3H3UA

Crystal structure of crp (camp receptor protein) from mycobacterium tuberculosis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
216
Chain Sequence
DEILARAGIFQGAIAALTQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
publication title Mapping conformational transitions in cyclic AMP receptor protein: crystal structure and normal-mode analysis of Mycobacterium tuberculosis apo-cAMP receptor protein
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 61
structure length 216
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h3uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h3uA01
2FQ3A 3FXQA 1R1UA 2EFPA 2EK5A 4CGZA 1JUHA 3IWFA 1CAXA 4S05A 3E6MA 4A0YA 1R1TA 5ICFA 1RZ4A 5D5WB 3GFJA 4LJZF 2PN6A 5CJ9A 2XRNA 1XN7A 1BN5A 5E8IA 2CWEA 1O3RA 1STZA 5ILUA 1XMAA 2DO7A 4WXCA 1SD4A 4M9SA 4U0VA 4N0BA 1QQIA 1R5HA 4LLGF 4MUVA 1PP8F 1CAWA 2F5CA 1BC7C 2L4AA 1J58A 1MJAA 1JHFA 5C8WA 3NL1A 2PTMA 2YU3A 3R0JA 1EY2A 2ACJA 3HOSA 5HI0A 1MD0A 3V8LA 3WW3A 2PQQA 2O8XA 2MNGA 1R5GA 5AIPA 2HYFA 1XGSA 1YFXA 1QPMA 4RB0A 2GXBA 2IXCA 5FLIA 5J3UA 1U3EM 2ZO4A 2YR2A 4HDVA 4JBAA 1UPIA 4ZYEA 5IT9K 5K5OA 3F8NA 1YTYA 4LK0F 3L2HA 3PQJA 2P4WA 4ENJA 4XFIA 3J7AO 4WX9A 1U8RA 2P6SA 1WKMA 2KIUA 6PAXA 4MGIE 2QNKA 1PDNC 3JTHA 1QWRA 4MGRA 1P92A 4KT5C 1ZH5A 3C3VA 1VP6A 2ZXJA 1WSUA 3VHRA 3KCCA 4A6EA 2D40A 1L0OC 4CICA 4MV2A 5LGUA 1OR7A 2K9ZA 2MH2A 5HLIA 3I53A 1H1IA 5FDBA 5A2QK 1EH8A 1PUEE 4YFNF 3LA3A 3RJPA 1WA4A 4Q0QA 4A5MA 2EVXA 2ZBKA 3KE2A 4KMFA 1FXZA 5CVVA 3SFZA 4OINF 5D4RA 2UWMA 2UXXA 4HYEA 3WGGA 1TW3A 1VTNC 5CVRA 4MQ9F 3CDHA 1D8JA 3QPHA 3D82A 5J7MA 3FZ3A 1ZRCA 1DGWA 5L3EA 2E7XA 5I8TA 2RKHA 1EP0A 5T3NA 1UCRA 3RIRA 3BDDA 3ROUA 2ZMEA 1BIAA 1FT9A 4HF1A 3IBMA 2F5DA 1S8NA 2L54A 3E5XA 3FMQA 1PP7U 1ON1A 5DCFA 3ZMDA 1XSDA 4EGZA 1QXJA 3FM3A 1QY4A 1FSEA 3WU1B 2VXZA 2IVMA 1YS7A 1LVAA 1YQAA 1TTYA 2CO5A 2K7LA 