V56A 4M3FA 5BPXA 3MWMA 5J6XA 1Z21A 2KM2A 2PLV2 4UVAA 3SQOA 2Q1ZB 1S2BA 3ZMNA 5ABJA 5IT6A 3FL7A 4B1MA 2DLLA 3GJAA 2ADUA 3NJZA 5CA6A 4OI2A 4R9AA 4ZXEA 3IM0A 4NHYA 1LHOA 3GZEA 3FM5A 1LTEA 4M3DA 3ZFEB 2N7GA 3I2JA 1DQ2A 9ANTA 2L9VA 4G12A 3BOPA 2JDNA 4KNYA 1OT5A 4HLXA 3RJRA 4WM8B 2F4IA 5BV6A 5K4LA 2WO7A 3ZN0A 4OAYA 4OUMA 4AVBA 2OPWA 1SFNA 4GA9A 5F9TA 5FZ7A 2VNVA 3JTGA 3VDBA 1LPQA 1W06A 2DOEA 2ZABA 3LA7A 1H8TA 5IVVA 2VNOA 1SQ4A 2QSFX 3WDTA 2VKDA 1OA2A 2FCTA 4A7KA 4XURA 2KHMA 5GTHC 1I9RA 1W0OA 2XDVA 1TC3C 2HWB3 4Y15A 1EV13 2A71A 1YX5A 4CRQA 1JYNA 2B42B 1W6NB 2WAEA 3AMPA 4V19K 1SEUA 1N77A 4E2GA 3WDXA 4IV3A 2VGDA 4AZZA 4CUBA 2DOAA 1YIJI 1WD4A 3DBHB 1S0EA 2RMU2 1L7LA 3RS6A 3J8F2 2M4KA 4B7KA 1BN5A 4IGOA 4KT6A 5HLTA 1CD3G 3HNMA 1YQ6A 4YW7A 3VL8A 1MZ5A 3P1IA 4QB6A 3TP3A 5ABJC 5C4JJ 4EGYA 1QPMA 5FYCA 5F32A 2HQ5A 5KBFA 3FZVA 1VBE1 1O4XA 2G9WA 5H9SA 1YJNI 2LD5A 2C6SA 2ZBJA 1MACA 4UBHA 4J19A 4EM0B 2FSWA 1FAYA 4BYYA 2XLAA 2Y0SN 1TWAJ 2L3DA 3IL2A 4O9EA 3HQRA 4ZYHA 2ZHLA 2QQNA 2RVAA 4HF0A 2DVAA 4RAGA 4F91B 2PA7A 1IC8A 3D0JA 3GLLA 4NVPA 1OVPA 2VZ3A 1VNDA 3IC7A 4MX3A 3ZN1A 4ASNA 2IUWA 1FY7A 1N25A 2AO9A 3CF5F 4QM8A 5HPOA 4V2GA 1S0IA 3ATGA 3GCWA 1AXYA 1P4WA 4R1HA 3K2ZA 1NLRA 4A42A 4D9JA 1PZ9A 3OGGA 1MNEA 1K6YA 3V8LA </