3H3UA

Crystal structure of crp (camp receptor protein) from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
216
Chain Sequence
b'DEILARAGIFQGAIAALTQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
publication title Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 61
structure length 216
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3uA01
4AVCA 3RYRA 1HW5A 4HDVA 5JSRA 5KHGA 4FX4A 1QO0D 2ZCWA 2JRTA 2YSRA 3J81K 4AIJA 4HDUA 3EHKA 3KZZA 4P9UA 2JTVA 3NEUA 3F8NA 2IA0A 5BS6A 4ZU7A 2ZMEB 3OF1A 2EVXA 1ZRRA 3BDDA 5HDGA 4WX9A 1RUNA 3FM3A 4XETA 1U12A 1CF7B 5I8YA 3TO7A 1NZCA 1O7FA 5KK1A 4I2OA 2TDXA 5AVPA 1DPRA 1V70A 1HSJA 2W84A 3T0YA 4MH0E 3RDIA 1J3RA 3IRQA 4MEYF 4JTNA 3L09A 3LWFA 1QXJA 3HHGA 4CHUA 4LLOA 2BNOA 2FE3A 3QRFF 1RC6A 4I7HA 3T1BA 5LEKA 2XLFA 3UKTA 3H7JA 4IEVA 1S29A 2J5PA 2K4JA 3WTTC 5KHJA 1K6OA 1RUOA 4MZUA 2LF7A 4KFCA 3ISPA 1UPIA 4Q0VA 1P4WA 1EP0A 3LOIA 3HTSB 3ZN0A 2KIFA 1YG2A 2HDCA 3T8RA 4EJOA 1Z6TA 2BYVE 1NYWA 3U10A 2GXBA 2AXLA 5C8WA 1MJ9A 3RNSA 4D0PA 2RQPA 1EH7A 4L9NA 3H9AA 2A07F 4XLPF 1FLIA 1UHWA 3WTVC 3S0MA 1KU3A 1R23A 3QPHA 4M9ZA 5LEJA 2GA2A 3I4PA 2CYYA 5HVQC 1J1LA 2STWA 3HRTA 4RB3C 4YSFA 4EGYA 3RKWA 3WTZA 2V6CA 1IN8A 3LQRA 2ZKLA 4E2QA 1LDKB 2VN2A 4G6DA 1CAWB 4ETSA 3WE3A 1IXCA 3JSPA 2FU4A 2QVOA 3Q5FA 2IXKA 1CAUA 3HQXA 5HLHA 1F5TA 2HOEA 5JCTA 2L01A 2Q4SA 2QCSB 4EVIA 3RPQA 1FYMA 3LSTA 1ZZ8A 2FSWA 3QP5A 4RAZA 2EK5A 1SMTA 2XGXA 4AQ6A 5E8GA 4IETA 1HKSA 1REPC 2EV6A 3VODA 5HLGA 1W7PD 1KU2A 3RTRA 1G3SA 3SCHA 3VOEA 1C0WA 2HFHA 1P4AA 4DNCA 2V79A 4A0XA 2PA7A 2GC2A 1Z7UA 4N0BA 5JAXA 3MPBA 1J75A 1QXRA 4YG2F 3SMHA 1EY2A 3IHUA 2LNBA 1NE4A 2GAUA 3SFZA 2ET7A 2K86A 5E20A 3K1PA 3QPTA 3SQNA 2W85A 4ONUA 2K27A 4KIGA 1F1ZA 5E8IA 2ATFA 4P9GA 3HRSA 3ECHA 3GEZA 5EZWA 4M71A 4XSZF 2Z99A 1XCVA 2QUFA 1ODDA 1D3YA 5LBQA 1CAXA 3D0JA 2QLZA 3OTFA 4JBAA 2CV6A 3C7JA 2HTJA 1H1MA 1IN7A 5CADA 2PQ8A 1J3QA 4EM1A 3ST7A 2Z9OA 4XFAA 1B6AA 5L3CA 3FHIB 5I0RA 1U2WA 1IZ1A 3TNQA 2E1NA 1I1GA 1ULYA 1LKNA 1UCXA 4IPAA 3FHZA 3M70A 4EJUA 1IXRC 1BI2A 3TOBA 4ZU4A 5E1XA 5FDBA 5D4RA 1FXZA 2DI3A 5DCMB 3TOAA 4ENNA 1U6GA 1OYYA 4LFUA 1ZG3A 2HTSA 4OU0A 2VOPA 1CAVB 1LEAA 3NKTA 2JPCA 2K4BA 2QDRA 2CO5A 3WGIA 1U5TB 2PFWA 3GYDA 4HSJA 5CJ9A 3EYIA 2QNKA 2EFWA 4WCGA 4MQVA 3NVCA 1X82A 4A6EA 3TO9A 1TQ5A 4IESA 4XFHA 5FLHA 4K2EA 1YS6A 2D5HA 2X4HA 4OIQF 4AIKA 4CDGA 2MA3A 1XSVA 1X3UA 3KEOA 4QGNA 5DDGA 1WGPA 3OV8A 4E2GA 1X8EA 1OYWA 3L2CA 1UW8A 1SD7A 3TQNA 4L5IA 1YQAA 2P6SA 2PEXA 1SFEA 4ZZDA 4HN0A 1I27A 2MNGA 2M87A 1T98A 1OKRA 2L4AA 5ICFA 3KEQA 4CICA 2CWEA 4N9IA 2EA2A 1O5UA 1HSTA 2E7XA 4CZZA 2XUBA 1FP1D 3C3WA 3WGGA 4IEQA 4TLFA 3DV8A 4KYWA 3RKXA 4FAHA 1FPQA 3F22A 1FZPB 1XGOA 5H20A 2DPUA 4OOIA 3N4MA 2FEZA 3F6OA 4AXOA 4LK0F 3E6MA 2HEOA 2FQPA 1ZRFA 4IEWA 3E5QA 3KCCA 3ZN1A 3UKVA 1J5YA 4BAYA 2R7FA 2W25A 4Z82A 3OOPA 3SHFA 2VBZA 1KU9A 2FNPA 2V1XA 1E2XA 3IWZA 3HSRA 2DFIA 3R0JA 2OQGA 4ENJA 4MGIE 1STZA 4IEPA 1TLHB 5FFZA 2ETEA 4Q0QA 4OIPF 1ZZBA 4KWJA 4D7TA 2Z33A 4ENKA 1SQ4A 2VE9A 2BNNA 3GBFA 3EETA 1U5TA 1RI7A 1LDJA 5CYVA 3BROA 4Z2YA 1S8NA 5AIPA 1DGRA 2FRHA 4YFXF 3EBRA 3SCGA 1ZLKA 3H3ZA 4YFKF 4HBNA 2VC0A 3COAC 4EM0B 4ZYDA 3KLNA 2D45A 1D5VA 5BV6A 2CGPA 1GHCA 2RDPA 4A2UA 5FGMA 4Q47A 2DTRA 5D1IA 5H6RA 4I02A 3SHRA 2OZUA 5LLQA 2QENA 4Q48A 3E6DA 1SD6A 3L00A 1F9NA 2P8TA 2GC3A 3K0LA 4U0VA 2UYBA 3TGNA 5HS9A 1T2KA 1ZH5A 2L3DA 1R5GA 3KP3A 3L7WA 1W5SA 2FA5A 2XV4S 2H0VA 3G7DA 4MV2A 5E1RA 2BV6A 4YYOA 4FBFA 3DPLC 3PNAA 2PI0A 3WE2A 1P6RA 2PTMA 1FP2A 2BGCA 4CGZA 3I53A 3EQLF 1W4MA 1TW2A 2OPKA 3F8BA 2NS0A 1D8JA 5HOOA 5CVUA 2FBKA 1Q43A 2UY9A 2PAEA 4I0BA 1YLFA 3D5LA 4G6QA 4U7DA 4XFBA 2DCTA 1QGPA 4LD5A 1EH6A 5ILVA 1NHAA 3WU0A 3CUQA 4XF3A 2NRAC 2IC1A 5CLSA 2Q0OA 3ZMZA 4META 1IN4A 1ZVFA 4RD7A 3RYKA 1TNTA 3WTYC 1V3FA 1B4AA 1MZBA 1XE7A 2IP2A 3MZYA 4PZJA 4Q4ZF 2ZKZA 5L3EA 3P9CA 1DGWA 5DUKA 3HSEA 4A5MA 4UXAA 1U5TC 3F8FA 3V8LA 1GXQA 1ZX5A 3BPVA 1RIOH 3WTXC 1LNWA 1J0RA 1YW8A 3ZMVA 4XFIA 2GIVA 4HZFA 2XKOA 1VP6A 1GQHA 1Y9QA 2DW4A 1YS7A 4RGUA 4UVAA 1BI3A 3QOPA 3CF6E 3J7AO 1Y0UA 2FBIA 3B73A 3IKTA 4ESFA 3M3IA 3F72A 4YIIA 3TO6A 5FLIA 1YW7A 3LAJA 3G73A 4L0YB 3VEPA 1TW3A 1R36A 3QP6A 3I5UA 2VE8A 5BPIA 2NNNA 5CVVA 5D8LB 2XASA 3CJNA 2K7LA 2HWVA 4BIFA 4P5OA 4UUVA 3WW1A 2P17A 1R7JA 1ZZCA 1CAUB 3KP5A 2V09A 3EO6A 3IKVA 3U1DA 1MJBA 1XSXA 2Q0AA 3CLPA 1OD5A 1K78A 2PN6A 4TV7A 4HN1A 1DZTA 4AIHA 5E1WA 2XAFA 3JZVA 2G7HA 5CVRA 1IRFA 4ASNA 1R5HA 4JTOA 2A61A 2G9WA 1W5TA 2GH2A 4ESJA 2QWWA 3GXOA 3C1DA 4I0AA 1YYVA 4QMAA 4RB2C 5LRSA 2B0LA 5FPZA 5EEHA 1F4KA 4HW0A 2JZYA 4ZU5A 2ADUA 3KSCA 3F21A 4L9JA 4EGZA 1Y3TA 2B5HA 4IEYA 4WZCA 2HR3A 3IDBB 1G3WA 4KMUX 4YFNF 3F3XA 5EFUA 5F64A 2OZJA 4XSXF 1S7OA 2EV5A 1FYLA 1JHFA 2RC4A 4N9HA 1ZLJA 3OD0A 4MHGA 1R58A 1CAXB 3BU7A 3ZMDA 1R22A 4IHSA 3KP4A 2HYFA 3D82A 1YWKA 3ZQ7A 1E17A 2ELHA 1ZZ7A 2V1DA 3E5XA 3FJSA 1O3RA 2XL7A 1MGTA 1FC3A 2H6CA 2UZKA 3DKWA 3H8UA 2XAHA 4UVBA 1J59A 4IVNA 3DXJF 5L3BA 3C18A 5FCCA 2Q2EA 1GQGA 1O3QA 2QQBA 1UIKA 3RYPA 3EJKA 2HYGD 3SZPA 2B8MA 5BQTA 4DQ2A 4KU8A 2RV8A 2V1UA 3MCZA 