3LAGA 1L3JA 3FM5A 3U11A 2D1VA 1FNNA 4EWEA 4LLOA 1EH7A 5H6QA 1PMIA 3SMHA 3TQNA 5FLHA 2KXLA 3RPUA 2LNBA 2OYZA 4LD5A 5JR7B 3D0JA 1B9NA 2HTJA 1BM9A 4KA4A 4XEZA 1XGMA 3TGNA 4EMSA 3R6SA 1D8KA 4HQMA 2QENA 3H9AA 3GZ5A 5FFXA 4UNOA 1HW5A 3F3XA 4IRHA 2DPDA 2DPUA 2UZKA 3I58A 4OMZA 1QXRA 5JR3A 4PIYA 3I64A 1S6LA 3RYKA 2D5HA 4N9HA 3IKTA 5BS6A 3E5UA 4YSFA 3FJSA 3JAMK 3I59A 3RYRA 2P6TA 3I71A 2QBYB 4ASNA 4RD7A 3KZYA 3NSTA 3WTYC 1J59A 2OA4A 4I01A 1NE6A 2BEOA 5I8YA 1YHFA 3GBFA 5D5XB 3H3ZA 4XBFA 2JSCA 3N97A 5I91A 4IXAA 4Q0PA 1LKNA 3BALA 3ZDSA 2X0LA 1YFYA 2CYYA 2XKOA 4L2NA 4J1WA 2MC3A 3CEWA 5K5RA 1UCXA 3C7JA 4UV9A 3LWCA 4RGUA 4EM1A 1WWXA 5BPDA 1ZLKA 2XASA 2DT5A 4Z82A 2O61A 2QVOA 3NQOA 2FBIA 1X8MA 5FGMA 3FMRA 4LTAA 1XE8A 5KVRA 1MGTA 3DXJF 4RGXA 3DEUA 1F1ZA 4HF0A 3H1WA 4META 3MWMA 2D45A 4EM0B 3BJ6A 2IPQX 1S7OA 4RGSA 3PVBB 3V8KA 3BJOA 4FHTA 1BI1A 2KRFA 3Q9SA 4WWCA 1XSVA 4LB6B 3S7EA 2FMYA 2WV0A 1J3QA 1YFWA 4ETSA 5EEHA 4KIFA 4IRGA 3MYXA 1G6NA 1BI0A 4I02A 5FCCA 2JTVA 2I45A 4BYYA 3GUDA 5AONA 1KU2A 1K79A 4AVAA 4EQQA 4U0WA 1I5ZA 4P9UA 3LZZA 3L09A 4IERA 4YARA 4UVCA 1QO0D 4R8HA 3Q5FA 5LEKA 1IXCA 1R23A 2P7VB 4G9YA 3GO5A 2OU2A 5LEJA 1LDKB 4I3PA 4XRFA 1HXDA 3ST7A 3CO7C 1RIOH 3TDUC 1H0MA 1OI6A 3E3VA 4D7SA 1UIJA 1ZN2A 3F6OA 4EGYA 1DGRA 3ZN0A 1SFUA 2LKPA 2XKPA 3GX4X 2DAOA 4GGGA 3V7SA 2EJRA 4EJOA 2MBFA 5D6EA 3ES4A 4NHJA 4QMAA 3KP3A 4HOBA 2PHLA 2E9QA 3EETA 2BNMA 2F2EA 1QGPA 3SHFA 1RGSA 4L5JA 4MH0E 3KSCA 3G7DA 3R61A 2HR3A 2D5FA 4U7DA 4F8AA 4IHTA 1E17A 1ZRDA 1XMKA 2J5OA 2GQQA 4GCVA 1DZRA 1FI2A 4HSJA 4X6QB 4XF4A 1Q1HA 1O5UA 2XVCA 3PLQA 2OAZA 3ZMZA 4XLPF 3RZZA 1HW1A 4KFCA 3HSEA 3SXYA 3GW2A 5I0UA 3KMHA 1Y0UA 1S3JA 4QWQA 4QLCU 4ESJA 2IA1A 5LHIA 3R60A 2VODA 4CYDA 3CLPA 3LSTA 4OIOF 1KYWA 5FQ0B 1GQHA 2LF8A 5F64A 4KN7X 2KIFA 2VBWA 3T8TA 1XCBA 3VODA 2VOOA 1TQ5A 2L4MA 2C6YA 2OZUA 4L9JA 2A07F 2ET1A 5DCMA 4L11A 2YX7A 1XSXA 