3H3UA

Crystal structure of crp (camp receptor protein) from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
216
Chain Sequence
b'DEILARAGIFQGAIAALTQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
publication title Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 61
structure length 216
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3uA01
4LB6B 2P4WA 4XF4A 5I0SA 1R36A 1PM7A 4OIQF 1JE8A 3WTTC 5J8FA 1NZCA 2FEZA 4YFXF 4LGWA 1SFEA 5IT9Z 2KRFA 4I02A 2PMHA 2NYXA 5FFXA 3E3VA 4P96A 1JXSA 5F6FA 2JPCA 1FZPB 4HOBA 5AONA 3O3KA 2RC4A 3K0LA 4A0ZA 2ET1A 2VBZA 2OQRA 3HOSA 2Q30A 1V4RA 3GLXA 2H0VA 1IW7F 2F2EA 5JSRA 4YRDA 2B9UA 3HTSB 5TJJA 2XROA 2M8EA 5EEHA 3S7IA 3FZ3A 2ACJA 5JAXA 4Z2YA 3HHGA 3RJPA 4UHTA 3U2RA 3FM3A 2JRTA 5K5OA 2NAZA 3KLOA 3MDPA 2EJRA 1R1UA 3COAC 1HSTA 2MBFA 4HDUA 1CAXB 3LSTA 3DF8A 4EJUA 4Q0QA 2EVXA 4IEOA 3MWMA 4ORFA 4QX5A 1XE7A 4MV2A 2D45A 2XVCA 2HKXA 3ISPA 2XAJA 3CUOA 3NW4A 1UHMA 1CGPA 2DO7A 5FLXK 1CX4A 5D6EA 4WXDA 3IKTA 2P5KA 3AAFA 1R1VA 2LF8A 1G3TA 4R52A 3HSRA 2G9WA 4EWAA 4FAGA 4M71A 2XASA 1KU9A 3LZZA 4A0XA 1VJ2A 5HS8A 3T1BA 2BV6A 2YX4A 1YFWA 4RAZA 3WW4A 3IHUA 2L54A 4L0YB 3GZ6A 1FI2A 4H0EA 2OPKA 1EV7A 4OFGA 3PVBB 5FPXA 1VR3A 4HLTA 4XFGA 5BPXA 4OIOF 3HHHA 4HV5A 4XETA 3CJXA 2V1UA 2IXJA 2QBYB 4HX8A 3F8BA 2XKOA 3LA2A 3K1NA 1S29A 2QQ9A 3ST7A 4G94A 1IXRC 3RKWA 5ICCA 3ERED 3SMHA 5D4RA 1BIBA 1IN6A 3QPTA 4WK8F 4L0ZB 3MEXA 5L3BA 5FLHA 1FT9A 4IVNA 4YFKF 2IXKA 4I98B 1LKNA 3R6SA 1Y9QA 2A68F 5FFZA 1S7AA 3JTHA 3EETA 2P5VA 5JHUA 5LEJA 4PJYA 2NRAC 3ECOA 3P9CA 1R58A 3OV8A 3CEWA 4P9UA 2Q4SA 3SZPA 2K9ZA 4WWCA 2MLKA 2F5EA 1H9TA 1ZRRA 2ZNYA 1MJ9A 3DN7A 5HLIA 2Q2EA 4XSXF 1RIOH 5FQ0B 2D2WA 2GZWA 1BN5A 1YO5C 2P7CB 5C6CA 1XCVA 2PEXA 4G7ZF 5ILSA 2YX7A 2WFPA 2PTMA 2EV6A 1MZBA 1ZAOA 2MC3A 2Q0AA 3PQKA 4PIZA 4QGNA 2CV6A 2VC0A 4LK1F 1KQ0A 3ZN1A 2IVMA 3CUQC 4O3MA 5DUIA 3TO9A 1BI1A 5A2QZ 2MH9A 2ATFA 3KEQA 3HRUA 3C1DA 1YLLA 4ZU5A 4U88A 2PBIA 3GVAA 4KT5C 2ET7A 2EV5A 1Y3TA 1SMYF 1IAWA 1DZRA 1XE8A 1BI0A 3ULQB 4MGRA 2GC2A 3RKXA 1OFNA 4R1HA 1GHCA 4I3PA 5HS7A 2QVOA 2W24A 4O9EA 4CZZA 1CAUA 4MQVA 2GA2A 4D7TA 1YFUA 2E7WA 3EQLF 2IW5A 2FQPA 1CF7B 4IRIA 4K8FA 1Z9CA 3FZVA 3I53A 3EQEA 3F23A 2FMLA 1X8MA 2IA0A 4KIBA 1OI6A 4P5OA 3WTSC 4X6QB 1LVAA 4L9VA 2RGVA 1STZA 4U7BA 4X6RB 4FX0A 1W5SA 4IEYA 4HYEA 1QXRA 1KU7A 1S7OA 3T5XA 4EM1A 4IEQA 1FWZA 3IBMA 1JHFA 2A6EF 1B4AA 1NE4A 1WLTA 4UVCA 2PFWA 1SQ4A 2VPVA 4PDKA 3V8JA 5I8TA 1OKRA 4PIYA 2K27A 2VXZA 3RKYA 1OR7A 2QDRA 2FNAA 2OAZA 2D5HA 3PNAA 2H6BA 1HBXG 2MPFA 3U10A 4E2GA 3IDBB 1UB9A 4M74A 1U2WA 4IESA 1SD6A 2HYFA 4EM0B 1TTYA 1Q43A 4KMUX 3ZN0A 4IHSA 3SXWA 5J48A 3CUQA 4MGKE 1O4TA 3MZYA 2ZXJA 3LOIA 5T3NA 4LK0F 2KIUA 4UUVA 2CGPA 3FM5A 2HQRA 1SD5A 3USSA 1IXCA 2ETHA 5LHHA 3I0TA 1FBUA 4A12A 3PFIA 1CF7A 4QM9A 2LSOA 5BS6A 4EGYA 4DINB 1LR5A 3FMRA 2VE8A 1IN7A 2KIMA 3FHZA 1G3SA 1KU3A 1G3YA 4LMYA 2HZTA 2FE3A 1XD7A 3R0AA 4LG0A 2PAEA 5L3GA 3ZMTA 1KQ9A 5DD4A 3MPBA 4XBFA 3MAJA 4LLNA 4PIXA 3WODF 5I0RA 2OYZA 3KEOA 4Q0VA 2A3SA 5KVRA 3I7DA 3E6BA 2YU3A 3H50A 4O5VA 1ZG3A 1K6OA 2H27A 4WXHA 2UYAA 2DK5A 2D93A 5FD6A 1V70A 4O9GA 4G6QA 4M9XA 5E20A 5LHIA 2MHFA 1HW1A 4L9TA 4M9SA 4ZYHA 5BOXA 3SZTA 1TNSA 1TW3A 3SQNA 2NNNA 3QU6A 4XF3A 3DPTA 5E1XA 2DI3A 1Z05A 4MHGA 3K2ZA 1ZZCA 4XFAA 4EJWA 5D8KB 4QWQA 2DCTA 3TNQA 5EEGA 2UYBA 5JI6A 4HX4A 3GO5A 2ZO4A 4IEPA 2FA5A 5ED4A 4F8AA 5CLSA 3CO2A 2UY8A 2EFWA 3VOEA 3TO6A 5FLJA 1XGNA 4JTNA 1ZLKA 2OQGA 5J6XA 4BNCA 2ISZA 1ON1A 3BJOA 1RGSA 1P6RA 3F8NA 5FLXZ 4PGGA 4A5MA 3CJNA 5I91A 3WGHA 3ZMUA 2B8MA 1L0OC 2H09A 1YTYA 1NYWA 4WF2A 3GBFA 5K1YA 5BUVA 3KMHA 1OD5A 4HQEA 2OA4A 3OD0A 3HRMA 1NXMA 2QJVA 2RKHA 3EYYA 2QUFA 3QP5A 3F8FA 3NEUA 3M8FA 5ILVA 3M8EA 3KP5A 3H9AA 1GVJA 4I01A 3J81K 1X82A 3SCHA 3SHRA 3M70A 3QACA 2FF4A 3SCFA 4ENJA 1ZRDA 2K4JA 2K86A 4MNUA 4Y17A 1LJ9A 5K5QA 1UIJA 4RB3C 1T2KA 2P7VB 5JR7B 1QWRA 1VTNC 4KU7A 2DQRA 1KGSA 2R3SA 1H1MA 2B5HA 3HSFA 3DEUA 4RD7A 5CVRA 3BPZA 4ASNA 4XF0A 2EB7A 5HDNA 4P9FA 3EO6A 3BY6A 4ZYDA 3T8RA 3IIAA 1H1IA 4A6EA 3Q5FA 3DKWA 4RB1A 1U8RA 1RNLA 1DPUA 1JGSA 3M9AA 5HDGA 4OIRF 2IXHA 5K5RA 3Q9VA 1ZX5A 3H8UA 4MEYF 1SD4A 1FX7A 2IT0A 3G73A 3OTFA 1IPKA 2QZ8A 2ZKLA 1RUOA 4OMYA 1AWCA 2QM3A 3J80K 2BYVE 2HYGD 3DXJF 4XLNF 4BHCA 3ETQA 4FT8A 4M6YA 1J59A 2EA2A 2EFOA 1LDKB 2M5WA 3V8KA 2VODA 1R23A 1B59A 4CO8A 1TLHB 3SCGA 3JSOA 1O7LA 1I1SA 2O8XA 2EFQA 4HBNA 4N0BA 2KKOA 2GXGA 3WU0A 4KL1A 3TQNA 2FNPA 2CQKA 4TLFA 2PAKA 2GXBA 3RI4A 1B1BA 3GW2A 3E6CC 1KYZA 2P8TA 1UPIA 2M30A 2F4PA 3ES4A 2DBBA 4BQAA 1HKSA 1BJAA 5DYMA 1UCRA 4YYOA 5HI0A 1WWXA 3K1PA 3MCZA 4D0PA 4XEZA 3FHIB 4IJAA 3F6VA 5FPZA 3WW3A 3D0JA 2ELHA 1TQPA 3S2WA 1GQHA 1P4AA 3LAGA 2FBIA 1MGTA 1DUXC 4GULA 1J75A 4Q48A 2QQBA 1IN4A 5LGNA 2B0LA 4RGXA 5ICFA 4XFHA 1Y0UA 1GXQA 3U1DA 3E5UA 3F8MA 4ZZDA 4WVZA 2IRFG 1FPQA 5HOOA 3HYIA 4EMSA 1J58A 3HUGA 1XGSA 3JTGA 2DFIA 1FSEA 2LNBA 1REPC 2Z99A 3CDHA 3H3UA 1GXPA 2DTRA 2FQ3A 3L00A 2Z9OA 4UV9A 3V8LA 3F3XA 2DW4A 2K7LA 1FP2A 3ZPLA 1PP8F 1Z6RA 4N9HA 3RYRA 2IXIA 2M1BA 2OBPA 2E7XA 1ZRCA 1SEFA 1C0WA 1S8NA 2XLFA 