5BPDA 4L11A 3V4GA 5FLXZ 2G7UA 4KDPA 5L3FA 1LRHA 3JTGA 2F2EA 1ZAOA 4KWLA 3P9IA 5JI6A 3E6BA 4LUKA 2FXAA 4U0WA 2HKOA 2CG4A 4HAMA 3QACA 1AOYA 3CO2A 3JTHA 3R60A 4AQ2A 1G6NA 4QGMA 1IF1A 2LSOA 4KUMA 4FHTA 3VFZA 5KHKA 2GZWA 3KGLA 2JPBA 4IF4A 4KN4X 5ICCA 4KIFA 3FXUA 3IBMA 4G7HF 3LA2A 1OR7A 3NRVA 4QM8A 1WKMA 3TDUC 2GC0A 2M1BA 3S7EA 5LGUA 2FMLA 1B9MA 4IERA 2NNYA 3GVAA 1FY7A 2ZFWA 1ZREA 4O5VA 2FF4A 2EAAA 2H27A 5LHGA 2ZO4A 3K1MA 4Q0SA 4AVBA 3M7GA 3FXQA 5D5XB 4KNYA 4L18B 5L3GA 2O1QA 1LVAA 2VODA 3DF8A 5J48A 4M6XA 3VB2A 3BZ6A 1EV7A 1BC8C 2RKHA 2PAKA 2ZJ2A 1MDMA 2IW5A 1PP7U 2WV0A 4A5NA 2K9ZA 1RGSA 4LMYA 5K1YA 1TQPA 1H0MA 5D8KB 4LA3A 2IA2A 3E6CC 3K1NA 4LUMA 3HRMA 1S7AA 1FOKA 3LA7A 4YRDA 3ES4A 2DQLA 1O4TA 4HLTA 5I0UA 3LA3A 5D5VB 1WLTA 4UBGA 1KQ9A 3KE2A 4PGGA 3W6KB 1WSUA 3H92A 1ZRDA 3T5XA 4WF2A 2P6TA 2JSCA 1YFYA 2LDUA 1CX4A 1T6SA 1K79A 4IEXA 1Z05A 2CAVA 4ZYHA 3FX3A 1ZG5A 3GZ6A 3WTSC 3SZTA 1H1IA 1J7KA 2DK5A 4S05A 2Z5UA 1SD4A 1XCBA 1J58A 2GA1A 2QBYA 1Z91A 4OIOF 2VPVA 4Y17A 2UXNA 4KWKA 3GW2A 4M6YA 2LF8A 3I7DA 3GWZA 3WU1B 4KICA 3NW4A 2HKXA 3HUGA 1YO5C 1Z1DA 5E1ZB 4EMSA 4DINB 1Z6RA 4HX7A 1UHMA 1W7PA 4ZZLA 1KA8A 3OCPA 2L4MA 2PLYA 3GO5A 4XFFA 2KKOA 4I98B 3M8FA 6PAXA 3CUOA 1QZYA 2XAJA 3QU6A 2VECA 1WRJA 5FD6A 1BIAA 1O5LA 2MH2A 2E7WA 1TBXA 4PGHA 2IJLA 1LR5A 3BCWA 2OA2A 1J9IA 3HOTA 2IXLA 3HHHA 1CGPA 1XRUA 3JSOA 2Y0OA 2X0LA 2RNJA 2FBHA 3MYXA 4R1HA 1RL3A 5I91A 1FBSA 1ZYRF 2P4WA 1ON1A 3B02A 4L9TA 1JGSA 1SAXA 2IPQX 3BWGA 3GF2A 3CO6C 2MPFA 1EH8A 5AONA 1LB2A 1XGMA 4L2NA 4QXKA 3BY6A 4R8HA 3LQQA 2YU3A 3F8MA 5K5RA 5J7MA 4Y13A 4OFGA 3CUQB 3USSA 3U11A 2RVCA 3C3VA 3NJZA 1MKMA 2DLLA 2A3SA 3R61A 3U9GA 3FMSA 4S04A 4LGWA 1XB4A 3S7IA 5K5OA 2XLAA 2BBYA 1KU7A 2COMA 1USTA 2ISYA 2LKPA 4X6RB 1QPMA 1DPUA 5J6XA 2OAZA 1IAWA 2IA1A 1U3EM 3BJAA 4PIXA 4GYGA 3BP8A 3VHRA 4LG0B 2QVSB 3WTWC 1BBYA 2XLGA 2EFQA 2CAUA 3T8TA 2J5OA 4G7ZF 3ZMSA 3ELNA 3JW4A 3ZMTA 3HSFA 5E16A 2IRFG 5LGNA 1TNSA 4Q0PA 5HS7A 3L2HA 4X6QB 2O6GE 2VOOA 2KJCA 2XRNA 2ZBKA 3KP6A 3KP2A 2XAQA 4ORFA 3MEXA 5J8CA 3FZVA 1IPJA 1SFNA 3V8JA 3R0AA 2XHKA 4KIBA 2FOKA 4HX4A 4L9VA 1X8MA 4O3MA 3FWEA 3GLXA 1DDNA 2RN7A 2GWRA 4G8XA 1J2XA 5DD4A 2D40A 3CO7C 2D93A 2IT0A 4HA8A 3WW3A 4LEJA 1QNTA 2K02A 1H9GA 4R52A 3RKYA 4RGXA 1YUDA 4HF2A 2ESNA 1SFXA 2DAOA 2PQQA 3M9AA 3MAJA 4MQ9F 1ZN2A 3LAPA 1XE8A 3P7NA 4LB5A 4MGKE 5FO5A 5ERIA 4HBLA 4UVCA 4YIFA 4UNOA 3ABUA 1K78B 4ZYGA 2ZXJA 5HDKA 2PJPA 2OU2A 4MTEA 4HVOA 4B8XA 4Z07A 4HQEA 1DP7P 5JR7B 1ZGAA 1QWRA 1FBUA 5DV5A 3FZ3A 2A69F 3DQVC 5K8SA 4OMYA 3EYYA 4Y15A 3FE5A 1O3SA 4HVQA 4LTAA 3BJ6A 4RGSA 2H09A 2Q8KA 4PJYA 3M1EA 3CLOA 3H1WA 4KA4A 3ZPLA 1YFXA 3PLQA 4A12A 1QBJA 2QYOA 2GQQA 3BOQA 1KGSA 4XFGA 1YW9A 1PP8F 1HKQA 1XMKA 2EFOA 1IW7F 1XGSA 3I54A 4UV9A 4XLNF 3NL1A 4LG0A 3KGZA 2EFPA 2P7CB 2PHDA 3K9TA 2O0YA 1T0FA 2XKPA 4QM9A 3F8CA 4JK1X 3DP7A 1KQ0A 4LLGF 4BXUA 5E17F 1O7LA 4IJAA 1FBQA 3KLOA 5FLJA 1YFHA 4IEZA 5HDNA 3JAMK 2QQ9A 3HYIA 4O9EA 4MGZE 1USSA 1IN6A 4EQQA 3TKYA 1UB9A 4XEZA 1NE6A 4JQFA 2M45A 3MZHA 3MDPA 3O2PE 4LJZF 4P96A 2VQAA 2FQ3A 3RZZA 1IRGA 2QQAA 5JSOA 3R4KA 4QWQA 1SMYF 5LHHA 4MGYE 2KIMA 1FYKA 4G7OF 2VT2A 1UFMA 1YTYA 4ZYEA 1QZZA 2W57A 3PVBB 3ZDSA 1UD1A 5BXXA 2CQKA 1O57A 3MWMA 4HV6A 1I1SA 1MJAA 5FFXA 4LB6B 3FFQA 1D8KA 4HVRA 5HI0A 4HSLA 2Y75A 5D4SA 2Z69A 4GXOA 5DEQA 1WWXA 3H1MA 2UYAA 2OA4A 3MQ0A 1X7NA 5FLXK 4E70A 5BY5A 2NAZA 2PAMA 3I59B 4PIZA 3LZZA 3CUQC 4LLLA 4XF0A 4EM2A 5LGTA 2OYZA 3LAGA 2O8XA 4ON0A 2Y0MA 3FM5A 3G3ZA 1XDSA 3TNPB 4IEUA 1FI2A 5IT9K 3PQJA 3RI4A 3SXWA 3BALA 3JAMZ 4LULA 1TQIA 2F5CA 1MDMB 1R1VA 4KU7A 1BIBA 1GVJA 2OZ6A 4UV8A 1A04A 2MD5A 3RPUA 4F7ZA 4RGRA 4BHPA 3K69A 3WGHA 5KHHA 3BPZA 4GULA 2PBIA 3PQKA 2EFNA 5HLIA 4FAGA 5AIQA 1YIOA 4BH9A 2O8QA 2M5WA 2YR2A 5I93A 5DD8A 1J3PA 2P5LC 4G94A 4IXAA 5A2QK 1L3LA 2RGVA 3CEWA 2CW0F 5ILSA 1ZG1A 1PM7A 5J8FA 1NXMA 4M72A 4PIYA 4IRHA 1LDDA 2XVCA 1Q5OA 3BPXA 4CYDA 4HLYA 3DFGA 2EWNA 3CTAA 5D6EA 3ML6A 4WBBA 3GUDA 2R7DA 4IHTA 1IXSB 3J81Z 2DBBA 1ONVA 2O61A 2QBYB 4HX8A 3K2ZA 3O3KA 2QM3A 4P55A 3HOSA 3LFKA 3ABTA 1IUYA 3GYHX 4A6DA 1S3JA 5CVIA 5DUIA 3E5UA 5D5WB 2IXHA 5KVRA 4EJTA 4NHJA 3Q9SA 3I71A 3HIFA 3DL3A 4CO8A 4AD9A 5IT9Z 1W7PB 5D6FA 2MHFA 1YHFA 1B59A 1ZARA 3M8EA 1R00A 5L3DA 3E3VA 3I59A 2AS5F 1I5ZA 4M74A 3WW2A 1Q1HA 3ROUA 5J3UA 2MBFA 4RB0A 2ZMEA 1TQMA 4HLXA 2P5VA 4HQMA 2GXGA 1OPCA 4EV0A 4QGLA 3WW4A 1FX7A 3KMHA 2JT1A 4L0ZB 1ZHFA 1CF7A 1FSEA 3NQOA 4Q0UA 3MFKA 4A0YA 5A2QZ 5ICGA 1EPZA 5F6FA 5JR3A 2I45A 2UWMA 2EV0A 1HKTA 2Q30A 1RZ4A 4Q5SF 4H0EA 1KQ8A 3EQEA 1LJ9A 2M30A 2Z2SB 3EUHA 1EYBA 4OIRF 3IIAA 4RB1A 1K7AA 2ESHA 2IXIA 2ET1A 5I8TA 1R1UA 4PDKA 1Z9CA 1B9NA 2BNMA 4HV5A 4KN7X 4NB5A 4KL1A 4NQWA 3GFIA 4XF1A 4B29A 1BI0A 4RAYA 1AWCA 1ON2A 4G9YA 5ICEA 3L9FA 2VXZA 2M8EA 2O03A 5IT3A 5EEGA 1HBXG 2WTEA 3H50A 2ZNZA 1YLLA 5C6CA 4GGGA 1VJ2A 4HF0A 2H6BA 2YX7A 2ISZA 2C0ZA 5I0TA 3CDHA 1HW1A 4UXNA 2YPRA 2DPDA 5DCFA 2P7VB 1VR3A 2D1HA 3GFJA 3H3UA 3UKNA 2F4PA 4I01A 2MLGA 4IRIA 3V8KA 2BEOA 2VBYA 4LA2A 1V4RA 3R6SA 4EWEA 5BUVA 3FF5A 4I09A 3F23A 3ULQB 3REOA 2CFXA 3I0TA 4ZH4F 