3QAHA 4QM9A 4AVCA 4MQVA 2GC1A 1IN4A 1IN6A 1V4RA 1XE7A 5TRDA 4QM8A 3VOEA 4YRDA 2GC3A 5L3BA 5JFRA 2G7HA 1ZRFA 2IRFG 2CV6A 1B4AA 1Q3EA 3LAPA 1R22A 4WXDA 5I93A 4HVRA 2M87A 2PBIA 4HN0A 2RVCA 2PFBA 2QQ9A 2Z9OA 3E97A 3F21A 1SFXA 3FHIB 2ZNYA 4LULA 2CW0F 4A0XA 2HJIA 1MJBA 3LQRA 1W5TA 1C0WA 3ETQA 4XF9A 2EFOA 1SAXA 1YFHA 4A12A 4FBFA 3P9KA 1W4MA 2RC4A 3HSFA 2LSOA 4KIBA 5HS9A 3KZZA 5LHHA 4CXFA 3HHGA 5J48A 3EO6A 5L3DA 1XD7A 3BY6A 2DCTA 1LDDA 2XAQA 3KFWX 2HTSA 5JI6A 2IXKA 1LRHA 2MLKA 1D5VA 2PMUA 4HMZA 2JPBA 2Q8KA 4QGLA 4LA3A 3FFQA 4KNYA 3EJKA 4CZZA 4XF3A 5D8LB 3SXWA 3SQNA 2YSRA 4IEQA 4XETA 3DKWA 2FXAA 1BIBA 4AIHA 1U5TA 1XRUA 4LK1F 2MHFA 3JTGA 3SCGA 4LG0B 1IXSB 3K2ZA 3B73A 2OZ6A 3BCWA 4P55A 4AWXB 5K8SA 3GXOA 2HEOA 2EFNA 2OBPA 3T8RA 3SZPA 3I0TA 4PGHA 1KQ9A 4IJAA 1OYWA 1XGOA 3WTVC 3BPZA 2PMHA 5L3CA 4X6RB 4PJYA 2B9UA 2MH9A 1O57A 3IL2A 4HV5A 3NKTA 3RPQA 3CUQA 2DFIA 3F8FA 5ILSA 3HTUA 1KGSA 2V09A 5FD6A 1IXRC 2GH2A 4QGMA 3RI4A 1J9IA 3BPVA 5D6FA 2E1NA 2ISYA 4LLLA 1CAVA 2VPVA 2FBKA 3P7NA 1IUYA 2IXHA 2FE3A 4MGYE 1TNSA 2VC1A 4KWKA 3F8CA 1IPJA 2B0LA 1Z7UA 1ZHFA 1W7PA 3ABUA 1RUNA 3QOPA 3U10A 2HKXA 3WGIA 2QDRA 3DQVC 1J5YA 4RB2C 2JT1A 3S0MA 2FEZA 3GWZA 2V1UA 1ZZ9A 4B29A 2ESHA 5IT9Z 1O4TA 1H9GA 4G7ZF 1IN7A 2EA4A 3RNSA 2XLGA 1Z6TA 1TW2A 3HIFA 3CUOA 3GLXA 1ZGJA 2M30A 3UKVA 2XGXA 1ZLJA 5DD4A 3K69A 1J75A 5E8GA 2E7WA 3QP5A 4ORFA 1SFEA 1FLIA 1G3TA 1SEFA 2EB7A 3CO2A 5E18F 3F23A 2ATFA 4HN1A 2ZFWA 1YFUA 2Q0AA 2NS0A 1RL3A 3H3UA 3OF1A 5F1RA 3ISPA 4GYIA 5CU1A 2FU4A 3G73A 3IC7A 5A2QZ 4MHGA 1ZARA 3L7WA 1JGSA 4IEOA 3GF2A 3TO9A 1OYYA 1B59A 3Q9VA 5FB2A 4BNCA 3QU6A 1EH6A 5E17F 5FLXZ 2ZNZA 1CF7A 1SD7A 5FLXK 1FBSA 5I8SA 2D2WA 1OFNA 2GA2A 5H6RA 3U0ZA 1FP2A 3TO7A 4HX7A 3T0YA 4M9XA 3DPTA 2VE9A 3ZMUA 4YIFA 4PZJA 3KLNA 4DNCA 5HVQC 1XCVA 3S7IA 5ILVA 4UVBA 2L01A 3EUHA 3WTZA 1ZRRA 2QZ8A 3LOIA 4K2EA 3NJZA 4HAMA 2M8EA 3WE2A 4YYOA 