2XHKA 1R5HA 3JSPA 2XKPA 3VODA 1KU2A 3H1WA 2O3FA 4G9YA 2Q8KA 1XSVA 2XLGA 3JW4A 3OF1A 3B73A 4MGZE 2QWWA 3IRRA 3QAHA 2CYYA 1MJBA 4M73A 3NJZA 3LQQA 1YQAA 4XFFA 1D3YA 4G7OF 4HF2A 2UZKA 3P7NA 2HEOA 1DZTA 1IRFA 2OZ6A 2ZBKA 1J0RA 2LF7A 2CSOA 2JZYA 1HW2A 4HF0A 1RC6A 2Z2SB 4EJVA 1QPMA 3E5XA 3P9IA 2D5FA 1T98A 5L3CA 3FJSA 1YW9A 1PDNC 2VE9A 5DD8A 2OZUA 4S05A 2L02A 1XGOA 1ON2A 1CAUB 1RZ4A 3V4GA 1QXJA 1TNTA 4I2OA 1MJAA 3BJ6A 3ELNA 4EQQA 2K0GA 4LA3A 3FE5A 1BOAA 2RNJA 4ZU4A 1H0MA 4LJZF 5F64A 4XSZF 3O6BB 4AVAA 3ROUA 4RB2C 2GA1A 4GO1A 4HN0A 1FY7A 1ONVA 3LWFA 2DAOA 1ZNPA 5E8GA 4O6JA 1DP7P 2P17A 5FDBA 3EHKA 1G3WA 5BPIA 4LA2A 4G8XA 4Q5SF 4EVIA 4IEXA 4EGZA 4Q4ZF 4XF9A 5D5WB 3I5UA 1HQCA 1ZZ8A 3N97A 3H7JA 1O57A 2TDXA 3V7RA 3S7EA 4U7DA 3OOPA 1B9MA 1XCBA 2KXLA 2EWNA 2PMUA 1YLFA 1ZGJA 4AIHA 2PYTA 2QVSB 4LTAA 4B09A 1FSHA 4BAYA 3KCCA 2V09A 3MFKA 1B9NA 3E97A 3H1MA 2OU2A 3CUQB 3HTUA 3BP8A 4YIIA 2YR2A 3MYXA 3WTWC 3VEPA 1XDUA 4NQWA 4KYWA 2J5PA 4CGZA 4YG2F 4AQ2A 4Q47A 3WTZA 4IEVA 3J81Z 4AVBA 2HDCA 3WW2A 1W7PA 3TNPB 2DPDA 3GYHX 1LRHA 1GQGA 1J2XA 1QBJA 1ZRFA 2YPRA 4LD5A 3T8TA 1YFHA 3E5QA 5FGMA 4EWEA 4LG0B 2HGCA 1XDSA 5L3EA 4NHJA 2ZMEA 3GFMA 3U0ZA 2P5LC 2BNNA 1O7FA 4D7SA 3FX3A 3WTYC 2A61A 2QYOA 2XLAA 1W5TA 3RTRA 1BC7C 5CVUA 2HJIA 5JFRA 4IEWA 4QGLA 4U0WA 1UW8A 2FOKA 4ESFA 4HLXA 4HLYA 1J1LA 2VBXA 2N7GA 4L2NA 2GIVA 4PGHA 3F6OA 4HF1A 4HAMA 2R7FA 5E1ZB 2UY9A 4FHTA 1J3RA 2GC3A 1U6GA 2XL9A 3LFKA 4BH9A 1YFXA 4UBGA 3HOTA 1RUNA 4UXNA 3GXOA 2HQNA 3UKTA 2XGXA 1NHAA 1T38A 2GWRA 4CHUA 2W85A 4MEXF 1HKQA 1ZG1A 1J9IA 5I93A 3OCPA 4MH0E 4IPAA 2Y48A 5E1WA 2IPQX 4OMZA 3N4MA 4ZU7A 4LEJA 3J80Z 3NQOA 5JR3A 1K79A 1TQMA 2PLYA 4JK1X 3JAMK 2L4AA 1F1ZA 5CYVA 2JTVA 5I0UA 2JPBA 1QO0D 4AIJA 4HW0A 1EYBA 4BHBA 3HT1A 2L3DA 1YUDA 1Z7UA 3EUHA 6PAXA 5D5XB 3BALA 2W84A 3R60A 4G6DA 1XMKA 1QZYA 1ZGAA 3ABTA 2DU9A 3HIFA 4HX7A 3WGIA 1CAWB 3NSTA 1F9NA 1Z1DA 4UVBA 4HSJA 5FLIA 3TGNA 3I64A 5CVIA 1SAXA 1LB2A 1BI2A 4MZUA 5HS9A 1ZHFA 3W6JB 4KIGA 3IWZA 2OD5A 1CAVA 4HBLA 4KWKA 1P4WA 2O03A 3DFGA 3IRQA 3TKYA 2IP2A 5AIQA 3GFJA 4EJTA 1EH6A 1SMTA 5LGTA 3R61A 4BHPA 3KSCA 1XB4A 2XAGA 3C3WA 3F22A 4MGIE 2QENA 2PA7A 2VT3A 4QM8A 1YFYA 4KWJA 3C7JA 2A69F 2VOOA 1K78A 4YARA 4NVPA 4META 2NNYA 4UVAA 1YW8A 2K02A 1BC8C 1FLIA 3FMQA 3LWCA 3U11A 3ZMZA 2VOPA 3QPHA 1TQ5A 4CXFA 4IEUA 4RAYA 3HSEA 5AIPA 5BPDA 4GYIA 4UBHA 5DCMA 3I59A 3GF2A 2IA1A 3M1EA 4CDGA 4FAHA 3FF5A 5D5VB 1CAWA 1ZZ9A 1FC3A 1ZVFA 2EV0A 1V3FA 5HDKA 3NVCA 3CO6C 4KFCA 1WI9A 4BXUA 4HZFA 3BDDA 1I5ZA 1OPCA 2VT2A 1KYWA 5LLQA 2ZCWA 2P6TA 2C0ZA 5EZWA 2WV0A 3LA3A 3H3ZA 2XRNA 2VECA 4QMAA 2KJCA 3O14A 5LGUA 3BPVA 3DPLC 3R0JA 4OINF 5JVTA 2M87A 4FX4A 2M45A 4L11A 5LBQA 5H6RA 5HVQC 4MTDA 1YYVA 3GZ5A 2LDUA 3GFIA 3EBRA 2IA2A 4YSFA 2GU9A 1WA4A 4XFIA 1U3EM 1MDMA 1HXDA 2XIGA 4JBAA 2DK8A 3BU7A 3IL2A 3L09A 4HN1A 4B8XA 2O6GE 2XAFA 2A6HF 1HW5A 5LHGA 5AVPA 4HVOA 2D1HA 3CLPA 3M3IA 2GC0A 5EFUA 1ZZ6A 2NS0A 1LQ1A 4AD9A 4JVAA 3ACLA 4Q0UA 3NL1A 1IXSB 4TV7A 3LQRA 4CYDA 1XGMA 4L5JA 4JQFA 4QLCU 3NKTA 1YHFA 2Z69A 1O3RA 3FFQA 3QRFF 1IN8A 1OYIA 3DQVC 4M72A 2ETEA 3D82A 3EYIA 1P92A 1EY2A 1RL3A 2W25A 1HKTA 2KJBA 1FP1D 2STTA 4DQ2A 2Y0OA 4I0BA 1RI7A 2X0LA 3VFZA 3WTVC 2Z33A 2QLZA 4ENMA 4GGGA 2IXCA 4ENKA 3MZHA 1BM9A 2OZJA 1B6AA 2HKOA 2Z5UA 4P9GA 1EH8A 2FU4A 2HS5A 2I45A 3FXRA 2RV8A 1ULYA 1L3JA 1FOKA 1Z91A 1YIOA 5D5UB 1TW2A 1UIKA 3ZQ7A 2ESNA 4I7HA 3ZDSA 1AOYA 3L9FA 4I0AA 2PQ8A 2OA2A 4A2UA 5DCFA 1W4MA 3DV8A 2BGCA 2V79A 4HQMA 2PJPA 1ZN2A 2Z3YA 5JSPA 3KP4A 2UWMA 1NE6A 1H9GA 2EFNA 2PG4A 4LUMA 3J7AO 2MLGA 4G7HF 2ZKZA 1XN7A 3EDPA 4A6DA 3M7GA 4IETA 3WTUC 3E6MA 4XF1A 3KZZA 4UNOA 5KHIA 5BY5A 1DPRA 2BBYA 2W57A 1X3UA 4XRFA 3WE2A 1S6LA 1XSXA 3OGJA 4EM2A 4IEZA 4ETSA 4R79A 1Q1HA 3G3ZA 2FSWA 1X8EA 4WZCA 3RNSA 2RN7A 4ZH4F 2XAHA 5IT3A 3LA7A 1L3LA 3GEZA 3D0SA 4PZJA 4CICA 1UCXA 4YFNF 3BCWA 2FMYA 3KFWX 5DV5A 3TDUC 2BEOA 1PP7U 4F7ZA 2DPUA 4AWXB 4IERA 3DL3A 2MD5A 1O3SA 2HOEA 4LLGF 4KWLA 1IN5A 2GAUA 5JCTA 3P9KA 1ZREA 1SFUA 4YIFA 4BIFA 2F5FA 3F21A 5H20A 2D1VA 1FYMA 2IXLA 2R7DA 2UXXA 3RYPA 3JAMZ 1TBXA 4IF4A 1K7AA 5KHJA 1G4DA 2O0YA 1LEAA 1DGRA 5D1IA 4RB0A 4KUMA 3WGGA 3FXUA 3HQXA 3K9TA 1JHHA 4WXCA 3BJAA 3F72A 4I09A 4JTOA 4A0YA 1LDDA 2FBKA 4ZZLA 2PHLA 3G7DA 4QXKA 3HRSA 1ZG5A 4ESJA 2EA7A 3RZZA 1YWKA 1JUHA 5CU1A 1FBQA 1EP0A 1USSA 4ONUA 3B02A 3H1YA 2EA4A 5ILUA 1WGPA 5D4SA 4RGUA 5J8CA 1D8KA 3TDZC 1T6SA 1ZYRF 4MX3A 1W7PB 3ZP5A 2FXAA 1F4KA 2BNMA 3CL1A 2X4HA 4B29A 2CAUA 2VBWA 4L5IA 2H6CA 2IJLA 1ZARA 3GWZA 2IC1A 2PQQA 2CAVA 1EH7A 2ZFWA 2ZMEB 2MNGA 3FXQA 4N9IA 3K1MA 1CAXA 5DEQA 3BPXA 5J7MA 5LRSA 3GYDA 4IRHA 2V1XA 4PCQA 2H94A 1Z6TA 3KE2A 4UXAA 1FNNA 1FXZA 2F5DA 2CG4A 2V9VA 5FD5A 5F1RA 5K8SA 2EAAA 4Z07A 4Q0PA 1J3PA 4P55A 2HTJA 1WRJA 3KETA 3V7CA 4EROA 1XSDA 2AS5F 4XFBA 3SFZA 2GH2A 4XLPF 5L3FA 3ELKA 2WWYA 1FBSA 4IHTA 2E1NA 3H92A 5CADA 1HSJA 5BQTA 1QQIA 4K2EA 2E1CA 1J5YA 1G6NA 3VHRA 1T0FA 1Q3EA 5FO5A 4Y13A 2XV4S 2DLLA 4IRGA 4J1XA 1ZZBA 1EPZA 3C18A 4ON0A 3KGZA 4MTEA 2ADUA 2QBYA 3Q9SA 3TOBA 4KA4A 3L2HA 2V1DA 1R00A 5ERIA 3V7SA 1YS7A 3KP2A 