2PFBA 3CJXA 1HW2A 1P2FA 4HMZA 2B9UA 5I0SA 1CAWA 1SD5A 1ZZ6A 3SXYA 1XMAA 2E9QA 2HGCA 3IWFA 1T39A 5BPXA 2H94A 4XF4A 4FX0A 2PYTA 4P9FA 1XN7A 2HZTA 5FQ0B 1KYWA 4M9XA 2GC1A 3GZ5A 4IRGA 4MEXF 4AVPA 3ETQA 5BMZA 1LQ1A 1FNNA 1G3YA 4O6JA 4LK1F 1WQ2A 2L02A 4BHBA 3IDCB 4WXCA 2OQRA 1DZRA 1BJAA 4EROA 3HTUA 3ECOA 1O3TA 1L0OC 2O3FA 3KZYA 4XF9A 2E1CA 1IN5A 2HS5A 4U88A 2HQRA 4BQAA 4KT5C 4L5JA 4RS8A 1FT9A 4EJVA 2VT3A 2IXCA 2UXXA 5JSPA 3SCFA 2OD5A 3BJOA 4M9SA 3CL1A 4D7SA 1LEBA 3FMQA 4MTDA 2KIUA 1BM9A 4HYEA 3S2WA 1PUEE 2KXLA 2N7GA 4YARA 2NYXA 1B1BA 2L54A 4BHCA 1P92A 2PHLA 2V9VA 1KYZA 1YFWA 2EA4A 5T3NA 3WTUC 4AWXB 3WG9A 4GYIA 3ACLA 1WI9A 3OGJA 2XL9A 4XFCA 1BI1A 5LHIA 1L3JA 3ELKA 4MX3A 1XSDA 4U0YA 2A6HF 5DYMA 2DO7A 3QAHA 2KJBA 3O6BB 1JE8A 3J80K 1OYIA 4HOBA 2D1VA 4FT8A 1RNLA 4LLNA 2WWYA 2Q1ZB 1ZZ9A 4ESBA 4ENMA 1G4DA 5JFRA 5DCMA 1HQCA 4EWDA 1P4XA 4A0ZA 1SEFA 5H6QA 2IVMA 4J1WA 2R3SA 1CAVA 2QZ8A 2XROA 3H1YA 3V7SA 2W24A 1XDUA 2DQRA 2EA7A 4HF1A 2IXJA 4F8AA 3F6VA 1OFNA 4OMZA 1PDNC 2ACJA 2DK8A 2PG4A 3BB6A 3V7RA 5FQ0A 2HJIA 4CXFA 2GU9A 3IRRA 5TRDA 4R79A 3PFIA 2P5KA 5KBFA 1JXSA 1RTVA 1U78A 3I64A 5K5QA 4I3PA 1R1TA 5ED4A 1G3TA 2F5FA 3I58A 2BE5F 4MNUA 4NVPA 2MH9A 3IL2A 1DUXC 3QU3A 1IPKA 4Q29A 4E2SA 3ES1A 1XGNA 1WA4A 3HRUA 1Q3EA 1QY4A 4WK8F 1OI6A 5E18F 1UIJA 1FWZA 2ETHA 5LRRA 3V7CA 3WODF 4KMFA 3NSTA 3W6JB 3HT1A 3RJPA 3Q9VA 5KHIA 2XIGA 2A5YB 3H7YA 3N97A 2VBWA 3J80Z 3U2RA 4IEOA 1GXPA 4O9GA 1H9TA 2PMUA 2Z3YA 1JHHA 5F1RA 2DU9A 1UCRA 2FMYA 2MC3A 3GFMA 2D2WA 4H7LA 1QQIA 4U7BA 4XBFA 3DN7A 4J1XA 2HQNA 4BYYA 1ZGJA 4PCQA 4MUVA 2KRFA 3AAFA 2DT5A 3KP7A 2C6YA 3EDPA 2PMHA 3U0ZA 5BOXA 1BC7C 3ZMUA 1BN5A 5ILUA 2WFPA 2F5DA 2D5FA 3FXRA 2Y48A 2XAGA 1YFUA 4JV4A 1ZRCA 1FSHA 1ZNPA 4WVZA 4MGRA 1TTYA 3DPTA 4GCVA 4QX5A 3RIRA 4UBHA 5JHUA 5FPXA 2UY8A 4XRFA 4YNIA 5JVTA 3LWCA 3ZP5A 4B09A 5FB2A 2VC1A 4WXHA 4BNCA 5I8SA 2OBPA 3E97A 3KETA 2WC2A 5HS8A 2YX4A 1T38A 4EJWA 2A68F 2QJVA 3O14A 3FMRA 4M73A 2A6EF 2MLKA 4AVAA 3KFWX 5TJJA 4QLCU 1XD7A 3IC7A 3P9KA 4WXDA 2STTA 5CU1A 2EJRA 2VBXA 1VTNC 2ZNYA 3GFLA 1U8RA 1I6XA 1HXDA 5D5UB 4EWAA 4JVAA 5CVJA 1SFUA 1BOAA 1PMIA 4OINF 1S6LA 3TDZC 2VONA 1OMIA 4WWCA 1JUHA 3DEUA 4K8FA 5FD5A 2EB7A 3D0SA 3GX4X 2FNAA 1MD0A 4GO1A 3HT2A 2CSOA 4UHTA 3ERED 4OLLA 2K0GA 2F5EA
chains in the Genus database with same CATH superfamily
3ZXLA 4AVCA 4Y22A 5F5CA 3OWTA 1R64A 4E7JA 1HW5A 4HDVA 4OUMA 5JSRA 4XRSG 4CP9A 2JRTA 2HWB1 1FJLA 2ZB9A 3J81K 3CQZJ 1D2SA 2DOFA 3CJRB 4P9UA 2JTVA 4B4QA 4DY5A 4WVMB 4QKDA 3ZCOA 3NMBA 5JLWA 1ZR4A 5BS6A 1VBC3 4NRMA 2MC4A 3OSDA 3U21A 3FM3A 1CF7B 2QSHX 1O7FA 1NZCA 1V70A 3E0JB 4AYUA 1GLNA 1SVOA 4MEYF 1LODA 1WD3A 5FYBA 5FRMA 4D5CA 2QEXI 1LENA 3B6AA 2MEV3 4I7HA 4ZDPA 5LEKA 1VAKA 1D7PM 3H7JA 1T0FC 2EIKH 4PT6A 4NJ4A 2K4JA 5A32B 3WTTC 5KHJA 1K6OA 1MZEA 4FQGA 1OCZH 2GALA 4NQWB 2XGDA 1UKRA 4SBVA 1P4WA 1ND3C 4PDWB 3WNLA 1YG2A 3JRAA 3T8RA 2BYVE 1NYWA 3U10A 1XBFA 4CSWA 3RNSA 4S2DA 4D0PA 3POWA 3FHAA 4F83A 2A3XA 1NA1B 5GZCA 4XILA 3QPHA 4M9ZA 2W91A 5LEJA 4DQAA 2CYYA 3NJXA 2R7XA 4E8DA 5FUNA 1A6IA 4CCDA 2Y6LA 4GQ7A 1IN8A 3VYSB 1N78A 2ZKLA 1D0GA 1UZYA 3AKQA 1KQRA 1AR62 5IOZA 3PNYA 1VI0A 5GTIC 3Q5FA 2IXKA 2ORXA 4MGQA 4NIAA 1A8MA 4FOVA 1AUYA 2ELJA 5F7UA 3LSTA 5DUXA 2VOKA 3JD73 3TL4X 2GSYA 1RINA 2AO9A 1HKSA 1REPC 5A6YA 3VODA 1JOPA 3RTRA 3BR1A 1W3XA 1S0EA 4JX6A 1SAUA 1I3QJ 2NMNA 1P4AA 5EP9A 1EA3A 2V1NA 4DNCA 2GDFA 4IV1B 3A01A 2YS9A 2CW8A 5AFBA 2J1VA 1AHSA 1SFKA 3ZMNA 1KEXA 2N8GA 3IHUA 1EY2A 5BNPA 1NE4A 2ET7A 1W8WA 1VMFA 3LDBA 4RA0A 2ATFA 5F5QA 3ECHA 4XSZF 2Z99A 4OZXA 1FATA 1S9HA 3DTEA 1H1MA 1NCQC 2WABA 4IX7A 2DN0A 2PQ8A 3PMEA 2WKKA 1ITYA 3ST7A 3JQWA 4XFAA 5L3CA 3NRUA 5B66C 3HD8B 1V00A 5C4WC 3FHZA 3M70A 4EJUA 1Y7BA 1JUPA 2B9VA 3TOBA 4NNJA 3OYHA 3CCMI 1FXZA 4CYCA 4CDQA 1W06A 4YGEA 2HTSA 2VOPA 2JPCA 5FY0A 1EV11 4PSWA 1UF2C 2XHNA 2FDHA 3WCRA 2QNKA 3NVCA 1MMDA 1PGW2 2JICA 2R92J 2X4HA 2LKXA 4MIMA 3KEOA 2F4LA 5KR7A 5GLUA 4E2GA 1X8EA 1P7JA 4BDZA 1OYWA 1H8TA 1SD7A 4Y1UA 4F92B 3FUQA 1F43A 3GHNA 2D7FA 5A7PA 3WQ7A 4Y20A 2QTWB 1ENHA 2VBPA 1LCLA 2MNGA 5C7GA 2W9XA 5IATA 1Y6IA 1W28A 4NR1A 2CWEA 3IDEA 2MEV2 2E7XA 3OYIA 3EUHC 1AR93 1UXXX 2XUBA 3FLPA 5FZMA 3DYMA 3WGGA 2JG8A 4TLFA 4KYWA 4FPLA 1FPQA 1XGOA 5H20A 3Q9OA 4HG2A 2FEZA 3T2PA 2LRPA 2BRTA 4LK0F 2VXRA 2FHRA 4ZZ8A 2JVHA 5DUWA 1D0ZA 4HPQA 2W25A 4Z82A 1HJFA 1E2XA 2ME0A 3FBMA 1KD7A 1GMMA 2OQGA 4JP0A 4RS5B 3J7MA 5F08A 3N36A 3MIGA 2ETEA 2WO2A 5F2SA 2VE9A 5T55A 4C0HA 5CYVA 1W3VA 5FZFA 1LEMA 3VKFC 4JDNA 1FNZA 1S55A 4HBNA 3OBRA 3PMSA 2VC0A 2XRLA 3LDRA 3H1CA 4V2VA 4LBJA 2QUOA 3IKWA 5C5TA 2PQSA 5BV6A 4I76A 3PM1A 4XIDA 1SBDA 1YJWI 2HVSA 2XB6C 4ASLA 5CAZA 4D7YA 2BQPA 3EPZA 2VTXA 5FGMA 1XNTA 1A31A 5H6RA 4KGGA 2X85A 3GALA 1OKQA 2XPVA 5EZGA 3TGNA 1T2KA 1ZH5A 2DA1A 2L3DA 5LD2C 2DCZA 1R5GA 3AM2A 2XV4S 4MV2A 2BWCA 5E1RA 1GBGA 4FISA 4Y22B 1VQLI 2PLV3 3PNAA 3WE2A 2DA4A 3PO3J 4CP9B 4CGZA 2VZRA 4C90A 2X5IB 4AEDA 1W4MA 2OPKA 3I3EA 1Q43A 3PIGA 3LGRA 4KBBA 4XN3A 1H2KA 1JT0A 3OIOA 2DCTA 1EH6A 5ILVA 4ZS3A 3ZQHA 1L7RA 2ZHKA 3NAPB 1EAH3 4WM7B 4LNVA 