1R7JA 2FBHA 4HSLA 3P9IA 4ESFA 1YW8A 3KP2A 1LR5A 3HT1A 3ES1A 2VT2A 4Y15A 2XAHA 3IWZA 5EFUA 1FWZA 2RV8A 3SCFA 1DP7P 4M6XA 2OQRA 3V7RA 4Q5SF 1W5SA 1OPCA 3HRSA 1L3LA 2VBYA 1USSA 2TDXA 4EJVA 1HSTA 4KU8A 1MDMB 4A2UA 4KYWA 5TJJA 1P4AA 3RKYA 3JSPA 4Z2YA 2MLGA 3H1MA 4D7TA 5DYMA 1Z91A 4O9EA 3LAJA 1JXSA 4I09A 2GC0A 4N9IA 1QZYA 2Z3YA 4BHPA 2D1HA 3I4PA 3M8FA 1WI9A 4XSZF 1J7KA 3HSRA 1YO5C 4JK1X 3JAMZ 1SFNA 2L3DA 1X82A 1K78A 1FX7A 3O2PE 4S04A 3SZTA 2QUFA 1DDNA 2XLAA 2XROA 1G3WA 5JSPA 2BNOA 1O7FA 2MD5A 3W6KB 4WK8F 1T98A 3C3WA 2G7UA 3DN7A 3FMSA 2F4PA 3WW4A 1F9NA 3TKYA 3VB2A 2W25A 2BV6A 3ZMVA 4TLFA 2A68F 3DP7A 2IW5A 4KUMA 2PFWA 2CG4A 2C0ZA 1R36A 2G9WA 1YWKA 1KU3A 2STTA 4A6DA 4EROA 5JAXA 2NYXA 3KP7A 1CAUB 3J80K 1IN5A 4P5OA 2FOKA 4HV6A 2H27A 2EAAA 2DI3A 3GEZA 4UVAA 4HW0A 5DUKA 1AWCA 1MKMA 3F6VA 4M6YA 2STWA 1U6GA 5ED4A 4BQAA 2H6CA 4EJWA 2QVSB 1WLTA 4FX0A 1RTVA 1X7NA 3CTAA 4G7HF 4A5NA 3V8JA 2Z33A 5DEQA 4BH9A 1GXPA 1HBXG 2PEXA 4Q47A 2QYOA 3M70A 1YLFA 5DV5A 5LRRA 3L9FA 4DINB 1IZ1A 1XDSA 2EFQA 4XFCA 1TQIA 2PQ8A 1CAXB 3GYDA 3BU7A 1K7AA 3LWFA 4ENMA 3T1BA 1KU7A 1RC6A 3H1YA 5KK1A 2PAMA 3CO6C 4R79A 2P17A 3FE5A 2IJLA 1JE8A 4OIRF 3IHUA 2V1DA 4YG2F 5IT3A 5HDGA 3L00A 5JHUA 4AXOA 4RS8A 4RB3C 2A5YB 1CAWB 5FLJA 4PDKA 3WTUC 1UW8A 5BY5A 3R0AA 1ZX5A 3U9GA 2DQLA 3EQLF 4QX5A 3E6CC 3MFKA 4TV7A 5BUVA 5JSRA 2VBXA 3DF8A 4IESA 2V79A 4HLXA 4YFXF 5D4SA 5AIQA 3FXUA 3RKWA 1FC3A 3RDIA 2F5FA 3MZYA 3HOTA 3ERED 1G4DA 2K02A 2QQBA 1ZREA 4HLYA 2CAUA 4R52A 4BHBA 3WU0A 4HF2A 3USSA 2P5LC 1MZBA 2HWVA 1U2WA 4IHSA 2ZCWA 2GAUA 2UYBA 4MEYF 4FT8A 3E6BA 3BZ6A 3H8UA 1ZZ8A 1B6AA 3NRVA 3NEUA 2YX4A 4ZZLA 3I54A 2UY9A 3KP6A 4NB5A 3EHKA 3O6BB 2DTRA 3IDCB 4D0PA 1MJ9A 2VC0A 2OZJA 2DQRA 5DUIA 2AXLA 1TBXA 5CADA 3GYHX 2VQAA 2PAKA 2CSOA 3REOA 1EYBA 2WWYA 1JHHA 4U0YA 4YNIA 4HQEA 3EBRA 4XF0A 4ZYDA 2P8TA 3BB6A 4LGWA 4I2OA 3J81K 3OCPA 5BMZA 1RNLA 2Q4SA 