4WCGA 2O61A 5CVVA 5IT9K 3F8CA 4XFCA 5KBFA 5H6QA 3S0MA 4OLLA 1A04A 3D5LA 4AQ6A 2HFHA 1WQ2A 3WTXC 4U0YA 3CLOA 4EJOA 3U9GA 4LULA 4U0VA 2P6SA 1CAVB 1ZH5A 3BROA 2QNKA 2COMA 1QY4A 2HR3A 5HLHA 1J7KA 4E70A 2BNOA 2L01A 4WBBA 4AVCA 4IXAA 4KN7X 3ABUA 3WU1B 5FQ0A 1KA8A 5C8WA 2DQLA 3KGLA 3RIRA 2J5OA 3BOQA 3RDIA 1RTVA 4Y15A 3E6DA 3ES1A 4MQ9F 1K78B 3I71A 3PQJA 4ZYGA 4S04A 4ZYEA 5I0TA 3ZMSA 5ICGA 5D8LB 3UKNA 2GQQA 2Q1ZB 3ML6A 3GUDA 1UHWA 2RVCA 1R22A 4Z82A 4WX9A 2O1QA 3L7WA 1I6XA 1LDJA 1UFMA 3KLNA 1UD1A 2ZNZA 3GX4X 2Y75A 5HLGA 5KK1A 5ICEA 3BB6A 1BIAA 1PUEE 5DCMB 3VB2A 2CW0F 3SHFA 3I59B 3RYKA 1DGWA 1QGPA 1XRUA 1U12A 1O3QA 2VBYA 2V6CA 3KP7A 4MGYE 2CWEA 4GCVA 1VP6A 4UV8A 4KICA 4ENNA 3QOPA 4EWDA 4KIFA 3QU3A 3CTAA 1MD0A 2PFBA 1P4XA 3WW1A 1OYYA 1S3JA 1W7PD 1IUYA 1IZ1A 4KN4X 2QQAA 3FWEA 5I8YA 4OOIA 3WG9A 2O8QA 4HVQA 4EV0A 2G7HA 1F5TA 5E18F 3SXYA 1R1TA 1USTA 2Q0OA 5D6FA 3W6KB 2PN6A 3BZ6A 3IC7A 1ZZ7A 5CJ9A 1QZZA 5LRRA 5TRDA 2MA3A 3UKVA 2A07F 3R4KA 1MDMB 1SFNA 3H7YA 2C6YA 5E8IA 3TOAA 1IRGA 1PMIA 1D8JA 5CVJA 1J3QA 4Q0SA 3JZVA 3RPQA 5KHKA 1XMAA 4M6XA 5E16A 3HT2A 2CO5A 4E2SA 4BYYA 2GC1A 2XAQA 1SFXA 3ZMVA 1LNWA 1U78A 2L4MA 2ESHA 1IPJA 5L3DA 1KQ8A 5BMZA 3T0YA 4RGSA 2XUBA 5KHGA 1SD7A 4NB5A 3NRVA 4M9ZA 2PI0A 2EK5A 5JSOA 2STWA 4MUVA 3K69A 5A2QK 2ISYA 1WKMA 1T39A 2XL7A 3EJKA 1D5VA 5LEKA 1ZLJA 1WSUA 2VQAA 5E1RA 5KHHA 3CO7C 1I27A 4LFUA 2EFPA 4LUKA 2Y0MA 4KMFA 3DP7A 2F5CA 1O3TA 2ZJ2A 2AXLA 3O2PE 4E2QA 3IWFA 5J3UA 2KIFA 1YG2A 1E17A 1U5TC 4QGMA 4L9NA 3I4PA 5FCCA 2K4BA 4HSLA 4AVPA 2HTSA 4L9JA 4RGRA 1YS6A 2RDPA 4L18B 1BI3A 2JT1A 3MQ0A 4ESBA 4YNIA 4LB5A 3KZYA 5DDGA 5DUKA 1P2FA 4J1WA 1U5TB 4LLOA 2VN2A 3IKVA 3QP6A 5BV6A 3WE3A 2FBHA 4HVRA 2G7UA 1E2XA 4OU0A 3REOA 3CF6E 2FRHA 4HA8A 3KP6A 4KDPA 2VC1A 3FMSA 1MKMA 2BE5F 4AXOA 3PLQA 2WTEA 3I54A 4GYGA 3TO7A 1R5GA 1O5UA 4KNYA 4KU8A 1X7NA 4FBFA 3L2CA 1BBYA 4HV6A 1O5LA 5BXXA 3LAPA 4HDVA 4JV4A 1OMIA 1IF1A 2CFXA 2E9QA 4LLLA 2JSCA 1DDNA 4GXOA 2LKPA 5E17F 2YSRA 4HMZA 1FYLA 4R8HA 4AIKA 1Q5OA 3HRTA 2PAMA 2UXNA 1ODDA 2HWVA 4A5NA 2DT5A 2RQPA 4RS8A 2A5YB 2D40A 1QNTA 3GFLA 3KP3A 1R7JA 1YW7A 5FB2A 2QCSB 2VONA 1I1GA 3RPUA 3ECHA 3I58A 1FYKA 3BWGA 4Q29A 2MH2A 3C3VA 1LEBA 3ZMDA 1TQIA 1U5TA 2WC2A 4DNCA 4H7LA 3IDCB 1OYWA 5I8SA 3LAJA 4OIPF 2PHDA
chains in the Genus database with same CATH superfamily
2P4WA 2Y6KA 5CEHA 4XKCA 2VNGA 1RPWA 4U87A 5FXZA 4LGWA 2WZPP 3UESA 1RUI2 2L7FP 1NK3P 1H2MA 2PMHA 5FFXA 3E3VA 4V2WA 2E51A 1RUF3 3FL7A 5EIYB 4V19K 4GWIA 2VB6A 4Y20A 4CDUA 3O3KA 2JUCA 2RC4A 3LSKA 3WG4A 3PU8A 4B4PA 2ET1A 2ZEWA 3HOSA 4NIGA 3H3LA 3GLXA 2HEYF 3VD7A 4YRDA 5EEHA 5JWPA 3FZ3A 5JAXA 1N1YA 4N43C 2ZAHA 4Z2YA 4UHTA 2VZSA 3OL4A 5M5YJ 1N3OA 2R4GA 1R1UA 1IG0A 1H6XA 4HDUA 3U4XA 5FXWA 1POV0 2XWBB 4ORFA 2GNDA 2P1BA 2RM21 4QX5A 2DBIA 2XVCA 1AXYA 1G7YA 3HN3A 2R7VA 3W5NA 1O6UA 1X1CA 3CUOA 2JB8A 1CX4A 1UAAA 1VQNI 4WXDA 4YFZA 3FIWA 2A5WA 1YNAA 3B9CA 1FOWA 2VQ0A 3KF3A 5K0UC 1SFOJ 5H9PA 1G3TA 1O8SA 4YZ2A 3K48A 3AL5A 5FFOC 4D6QA 5C9AC 5FJHA 3GTGJ 3JREA 3L2WA 2LG4A 1F31A 2R7WA 1VJ2A 4D6RA 1HC8A 4BXFA 4FFHA 2C9AA 2BTVC 1R4MB 1FI2A 2OPKA 2CQNA 3RS6A 4IE7A 1EV11 4OFGA 3PVBB 1MBKA 3SDBA 5FRNA 1AYN2 4HV5A 3AFKA 3AVSA 5FY8A 2IXJA 3F8BA 3GJAA 4Q4X1 3FXJA 2XMLA 2K2SA 1UYXA 3THDA 4G94A 2MEV1 3T1LA 2MC4A 4IVNA 2IXKA 2WV1A 4I98B 3R6SA 3CJQB 2X5IB 3GTPJ 2DU0A 1BA5A 2P5VA 4RHV3 1OA3A 4IE4A 1OKQA 1VBB2 4JYKA 3OV8A 4P9UA 1MNEA 3K77A 4CCMA 4KG0A 1V0AA 3RMYA 4LITA 4PF5A 2VZQA 2MLKA 2F5EA 2ZNYA 1MJ9A 4XE9A 1YQCA 2QQKA 3S5AA 1JUPA 3DN7A 2Q2EA 2QZ3A 1RIOH 2D2WA 1NK2P 4AF9A 5C6CA 5ILSA 2YX7A 2X1CA 2WFPA 5C4JJ 3T30A 1MZBA 1WBLA 3PQKA 4PIZA 4JGZB 4QGNA 4O3MA 3VD3A 5DUIA 4NRMA 4BQOA 4QB2A 1BI1A 1VNDA 1VQMI 2ATFA 1SLBA 2ID6A 4XMAA 1OF4A 3GVAA 1HXS3 3VZKA 1Y3TA 5EG0A 1IAWA 2WAFA 1XE8A 4Z2WA 2QQWA 3NNGA 3BQYA 3ULQB 2RS11 1TWAJ 1PVC1 4LO8A 3FK6A 1PVEA 3RKXA 1OFNA 1JTXA 2VCAA 5HS7A 2RMU1 3KYDB 1DU3D 3K4NA 2LUWA 2A71A 3U1XA 2EPFA 4ZY9A 2PHWA 4XR6A 3ZQFA 2R043 2GA2A 2LY2A 1EAH3 1YFUA 2IVIB 5FYYA 4MOAA 4XKVA 1Z0XA 1UXXX 3FZVA 3ESWB 4AR2A 3F23A 2IA0A 1YQ2A 5GLUA 3VDCA 1YRNB 3D1NI 4K7JA 1OOPC 3T3YA 2RGVA 4U7BA 2ZTNA 5FLVA 2E2HJ 1KDMA 4BGDA 3ZXDA 4IEYA 3CP2A 1QXRA 4NPLA 1PK6C 3OUIA 1DQ0A 1FWZA 3IBMA 3TW6A 3GXUA 3AL0B 3KVBA 1JHFA 1UU6A 2A6EF 4DBQA 1AR83 1B4AA 1B35A 4UVCA 3TAYA 4D7NA 1JT0A 3GHNA 2VPVA 4PDKA 5FZFA 3ZSMA 2VXZA 3KLSA 2L9RA 1OR7A 2EAKA 2DCEA 3AP4A 5FP3A 2OAZA 2FDJA 4SLIA 5FZHA 2MPFA 1RUD3 1V6LA 4BDYA 4M74A 3USUA 1SD6A 1DU6A 4Y1VA 3PM1A 4EM0B 1Q43A 5G05L 3CZJA 4MGKE 2ZXJA 4HETA 4Q8LA 2CGPA 2A6XA 2HQRA 1W36C 2QQNA 5GM0A 3WHBA 1IXCA 2ETHA 4A12A 5IFTA 1JN2P 1PO11 4QM9A 2GP3A 3DGTA 1H4GA 4CCOA 1LEMA 4OMDA 1JZ2A 2DTZA 4C30A 1IN7A 2MG4A 3INAA 3ECQA 4XABA 1G3SA 2JN6A 1KU3A 5JOWA 3HR9A 1W2NA 2HZTA 3VGIA 1XD7A 4LG0A 3HL2A 1NCQA 3Q8BA 2R0QC 1KQ9A 4YM0A 2BQPA 4XBFA 3LEMA 5GALA 1SBEA 4IV1B 5I0RA 3CD6I 5KVRA 1LESA 3JQWA 2YU3A 2IZWA 4PLOA 3K4KA 3PVOA 2HWD3 1BVVA 4GB32 1W9YA 2ELKA 1FIAA 4XJ9A 1ND3C 2DK5A 2D93A 3PUAA 4O9GA 2D43A 5E20A 1OFCX 4XUTA 1HW1A 4ZYHA 3JRFA 3SQNA 3QU6A 2PMWB 