5KAIC 2V5DA 2XC7A 3RYKA 1G9AA 4YVSC 4BE1A 4E8CA 1B4AA 2E35A 4BLIA 5B1BH 1JKOC 2IP2A 3CP2A 1DQ6A 1SFOJ 1BJQA 3G1MA 2EZHA 3P9CA 1DGWA 5DUKA 4CRQA 2AHQA 4NC8A 1UMQA 4UXAA 1U5TC 3F8FA 3PJYA 1E5IA 1R71A 1UYYA 3P5JA 5D8AC 1ZX5A 4LK6A 1FTZA 1RIOH 1J0RA 5FY9A 3S5AA 1W9SA 5M5XJ 5F1JA 4CUAA 2EXJA 2XKOA 1W8HA 2M34A 3BQZA 2WWUA 3AYAA 4JX0A 2DW4A 2WINB 1DCSA 2ZS6B 4UVAA 2WZR1 1BI3A 3BC8A 3QOPA 1N3OA 3JRHA 3APBA 4YM0A 2FBIA 3NV4A 1RJ8A 3M3IA 3T2OA 3OYNA 2RS32 3S8PA 3ZQQA 1XNCA 3VB9A 2JDUA 5FLIA 4A3XA 1MACA 4OUSA 1UZCA 3G73A 3I55I 2A6XA 2NS7A 5GZEA 2VE8A 5BPIA 5D8LB 2OUJA 1AR92 3CJNA 4XQDA 2K7LA 2ZMKA 2HWVA 4BIFA 1BVVA 3VBOC 3QWLA 5FZIA 3WW1A 1CR7A 3WQ0A 1R7JA 3ZKUA 4RQPA 4QB6A 1MJBA 1XSXA 4JGYC 2FZ2A 3OOXA 2PN6A 1EF4A 2WS93 2GNMA 1GZCA 1EUUA 2HEWF 2LY9A 2HQAA 3WF3A 2LR8A 2A61A 1F35A 3K51A 3ZN4A 4ARXA 4M4RA 1DFQA 2FCUA 3VDAA 4I0AA 3A01B 3CCQI 1VNDA 1X4PA 5LRSA 1Z7LA 4AE2A 2ZTNA 4HW0A 1IKPA 2JZYA 1VAMA 5B2GB 1K42A 3F21A 4NOTA 4IEYA 2B5HA 1UY2A 1X1PA 3CP8A 4PJNA 2JWPA 3RMXA 4KMUX 4YFNF 3F3XA 1QZEA 5F64A 2OZJA 3VD9A 2IUWA 2Y6JA 5FZ6A 1JHFA 1ZBA2 4B3NA 4GMP1 3JRCA 2W1UA 3HN1A 5FZ7A 1R58A 4M3FA 4D5FA 3CDIA 3BU7A 2BUKA 1R22A 4E4HA 3KP4A 4IHSA 4YG0A 5FXXA 1E17A 2O7OA 1ZZ7A 3INAA 3E5XA 1BW6A 4AVSA 2PELA 2H6CA 3DKWA 1QJX3 3DXJF 2LMDA 3C18A 3GXUA 1H1AA 3L2WA 3CCUI 1GYKA 1UIKA 4QPGA 3EJKA 2Q8DA 4AL9A 1VZ0A 4CDQB 4QPIC 4N4OB 2RV8A 4GB33 5J1UA 5FFOC 4EN0A 1UNBA 4Y1VA 4OI0A 3BKZA 3VSLA 3EXUA 1JGGA 1RXFA 3POJA 1LRHA 1ZAOA 1WBFA 4KWLA 5JI6A 4FXKB 2PLV2 4QQLA 3H8XA 5KXDA 2CG4A 5IVYA 3AYDA 3R60A 3R4SA 3ACFA 2Q8EA 4OI2A 2LSOA 2VJ5A 2HVRA 1RR8C 3ZM8A 3VFZA 5KHKA 4IF4A 3WY6A 4KIFA 2VUCA 3IBMA 3LA2A 4BJ5C 2R073 2LD5A 4QM8A 3TDUC 5FXZA 4BEHB 1B9MA 4IERA 3DLLF 1EAH2 4O5VA 1DYKA 4QT6A 2EAAA 5LHGA 3K1MA 3TP0A 4CH7A 4AVBA 2XPUA 3I2IA 1SG3A 2ZJQF 4JX5A 3FXQA 2LUWA 2WZ8A 2X29A 2I07B 1SCRA 2O1QA 5ANQA 4YW3A 2WNUA 3VB2A 2GLOA 3BZ6A 2ZSHB 3NV3A 4RM3A 3Q0UA 1RUI1 2WV0A 2K9ZA 5K1YA 5GAHJ 4BM8A 2IA2A 3E6CC 3NNMA 4LO8A 4XUTA 5FROA 3HRMA 3WDXA 2WAAA 1Y43B 4RLQA 1K4SA 4DYQA 5HXVA 1POV1 2HWC3 4YRDA 1QHHD 4ASMB 5F6LB 3LA3A 4UBGA 5A1FA 5DAQA 1KQ9A 3KE2A 4PGGA 2VTFA 1I5PA 1ZRDA 3T5XA 4QHBA 1PO11 3AB0A 5CFDB 4ZPIA 2DMTA 2QQIA 2E7AA 4IEXA 5GLWA 2A3YA 1HB4A 1CONA 1T33A 5D2AA 4C0BA 3CC2I 1NG0A 3KQRA 1H1IA 1UWWA 2VCAA 2FDGA 5FZOB 4F52A 1OOPC 1XCBA 3DPRC 2Y8KA 2GA1A 2QBYA 1Z91A 1I3AA 1UYZA 4MHRA 2AENA 3FMGA 3GW2A 2LF8A 3GWZA 3WU1B 2HKXA 4D6SA 4BPZA 1W7PA 3C2UA 3G6EI 1JZ3A 1IOAA 1BK0A 5SV8A 3ZR8X 3UK9A 1UX6A 2LRDA 2AUYA 2VZSA 3VBHC 1XYPA 1BIAA 4OHWA 3ZRGA 1AU7A 4HG6B 1O5LA 1BYHA 3OYDA 2E7WA 1W6MA 4PGHA 2BBAA 3BCWA 2JKBA 3HOTA 1SFPA 3D4KA 1WMFA 4JHTA 1J09A 2Y0OA 3VKLA 2RNJA 2FBHA 2R7TA 1RL3A 1YXWA 2VMHA 1JZ5A 1AL21 1UELB 3OPTA 4AEDB 3ZFGB 5L7OC 3HNYM 5J4VA 2JB8A 3B02A 1ON1A 4AVTA 4L9TA 1BBT3 3IB3A 1RUC3 2IPQX 1ND2A 2MPFA 5FUIA 5AONA 1XGMA 2W46A 4AI0A 1VMJA 2E51A 3BY6A 1DP3A 5CB7A 2ECCA 4QPOA 4R8HA 5K5RA 3USSA 2XGEA 5F3IA 2Y6KA 1QJX2 5C3RA 2A1XA 3C3VA 3NJZA 1QJU2 2RMU2 2OKXA 2ZOEB 4A3MJ 3FMSA 4LGWA 1XB4A 4HRIA 1KU7A 1W6OA 2ISYA 1JW6A 4LORA 4X6RB 1QVUA 5J6XA 1QJZA 4B7KA 1U3EM 5A3UA 2P34A 5C33A 2Y69H 3K70D 4E4DX 1RKTA 2QCOA 3VYTB 2D97A 2HBTA 3WTWC 2DOEA 2XLGA 1XB9A 1R4MB 3AMNA 4G7ZF 1TEIA 1AXKA 3QH6A 3IH4A 4JC1A 3ZXEA 1AL0G 4LHKA 3HSFA 3OEBA 4EATA 1NK3P 2IRFG 4Q4X1 3SNMA 3WF0A 1JN2P 4Q0PA 2LREA 1LE8A 3AMPA 3L2HA 4PFPA 2KJCA 4ORFA 4JYKA 3MEXA 1W6NA 2XHKA 4KIBA 2R072 4HX4A 1CD3G 4O3MA 3ZR5A 1KXGA 2D3PA 1VBB3 3VL9A 1REDA 1DDNA 2YPJA 2RN7A 4DO0A 3LL7A 2O9LA 2D93A 5G05L 1HCRA 3VBSA 2A6WA 1O8PA 3VKOA 1YQ6A 1PGL2 4DXZA 1H9GA 1WW4A 4R52A 4RGXA 3J26N 2WNVC 4MXVA 4DS0A 5A1AA 3H9QA 2PQQA 2HDDA 4ZDLA 3PTYA 3R4DB 4LR4A 4AHWA 4QIWN 3LAPA 1XE8A 5FZHA 3BTZA 4LB5A 4MGKE 3ZDVA 5FO5A 2LW8A 2ZJPF 4FSJA 4ZYGA 4KT6A 4XCBA 2RVAA 2R93J 2JSPA 2HWC2 4DZPA 2OU2A 4MTEA 5F5AA 3S93A 1C5HA 4Z07A 1OUXA 2KR2A 5JR7B 3B93A 5L9VA 5IYYA 5A33A 3VD4A 2YBSA 3SEQA 3EYYA 4Y15A 4V2GA 1O3SA 2BVVA 3PTRB 1OD3A 3BJ6A 5A6ZA 2H09A 2Q8KA 3RVHA 1SDDB 2HWE3 3MI8A 1QBJA 3BOQA 1PUFB 1S2KA 3VBUA 1XMKA 1XGSA 2E71A 4LG0A 1TMF3 2P7CB 2VJJA 2BDRA 2O0YA 3J4UH 5JI7A 3AYEA 3ZIWA 4INDA 1WKYA 4QM9A 3QBQA 3ONQA 1K4TA 4LLGF 4BXUA 3MKLA 1VBC1 2VB6A 5A7WB 4YELA 3HWJA 4W4ZA 1C8M3 5A7NA 3DEWA 4LBKA 5CFCC 1NCQB 2E2HJ 1O4XA 3S16J 3LSIA 5FZGA 4NHXA 3M3EA 5CEHA 1YJKA 3ABKH 3IPVB 1PVEA 1NE6A 3MDPA 3N9MA 4OMCA 4AZZA 2BZDA 4XRSA 5M3FJ 4XK4A 5FWJA 1HB3A 2ARBA 1SMYF 1JKQC 2ZMLA 3HOBA 3HOYJ 2WLPA 4FFIA 3GF6A 1FYKA 2VT2A 1LHWA 1Q8QA 2W08A 2W57A 3PVBB 4UW6A 2BVMA 2PMZN 4IUGA 2CQKA 4EZHA 2LTPA 1LGBA 5KWRA 3VKMA 3FFQA 4HVRA 5HI0A 3PJRA 4HSLA 1LPQA 2QQJA 3CJIB 2Z69A 2R043 4CCKA 2KQRA 1MNEA 3BODA 5K9YA 2UYAA 2OA4A 3MQ0A 1X7NA 5K0UC 4E70A 5BY5A 2NAZA 1WCDJ 2PAMA 2LG4A 4YFZA 2PN5A 2J1AA 5IP7J 1VQPI 3LZZA 4UUTA 1MZ6A 4C9YA 3FXOA 2VZQA 2P81A 9ANTA 3Q8AA 1X1DA 4A3ZA 2IS4A 3U75A 1SLIA 3K48A 3CHXA 4JGZA 4BBRJ 5IYCJ 1VLNA 4KISA 5FZBA 3TNPB 4FTEA 4Z1VA 2GM4A 3N9NA 3JAMZ 4LULA 1TQIA 2VQUA 1SLTA 4GH4B 1R1VA 2OIIA 4KU7A 1W99A 5IAVA 1GVJA 2OZ6A 4UV8A 4E4SA 3RPUA 2ZJRF 