4G94A 1RI7A 2DK5A 1ZG1A 3EDPA 4YIIA 2PJPA 1HW2A 2VE8A 3F22A 3IDBB 2ZMEB 3CJNA 1IRFA 1J3RA 4M74A 4BAYA 1R58A 5BPIA 3IKVA 4UBHA 3TNQA 5DDGA 3UKTA 2EV5A 3TOAA 4EM2A 4B8XA 2ISZA 4KMUX 3FF5A 4UXNA 2UYAA 3MDPA 5CVJA 2JPCA 5ERIA 2QWWA 4I7HA 3V7CA 4E2GA 4LMYA 3HTSB 4HZFA 4HX8A 2XV4S 4MEXF 3HQXA 2KJBA 4P9FA 2FNAA 3ULQB 1T0FA 1BBYA 5J8FA 2N7GA 1YS6A 2LF7A 3H7JA 3BJAA 1VR3A 5BXXA 3BROA 2O3FA 1Z05A 3MAJA 2IT0A 4EWAA 4IEUA 3TDZC 3K1PA 1MDMA 1FBUA 3M3IA 3FHZA 4OOIA 5LGTA 3BP8A 2OQGA 1YUDA 5L3FA 3K1NA 4IVNA 2FMLA 3ABTA 2DU9A 2HFHA 4WF2A 2RGVA 2ZKLA 3HUGA 2Y0OA 2H09A 4E2QA 1YLLA 1ULYA 2HOEA 4EVIA 2NNYA 4XFBA 4L9VA 1G3SA 2HDCA 2HS5A 2QBYA 2XAJA 2V6CA 4P96A 4A0ZA 4AD9A 1DZTA 2ESNA 1ZZCA 2HZTA 1PM7A 1S29A 1FOKA 1QBJA 2FSWA 2RN7A 5BPXA 4MNUA 1UHMA 1CX4A 1X8EA 3WTTC 3FZVA 1NXMA 3OD0A 1FYLA 3WTXC 4GULA 4JVAA 5FFZA 1WGPA 1DPRA 5FO5A 3CL1A 3RTRA 4HDUA 1FY7A 4IEPA 3PQKA 2Y0MA 2UXNA 3HRMA 4XFAA 1R00A 1OYIA 2Z69A 4AIJA 2O8QA 1H9TA 2PI0A 3ACLA 2IXJA 4LUKA 4OLLA 1YG2A 4ZYGA 3ECHA 2IXLA 4Q29A 4MTEA 2HGCA 3TO6A 1F5TA 2FF4A 3K0LA 5CYVA 2VECA 5JVTA 3GFIA 1NYWA 5LLQA 2HYGD 2EA2A 4ESBA 1QZZA 1CGPA 2FNPA 4BXUA 4HVQA 3BPXA 2DBBA 4P9GA 3LQQA 1BI2A 3IIAA 3FX3A 3MPBA 4L0ZB 1NE4A 1UFMA 5H20A 2K4BA 2A61A 4MGKE 1HKTA 2BGCA 5J6XA 4M73A 4J1XA 1IPKA 3MZHA 4NVPA 3CLOA 2Z5UA 2VN2A 2GA1A 5BV6A 3B02A 2GIVA 3K1MA 3WTSC 4OIPF 5HLGA 4WVZA 2Q30A 2EV0A 2OPKA 3M9AA 3TNPB 3F8BA 4IEWA 1ZZ6A 4LUMA 3F8MA 5E1RA 3HRUA 2EWNA 4M72A 4IEYA 1Y9QA 2CAVA 4IF4A 1DPUA 1GQGA 1O5LA 3IRQA 3R4KA 5KHIA 5LHGA 3DV8A 2BBYA 1O3TA 4QXKA 2NAZA 1REPC 3KGLA 2IXIA 2R7DA 2WTEA 1O3SA 3V4GA 2Y48A 4LLNA 1KQ8A 1FBQA 5HLHA 3E5QA 1ZAOA 1S7AA 2IP2A 4CDGA 2R3SA 4KWLA 1OKRA 4ZU7A 2XAGA 1KQ0A 2BYVE 4KL1A 3CJXA 1I6XA 3KEOA 3VEPA 2COMA 3F72A 2DLLA 1R1VA 2GXGA 4FAHA 3GZ6A 4KICA 2O03A 1RUOA 2GWRA 1SMYF 2FA5A 1T38A 4MX3A 4RB1A 3GFMA 2QCSB 5HS8A 3WE3A 4I0AA 5LBQA 3MQ0A 