5E1XA 4KT6A 3K2ZA 4XFAA 2YC0A 4QWQA 2UV1A 3FBIB 5EEGA 1AR61 1ND2C 4XLFA 3FK7A 4HX4A 3JD73 1WJEA 2FA5A 5CLSA 2EFWA 1VAVA 3VOEA 1BBT1 4DOZA 5ABJA 4BNCA 1ON1A 3ZYRA 3I2FA 3AKPA 4PGGA 4EN7B 5B66C 3CJNA 1RETA 4HK9A 1X9TA 3IH3A 1C1LA 1XNAA 2WLPA 1L0OC 2H09A 4JHTA 1YTYA 3IAQA 4WF2A 2HQ5A 3RZGA 3GBFA 4XIKA 3VN4A 1OD5A 5DG2A 3HRMA 1LENA 2QUFA 1A36A 4NRQA 2G4IA 1FMD2 4P08A 3ZFFC 3SHRA 5CAZA 2FF4A 3C2HA 3SCFA 5L73A 1UY3A 5FO9B 3THCA 4W65A 4HRIA 1V6MA 1T08B 4UFLA 1FOD1 1KGSA 2RR13 2R3SA 5E3MA 1MMGA 2QUOA 1LJ7A 2QQLA 5JI9A 2EBIA 2RS33 1RYYA 5JHFA 1UY2A 2DV9A 2ZXIA 5HPOA 1KJRA 1SACA 4Y20B 4CDUB 1H1IA 1G86A 3BG3A 1RNLA 3CJIC 1JGSA 1DFQA 3ZOIA 3N9LA 2W48A 2RV9A 4UI9L 3MICA 4S2GA 1SD4A 2DOAA 3VD9A 2IT0A 1X1AA 2CNAA 3G73A 4EZHA 1L7RA 4FPKA 1BW6A 5DM7F 1L7LA 5DAXA 4OMYA 4CE8A 4JQTA 1AWCA 2DTYA 2R0FA 3J80K 2HYGD 4BHCA 3DXJF 1J59A 2EA2A 2JB4A 1NCRA 1LDKB 4QKDA 1ETKA 2VODA 2V5YA 1WH7A 1KEXA 1G2HA 4CO8A 4PBOA 1ITYA 1I1SA 2XF5A 1W36D 4HBNA 2DVBA 2R30A 2O8KA 3TQNA 2CQKA 2PAKA 1B1BA 4Y26A 2IXSA 1G9FA 2F4PA 1RVF1 2RS51 2D6MA 5F5IA 1LAJA 3IMMA 2PHTA 3DXTA 1BJAA 5TSWA 3HOBA 1GWLA 1D0XA 3MCZA 1M1EB 1JJ6C 2HWF2 2Q8CA 5FYMA 3FHIB 4IJAA 2E26A 5FP8A 3WW3A 2XHNA 4LE3A 1SVOA 2WS92 3AKZA 3LAGA 1MGTA 1AL23 1JUMA 5JMOA 1A6CA 4Q48A 4RGXA 5ICFA 4XFHA 2BZDA 3F8MA 4PLMA 3O1SA 2IRFG 1FPQA 4Q4V2 5HOOA 5J40A 5IAXA 1OC1A 3E1F1 1ZA4A 2DFIA 1FSEA 2LNBA 3AZWA 1XXNA 1REPC 3OBAA 1MMDA 3CDHA 3H3UA 2DTRA 4EN8B 1VQKI 1HRV3 5EDNA 1XE0A 2HLEA 2VCBA 3JBG1 1NAEA 3OEAA 2HH9A 4ZDPA 4XJAA 1Z6RA 4D69A 1RUE1 4A7ZA 1DQ6A 4P9XA 4V2VA 1W6OA 1C0WA 2XR4A 2Q2EB 2XHKA 3VODA 2M9HA 3OS0A 4G9YA 2XLGA 5CQEA 4XW3A 2WY7Q 2QWWA 1UN1A 2VTFA 5K7PA 3NJZA 4UFHA 4XFFA 1D3YA 3QH6A 5L7OA 3CCSI 3RPUD 2VJ4A 3LSRA 4BWOA 4QB6A 1OJLA 3LSMA 3O12A 3G6JB 4HF0A 1RC6A 2VULA 1ZBA3 1W04A 4IXLA 5EG0B 3WQ1A 1OXCA 3ZSKA 2ARCA 4OUSA 1ENRA 3FJSA 1RUG2 2TNFA 1PDNC 4D7MA 3B00A 4E7SA 4FP3A 3SDGA 3T2TA 3V4GA 1ZR4A 2WAAA 4I2OA 5GPAA 2RNJA 2IEKA 3JU9A 5FZ0A 2AH2A 3RJ2X 3O6BB 2EILH 2FD5A 3LGRA 1FY7A 1ZNPA 1OA2A 5A32A 2P17A 1REFA 3VDBA 4CP9B 1JI6A 4CCCA 5E79C 1J09A 4JZRA 1B35B 1OVSA 4PFOA 2IGMA 2CUJA 1X1BA 1W2AX 1C28A 2V26A 2HWC1 3OOPA 1DYOA 2KXLA 2R7ZJ 4PLNA 2PYTA 2QVSB 1S7EA 4B09A 4Z92B 4KJZA 4W50A 3USUB 4QU1A 4BAYA 3KCCA 2YFZA 2W87A 1X3ZB 2V09A 3MFKA 3CQZJ 4KQ7A 2VIXA 2WINB 5IPAA 2BFUS 5FZMA 3BTLA 3VEPA 4KYWA 3JCIA 4TLGA 2VPLA 4I99C 4YG2F 1EUTA 1FMWA 4LBQA 3ABZA 1LE8A 2AZ5A 5LATA 3DYOA 1BQPA 3K3OA 2DPDA 3C2UA 2B4KA 1QBJA 4FPGA 1E57A 4LD5A 2J1UA 4DNYA 1RUF2 3K4ZA 3E5QA 4B3AA 3VL9A 3WOGA 2TRTA 4UUTA 4LG0B 2CL2A 2JRMA 4GKYA 5ERLA 3IN9A 1K5JA 1QGLA 2CV0A 3CQOA 4IQJA 3WTYC 2Y6GA 2A61A 2CTVA 3VZJA 1RUI1 3B93A 3RTRA 1JTZX 3P6BA 4Z1VA 3I97A 2HJIA 3BTIA 3HQRA 1W0UA 4HLYA 2R49A 1TC3C 3F6OA 4JP0A 4HF1A 3VZMA 5L36A 3PFYA 2ZJCA 2UY9A 5H9RA 2AQFA 4GRIA 4LKFA 2DA7A 1J3RA 2GC3A 1U6GA 1D4M3 3MBWA 3LFKA 4MHRA 1YFXA 3O7OA 2SBAA 1MR5A 3GXOA 4PSXA 3UKTA 2GWRA 1ZG1A 5FKLA 3OCPA 5E1WA 2GOXB 5F6LB 2IPQX 4OMZA 2XVGA 4ZU7A 3WUDA 3LEGA 4TN7A 1Y43B 3OS2A 1BMV2 1BL0A 1F1ZA 5CYVA 2JTVA 1T56A 5C44J 5I0UA 3OG2A 5ABJB 4QAWA 2ZGTA 3ZQCA 1Z7UA 1URXA 4EJRA 1OCCH 5D5XB 2WBMA 3CJRB 2H8WA 3L1PA 3ABTA 3HIFA 4AWDA 4K1ZA 1HJFA 3I64A 3OIOA 5CVIA 2R5YB 3ASOH 1LB2A 4GH4A 1BI2A 5IYYA 4MZUA 2OD5A 4C3HJ 3NNLA 3KHCA 4NAMA 1QVTA 3ZYBA 3GM8A 4BQNA 3TKYA 3GFJA 2W94A 2DDAA 2PMZA 4ITCA 4NHLA 1R091 4TZDA 2VNRA 2V4JC 3IAPA 4DBRA 1LOEA 4BJ6C 1ASJ3 4UOJA 1YQ8A 2QENA 4KWJA 2JE9A 4YARA 4RHV2 2LVSA 4META 1WMXA 4A3ZA 2NNYA 3J8F2 3LFMA 4AW7A 1MQTC 4XIDA 2DFCA 2LRDA 4DY3A 5B2GB 1COV1 1LOCA 4RAYA 4DXZA 3PJQA 5AIPA 3IKWA 3M2MA 5L19A 3I3LA 5BPDA 2JVGA 2X51A 4UBHA 3VBRA 1QOOA 4XKBA 3I59A 3GF2A 3OOXA 4CDGA 4RS5A 2WFF3 3MPPG 1S9HA 2E1MB 3J26N 1V3FA 2Z16A 3ILFA 4NN0A 5FKOA 4PJLA 3CMYA 3ENRA 4RSUA 5CFDC 2P2KA 3BDDA 1HXS2 1NCRB 3BVCA 2WWSA 1O59A 5HCBA 2P6TA 4JGYC 1TMF2 2XRNA 1AX2A 1W8OA 1GP6A 2R042 3W2WA 5LGUA 5FY0A 3DPLC 2JG8C 1W9FA 1ULOA 1F15A 5JVTA 4WM7C 4FX4A 2VUJA 2DUPA 5H6RA 5HVQC 1C8M1 3NWKA 2GN7A 3OBTA 1GVDA 3H5RA 4N7UA 4MTDA 1MNMC 1YYVA 3GZ5A 3GDBA 2V6EA 2E33A 3KZ4C 2IA2A 2GU9A 1VAMA 4HK8A 3BU7A 1Z7S1 4PHZA 1G9BA 2LK2A 1HW5A 1FPN1 5A80A 5AVPA 1UY1A 2D1HA 3S1QJ 1RUC2 1ZZ6A 2NS0A 2BGPA 2X6YA 4X6AJ 1MBHA 3JQXA 3ACLA 1Y4WA 4Q0UA 4FPYA 5CKNA 4TV7A 3LQRA 4CYDA 3DEMA 1MEC3 1EJ9A 4ASMB 3ZPYA 4A3JJ 3DQVC 1X1PA 4BKXA 1LGBA 1VZ0A 3Q0UA 4QX7A 3OYBA 2R063 1HDKA 2Z33A 4BXXJ 1SZBA 1NG6A 4XMYA 2H8RA 1MMAA 1TWCJ 2IXCA 2R7QA 4BJ5C 5FY7A 2Z5UA 1RUJ3 3A7QA 1DLCA 1QJY1 4IOAF 3U4SA 2FU4A 1ETVA 3LKJA 1ULYA 2W82A 1FOKA 3Q0VA 1Z91A 3OYAA 1TW2A 4K1YA 4IV3C 1UF2C 2WSVA 2VJ5A 1W6OB 2ARAA 2DYRH 3ZDSA 3FBMA 4EEFG 3L9FA 2ZHLA 2PQ8A 4L8QA 3OYDA 3U21A 4A2UA 5DCFA 1A78A 2V79A 2QKLB 2OPTA 4HQMA 2XF6A 4XMIA 3LSGA 2EFNA 2WNVB 4QU2A 3EDPA 4C2MJ 2KD7A 3S6PA 5F27A 1TWFJ 3KZZA 2HWD2 2VXJA 4UNOA 3O0XA 1DPRA 2YC2A 2BBYA 2W57A 1NQJA 1RKTA 1UMZA 2WADA 2JXAA 3OGJA 3TP0A 3J7MA 1QVUA 1MVEA 2OXBA 1X8EA 3VKFC 1UY0A 1L3LA 3D0SA 2YU9J 2FMYA 3RZLA 2YHJA 3GMEA 4AWXB 5JIAA 1VQPI 3WF0A 1WFXA 3JD72 4GWMA 2XB6C 1SAUA 4NHKA 4QPGC 