2BY0A 3G1OA 3UJQA 3WNOA 4BQ4A 1UN1A 4Y4YA 1IRXA 1UU5A 4AYBN 1CN1A 1YIOA 1Q8PA 3HL2A 4L97A 4UWDA 2M5WA 3LOCA 4QX2A 3LSRA 1PVC1 4IXAA 3JD71 2WYSA 3POGA 1ZG1A 3HPNA 2JA7J 5FPLA 4PIYA 3FBYA 3BPXA 4UOJA 3UESA 2R5ZB 2EWNA 2JE9A 5FMDA 2EXKA 1VBB2 3A0BC 2B7YA 3POYA 4WBBA 2HYKA 1GANA 3GUDA 3OB8A 1GZWA 2R7DA 2R7SA 1AKHA 1IXSB 4AI2A 3TAYA 4A3LJ 2DBBA 2K2SA 2O61A 2QBYB 5BNOA 4QKNA 3K7AJ 3O3KA 2RDNA 1ENXA 2QM3A 1IUYA 3WSOA 2E34A 5CVIA 3VBFC 2VI6A 5D5WB 4I6ZA 4EJTA 4NHJA 4AK3A 2X8KA 2GOMA 1W7PB 3RZLA 1ZARA 2RS13 4NO4A 4CDWA 3OSGA 1R6RA 4XMIA 3E3VA 2QSFX 3OEAA 3WXPA 4NC7A 1MS9A 3O0XA 3ROUA 5CZKA 2MBFA 1JBCA 3ZYRA 2PHRA 3GNEA 1W0TA 1HRV3 1N1SA 4TLGA 4Y5Z0 4V19K 4CXYA 1TP4A 3KMHA 3KZ4C 4TZDA 2L0KA 1WCSA 1STMA 4Q0UA 4KI5M 2HWE2 4DBRA 1EPZA 1YHQI 3RZOJ 4Y5SA 2VMIA 1RJ7A 3BU0A 1R081 1NAEA 3HAGA 4F91B 3GTJJ 3EQEA 2FCVA 4A3FJ 1TMF2 4W97A 2ESHA 2IXIA 1ND2B 5I8TA 2JENA 2BNMA 4HV5A 4KN7X 3KT4A 3T08A 3SDGA 4P00B 2BGOA 1TL8A 3GFIA 4XF1A 5EYXA 3SFIA 3H0OA 1C8M2 1I50J 3NARA 5IAXA 4XAAA 1RUF1 2O03A 2ZNZA 4URTA 1W6OB 2LH9A 2YPDA 5C6CA 4XUOA 4R4ZA 4IOCF 2ISZA 5E3MA 3PIJA 2DPDA 2YPRA 1VR3A 5FYSA 3UKNA 4CEYC 1Y1VJ 1D0XA 5C8CA 2V72A 4XLHA 2EILH 4IRIA 1FV2A 1QXPA 4LO6B 3V0BA 3V8KA 2BEOA 2VBYA 3QYEA 1RUG1 2RG4A 1YX5A 2ILMA 2V4AA 1C3HA 4EWEA 4N53B 2VUMJ 4I09A 5LFAA 1UQXA 1X36A 3I0TA 2KD7A 3ZXKA 1HW2A 5EXOA 1CIWA 1ZZ6A 2ZGMA 3PNVA 5D8AB 2E9QA 2R042 4C30A 3OUIA 1TWAJ 2QQNA 2PYTA 1W6NB 2VOXA 2ZEWA 3KHBA 4CCMA 2VQLA 3Q8BA 1Z0HA 3MD2A 5A3NA 2A75A 2RJLA 3RGBA 2AGSA 3ETQA 4YPJA 2LTNA 4LK1F 3UT0A 1WQ2A 3KCYA 1QOOA 1DZQA 3VBSB 3IDCB 3G1LA 2JJ7A 4WXCA 2OQRA 1SFYA 3SH3A 3HTUA 3ECOA 1L0OC 4OCTA 2HWD1 2TRTA 2VBBA 2WO7A 2FDJA 3OY8B 1R1A3 3R05A 2PMZA 3DEMA 1LHVA 3RZKA 2BZTA 3NWTA 4XKWA 3LSDA 4A4AA 4L5JA 2NQYA 2W1SA 2XR4A 4WZFA 2UXXA 2WA0A 1C1LA 1LEBA 1RMU3 2PX9A 1BM9A 2G9ZA 3K4CA 1RR7A 3S2WA 2W7NA 4YW2A 2N7GA 5FZ1A 4BQ3A 1T56A 3OS1A 1HQWA 4C2TA 2HWF3 4A41A 5A33B 4DXRA 3H5NA 2DUPA 4XFCA 1BI1A 5LHIA 3PVEA 3ELKA 4GZ9A 4CUCA 2QF7A 4HNTA 4CTEA 1AJKA 3QAHA 3O6BB 1JUMA 3VZJA 4FT8A 2WDBA 3VBUB 1IG0A 1ZGWA 3O0VA 3ZFFC 5DCMA 1P8JA 3HNMA 2OT7A 3WNXA 2Y34A 4EWDA 2A71A 2P6HA 2OPTA 1Y1WJ 5H6QA 2RDQA 3AK0A 3ZYHA 3H1YA 3J7ZI 4OI1A 4AYBA 2DQRA 1WI3A 3DUIA 1JZ7A 4AHYA 4F8AA 2W1WA 4BQYA 3F6VA 3O1VA 2DK8A 3A0HC 1AR81 3O1MA 2DUQA 2GU9A 2XGCA 3PFIA 2EPFA 1X3ZB 4O7XA 3AG2H 5FKMA 1QQP3 4A6SA 1JU3A 4ANJA 2EIBA 5FKCA 5K5QA 3Q0WA 2WO1A 2BE5F 4MNUA 3IL2A 4X6AJ 3ITQA 4E2SA 4QPIB 1WA4A 3HRUA 1QY4A 4C1WA 4YG6A 2JIJA 3ESWB 2K9QA 1A78A 2ETHA 5LRRA 4XHBA 3V7CA 3TW7A 3HT1A 3RJPA 5KHIA 5EYRA 1OLQA 3DKXA 3H7YA 3MIEA 5BNNC 5FXVA 4HFSA 1IUFA 3J80Z 2OJED 4CPBA 3LD8A 1E0EA 1XE0A 4O9GA 1YRZA 5FY5A 2ZMNA 2EF6A 2PMUA 3S32A 1XNAA 2XSDC 4OI4A 2KFDA 1QQIA 3N7LA 1PMHX 1X19A 4J1XA 4CP1A 2W95A 2HU9A 1HV1A 4BYYA 1WW5A 2KRFA 5FMCA 1W9YA 4CXXA 2PMHA 3U0ZA 5BOXA 1U0JA 1RUD3 3NV2A 2F5DA 2D5FA 1DU0A 1ZRCA 1FSHA 1TTYA 4GCVA 3K4KA 4JRLA 4QX5A 4A45A 1TNFA 1SLLA 3FXJA 2NYYA 4BUPA 4AI3A 4XRFA 1RHI3 5C9AA 4B09A 2WS91 5GAEJ 4WXHA 4BNCA 2W4SA 1ND3A 2XOMA 1QHGA 3KETA 2WC2A 5HS8A 2YX4A 4A3JJ 3O14A 3RPUD 2A6EF 3KVBA 3VDDA 3G6JB 3WEZA 3KFWX 1E5HA 4KG8A 2WL1A 1XD7A 4YM3A 3DCFA 2CY6A 2GBYA 2ZAAA 3RS6A 4RR3C 1AKHB 3WU2C 1HXDA 3K4JA 4JVAA 1PX4A 1GNYA 1SFUA 5BNOB 4LE4A 1RUE3 2Y6HA 2TCTA 4WWCA 3DEUA 1R1A2 1G86A 5KCMA 2ZGNA 4GO1A 2CSOA 3DPRB 2ARXA 2M3AA 3ZSLA 4RGKA 1JTZX 1IDZA 1CPMA 1V5EA 4FX4A 5HODA 3EHKA 4HDUA 2KLOA 5IOYA 2BOIA 4CEWA 3NEUA 2XUEA 3F8NA 1CVNA 1OA2A 2HWF2 4QX3A 5GLZA 5EJ1B 4WX9A 1Z77A 1U12A 4XAEA 5CNAA 5J96B 4COZA 2CRGA 2DMNA 2HEYF 5KK1A 5AVPA 1Y0NA 3OOUA 2IGKA 1R093 4GB31 2QDNA 4N7UA 4MH0E 2V6EA 1J3RA 5J4YA 4AC0A 3CZJA 1UPSA 3BG6A 3I97A 3IRQA 4DB5A 4XABA 3LWFA 3EUKL 1VB4A 4ABZA 3QRFF 1GSLA 3T1BA 3ZXAC 4KJZA 1PZ8A 1FOWA 3UKTA 2XG3A 5LBEA 2JA8J 2WSVA 1Q8VA 2RHPA 1H89C 2LF7A 4KFCA 2VC9A 5E79C 1ONAA 4RN5A 4Z8BA 3HTSB 1OQEA 1GKBA 2Y38A 3RJ2X 4EJOA 4QX0A 1WGXA 1QQP2 5C4WA 1OISA 2AXLA 5DUVA 1VQOI 1EH7A 2QKMB 1XSRA 4L9NA 1VPHA 1FLIA 2D3RA 3S0MA 2W48A 4RM2A 3V0BB 1R23A 1HN1A 2D6KA 2VMDA 3I4PA 5FKKA 1J1LA 4C3JJ 4Y1ZA 3BZCA 3RKWA 3WTZA 3CIHA 1FV3A 4Y4RA 1LDKB 3ZYIB 3TBIA 3FHNA 1XOYA 2DFEA 1JOJA 1FOD1 3TEXA 2PJRA 1CESA 5FLVA 1CAUA 1UY0A 3HQXA 4H14A 5HLHA 1F5TA 2R7ZJ 1OSGA 2MYSA 2Q4SA 3FK6A 4JCKA 3GMEA 2OUHA 2WJSA 5JWPA 1HV0A 2DVBA 1ZZ8A 4B1LA 3QP5A 3I4NJ 1H6YA 2EV6A 1KU2A 1G3SA 3I2JA 1S1AA 1B35A 4F93B 1IGOA 3MF9A 1W8FA 1Z7UA 3NO8A 3VD5A 1KZHA 3I2KA 2LNBA 2GAUA 5C4XJ 5E20A 3SQNA 2W85A 2K27A 4YW6A 1YOVB 4LBQA 4P9GA 4OQ9A 1KONA 1UY1A 3HRSA 2VCMA 5EZWA 1RHI2 2CUFA 1G9FA 2Z16A 4OHZA 3ERMA 1AYM1 1CAXA 3D0JA 2XQXA 4TXWA 2QLZA 4ISQA 4FQ4A 1KRIA 2WY8Q 1D0YA 1J3QA 2Z9OA 1SANA 1B6AA 1UX7A 3WG4A 1IZ1A 1ULYA 1UCXA 4AGVA 1QU0A 5GZDA 2WNEA 5FDBA 4RAFA 2DVFA 2DI3A 5DCMB 1MEC3 1DQ1A 1ZG3A 4OU0A 1HIXA 1GOGA 2JG9A 2VJXA 3WGIA 4BQNA 2BGPA 1RUC1 3NNLA 3AL6A 3VDCA 3S3NA 3BIEA 3V56A 2X53S 2BPA2 5C3QA 4CDGA 4FE4A 4DOZA 5D21A 4QDRA 4BGDA 4QGNA 5FOJB 5DDGA 2D44A 3OV8A 4KGQA 3PUFA 5CFCB 4Q4Y3 3TQNA 1PGSA 5T54A 1LOFC 1ETWA 1HB2A 1SFEA 3WP4A 2BP6A 