4EJUA 1B1BA 2BE5F 2MA3A 3WG9A 4E70A 2VOPA 5FQ0A 2GC2A 3OV8A 4H7LA 4XFHA 5DCMB 1SMTA 1ON2A 4XFGA 2JRTA 1TQPA 1UIKA 2FQPA 4GXOA 2XHKA 4AQ2A 2ADUA 2W84A 3KP5A 2PAEA 3I5UA 1YYVA 2QQAA 1FZPB 3D0SA 3PFIA 1BOAA 4WZCA 1HQCA 1GHCA 1I27A 1FYMA 3KETA 4RGRA 4I98B 2RNJA 1Q5OA 1UB9A 1D3YA 2Z2SB 4M9ZA 2GU9A 4AQ6A 4U88A 5L3GA 3ZPLA 1QNTA 3QPTA 5E1WA 2XIGA 1T6SA 5ICCA 1YW9A 4G8XA 4YFKF 3WGHA 3JZVA 3KLOA 1USTA 4LA2A 4AVBA 3O14A 4BHCA 3T5XA 5E1ZB 4OU0A 3SCHA 3S2WA 4ONUA 4PIXA 2HQRA 5D8KB 3RYPA 1IN8A 4U7BA 4ENKA 1HSJA 5KHHA 3DL3A 3DPLC 2Q1ZB 2M5WA 5I0RA 2QLZA 1WRJA 4WXHA 1J0RA 3ZN1A 4JQFA 4CHUA 5LGNA 4LB5A 2NNNA 5FD5A 1UHWA 2RDPA 1Z1DA 2KIMA 2EV6A 3UKNA 2D93A 2O0YA 2H6BA 4UV8A 2PG4A 4ZYHA 1ZGAA 2KJCA 2W24A 3QP6A 2P5VA 1ONVA 3H50A 4JTNA 3MCZA 3D5LA 2XUBA 4KU7A 3QACA 2JZYA 3J80Z 1U5TB 1SQ4A 4H0EA 2AS5F 3L2CA 3DFGA 3HT2A 3G3ZA 1DUXC 1EPZA 2ET7A 2OA2A 4LG0A 2B5HA 3LA7A 4LEJA 1AOYA 1BI3A 5E20A 4XSXF 2IC1A 2IA0A 2YPRA 1V70A 1J3PA 1O7LA 4Z07A 4NQWA 5BOXA 4KIGA 2BNNA 1ZZBA 4E2SA 4UHTA 2EA7A 1XB4A 4IEZA 1XGNA 1ZG3A 1J1LA 4UXAA 3CUQB 3QU3A 1H1MA 4ON0A 2Z99A 4HBNA 3HHHA 5CLSA 2PLYA 4PCQA 1V3FA 2ELHA 2OD5A 3WW1A 3W6JB 3M1EA 3NVCA 1CAVB 2WC2A 1KU9A 4KWJA 5HS7A 2W85A 1Z6RA 4HLTA 4XF1A 1SD6A 2V1XA 1LDJA 5C6CA 1F4KA 3ML6A 4M71A 1TQMA 4ZU4A 4Q0VA 3ZMSA 1W7PB 2ZJ2A 2VONA 2V9VA 1LB2A 2DW4A 2DK8A 3BOQA 4Q0UA 3JW4A 4O3MA 4F7ZA 4G6QA 4IEXA 4AIKA 3LA2A 4G6DA 4O5VA 5FPXA 5I0SA 1KA8A 3HYIA 4HA8A 2M1BA 1NZCA 4HX4A 4K8FA 4AVPA 3K9TA 3FXRA 3BWGA 5KHGA 2A3SA 1P2FA 2RQPA 2A6HF 2H94A 4EV0A 4MTDA 2PYTA 3ELNA 4KDPA 1OMIA 3TOBA 4ZH4F 4ENNA 5BQTA 2IA2A 2K86A 1WQ2A 1TNTA 1VJ2A 1B9MA 2W57A 3KP4A 1FP1D 3O3KA 5D5VB 5HDKA 4L18B 4QGNA 1Z9CA 1O3QA 3P9CA 2CGPA 4Y13A 3WTWC 4Y17A 4Q4ZF 1LQ1A 4L0YB 4FX4A 4RAYA 4LFUA 2LDUA 3QRFF 2PA7A 1U12A 1SD5A 3AAFA 4UBGA 4B09A 3M7GA 2PHDA 1HKQA 4L9TA 2ETHA 1U78A 3WW2A 3ZQ7A 1T39A 3LFKA 3KGZA 4O6JA 