1IN5A 5A32B 4DZPA 5APAA 4D5FA 3I3BA 2XF7A 1ZREA 5BNPB 2DCKA 2KRCA 1R1A2 1GUUA 1IV6A 1SFUA 3BG9A 3ACHA 2F5FA 3F21A 2IXLA 2DTWA 3OPWA 2UXXA 2D97A 1MACA 4DOUA 1VMHA 5KHJA 1G4DA 2MW8A 2O0YA 1GZCA 2HVSA 5D1IA 3N36A 4JHZA 3QOEA 1BR4A 3FXUA 4LHKA 4E6KG 4BUPA 2JG9A 2HBUA 2D6NA 1T0FC 2FDKA 1UMIA 4ZZLA 3G7DA 5A7WA 1ZG5A 2EA7A 1RRJA 1D1CA 4A6OA 3K2OA 4IUGA 2HWB2 2KQRA 2DWRA 1IKPA 1JUHA 1FBQA 2VPRA 3DECA 4HKWA 2EZHA 3B02A 1K6YA 1VQ9I 2K3FA 1AUYA 5A6XA 1UO9A 1FYUA 1ULCA 3TDZC 4LBQB 1LE8B 2JUGA 1S0FA 2CQXA 3ZP5A 1HKDA 2FXAA 2RR12 4IGOA 4Y3OA 1JZ8A 4A3DJ 4AGRA 3DTEA 1W9TA 4XJZA 2RS32 2EH3A 2W92A 2IJLA 4AU7A 2W1OA 2IC1A 2CAVA 5A7SA 2ZFWA 2MNGA 3FXQA 5FKBA 5DEQA 3IUOA 4J19A 5LRSA 2G0EA 2XQRA 1CWPA 4IRHA 3SKJE 3HNBM 3NJVA 2H94A 1Z6TA 1ORKA 3KE2A 1Y1WJ 1FNNA 3M3YJ 2CG4A 2RM23 3ON7A 5SV5A 1YOVB 5F1RA 5CQGA 4IGPA 4Z07A 4R9AA 3KETA 2J22A 3S3NA 1VBE2 4EROA 3SFZA 5L3FA 2E5NA 2Z42A 3O5SA 4YGEA 1SHWB 4BY7J 2DCZA 4MG2A 1GOHA 4OZOA 2GDFA 4AQTA 1FMVA 3P3NA 2HOAA 2A5ZA 3GZAA 1U0AA 2WY8Q 2MSYA 2VMEA 1Q3EA 2DYCA 2OUMA 2PELA 3JB8A 1ENHA 2DLLA 2VZRA 4KGQA 4JX6A 1RJ7A 2YXSA 4JKKA 2CWMA 1EPZA 4ON0A 1EV13 2QBYA 4NPMA 1G59A 4CCJA 2V1DA 4XM3A 4RR3A 1R00A 3MMYB 5ERIA 1Q8SA 5LBCA 1X58A 4ASKA 4P5YA 5BNOA 4OHZA 1UZYA 4N53C 5KBFA 3AX4A 3OGSA 3BR6A 3S15J 4LO4B 2MEV3 2FD8A 2W1QA 2A75A 1WQ2A 1YI2I 4GH4B 4PI0A 4PUSA 5LK5A 1NG7A 3CCUI 4U0VA 2Y9YA 4Q4W1 2P6SA 4PF1A 5K9YA 1ZH5A 3BROA 4AI0A 3NV4A 3PJRA 5JOZA 2PJRA 2WQZC 2K85A 4AVCA 4IXAA 4P02B 2BHZA 2HDWA 1KA8A 2B9VA 4ZHNA 4QTRA 2CGNA 2ZGQA 5FYTA 4YRVA 1JZ4A 5IW0A 2G9GA 2J5OA 3BOQA 1RTVA 5IVVA 3IDEA 1HRV2 4MQ9F 4S04A 3ZMSA 3PUFA 2WA0A 5KAFC 3PO3J 4XL9A 1D0GA 3GUDA 3AB0A 3DWLE 1S0IA 2O1QA 3MW3A 3NAPC 3POJA 1ETYA 5FMOL 4PJMA 2C6SA 4Y5Z0 3GX4X 2I5UA 5KK1A 3OYJA 4P9LA 4E9KA 2VG9A 4TSVA 4X8NA 2D44A 3HM5A 1BIAA 3WG7H 1PUEE 3I59B 3K4BA 3RYKA 2RS13 5FK8A 4RS5B 5GP9A 2FBEA 2M2EA 2XGDA 2RMU3 4BOWA 2VBYA 2OVUA 4F55A 2V6CA 3FKIJ 2CWEA 3PSFA 2ZJQF 1WKYA 2C24A 2JA7J 1JW6A 4KICA 1ZBA2 2GSYA 3OGVA 4K6BA 3MF6A 1RIRA 1MD0A 3HPNA 1JUIA 1AVBA 1GZ9A 1PM4A 4XICA 1H4HA 5A3NA 4MADA 1IZ1A 2Y34A 4KN4X 4AC0A 2ENRA 2QQAA 3FWEA 3KIOA 3ASIA 2VQCA 4XLEA 3B3QE 2G7HA 3B6AA 2M0CA 3WY6A 5D6FA 3W6KB 3BZ6A 5KCMA 1ZZ7A 2BVMA 4CDXC 1V9U3 5TRDA 4UB8C 1TZOA 3R4KA 1SFNA 1S4CA 3H7YA 3RWNA 2E2JJ 1N47A 2BXYA 1R64A 1D8JA 2HPIA 2M3AA 1LU1A 5KHKA 2IS6A 4Q5OA 3K10A 5E16A 5J98B 2CO5A 1UJ8A 1U78A 3O0WA 2ZSIB 2L4MA 1RB8G 5H9SA 5FYHA 1IPJA 1NLRA 2FZ1A 3AG2H 2WQ4A 1AJKA 2CQ7A 1PO13 5A2QK 2ISYA 2XL7A 1VALA 1ULEA 4XQWA 5E1RA 2RJKA 4AEMA 5AFEA 5FP7A 3DP7A 3DCQA 2HNHA 5CISA 3S30A 1O3TA 2ZJ2A 2O9LA 3WP4A 4MXVA 5CG8A 1YG2A 4QWNA 1R9TJ 5FCCA 2K4BA 5JZGA 2HTSA 4L9JA 1APLC 3HMYA 2M7BA 4R4XA 2XJTA 2AC1A 1BI3A 3KZYA 4AHWA 1UKRA 3WNKA 3O8GA 3IKVA 5C8CC 3WE3A 4CXYA 4IHVA 4P1WA 4OU0A 5LZ6A 1S5LC 1PZ7A 2TCTA 2BE5F 4AXOA 1JKPC 2XPWA 2H1LA 4Y4YA 1WZXA 3BOPA 1PUFA 4FI9A 3TO7A 1LCLA 3U75A 4LOCA 4PK4A 2E31A 1AR63 1H2KA 4HV6A 3GCWA 1VBA3 3S17J 3URFA 1D4M2 4XXAA 4AI9A 1I50J 1XS9A 2L9VA 4JV4A 2Y6LA 3ZXKA 3KX2A 5CKMA 5GAHJ 2CFXA 2E9QA 2JSCA 2F6CA 5EXOA 2ZBJA 3CKHA 5E17F 1TG7A 1GQPA 4ISQA 3ACIA 5IK8A 1LULA 1SCRA 4R8HA 4AIKA 1G9AA 1UY4A 1V55H 3BG7A 3E0JB 4A5NA 2DT5A 2RQPA 2BY1A 1XG1A 1GT0C 1R6RA 1MZFA 1DYKA 4DY5A 1FV3A 1YW7A 1UZ0A 3AFGA 1GV2A 5JLXA 3ECHA 1FYKA 2A6ZA 4ARXA 3BWGA 3VYRB 2Y31A 1LEBA 2HEWF 1YHQI 1BMV1 2R7SA 1TQIA 1U5TA 1JXNA 2YG0A 2BVLA 2WC2A 1HQLA 2A6VA 4H7LA 3POGA 3IDCB 1O4YA 2QQVA 4OIPF 2PHDA 1R71A 5I0SA 1HB1A 4QX8A 4OI2A 4XTPA 2YB7A 4YFXF 5FV3A 2JG9B 5IT9Z 2NYYA 1IO2A 2RAEA 4UFKA 5GPCA 1HQWA 5A7WB 2XG3A 5F6FA 2XWJB 1FOD3 3CHXA 1GOFA 3CC7I 4HOBA 1YI7A 4E7IA 2W7NA 1X50A 4A0ZA 2DJNA 2XBO1 4M0NA 5FMOS 5FUIA 1IW7F 4E4DX 3RZDJ 2B9UA 2XROA 2M8EA 3WDWA 2VMDA 1F5FA 3S7IA 2EZLA 4LIUA 5GZDA 3DKQA 3U2RA 2YBPA 1GP4A 2EJRA 3COAC 2B42B 5LY1A 1WI3A 4KISA 1IHMA 2HEVF 4EJUA 4Q0QA 4EE2A 2R7XA 2JWPA 2VJXA 4QXCA 4QPIC 3PIGA 3OD4A 1JOJA 2CH0A 2WFF2 4FXKB 3IKTA 3AFHA 3VKLA 3LL7A 1XNCA 2FCVA 2CQQA 2LS6A 3ABMH 2X9DA 2VBBA 4QHOA 1Z77A 2G9WA 4FAGA 3C2GA 4Q1RA 3KD4A 4DIQA 1EKEA 1KU9A 1RVF3 2RS53 3QPSA 5HS8A 4JKMA 4B4RA 3T1BA 3BTCA 2CMPA 3IHUA 2K9MA 3GGLA 2LMDA 1EV7A 1AHDP 4J00A 2QQPA 2W68A 1ULPA 2YROA 2VMFA 4GQ7A 2V1UA 3M3CA 2CSGA 2QBYB 4HX8A 1U5IA 2XKOA 1NZIA 1W9SA 2XVKA 5BNOB 2X5IC 1IXRC 4XYXA 2CYFA 1OBNA 3W2VA 4GD4A 3SMHA 4B43A 1IS5A 1BIBA 4WK8F 4HNVA 4L0ZB 3MEXA 5L3BA 5FLHA 1FT9A 1OQYA 1LKNA 1POGA 3BR5A 4QQOA 2MFZA 2DFBA 4AI3A 3JTHA 2YBSA 4FFFA 3EETA 2L7MP 2NRAC 3ILNA 3ECOA 3P9CA 1R58A 1RUC1 3SZPA 2PJRB 5E89A 3QWLA 4WWCA 4CA0A 1H9TA 1ZRRA 3JBG3 1CJDA 4HG6B 2NXNB 2R062 3MEPA 1CQTA 4JGZC 3M1CA 4XSXF 1F9KA 3DKXA 1RUE3 2GZWA 5FJ8J 3DLAA 2ORXA 1YO5C 1HA8A 4EATA 3AMHA 4FPFA 2VM9A 5FY9A 5K0UA 3LD8A 3DU6A 4MHUA 1A5JA 3ZQLA 1ETWA 5FREA 3DTKA 3ZN1A 2ZACA 3CUQC 1NH3A 4LBMA 3HRUA 4JDOA 4NIHA 4Y1YA 5LBEA 1SMYF 4NROA 2JICA 1BI0A 2IS1A 1OF3A 3CF5F 4YGDA 4MGRA 4XORA 5FKMA 1UELB 1W3VA 4I3PA 3QYFA 2W24A 3MIHA 2DN0A 2HPMA 3BGAA 4CZZA 3VHNA 4MQVA 4P9YA 4UUSA 5DTDA 3BOWA 4KITB 4AM3A 3OGGA 4D7TA 3A21A 4LKSA 