5E89A 1WUVA 4Z2WA 2WAFA 5DXDA 2A5WA 1ZELA 4ZZDA 1R092 5DG1A 4HN0A 1ULGA 2HYXA 2D6OX 4QU2A 5E3LA 3L1PA 2NMOA 2L4AA 1R4NB 5ICFA 4N9IA 3OIPA 5A7OA 4DRVA 2VPLA 1WLDA 4M4PA 3S2DJ 3QLQA 2C9KA 3DU5A 5LBFA 3SYTA 3VHNA 2CGNA 1FZPB 3BTLA 1GWLA 2VZPA 3VWBA 4AXOA 1J84A 5F9TA 5JIUA 1LOAA 3E5QA 3UKVA 1J5YA 1W2OA 4BAYA 3LSJA 3SHFA 4XOTA 2L7FP 4YZ2A 4AU7A 1AVBA 4UW4A 1S2BA 2FNPA 5GP9A 2WT2A 2IGMA 3IWZA 2DFIA 2BFUS 3K4MA 2L7KA 4CPBD 5IHRA 1YJNI 1TLHB 1NA1C 3TB0A 2HXIA 4JKKA 3K77A 1SQ4A 2WQ8A 3GBFA 3EETA 1U5TA 1RI7A 1LDJA 4Z2YA 2MABA 5FUPA 1S8NA 5B3SH 4FPKA 2B4KA 4DEQA 2G4IA 1BMV1 2VKEA 1QJEA 4XQFA 3SCGA 1MS1A 1YQCA 4YFKF 3OYEA 3CLQA 3COAC 4EN7B 1FAYA 1W0OA 4CZSA 1FPN2 4QXHA 3VDDB 2D98A 5F04A 2ZHLA 3KLNA 5L73A 2D45A 1D5VA 2CGPA 2ZX4A 2VOWA 2RDPA 4A2UA 2NOGA 2WT1A 2H8WA 3ZXJA 3CZ6A 3GCXA 4Q47A 2RNGA 2I74A 5GALA 5D1IA 1OBNA 3VYUB 1UZVA 3RG0A 5FLMJ 2OZUA 4C3IJ 5LLQA 2QENA 2ADEA 1MZFA 1F9NA 2P8TA 3K0LA 4U0VA 2UYBA 5IVFA 4IV1C 3DGTA 4LJHA 3DXUA 3LFMA 3J7YJ 3L7WA 3G7DA 2DCKA 3B94A 4P02B 4FBFA 3DPLC 2ZGLA 5IY5H 3C7HA 3VBFB 1Z3YA 1FP2A 2BGCA 2OQ7A 1UZ0A 3ZXGA 2HOAA 3VBRB 3HNBM 3QODA 2CUJA 4CEWB 2NS0A 1D8JA 5CVUA 2FBKA 1YLFA 3D5LA 3ECQA 3NJVA 4U7DA 3FUOA 1GZTA 3SEZA 3WU0A 1D4M1 4YW4A 4A3GJ 5HCBA 4GMP0 2V9PA 2YC2A 2ZGOA 1TVGA 2IC1A 1ZVFA 4RD7A 5FRAA 2XJRA 1COV3 3LEGA 3ZN6B 1FMWA 1XE7A 1PIV3 1DGLA 1MEC2 4AI1A 4QWNA 2L7MP 2OCCH 1S0CA 4Q4ZF 5L3EA 2YUSA 1YEWA 3HSEA 2LROA 3W6VA 2ZXHA 1AR71 4NPMA 1TME3 3AG1H 1GXQA 5KC5A 1W2NA 4XKBA 3MEPA 4RHV3 1XU2A 1F31A 1TNRA 2EALA 4ET7A 2GP5A 1SVLA 2GIVA 2ZGKA 3MW3A 1W90A 1UG2A 1IJWC 5GJ6A 1X4OA 2R7QA 3KX2A 2VUAA 3JRFA 3KYLA 1YS7A 1JZ4A 5HPOA 4G6TB 2VVEA 4Q4Y2 1OLTA 3SJMA 1Y0UA 5FY1A 1ALYA 3IKTA 4ESFA 4D69A 1WCUA 3HZJA 4YIIA 1TT0A 4KNCA 3WLUA 3V42A 1VBD1 1YW7A 4NIIA 3LAJA 4L0YB 3VEPA 1A36A 1W5CC 4C2UA 1RB8G 1R36A 3GGLA 3I5UA 4OHYA 1MS4A 2NNNA 5JHFA 2VVFA 4DGWB 2ZZQA 3ZO0B 4KMQA 5CYYA 2JIGA 4P5OA 2PJRB 1ULEA 4XM3A 4QKFA 2P17A 1ZZCA 1CAUB 3KP5A 4PSXA 1HDDC 3AX4A 3EO6A 3PIPF 3IKVA 2W68A 1EPWA 2Q0AA 3CLPA 3ZYBA 1OD5A 1AYN3 4HKWA 4P9JA 1R5ID 1DZTA 1IS3A 1IRFA 2GXAA 2NVTJ 4CCLA 2TNFA 4C2MJ 4LLFA 4YZ1A 4DOUA 2QSGX 4ESJA 1DGWX 2VZOA 1YYVA 1ZKGA 4QMAA 4LIUA 2V4VA 5LBBA 4N8MA 1UL9A 5TISC 2DBIA 1RUJ3 3VZLA 1VRH3 4EGZA 5IT6A 3IDBB 1G3WA 2A70A 1S7OA 2W87A 1M4WA 2EV5A 3WHUA 2EIEA 1ZLJA 2Y30A 2L9VA 3OD0A 4FOQA 3KPHA 3I3MA 4MHGA 1CAXB 2XB5A 4PJJA 4YGBA 1BEV3 1UYPA 3PNTA 4BQ1A 4NHLA 2JQ7A 4PI2A 4R9BA 3FJSA 5HXMA 4IGQA 2XL7A 2G9FA 2UZKA 1HRV1 4H3WA 2WAQN 1WLCA 2GN3A 4UVBA 4IVNA 2VL8A 4PBOA 3UGHA 4LBQD 5FY4A 2QQBA 3H36A 3ENRA 1I39A 2RR11 4IE4A 1ZBE3 4DQ2A 4ES8A 2Y6GA 2DT7B 2V1UA 2C26A 3MCZA 5BPDA 4HXCA 4A7KA 4L11A 3RSJA 3V4GA 4KDPA 2JG9B 5L3FA 2E7QA 3P9IA 3TEWA 4M3CE 4PLMA 4U0WA 2DTZA 3DYOA 3QACA 1WW6A 3CO2A 3JTHA 3VN4A 4M3DA 3GJBA 4AQ2A 3KLSA 2CH0A 1IF1A 2VQ0A 2R5YA 2CUZA 4X0GA 3GTPJ 5DZEA 2KZVA 4U2AA 3KV6A 4KN4X 5FP3A 3LB9A 2E33A 3LKJA 4IHYA 3IM0A 4BQOA 1UXZA 2JDMA 3NRVA 4NROA 4K7JA 2E60A 3ATGA 1AX1A 4UF0B 3GVAA 4M0NA 2ZGQA 4IEJA 4LITA 1OPOA 1V6MA 3RZMA 2M4KA 1COV2 2H27A 4UFHA 3ZXDA 2DCYA 4CDXB 1PK6A 5D5XB 4E7HA 1PIV2 5L3GA 1LVAA 3CESA 3DF8A 5J48A 3OYCA 2JEMA 2G9GA 1HKDA 1BC8C 3MUY1 2RKHA 4K6BA 1PP7U 3HPGA 4A5NA 4LMYA 3DLAA 1RUH1 1H0MA 1TME2 5B5EC 3K1NA 4XORA 4LUMA 4XL9A 1W2AX 1TT5B 2R16A 4RHV2 1W8UA 2X1DA 3LA7A 3GTOJ 3KV5A 2WFF3 2NVXJ 2ZHMA 1X58A 1O59A 4FPFA 3ES4A 4HLTA 3VPRA 2XBO2 5D5VB 2CQ7A 3TN91 1K12A 2SBAA 1F36A 3WQBA 1WSUA 4QQHA 4LXLA 3L2RA 2JSCA 2LDUA 3WR0A 4FFFA 1IV6A 2FJ1A 2QQLA 4QB1A 3E7LA 4ZYHA 3QOEA 3HKZN 4LBOA 5FP8A 5M3MJ 2VMFA 1Z78A 2ZX0A 1DF0A 3K4BA 2WSUA 3F95A 1J7KA 1UY4A 3WV6A 2EH3A 1YIFA 2UU8A 3WQ1A 1POGA 2VCCA 1SD4A 2JDZA 1NTCA 3OYJA 2JUGA 1ASJ2 2D6PA 1RMU1 5KXCA 2RM23 4XR6A 4DZJA 2UXNA 5EWSA 5T5OA 3NW4A 2DYCA 4FTHA 1YO5C 3CJTB 1Z1DA 4EMSA 1A34A 1Z6RA 4ES9A 4B1RA 1KA8A 2L4MA 2DJIA 4JAAA 3GO5A 4Q26A 1CQTA 3B5LB 4XFFA 2KKOA 4I98B 3M8FA 4AEKA 1HRI1 2DTYA 1F2NA 5E6HA 1H0BA 3QU6A 5B1AH 1WRJA 3SEPA 2VY0A 2MH2A 4G4FA 4FPHA 4MGTA 1JZ2A 1JJ8C 2VMGA 3HHHA 3JREA 2TBVA 1RUJ2 1XRUA 4U36A 3C7OA 4Y24A 4Q5OA 2BW3A 2VMEA 4UW3A 1W9FA 4F3JA 1FBSA 1TWCJ 4AGRA 4NHYA 1IZ3A 2K9SA 2DMUA 1SAXA 3QYFA 1BEV2 2ZGRA 5A3WA 1EH8A 1LB2A 5EYYA 3LFIA 1WCKA 1W8OA 3VV1A 2P1BA 1LFBA 1FEXA 1MS0A 1BZWA 1G7YA 5J7MA 4Y13A 4OFGA 3VDBA 3IUOA 1TZLA 1MVQA 2A6TA 2IGNA 2DLLA 3G71I 4XLEA 3RZJA 3U9GA 3N35A 4YIRX 1LEDA 4FPJA 2Y2ZA 4JOMA 2XLAA 2COMA 4NRPA 3CCLI 1ZBE2 4CDQC 5HCFA 3GZTB 1VMHA 2OAZA 2IA1A 2Z5WA 3A4UA 2AXTC 1MSEC 2QQMA 1K5MA 1XX5A 1SLBA 3MZ8A 1BBYA 2WUHA 2VULA 3T8TA 2WN2A 3ZMSA 4A3DJ 2V73A 3ELNA 2J1UA 1YRNB 2G0EA 3GLLA 5E16A 4HT1T 1DLLA 4GA9A 3KWVA 5HS7A 2WQ4A 1YJ9I 2WAQA 2O6GE 4UB8C 2QQVA 1HXS1 3KP6A 1KS4A 3OG2A 2YUEA 5FYYA 5J8CA 3RJRA 3R0AA 1W0PA 2FOKA 4ATFA 3WNKA 1MVEA 4P9LA 2HI3A 1RUD1 5IYBJ 1OF4A 3JRGA 1W6PB 3KEYA 3S6PA 2VZUA 4UUSB 1LHNA 3GDBA 3WW3A 3ZPYA 5EG0A 4DJAA 2YBKA 3K4ZA 3RKYA 1YUDA 3BTIA 2LY2A 2DAOA 1OC1A 2J1SA 1OA3A 4MQ9F 3ETPA 2JG8C 5FBZA 4AW7A 2HPMA 2ZXQA 1WH5A 5ERIA 1C4RA 1PVXA 2AQEA 1RPWA 5FV3A 5IK8A 3RQIA 5FAXA 