3OTFA 2FRHA 5J8CA 4GO1A 1X3UA 4XLNF 1BC8C 4IEVA 5AVPA 4IPAA 1CF7B 4O9GA 4MGZE 1LNWA 2P5KA 3J81Z 3NW4A 5DD8A 1TLHB 4RAZA 5EZWA 3HRTA 4ZU5A 1GXQA 1ODDA 4L9NA 5KHJA 4FAGA 4Q48A 2P7CB 2H0VA 3VFZA 4G7OF 3C1DA 1HKSA 3GFLA 2Q2EA 3E6DA 1KYZA 5FPZA 1ZYRF 2VBZA 3IRRA 4OMYA 2L02A 4PGGA 1FSHA 2F5EA 2QJVA 4EWDA 1U5TC 4L5IA 2E1CA 1ZVFA 1P4XA 3H92A 2Y75A 3U1DA 2GZWA 4HBLA 5D5UB 5KHKA 3COAC 1IW7F 4WCGA 3SHRA 1FPQA 5KBFA 2KKOA 4I0BA 1NHAA 3KEQA 4Q0SA 4GYGA 2NRAC 3RKXA 4OFGA 5EEGA 4BIFA 1YW7A 5K5QA 2J5PA 3ECOA 4ZZDA 5E1XA 5JSOA 2Q0OA 2XL7A 4HVOA 1P6RA 5F6FA 2EFWA 1UD1A 3EYIA 3OGJA 4XFFA 3GVAA 3ZP5A 5I0TA 5CVUA 1J2XA 3CUQC 1Q43A 2HKOA 2VT3A 1IAWA 3EQEA 3PNAA 2A6EF 1BJAA 3OOPA 1OD5A 3CF6E 1P4WA 4MZUA 3H7YA 1K78B 2CFXA 2K4JA 4KN4X 2CQKA 4UUVA 2K27A 1XDUA 3I59B 3WODF 1ZNPA 3MEXA 2MPFA 2X4HA 4R1HA 4DQ2A 2XLFA 1I1SA 5K1YA 1IF1A 2O6GE 3C18A 1G3YA 4EJTA 1Y3TA 4OIQF 4PIZA 3ELKA 1K6OA 2HQNA 5LRSA 1EV7A 4JV4A 1W7PD 1I1GA 3FWEA 4WBBA 3N4MA 2M45A 5ICEA 3JSOA 2XL9A 1T2KA 4IRIA 2UY8A 3EYYA 5HDNA 5HOOA 1E2XA 2B8MA 5E16A 5JCTA 1CAUA 4JTOA 2ETEA 3U2RA 2ZKZA 2K0GA 3M8EA 1LEAA 1IRGA 5D1IA 4IETA 2R7FA 1GVJA 5CVIA 3ZMTA 1LEBA 2O1QA 1LJ9A 1FYKA 3I7DA 1ZZ7A 5ICGA 1A04A 2QM3A 2A69F 1YIOA 2WFPA 1ZG5A 4CO8A 2XAFA
chains in the Genus database with same CATH superfamily
2WAAA 2FQ3A 5FXWA 3FXQA 1GZ9A 2EK5A 4CGZA 4NHMA 4XURA 3WNNA 3O8GA 3WHBA 4XXPA 1IS3A 5IK4A 3W2VA 2RDQA 4JX0A 1W0OA 3GFJA 1RMU2 1XN7A 3CCYA 1HRV2 2ZGMA 4ZYAA 1O3RA 5FR3A 1IS5A 4U0VA 2GSYA 1QQIA 1S0EA 5FUNA 1G8WA 1PP8F 1CAWA 1J58A 1MJAA 4CU6A 4M3CA 3OBZA 5HI0A 4NC7A 3V8LA 3BG3A 2DA5A 2MNGA 3HOZJ 2HYFA 1WLWA 2LBFB 4IQ4A 3ZFEA 4IQPA 5FLIA 3ZM8A 3IKWA 3N9OA 2WAFA 5L73A 2ZO4A 2MEV3 1ULOA 5FYTA 1TNRA 4JBAA 4QDQA 5K5OA 4DZJA 1ZBA1 3L2HA 3BZCA 3BPSA 4WX9A 2V73A 2P6SA 1VBE2 5EGOB 1DF0A 2FDGA 1WKMA 6PAXA 1LOBA 3CNAA 4CCLA 2WNVA 1H6YA 1JZ7A 3JTHA 2ZHKA 2VZVA 1ZH5A 