3EQLF 1EA3A 2IW5A 1R082 4K8FA 1CF7B 4IRIA 1W6QA 3BI3A 2FMLA 3VKNA 2YYOA 3WTSC 4X6QB 2WT2A 1ACCA 1UYZA 1LVAA 4YWAA 4NHMA 4L9VA 3RG0A 1STZA 3K70C 1JZ5A 4CZCA 2DUQA 3QH7A 2ZMLA 1VQ8I 4Y4RA 3F9KA 3LOBA 1BZWA 3A0KA 3NQHA 2PFWA 4PIYA 3S1RJ 4A3EJ 2ERFA 1CPMA 5ANQA 3GBWA 2Y6JA 5JI7A 2J1RA 3ZVXA 5L9BA 2QDRA 1QJU1 2D5HA 5KC5A 1V00A 4E2GA 3IDBB 4CDQA 3P5BA 1UB9A 1U2WA 1VMJA 4KMUX 3SXWA 1O4TA 1I9RA 5KXDA 3LOIA 5T3NA 2LKSA 4LK0F 5C7GA 2KIUA 3J9SA 3KV9A 4F3JA 4FCYA 5IVYA 2HWE1 3TB0A 2KL4A 2WWJA 2WO2A 1GMMA 3B01A 1CZVA 1FBUA 3PFIA 2LSOA 5BS6A 3H9JA 1LHVA 2YMZA 2VE8A 4LQRA 4IV1C 1UYPA 2QDNA 2FE3A 3DLLF 1UZCA 2DOFA 3R0AA 4NWWA 5L3GA 5DD4A 3HG9A 5H9QA 3WCSA 2W5FA 1LFUP 4Q0VA 1YJKA 3NRUA 2HWB1 4I0WB 4CP0A 3H50A 1UKGA 1RUH2 2E5ZA 3E7LA 1RUI3 4A7YA 3J7NA 1MBJA 2QQJA 5JZGB 1K6OA 4GJZA 1SBDA 4WXHA 2UYAA 1F8VA 2WO3A 2VY0A 5LHIA 3DYMA 2J1TA 3AMMA 1Q1VA 1TW3A 4DYRA 2NNNA 4OQ9A 4XF3A 2DI3A 2HYKA 3VSKA 4MHGA 5D8KB 1S0DA 1YEWA 5JI6A 2QQOA 2R071 4XJ8A 4BA6A 1PUFB 5F0HA 3ZYHA 2X53S 5FLJA 1ODNA 5IJRA 4JTNA 1ZLKA 5I0DA 2C5DA 3PUQA 4FOYA 1RMU1 2W3JA 5I91A 5DABA 3WGHA 1J83A 3WQ7A 2A05A 4O7XA 2JDNA 2BW8A 2MYSA 3THTA 1WH5A 4QT6A 4L92A 2F17A 4LKEA 3OD0A 4W97A 3B5LB 1NXMA 3V65A 3EYYA 3OMYA 2DFFA 2KFDA 3NEUA 3H9AA 1EV12 1W99A 2GLOA 3J81K 2GBYA 3SCHA 4LK7A 1IKQA 5FYBA 4Q4X2 1W6PA 3PJYA 1X2NA 4X0GA 5GZEA 1ONAA 1C1FA 5K5QA 4Y17A 5FWJA 1T2KA 3A0HC 2P7VB 4XK4A 3A0BC 1R093 2VW2A 2MEV2 1ND3A 4KU7A 3ZR8X 4ATFA 3FHQA 2VZVA 2QSHX 2AACA 3VKMA 2B5HA 1ZBE1 4CDUC 5FKNA 2I8DA 2R1BA 4AI1A 3DEUA 3K70D 4RD7A 5CVRA 3BPZA 3RZHA 2ZGRA 3EB7A 3ZYFA 3BY6A 3ZFEB 1O91A 2ZKNA 3IIAA 3Q5FA 3DKWA 1U8RA 1COV3 5HDGA 1XQNA 4OIRF 5K5RA 3Q9VA 1VBC2 3H8UA 4MEYF 3ZQQA 1HJGA 2COBA 5F3IA 4DXSA 3C2BA 3K6GA 2WNOA 5FZAA 3N35A 4AGVA 2YFUA 4PBPA 4LNVA 2DT6A 3WDTA 3VD4A 4AVVA 3ETQA 1JZ7A 2V7FA 1P7IA 3SZGA 4FT8A 4K8RB 3KCXA 2BWCA 1JYVA 2LLKA 1UPSA 4CSWA 1ETQA 1TLHB 3MLKA 3OL3A 1O7LA 1BW5A 2JQ7A 5CZKA 2RS12 1PVC2 4XRSG 1BKZA 3C7OA 1SPPA 2KKOA 2RMU2 4CXWA 1C3HA 4TLFA 2QQ8A 2VQUA 3ZFFA 1H6YA 1KYZA 3ES4A 2VVFA 4D1QA 4BQAA 2OJED 1UCRA 4YYOA 5HI0A 3WNNA 3ZXLA 5C3EJ 2WZR1 3U78A 2WSUA 3D0JA 2ELHA 1TQPA 2KLOA 1P4AA 5IP9J 2FBIA 1FPN3 1J75A 1GZTA 5EGOA 2QQBA 3T0DA 1DGRM 2HOSA 4XHXA 1OCZH 2CS3A 3E5UA 1GSLA 4NMIA 2WNUC 4GJYA 4PDWA 4ZZDA 4F93B 3HYIA 4IE5A 4TWTA 3JTGA 3EMRA 2J1EA 2FJ1A 5EWSA 2Z99A 1PZ9A 4QPOA 3WF4A 2FQ3A 4MGSA 3IH2A 5A7NA 1Z78A 3ME2A 3S32A 3ZXGA 2PXJA 3F3XA 4IOCF 3MZ8A 1UNBA 1UXZA 2BRTA 1VRH2 3DU5A 2H1KA 2EIEA 4N9HA 5AVAA 1QJY3 5F37A 1G9CA 2OBPA 1SEFA 3LB9A 4YVSA 3JSPA 2XKPA 1KU2A 4CCLA 2O3FA 2WYSA 1X9PA 2Q5TA 1XSVA 3JW4A 3B73A 3J7AY 5K0UB 3CDLA 3QAHA 2CYYA 5LK7B 3FMGA 1STMA 1YQAA 3SQOA 4HF2A 3AXEA 2HEOA 5DPNA 1DZTA 2OZ6A 3EUKL 2ZBKA 4QHBA 2CSOA 2JZYA 2DA5A 3OOUA 1QPMA 2QKMB 2R6QA 1I5PA 5GTHC 5HNHA 1T98A 3T1MA 1YW9A 4XBLA 2F4OB 5DD8A 4S05A 2DA1A 4G12A 1XGOA 1KITA 2NN8A 2LALA 1ON2A 4BLIA 1RZ4A 4UUSB 1QXJA 3BJ6A 3TEDA 2K0GA 3ELNA 4DRRA 2F6BA 3CJTB 3OYEA 1QZEA 4ZU4A 1MPXA 1W6QB 4Q26A 4RB2C 3W5MA 2K9NA 4GO1A 4XPVA 4X1EA 4P9WA 3WHCA 1UYYA 3MIFA 2DAOA 1AR62 2QSGX 4O6JA 1B35C 5FDBA 4I76A 3EHKA 1F4AA 5LCWL 3AKSA 3UGGA 2WT0A 1O8PA 1BCXA 4EVIA 1BBT2 5KR7A 2QCOA 2X6WA 2OC6A 5D5WB 1W05A 3NNFA 2VZ1A 1MMNA 1AZDA 5FO8B 1TP4A 3K7AJ 1CJPA 3V7RA 1VF9A 5T54A 5ACA1 4Z2AA 1B9MA 2DA4A 2YUEA 4AIHA 1ZGJA 1PGSA 3S1MJ 2XUMA 5A3LA 2M0MA 4CDQB 1FSHA 1WJFA 2KR2A 3SISA 1TWGJ 2FDFA 2K9LA 1UAIA 3E97A 4NIAA 2P34A 2YGMA 3BP8A 1PGL1 4LBKA 1TEIA 5FZ9A 1W0OA 2E6VA 2WBKA 2J5PA 1Z67A 4LOSA 2Y30A 5BNNC 4AQ2A 3KV4A 4RLQA 3WTZA 4IEVA 4AEKA 3WW2A 1H88C 2BJSA 3GYHX 4BPZA 4RAGA 4LPLA 1GQGA 4YW6A 3HD8B 1WCMJ 5HNFA 2YPRA 3D5SC 2VVDA 3FC0A 2UU8A 1ULGA 2O5RA 1FOD2 5FZOB 2E32A 1XDSA 2ZMEA 2EQRA 1UZWA 2BNNA 4YM2A 1O7FA 3G71I 1X4PA 3GZUC 2QYOA 4LBNA 3RVHA 4BXSV 5HXMA 5GADJ 1JBCA 5CVUA 3SJMA 3B7MA 2RG4A 5JFRA 4U0WA 4HLXA 1J1LA 2DA2A 2VD7A 4BCUA 1PIV1 5E1ZB 4LHSA 3SITA 3ZSEA 3HOTA 4RM2A 2HQNA 3Q8AA 1T38A 4CHUA 2W85A 5C4WA 4HPKB 5I93A 2Y48A 5FROA 1W8ZA 5C3PA 4LEJA 5ABJC 2ZGPA 4AHZA 3O1UA 3J80Z 5JR3A 2RHPA 1K79A 5BYNA 4JK1X 2B9SA 4ES9A 3ZFGA 2A7AA 5FZ6A 3MO4A 2EXJA 1EYBA 1PGW1 4PI2A 4LT5A 1W28A 1SFPA 1YUDA 4IEJA 2W52A 1RVF2 2RS52 2WIIB 1JYNA 4CH7A 2W84A 3R60A 4LBOA 2VZUA 4HX7A 3LFIA 2DU9A 3WGIA 1XX5A 3NSTA 3GBGA 5FLIA 2FZ2A 5IYBJ 1SAXA 3VBHA 2F4MB 5FBJA 1ZHFA 3W6JB 4Q4Y1 4CCDA 1YIJI 3H0DA 4KWKA 5FUPA 3OIQA 2CRGA 1JYIA 2X6XA 4EJTA 3ABLH 2P3IA 4Q4W3 1SMTA 5LGTA 4JCKA 1U0JA 3R61A 2GNBA 5CPRB 3KSCA 3I2IA 4NWVA 3F22A 1WJDA 2PA7A 1NTCA 2VT3A 1KRIA 4COWA 1MS9A 4D8MA 4QM8A 2EIDA 1YFYA 2FCUA 2VOOA 4GMP1 1OT5A 3O1RA 1D0ZA 4SBVA 4Q4V3 1YJWI 4UVAA 5JVGF 2XRLA 2K02A 3BR1A 4UW6A 2WWUA 3FMQA 1VB4A 4EN9B 4CXFA 3HSEA 2W1SA 5C3RA 1REEA 3RSNA 2YDEA 4GYIA 2E1MC 5FZ4A 2B45X 4W6WA 2ZXHA 2HI3A 5DDJ1 5F7UA 1EUUA 1W8WA 5LBBA 2VW1A 4LO6B 1N3QA 3OSGA 1NCRC 5D5VB 2ADDA 1CAWA 2V4AA 3DPRA 3MUZ1 2E63A 1ZVFA 3CMGA 2EV0A 3U1KA 4B1RA 2DMTA 1QJX2 3NVCA 3CO6C 1DCSA 4BXUA 3ZYPA 1KYWA 2ZCWA 3SH3A 1Y9MA 4DQAA 1ALYA 4KBZA 3LA3A 2KMUA 1V6NA 4QMAA 2R5ZA 4A93J 1YQ6A 1SPPB 2VL8A 