2WFF2 1HA8A 4I3GA 5FJ8J 4HVOA 5FZLA 4BQQA 4FCYA 1DP7P 3DBHB 4OYUA 4Q4V3 4A93J 1QJY2 1TZOA 4AI9A 1QWRA 4HONA 5FIXA 1VE0A 4OMYA 2HDWA 4IE0A 3FE5A 4Q8LA 1RUE1 1VQNI 3BVCA 1Y9MA 4RGSA 4NAOA 2Z4FA 3H1WA 4A12A 3CC4I 2GQQA 2CU7A 1YW9A 3RZGA 1HKQA 2EFOA 4DW6A 2CWSA 1HB1A 1NY71 2JE7A 3KGZA 3PUIA 2HVQA 2PHDA 2VKHA 2JMWA 1PO23 5ACA3 5E3NA 5AC93 4FETA 2XKPA 5J40A 3POBA 3DP7A 5F27A 1PHMA 3VZMA 4TWTA 3KLOA 1CZVA 1GZ9A 5L36A 4UFLA 5FKLA 3C2HA 5HDNA 3EMRA 3NNGA 3S1RJ 2QQ9A 3HQRA 3GZAA 4O9EA 4MFDA 3IP4B 3HKZA 4CZCA 3WNPA 2DVDA 4EQQA 3TKYA 5FMOS 2M45A 3MZHA 4AAXA 2VKDA 2VQAA 4OAYA 2QQAA 5JSOA 4NWVA 2X6XA 3W58A 4MGYE 1NG6A 2KIMA 4G7OF 5M5YJ 3VDXA 2WNOA 3KZIC 1YTYA 3BR0A 3FKJA 4COVA 1UD1A 2ADDA 1O57A 2DT6A 3WG2A 1I6HJ 1MJAA 2EINH 3E1SA 3LEIA 4AEDC 1ULCA 2R5YB 1TWHJ 1D8KA 2JECA 3U37A 2Y60A 3OUHA 4M3GA 1WWXA 5C3EJ 2EIGA 3GHMA 5FYZA 4B7EA 3I59B 4BL0B 3K70C 2R7VA 1T08B 3A7QA 4FTBA 4BY1J 3OD4A 2Y0MA 1BK1A 1PK6B 2R1BA 4IEUA 4J00A 4K21A 1CQ9A 4BJTA 2ES3A 4BACA 1QA6A 3JBG1 3SXWA 2F5CA 2WY7Q 3AP9A 1GV2A 2MD5A 2WYFA 4F7ZA 4K20A 4BS9A 3T2QA 4YWAA 3BPZA 4GULA 3PQKA 2B39A 1KGYA 5HLIA 5AIQA 2WZEA 2FDFA 4XDQA 4BH9A 2HWB3 2YR2A 5I93A 4K9SA 2R062 1GOHA 4N7IA 5A2QK 2RGVA 4IE6A 2CW0F 2YBPA 4XNFA 1Z3XA 1US3A 2XVGA 3WOGA 3OYAA 4I30A 3CTAA 2LOOA 1FMD1 5KNLA 1N75A 1EKEA 4IXLA 5JDBA 2O5RA 2DA2A 3O8HA 1MQTA 1UMZA 5EZHA 3K2ZA 4FPEA 4P55A 1Y4WA 1AJOA 3OYWB 3HOSA 3ABTA 4XUQA 2M9HA 1UAAA 4EN9B 1EUTA 4COWA 4Y1YA 3E5UA 2IXHA 2Y9ZA 3HIFA 3JB4C 1Z7S1 4RQPC 5DTDA 1XSQA 2MHFA 3ILNA 5FZKA 3AP7A 4OZOA 1KFXL 4CU8A 1WJDA 3M8EA 1X3WB 2GMEA 5CKQA 1R00A 1B8IB 4Q4W1 4M74A 3C7GA 1Q1HA 5HV4A 4GFBA 4XOPA 4Q4V2 3ZFEA 5J3UA 4IV3A 4RB0A 3SDBA 2D3SA 5JPNB 2ZMEA 1SCSA 1V9U1 4WM8B 1TQMA 4CDUA 2P5VA 4HQMA 1OPCA 1V6LA 2Q1FA 1FX7A 4BZ4A 5DG2A 1ZHFA 3F2ZA 4HNUA 2RV9A 1VBA1 4IHVA 5F6FA 2LS6A 1RETA 4W6XA 2NZ9A 1F8VA 2UWMA 4P1WA 2KRCA 4Q5SF 1NOVA 3OPWA 3MKWB 1KQ8A 5IK4A 1LHOA 3M3CA 5CG8A 4OIRF 1PO22 3ZPOA 3IIAA 4DY3A 5ACA2 5AC92 2COBA 3MIBA 1X2MA 1W1WE 1VBE2 4RFRB 4F3QA 4UYBA 4KL1A 1UU6A 1BI0A 2DYRH 2JK3A 1G59A 4RAYA 1AWCA 2FUG2 2ZACA 5ICEA 4FQZA 3B00A 5DDJ1 2M8EA 1MBEA 1HBXG 4LHLA 3CMYA 4QPGC 1YLLA 1VJ2A 1NCRB 1XU1A 1G9BA 3CDHA 4UXNA 5HNFA 4XQ4A 3U14A 1VQ4I 3ZFFA 2MLGA 1NT0A 2WWSA 3KF3A 5FZ3A 3E1F1 4M3CA 4AI8A 5BUVA 3WVJA 3F23A 3ULQB 2V7FA 1LAJA 2PFBA 2B9UA 1W04A 5FY8A 5I0SA 3POIA 2XJUA 1SD5A 2ME6A 5EPAA 3CJIC 2ZGUA 1IG7A 4NHMA 4NHKA 4XF4A 3B69A 3LQCA 5GLVA 1XN7A 1H30A 5FQ0B 1KYWA 3U78A 4FPGA 4M9XA 3LSHA 2GC1A 4IRGA 1LU2A 4AVPA 1WJ5A 2ZC2A 1G3YA 4Y3OA 2CV2A 4O6JA 3CCEI 1OURA 2ENRA 2PHWA 2L02A 3HG9A 2KA3A 1GICA 5IJRA 3LIHA 1MBHA 1QF3A 1O3TA 2O3FA 2P2KA 2RS33 3T30A 5IUQA 3BIWE 5HCAA 1YCIA 3J8F2 4NIHA 2Y26A 3H8OA 4GH4C 1ETXA 3M8LA 2JUCA 4YRVA 2P37A 4RS8A 1EV13 2VT3A 5JOXA 4RSUA 2VZTA 3VYRB 2IXCA 3NWKA 5DMYA 3SCFA 4D7SA 5GLTA 2H8RA 3AC0A 2X05A 2HWB2 1PUEE 4YARA 1B1BA 2R7UA 2PHLA 1YFWA 2EA4A 3WTUC 4GYIA 1NQJA 5IVVA 4JQRA 4MVTA 4UAPA 1WJCA 1SLCA 4BA6A 2E1MB 4B3AA 4U0YA 1HQLA 5DYMA 5C4JJ 3SH4A 4XBLA 3LF7A 4HOBA 2A5ZA 1RNLA 3ON7A 2WWYA 1IS4A 4OHVA 2ZX3A 5G04L 1ZZ9A 3H9JA 1JKRC 3JRIA 2Y33A 4J1WA 2QZ8A 1MBGA 5C44J 1XDUA 3VUOA 2BOLA 3ZQCA 1ZBA3 2ZEZA 3I2OA 2A7AA 4FFHA 4LO7A 1URXA 1D0HA 4DEVA 4M01A 4QHZA 4OMZA 2C1FA 2ACJA 4BK5A 3FK7A 4CXFA 4ZS2A 1RVF1 5H9PA 1JKPC 2CGOA 4CCNA 4II2A 1JXSA 1RTVA 2JDNA 3LSEA 3BTCA 1U78A 2B42B 4RR3A 4I3PA 4XJAA 5A1LA 3I58A 1A8DA 2WR9A 3PUAA 2DU1A 5EIYB 5EGOA 1VAVA 3ES1A 2OTLI 1XGNA 2GNBA 1L7LA 1Q3EA 1ETOA 2K9MA 4WK8F 2HH9A 3CQOA 3OYLA 2JD9A 1OI6A 1ETVA 2F48A 3S3MA 1UIJA 3NSTA 4XCAA 3JUUA 2A5YB 3F0CA 3MMYB 3KVAA 1ND2C 2R0QC 5M5WJ 1GXPA 1SC7A 2CTVA 2ZEXA 3ACIA 2GH8A 3IT8A 4W65A 4L8QA 2D6LX 2LY1A 1YI7A 2XSJC 3GCMA 1QEXA 3LPGA 2FMYA 3NNJA 4M00A 1MS5A 2D43A 2RJ2A 2D2WA 3BR6A 3S3OA 2RS51 5F0CA 3DN7A 3G4SI 2HQNA 2E53A 4MUVA 3AAFA 1SBEA 3EDPA 2OW4A 4D0QA 1BC7C 2WFPA 3FXRA 4J19A 2Y48A 1YFUA 4JV4A 3IMNA 1WJBA 1JS9A 4MGRA 5F0FA 3VSKA 1H88C 4ISRA 5IP6A 4UBHA 3KCXA 4N53C 5JZGA 1C57A 5JHUA 2YU1A 1SPPA 2NVYJ 1AYN1 1H8AC 5FB2A 3CF2A 4PK4A 2R30A 1JMUB 2A68F 3PSIA 1FMVA 3TEDA 3N05A 3I3DA 1IQAA 4AVAA 4WXDA 5EV7A 5CU1A 4N43A 4BXXJ 5JUVA 4MXWA 2ZNYA 1U8RA 5D5UB 1MQTB 3VZNA 1VRH1 1K45A 5CVJA 3VBSC 1PMIA 3WT3A 4OINF 5JI9A 3H0DA 3FHQA 4DMIA 1DQ2A 1H4GA 1ZM1A 1ST8A 2Y31A 1NLQA 2LALA 4DBQA 5F3CA 2EB7A 3N9OA 3D0SA 3GX4X 3HT2A 4BMEA 4QDQA 4YG3A 4OLLA 2K0GA 3BPSA 1EV12 4KWUA 4QQ2A 4YZ4A 3PFYA 3CCRI 5FP7A 4OQ8A 2BW8A 5KXBA 4P9YA 2ZCWA 3BG3A 4B4RA 5F5IA 3O8GA 3ZSMA 4UB6C 1U9OA 2MG4A 2YYOA 2K9LA 3THCA 3VGIA 1DYOA 3ABLH 4BISA 3ZFEB 3O1PA 2GN7A 2ZMEB 2EVXA 1QJFA 1ZRRA 4CDUB 5A3OA 1UOJA 3BDDA 3MPPG 4IW3A 2W39A 2WZR3 3PL0A 5A7SA 4CU6A 2VIXA 4YM1A 5I8YA 3TO7A 4I2OA 2TDXA 5APAA 1DPRA 3KS7A 1NLRA 2JJ6A 1HSJA 2W84A 3T0YA 3RDIA 1RC9A 2XAUA 5FRNA 5JXIA 3O1RA 2HOSA 3L09A 3VBUC 4M3BA 4CHUA 2BNOA 4FP3A 4P9XA 1ULDA 5FYHA 1XYNA 3AXDA 5BNPB 4XPVA 2MW8A 2TEPA 3R0RA 2XB0X 2LBFA 4IEVA 1S29A 1A6CA 3ZSEA 1QDOA 3WDTA 1UKGA 4CU7A 3KQ4B 1DGRN 2ZKNA 4DZGA 3ISPA 2VD7A 1ACIA 3ZMOA 4Q0VA 2DDBA 4IL6C 1EP0A 2GNDA 3LOIA 1V0AA 2CNAA 2J7MA 4YVWA 4E7IA 2Q5TA 4QDSA 2HDCA 4D8MA 1Z6TA 3PVNA 4XIKA 2CW7A 4XACA 4AEJA 1QJU3 2RMU3 4JDMA 3VKNA 3IH2A 4FFGA 4CE8A 2A07F 4XLPF 1UHWA 5IVCA 5EHDA 1CIYA 5C70A 4DXTA 4CYCB 4CCCA 2GA2A 1BHGA 2DF7A 5HVQC 2X09A 2STWA 1ULPA 4RB3C 4YSFA 4EGYA 3KM5A 1Y8QB 4YW5A 1VQMI 4QXCA 3LQRA 4E2QA 4G6DA 2KL4A 3L2VA 4Q1RA 1IXCA 5DM6F 2DA7A 1WZXA 4YW1A 1ETQA 2HOEA 4WVMA 2L01A 2CMPA 2NM1A 2QCSB 4ZKTB 4IHWA 4EVIA 1FYMA 3NWSA 1JH5A 2FSWA 1H8TB 4IETA 2BVLA 5HLGA 1WA6X 3BTAA 1N1VA 1FOYA 2QQ8A 2K9NA 3VOEA 1C0WA 2HFHA 4R9DA 4Y20B 4A0XA 1LOCA 2GC2A 2E32A 1WZ2A 5T5LA 3GTKJ 4N0BA 3M3YJ 5HCHA 2RM21 3SMHA 4AFDA 2JDAA 3SFZA 2K86A 2AEYA 4FASD 3K1PA 3QPTA 2BHZA 4KIGA 5E8IA 3Q8EA 2JG8B 2B46X 5LA0A 2JKXA 2HPIA 2HYJA 1XCVA 4NAMA 2XWBB 2J42A 5TSWA 5LBQA 3ZLIA 3M4OJ 4AFAA 3O0WA 4PDWA 2WN3A 3C7JA 1VQKI 2HTJA 3WP6A 3MVPA 2Y0SN 4H55A 3I3QA 1FNYA 3LNQA 4AG4A 4XDOA 1U2WA 3TNQA 4L9BA 2E1NA 1I1GA 1OJLA 1LKNA 2ZFUA 4QXBA 2BY3A 4LG3A 1IXRC 4Y7NJ 5IP9J 1MSFC 4AM3A 2ARAA 2YHJA 2VL4A 3HMYA 5E1XA 1LOEA 1LFPA 5FWEA 1OCRH 3MLKA 3TOAA 4LPLA 5IFPA 5LWBA 5BNOC 5IK7A 4ENNA 1U6GA 1OYYA 2IFRA 2QE3A 1LEAA 2K4BA 2QDRA 2CO5A 2B7EA 5ABJA 1RUI3 2J1RA 2PFWA 3GYDA 1GWKA 5CJ9A 1GVDA 2ICWG 2EFWA 4MQVA 4A3BJ 2KDZA 1TQ5A 4IESA 4XFHA 5FLHA 4CDWC 3W5NA 4K2EA 2D5HA 3PUSA 4AIKA 4DIQA 2MA3A 1XSVA 1X3UA 1VALA 5FYUA 1SDWA 1ZYBA 1PO13 4MG2A 1UW8A 4L5IA 2WZR2 2PEXA 1OUSA 2AR6A 3M1CA 5EGOB 3Q8FA 1I27A 2QZ3A 3WF2A 3DKQA 4CVUA 1Y8RB 1T98A 3S17J 1V5GA 3I2FA 4XZPA 1ULOA 2EA2A 3OL4A 2R7RA 1O5UA 4CZZA 1LESA 3ZN5A 3C3WA 1DU3D 4IEQA 4P14A 3W59A 3MV11 3DV8A 3RKXA 5E88A 2E2IJ 4FAHA 4KH9A 3H3VK 4ZHNA 2ZZJA 1WMDA 2DPUA 3OR1C 3N4MA 3F6OA 3E6MA 2FQPA 4IEWA 1ZRFA 4OVEA 3KCCA 3ZN1A 1D4VB 1V6NA 4HSTA 1CPNA 1QNWA 2R7FA 2W0XA 5FP9A 2B63J 3OOPA 1C8NA 2VBZA 1OVPA 2DBNA 2AZ5A 1B09A 4BK4A 5FZ0A 2V1XA 3LOBA 2J1TA 3HSRA 4ENJA 4MGIE 1STZA 4IEPA 5C8CC 1YO8A 4R9AA 3H5RA 1BW5A 3N7MA 1ZK8A 4IQ4A 1S7EA 3ZYGA 4OIPF 4KWJA 4EN6B 4D7TA 2Z33A 4ENKA 2E1OA 3SH5A 2OUMA 4MSVA 5FMBA 1G9DA 2ID4A 5JZGB 1I1EA 5LW9A 1SPPB 3BROA 1AL23 1MW7A 5KHDA 5AIPA 1AR61 1DGRA 1JU4A 2FRHA 5LA9A 1ZLKA 2W1QA 4EQVA 3O5SA 3HB9A 5H9RA 2X10A 4EM0B 5FY7A 1WHUA 1VIWB 4FPOB 3BTYA 3ZOBA 4GJYA 4JHZA 3I3LA 2D6NA 4OWRB 2DTRA 3DCQA 3CCVI 2IVIB 3SHRA 3E6DA 1SD6A 3B9CA 1JYXA 4AUXA 3A0NA 5J98B 4O61A 1W5SA 2W92A 4A3IJ 2QBXA 3WHCA 4YYOA 1DBNA 2PI0A 1P6RA 1T2XA 2IS1A 2PTMA 1LU1A 2WA4A 4G9SB 1BL0A 3K46A 1SLAA 1YIPA 1LGCA 1OXCA 3EQLF 1E57A 4Q4X3 1JUSA 4RQPB 3BGAA 3F8BA 5HOOA 1QDCA 1GV9A 4JKLA 2BU9A 2PAEA 1H2NA 4G6QA 1WBLA 3KV9A 1QGPA 5TGTA 1OPMA 4LD5A 4YLZA 3POFA 1NHAA 4UI9L 4C91A 4NUBA 1UY3A 2YGMA 3CUQA 4HK8A 2ZPXA 4META 1IN4A 3EB7A 2JA6J 1V3FA 1APLC 4RS5A 1MZBA 3GTQJ 4EE2A 3MZYA 5K7PA 2CS3A 4PZJA 3K2OA 2ZKZA 1AF9A 1QIQA 4A5MA 1RUI2 2PHFA 2CUEA 1DLCA 3IZOA 3BG7A 4ZXEA 1LNWA 1WD4A 2J1EA 4YVWB 4LMFA 4BE3A 5CISA 2Y0SA 2GP3A 4XFIA 4HZFA 2IVJA 1N25A 1GQHA 3KT7A 1Y9QA 3I8TA 4B44A 1IHMA 4RGUA 5GPCA 1PO12 2X9DA 3OYKA 3FIWA 4XBQA 3CF6E 2X6YA 3HGGA 4YGCA 3B73A 3X29B 4QPGB 3F72A 4NBQA 2ID6A 4B8EA 2P3JA 1CZSA 4YGDA 2OXBA 3CNAA 1TW3A 1XNDA 2KHMA 5FBJA 2MEV1 1E5SA 3AZVA 3A0KA 1T6BX 4W6YA 5CVVA 2XASA 2FDKA 2B45X 2XF7A 3O1UA 3HOXJ 1MBJA 3DPUA 2X5IA 5CPRB 1MMSA 1GNHA 3AKZA 4NE9A 4A3CJ 1YQ2A 2V09A 4XQWA 3U1DA 2H1KA 2RAEA 3NQHA 2DURA 4TV7A 2PMWB 4AIHA 5E1WA 1H4HA 2XAFA 3JZVA 2G7HA 5IYDJ 4ASNA 2Z1DA 1R5HA 3NAUA 3K4NA 3HJRA 4JTOA 2IFWA 1YX3A 1HN0A 1H6XA 4QX1A 2XVLA 4FXGB 3NAPA 4WM7A 3ZYJB 3C2BA 3GXOA 1P7IA 4XXPA 4A7YA 5B4NA 4RB2C 1UG0A 2B0LA 1F4KA 2CV0A 1WFXA 2OQ6A 2ADUA 3KSCA 2OC6A 4UFMA 3FLRA 2WNUB 1U0AA 2WO3A 4RDUA 4W8JA 1FYLA 1AL22 5C9AC 3NV1A 1IS5A 5FPUA 2ZJCA 4BOWA 4JKMA 1V6KA 2HYFA 1YWKA 3ZQ7A 2P3KA 4MGSA 2FQ4A 2ELHA 2A6ZA 4HNVA 1MGTA 1FC3A 4XJ8A 1WW7A 3VDDC 2QQPA 5CBLA 5FCCA 1RKWA 2YZ4A 1VRBA 2M7AA 4NIGA 3OBZA 3SZPA 4TYSA 3ABMH 2ELKA 4KU8A 1T95A 2VZVA 3ZQIA 3K4AA 3WG1A 5ABJB 5FLXZ 2G7UA 3AZYA 1GFF2 2F2EA 4CCEA 3AVRA 2OX0A 1ERDA 4LUKA 3UKGA 3CF5F 3K6GA 4COUA 1AOYA 3NNFA 5I0DA 4NMIA 1PMJX 1FX5A 5FKBA 3MIHA 2FZ1A 3Q3SA 3VBRC 4KUMA 4Q4X2 3WNNA 3PDQA 4CEWC 3KGLA 3HM5A 1WCQA 2JPBA 1PVC3 1JZ6A 3GM8A 5ICCA 2BXZA 3FXUA 3AJYA 1OR7A 1BR2A 2BTVC 3S7EA 3T3YA 1ZREA 3RWNA 3A23A 1W6MB 2ZO4A 1JTXA 4CU9A 3M7GA 2DVAA 3D8CA 3A2KA 2C5DA 4M6XA 3AFHA 2O8OA 1EV7A 1ODNA 2PAKA 2ZJ2A 4B47A 3AZZA 2O8KA 2XMLA 1RGSA 2BV4A 4LHSA 1TQPA 4LA3A 5D8KB 2XH6A 4HKOA 1Y39A 2XUMA 4BBSJ 3KYCB 3MO4A 1Q56A 1FTTA 1O4TA 1WLTA 4DUXA 3W6KB 5JVGF 3H92A 3UNGC 4WF2A 2P6TA 1YFYA 3O1TA 1M1EB 3T1LA 1CX4A 3C8XA 4PHZA 3O7OA 5GZGA 1T6SA 1Z05A 2CAVA 2E63A 2RS31 3FX3A 4PUSA 3K3OA 1ZG5A 2VR4A 5L9RA 5FR3A 1IC8A 2JXAA 3FXKA 3SZTA 5FXWA 4C8DA 1BLZA 4JDOA 2FD5A 4S05A 2Z5UA 3D6EA 1R083 1CWPA 1AR91 1DP0A 4I0WB 2WQZC 1C1FA 3I7DA 4KICA 3DTKA 4D9JA 5E1ZB 3PU8A 2K3FA 4HX7A 1LE8B 1UHMA 2CQXA 4ZZLA 3OCPA 1VBC2 2PLYA 5E3OA 1AA7A 3I2DA 4YZ5A 1QZYA 1RUF3 4BEHA 2XAJA 4NIDA 2VECA 3HGYA 5A6QA 1B35C 1W8TA 1TC3C 1TBXA 3VZKA 5A70A 2PHUA 1W9TA 1H2MA 4D6QA 5LY1A 5LA2A 4QX7A 3R4UA 1J9IA 5DZGA 2IXLA 5T5JA 4TSVA 1CGPA 3JSOA 1D1AA 2X0LA 3MYXA 2IXSA