2M87A 1QH6A 2M45A 4L11A 3GALA 4NIIA 2IS2A 2PLV1 2DYSH 2LDUA 3Q3SA 3UETA 1QDOA 3MW2A 4QX3A 1QHGA 4YSFA 4XFIA 2K3PA 1U3EM 4KWUA 1HXDA 4CUGA 2XIGA 1K61A 4M3DA 4HN1A 2XAFA 2A6HF 2E35A 3C7HA 4E27A 5EFUA 5A70A 2OUHA 1LQ1A 2WA3A 2JKXA 1AR91 3LSJA 3HOYJ 1MQTA 1DGWX 4BQ3A 4A4AA 3VHOA 1YHFA 1BK0A 1C5IA 1O3RA 2OT7A 3QRFF 1KS4A 4PDWB 1IN8A 4M72A 1MBEA 3D82A 3NWSA 2HWC2 4M0HA 1P92A 3EUAA 1Y56A 2Y0OA 5A1AA 1WCUA 5GZCA 2X0LA 3VFZA 4NHXA 1R49A 1POV1 3LSPA 3HWJA 3MZHA 2OIIA 3KV5A 5FWEA 1B6AA 5CFDA 1EH8A 3WDXA 2SLIA 2RV8A 1K4TA 4JGYA 3ZQ7A 9ANTA 2ESNA 4LR4A 4FOQA 1AOYA 4YVSB 2WNVC 4IQPA 2JG8A 3ZM8A 2OQ6A 2PJPA 1C4RA 4UFIA 3UJQA 1NE6A 1H9GA 1LFBA 4A3GJ 1ZYBA 2MLGA 4G7HF 1GWMA 1XN7A 4IETA 3E6MA 1MBFA 3OGRA 2M8GX 2F4LA 2W91A 4IHWA 2AGSA 1M4WA 2ZXQA 2R7RA 1S0JA 4QXHA 1S6LA 1XSXA 4C9YA 1MZ6A 4EM2A 2V9KA 4IEZA 2Y64A 4ETSA 3PMSA 4R79A 2ZX3A 4NC7A 1Q1HA 1DP0A 1RUH1 1DU0A 3G3ZA 2CDOA 3T4VA 1JYCA 3W59A 3LA7A 5GAEJ 2JDAA 4Y1UA 3SLIA 4GWJA 2ZSHB 4CICA 4YFNF 5GZGA 2D3PA 3MUY1 5BNPC 2DPUA 4YGBA 1Z7LA 1HCRA 2MD5A 1O3SA 1WLCA 4LLGF 1VLNA 2V1NA 1NLQA 3FFZA 4CUAA 1D1AA 2DBNA 3NV1A 4AE2A 1FX5A 2V5DA 5EP9A 5DAWA 5M5XJ 2VKEA 2D1VA 3ACGA 4WVWA 3I55I 1BJQA 3RYPA 1TBXA 4IF4A 3KVAA 4IV3A 2O14A 4E7HA 4BQXA 1XJAA 2VZ3A 2VAUA 1LEAA 2UURA 5SV8A 4IL7A 1SLLA 4KUMA 2VUMJ 3HQXA 4AI2A 3H0GJ 1JHHA 4WXCA 4JTOA 3UK9A 1AF9A 4A0YA 2FBKA 3A22A 1U9NA 4GZ9A 2WAEA 4RA2A 4FTEA 3H1YA 3GTOJ 4UFMA 5ILUA 3KPHA 1MS3A 2IGOA 1R092 4MLOA 3TW7A 2JIJA 2XBO3 1LHNA 2JDZA 3DXUA 5J37A 1F4KA 3RRDA 5JLVA 4L5IA 4CP1A 2H6CA 1ZARA 4DXTA 2PQQA 4UB6C 1EH7A 2ZMEB 3WEZA 3CP8A 1XU2A 3BPXA 5J7MA 5IWFA 1WCSA 2GOMA 1W39A 2V1XA 4CXXA 2J42A 4PCQA 2ID4A 4B1LA 1COV2 3ZKYA 2R16A 4P9IA 4QPGA 4KI5M 1SC7A 2F5DA 3PNYA 3J8F3 4D0QA 3RGBA 3LNQA 2V9VA 1GWKA 1AKHA 2CJJA 5K8SA 1RUD1 3WF3A 4YGCA 2RDNA 1NG0A 3AJZA 2AS5F 4OCTA 1QRYA 1VBC1 3IMNA 1W2UA 3ELKA 3E1SA 3K4JA 1FBSA 2KPMA 5C4WB 2I07B 2CU5A 3DEWA 4CYCB 3CZ6A 5CADA 5BQTA 1QQIA 4A42A 1G6NA 5A33A 2GN3A 1LPQA 1T0FA 3VHRA 3FKJA 4Y13A 1QMJA 5IK5A 1IDZA 3SKVA 3ZFGB 2LBFA 1YITI 1TVGA 1D4VB 4J1XA 3KGZA 2EIBA 3WDVA 2ADUA 5FMDA 1JH5A 3HKZN 1ENQA 1C8M2 1TMF3 4N90A 4C3JJ 3KP2A 2O61A 3F8CA 4QPYA 5J1RA 1W0TA 3ZXFA 1Z7S2 4DEQA 4BQ2A 3D5LA 1FPN2 3OR1C 4U0YA 5LD2C 3VBHB 1CN1A 4EJOA 3RI9A 4LULA 3MI8A 4RL7A 3WT3A 1MZEA 3PSIA 1DQ5A 2QNKA 4Q1PA 1QY4A 1J7KA 2BNOA 2HBTA 5D2AA 2L01A 2N8GA 3WU1B 1RUC3 2BDRA 5FQ0A 4DMIA 4PQ9A 3WQ0A 4OQ8A 4UAPA 3PQJA 3N7JA 1NA1A 5LW9A 3WF2A 4AUXA 3BG6A 2GMEA 1S0EA 3ML6A 3TRSB 1QJY2 5F9TA 1PO21 3L7WA 2A6YA 1I6XA 3JRDA 2GM4A 1LDJA 3FBNB 5K7FA 4F83A 4RS5C 2Y75A 5HLGA 5ICEA 3BB6A 1VRH1 4YW2A 1GBGA 2QFEA 4UF0B 1QHHD 1KQRA 4QDQA 1QGPA 1XRUA 1SVMA 2VOVA 4ISRA 3FXKA 3DPRB 2R7TA 5D21A 4MGYE 4GCVA 3TL4X 4DGWB 2ZGOA 4N4NB 2KA3A 4N53A 2QTWB 2DMPA 3VD5A 4QIWN 2P4EA 4CA9A 1SG3A 3CTAA 3LEKA 4LBQD 5HV4A 2EICA 5FRAA 2ZS6B 2JX9A 2YY1A 3WUCA 2JIGA 2OQ7A 2B46X 5JPNB 3CF2A 1IUYA 2DDUA 1S55A 3OYGA 5FZCA 1B72A 1Y8QB 2ZAAA 4FSJA 4HL0A 5E18F 3SXYA 5KXEA 3W20A 2Q0OA 3IC7A 2DF7A 1VQ7I 5CJ9A 4XRMA 2A07F 3MLJA 2WO1A 4XLHA 1WJAA 1P7JA 3S3MA 5B3SH 3BG5A 2DVFA 1QJU3 3S14J 3JZVA 3MKYB 1W0NA 5EJZB 3NMBA 3HT2A 3OYLA 1LUJB 3Q8EA 4UW4A 4BYYA 2GC1A 2XAQA 5J47A 3CESA 5T50A 4YW3A 5L3DA 2DOEA 3OUJA 1GP5A 4NUBA 3ZSJA 1SD7A 3DTIA 4NB5A 1R1A3 4NDLA 2HWE3 3DPUA 3QQAA 3OBZA 1QQP1 2STWA 2RQQA 4A3FJ 5EJ1B 2ARBA 1WKMA 3EJKA 1QU3A 1DLLA 5FYUA 2VQAA 3WNLA 4LFUA 4NBQA 4KMFA 4B4QA 3HBKA 4E2QA 4BACA 4HNTA 1EF4A 4XBQA 1AXKA 3IT8A 2CUZA 3WU2C 1HB2A 5HXVA 1E17A 3KT4A 4ZTFA 5HCFA 2CDPA 5H2FC 3V0BA 4HSLA 4AVPA 3RFRA 2HWB3 1Q8PA 2TUNA 4L18B 2W08A 4NOTA 3MQ0A 3POEA 3K75B 4LB5A 4YNIA 1MBGA 5DUKA 5DQ0A 2RE9A 4TXWA 4EQVA 2Y8KA 2G7UA 2QQIA 4CEYB 4Z6YA 3REOA 4KBBA 1X2MA 1AL21 4XC9A 2EZIA 3KP6A 4BJ0A 4CDXA 4CU6A 2ZEYA 2WTEA 3I54A 1N78A 1O5UA 1R5GA 2LR8A 1UU4A 2BFUL 3IZOA 4KNYA 4FPCA 1ULDA 4KU8A 3CCYA 4HKOA 2C1FA 1I3QJ 3BCBA 1BBYA 4CDWC 2R073 5BXXA 1E0EA 4OI0A 5GTIC 3ZKUA 4HDVA 3NV3A 4FTHA 1DDNA 2X6OA 4FQZA 2QGUA 1RMU3 3HRTA 3OYIA 1LGCA 1SDWA 2HWVA 1E3PA 2KT0A 1IQDC 4MGQA 4LIVA 5D8AC 1VBE3 5IK4A 5E3LA 2ZGKA 3C8XA 2NVUB 1AYM1 2JDMA 2A3YA 4FETA 3I58A 4OHVA 4BQWA 2DU1A 3U37A 1OVPA 3N9PA 3BTJA 2JG9C 3HKZA 2PHXA 1OYWA 2RREA 3LAJA 2J1VA 3W21A 1IDYA 4LB6B 5FYSA 1R36A 1T95A 4GKXA 2ZX1A 4OIQF 1JE8A 3WTTC 1NZCA 3D8CA 2PN5A 1N25A 5C8CA 2Z5WA 2A3XA 2GNTA 1SFEA 4I02A 2NYXA 4M3CA 4P96A 2AHQA 4S2HA 4PCRA 2JPCA 1FZPB 4Q4W2 4DUVA 1HIXA 3WG3A 1PJRA 5AONA 4KGGA 1F2NA 3K0LA 4K21A 2VBZA 2OQRA 3HAGA 4RQPA 3W3CA 4WV8A 4E8CA 2PMZN 2H0VA 1ZTRA 5JSRA 1MS1A 1WCKA 2ACJA 5FOBB 1FIPA 3RJPA 3FM3A 5B1AH 2JRTA 2AYHA 2NAZA 5F0FA 3KLOA 2ZHMA 4LBLA 1HSTA 4H7MA 2MBFA 3GTQJ 3VPRA 3LSTA 5LASA 4IEOA 3WNPA 1XE7A 1DQ1A 4MV2A 2D45A 1IG3A 2HKXA 3P1IA 1CGPA 1KFXL 5FLXK 3OPTA 1OLTA 3ZOBA 2P5KA 3AJYA 3B9IA 3CCQI 1NY72 1AKHB 5JDBA 1Q8VA 1R1VA 2LF8A 3ZGKA 2QA4I 4GDFA 5FY1A 3C7EA 3O1TA 3HSRA 4EWAA 2YC4A 1E3OC 5JVVA 4TYSA 2VOTA 3LZZA 4A0XA 2NMNA 1QJX1 3A02A 4H4KC 5E8AA 1BVP1 1JS9A 1RITA 2EXKA 2IUWA 4RAZA 3WW4A 1OQ1A 2L54A 3GZ6A 4AAXA 5A33B 3AYEA 3K4MA 3VDXA 2WZR3 1VR3A 4OIOF 2LBFB 3HHHA 1PNGA 4OAZA 5BNOC 4XETA 3POYA 2GMMA 1CZSA 1K3IA 2WAQN 2ZC2A 1GFF2 1VBD1 4MSVA 3K1NA 3NJYA 1S29A 2QQ9A 3ST7A 4XDOA 3I3EA 1I3AA 3RKWA 5ICCA 3RWKX 2RNGA 1OURA 2OF7A 3ERED 1IN6A 4G9SB 3MV11 4BK5A 4YFKF 4RBOA 1N1SA 1XC5A 4PSWA 3VBOA 1Y9QA 5FFZA 2Q1MA 1HLVA 5LEJA 2QSFX 3CEWA 2K9ZA 2X29A 3N7LA 3H3VK 3LDRA 3IP4B 2WN2A 4QPIA 1QEXA 2JVHA 4D7YA 4J01A 1ERDA 5FQ0B 5IOYA 2DA6A 4BQ1A 1D0YA 1XCVA 2PEXA 3VHPA 3TBDA 1FAYA 4HT1T 1VQ4I 1ZAOA 1JTYA 2MC3A 2Q0AA 3BR3A 1NA1B 1KQ0A 4MFEA 2IVMA 5A2QZ 2MH9A 3KEQA 4LHNA 3C1DA 2VUAA 2Y6HA 1LOFC 1YJ9I 1SDDB 5FZ1A 2TEPA 3LSDA 2OCCH 4HONA 1HV1A 1D0HA 1MS5A 1OSGA 2FDGA 2GC2A 1WD4A 1SMVA 5F08A 1GHCA 2QVOA 3TBIA 4O9EA 1CAUA 4PJ0C 2I2SA 3O1VA 2Z79A 4B7KA 3I2KA 1LECA 1JODA 4OI1A 2FQPA 4XLAA 4BE3A 1AL0G 1N77A 3ZR5A 3DBHB 1Z9CA 5FPVA 3C7FA 4FE4A 3V42A 1YYNA 2MD0A 2X5IA 1X8MA 4P5OA 1CX1A 2RDRA 4X6RB 1SLTA 1NCQB 4FX0A 1W5SA 5J3LA 3T5XA 3HDDA 1IRXA 1PMHX 4B3XA 3AP7A 5CIRA 1B72B 4PJJA 1NE4A 1WLTA 2LP0A 3APBA 3V8JA 1OKRA 3M07A 1MMSA 2CU7A 4ZC3A 4PFPA 1W6MA 2K27A 1WW7A 5B1BH 1O4ZA 2D7FA 2JDUA 4COYA 2CFOA 3TEXA 2X48A 4JGZA 4RAFA 1GLNA 3BLYA 2LKXA 2XSJC 1JMUB 5ACA3 2YS9A 4IESA 1IPSA 3R05A 5GKAC 3ZN0A 5J48A 3CUQA 1C5HA 4EN0A 4XTMA 4UUVA 3MLLA 3O1MA 3FM5A 1P8JA 2HYJA 1OKOA 4RFT0 3I0TA 3PL8A 2OCEA 3LDKA 2D5VA 4EGYA 4DINB 1LR5A 4OYUA 3PDQA 2KIMA 3FHZA 4R9CA 4X8PA 3CDIA 2PAEA 3S57A 2BZTA 3ZMTA 3MPBA 3R4DB 5JZGC 3KEOA 3ZQGA 3T2QA 1UMHA 2A3SA 3E6BA 1WUVA 4OHYA 3CMMA 4IE0A 4O5VA 4GIQA 4FE7A 2XBO2 3V0BB 1ZG3A 3MN2A 3W6VA 1QF3A 4AQSA 4XUQA 1CQ9A 4BU2A 5FD6A 1V70A 4G6QA 4M9XA 2MHFA 4M9SA 4L9TA 4M3CF 3SZTA 1PIV3 1YX3A 4II2A 2A6WA 3CCEI 3WF1A 4LOTA 3EXUA 4YZ5A 1Z05A 4BQ5A 1ZZCA 4CDXB 1H8TA 1MEC1 2DCTA 5GLTA 3TNQA 4FPJA 4QDSA 2Y9ZA 3HOXJ 1WWYA 2E71A 3GO5A 2ZO4A 3BYWA 3ZIXA 2ME0A 4IEPA 5ED4A 5GLVA 1W0PA 4F8AA 2KP6A 4YLZA 2P3KA 4IZZA 2F4IA 2R1DA 3TO6A 1XGNA 3PU3A 2WZEA 4BL0B 5JXJA 2WB1N 2VGDA 1OCPA 4A5MA 2E34A 4DS0A 3ZMUA 1IG7A 5M0TA 2B8MA 2VUDA 2YPJA 1NYWA 2QF7A 3PIOF 4CU7A 3D3AA 5BUVA 4LG3A 2BW3A 3HOZJ 4YW1A 2OA4A 2WO7A 3VBUC 4JRLA 2JMWA 1OUXA 4ZYAA 3M8EA 1GVJA 3VB9A 1W8NA 3BUCA 4Q4Y3 1I39A 2E53A 3M70A 2WAQA 2HDDA 4JX5A 3LQCA 2OTLI 2K86A 4MNUA 4RB3C 1PNFA 4C3IJ 1MSEC 5JR7B 3SH5A 4LMFA 2DQRA 1WBFA 2W46A 5A3WA 3ZFEC 1H1MA 5T5LA 3CLQA 1DP3A 3HSFA 2NVQJ 4RA0A 4JX0A 1M06G 2ZGLA 1MNDA 4M3CB 5B5EC 1I1EA 3X29B 4GMP3 4ASNA 4RMNA 4XF0A 4P9FA 3EO6A 5DUUA 2Y0SN 5IOZA 5M5WJ 1TT0A 4A6EA 2ZX2A 3A01A 2P81A 4AFDA 4RQPB 1DPUA 1E5RA 1XSRA 3POWA 2ZEXA 5TISC 2ZGNA 1V5EA 2DMUA 1ZX5A 1W1WE 3Q9OA 3AYDA 3UT0A 1QJFA 1WCQA 2IGNA 5KWRA 3OTFA 1JZ6A 3AG1H 2QZ8A 2GXAA 4QQPA 1N75A 3V0AA 1E3HA 4QSHA 4M6YA 2EFOA 2VL4A 1G8XA 1R23A 2FDHA 1B59A 2M4GA 2Z1DA 4MIMA 3K4DA 3SCGA 3RI8A 3JSOA 5FYVA 2PX9A 3DCFA 4H55A 4A41A 2EFQA 2GXGA 2K5CA 2VKDA 1LEDA 2NS7A 3V56A 3RI4A 3GW2A 3E6CC 2P8TA 2M30A 3HPGA 2ELJA 2CV2A 1GV9A 3RZKA 5DYMA 1OD3A 3B94A 2PLV3 5FKKA 3F95A 5L7OB 1TNFA 3JCUC 1R083 4A6SA 4BZ4A 3RZMA 3S2WA 1UX7A 5IVBA 1WJCA 1GQHA 4RGGA 4GULA 2DVDA 2JEMA 4ABZA 3A2KA 5F04A 4C1XA 1Y0UA 3PNTA 5IVJA 1XPWA 1JUSA 1AR93 3W58A 4L5EA 5FPUA 4WVZA 3VDDA 4XKWA 4EMSA 2BVVA 3HUGA 1XGSA 2R93J 5FPAA 1QJU2 2CUFA 3ETPA 4JDNA 3RCOA 4CUBA 1HLCA 3TP3A 1GXPA 3P5JA 3VBOB 1BEV2 2Y0IA 3L00A 4XAEA 4UV9A 3V8LA 4I3GA 2VASA 3JB4C 1POV3 3ZPLA 1PP8F 3WXPA 2E7TA 4XN3A 4IL6C 1OCTC 4GFBA 2C9KA 2D3RA 3FISA 2JWTA 5JOYA 1D2SA 1UMQA 2H0BA 2HWE2 4QPIB 2DFHA 4AEDC 4FTBA 1TME1 3JRCA 2Y33A 3H1WA 3ZYGA 2P3JA 3S2HJ 1MJBA 2DT7B 4M73A 4C2TA 3LQQA 2LD5A 2UZKA 1NX9A 1HDDC 1IRFA 3ZR6A 1B8IA 2L2OA 1J0RA 2LF7A 3VYUB 1HW2A 2NP0A 1JKOC 2EXHA 1YCIA 1YRZA 4EJVA 3DF0A 3E5XA 1SBFA 4M6VA 1S0GA 4Y5TA 4NIDA 3PUHA 4WVVA 1OPMA 1XYNA 4ANJA 2OZUA 2EF6A 2XPVA 1CAUB 3LIHA 3DYPA 4AIDA 4LA3A 1MJAA 5A1FA 3FE5A 1XNTA 3K4LA 2ZMNA 1BOAA 1RUH3 2WNUA 3J7ZI 2JA8J 3A23A 1SANA 5F64A 3NNMA 1UQXA 4XSZF 4AVAA 1QKQA 2GA1A 3AKQA 1S0CA 4HN0A 1ONVA 4H14A 5E8GA 1VAKA 4FXGB 2R072 1VE0A 1DP7P 1CIYA 3HVDA 1SLIA 5BPIA 4C1WA 4DRVA 1RHI1 2ADEA 4Q5SF 4IEXA 4EGZA 1APNA 4Q4ZF 1FV2A 4CEWC 3I5UA 1HQCA 4XILA 4E7KA 4AOCA 2WB1A 1QJZA 4CDQC 1RMU2 1W6MB 2TDXA 4QD2A 3S7EA 2CGOA 2YU2A 4XN0A 1XCBA 2BU9A 1YLFA 4L99A 4H3WA 2VI6A 4D94A 3VBFA 1GR3A 3KB5A 2L5QA 1MSFC 1B9NA 2OU2A 1DGLA 3CUQB 3HTUA 2XONA 3L2RA 4CCKA 1D2QA 5J4YA 4C2UA 3WTWC 5FO7B 3PHMA 1AA7A 2E7AA 2BHYA 3MKWB 3AMPA 1HRI2 4W1UA 4M3CE 4Q47A 3VV1A 4OULA 5LA2A 4QX1A 3J81Z 4AVBA 2HDCA 1W7PA 3JRBA 2NVYJ 1J2XA 3MHZA 3FLPA 1ZRFA 2VC9A 1ODMA 1OCRH 4LKDA 1YFHA 5FGMA 5C33A 2P6CA 2HGCA 4Q4X3 2HXIA 4QX2A 1ZBE2 3OYHA 3FX3A 3NAUA 2XLAA 1W5TA 3PTRB 2VQLA 3H8RA 2WUHA 3N7KA 4AFCA 4CP9A 1BC7C 3FXLA 2XSDC 2Y0SA 2WN3A 2ZZQA 5FUNA 1NOVA 2GIVA 1V9U1 2J1AA 1K12A 2BGOA 2A3WA 2NVTJ 5IATA 2R7FA 4QKFA 1JYWA 4WM8C 3KV6A 2XL9A 3KM5A 4BH9A 4UBGA 2X1EA 2A1XA 5FXVA 2QEXI 4UXNA 1SVLA 3HB9A 2ICWG 1NHAA 3O1PA 4MEXF 1HKQA 4FPOB 1VBC3 3ZCOA 4IO9F 1H8TB 3N4MA 3UL2A 3DBLB 3L2YA 4RYDA 3NQOA 2BXZA 1JI8A 3IAS2 1TQMA 3I4MJ 2PLYA 3WCRA 3ZMOA 3JAMK 3CZUA 2L4AA 2LYCA 1IS3A 2DCYA 2XGCA 2JPBA 1QO0D 3HT1A 4EN6B 2L3DA 3VBRB