5F32A 5IVVA 1WH7A 2D40A 3M3CA 4HXCA 2VD7A 3AK0A 1D4M1 2K9ZA 3DWLE 3VDDC 4TTGA 2PMZA 4CUAA 3LA3A 4XAEA 4COZA 2WSVA 1OVSA 4A5MA 4Q0QA 2EVXA 2HPMA 3KE2A 2ZXIA 4KMFA 2M2EA 2OCEA 3BR5A 1KGYA 4YLZA 2OUHA 4BQ1A 5SV5A 4AI8A 2E1OA 4BA6A 1R4MB 5F2SA 5CVRA 1HQWA 2HWF3 3PJQA 3AJZA 2E7XA 3KHCA 2RKHA 3I2IA 4A7YA 4IW3A 5CIRA 3ROUA 2ZMEA 3FK7A 3O12A 4QWNA 1FT9A 2ZMKA 4FP2A 3IBMA 2F5DA 1S8NA 1ON1A 4W4ZA 1XSDA 2DODA 1FSEA 2P37A 1QPIA 3ZFGB 1YQAA 1TTYA 2CO5A 4LLFA 5J37A 1L3JA 4QB6A 3AYAA 2D1VA 1FNNA 4EWEA 3VSLA 1H2MA 1VQ6I 1PK6C 1MEC1 2YU9J 1WLCA 2KXLA 1PIV1 4FETA 3RPUA 2OYZA 4LD5A 2M9HA 5IVCA 2QQPA 3D0JA 1BM9A 4CUCA 3HWJA 4E7HA 3KB5A 3TGNA 2P3IA 1UZCA 5FFXA 2WT2A 4RM2A 3POFA 2I74A 4RLFA 2DPDA 3OMYA 5DM6F 4NPMA 1RYYA 5JR3A 4COWA 4M00A 3HL2A 2ZX0A 4YSFA 3OIOA 3FJSA 2MD0A 3I59A 3I71A 2JA6J 1ZGWA 4RD7A 4AI0A 1UMZA 1UNBA 2QFEA 1J59A 3HJEA 1QKQA 2BEOA 3GBFA 5D5XB 2JVGA 2EZKA 2FDKA 2JA7J 1JJ6C 3T09A 2ZOEB 1W6PA 1CZVA 3ZDSA 3CMAI 1YXWA 3ZN6A 2Y0SN 4L2NA 3K4AA 4J1WA 2MC3A 3AL0C 5FAXA 3AYDA 2E19A 2WA3A 2RS51 4MVTA 4B3NA 2WNUA 3WG3A 4EM1A 2VCBA 1ZLKA 4DUWA 1X1DA 3CD6I 1GDTA 4LTAA 5A6QA 5A3TA 2R5ZB 3S16J 2X10A 4HF0A 1CWPA 2OT7A 4PJMA 1TT5B 2X6YA 2IS2A 5IVYA 4J19A 3A01B 2PJRB 5CQEA 4Y5SA 2WQZC 4LKDA 1HXS1 4RGSA 3V8KA 3BJOA 1BI1A 3H35A 1YFWA 1J3QA 1ZBA2 2CUEA 5EEHA 4IRGA 4YELA 4QDRA 5BNNA 4I02A 4M3FA 4XOGA 2K5CA 3WCRA 1SLIA 1KU2A 2ZPXA 4CCJA 2LD5A 1A34A 3GLLA 5IVEA 3HN1A 1QO0D 4Y5Z0 5LEKA 1IXCA 3NWTA 5H9QA 2O9LA 3PJRA 5LEJA 4G3YC 4LT5A 2XGEA 4XOPA 2UWCA 1H0MA 1OI6A 3DU6A 1D4M2 3N35A 4WM7A 4M3EA 5FZ0A 1SFUA 2LKPA 4Q2FA 4DUVA 2IFRA 4GGGA 2W1UA 1DQ1A 4KBZA 3IP4B 3ZFFA 3ZMOA 3T0DA 5AC93 3ES4A 4NHJA 2CMPA 4HOBA 1QGPA 5C3RA 1K42A 3THTA 4B1LA 3ZFGC 2B9SA 1UAIA 4U7DA 1BJQA 2D5FA 4F8AA 2MEV1 1XMKA 2J5OA 2QZ2A 4GCVA 1DZRA 1FI2A 4XQDA 2JQ7A 3DPUA 3W2WA 1LOGA 2Y6JA 2XVCA 1JYVA 4H14A 2E32A 1AYM1 4XLPF 5CISA 1HW1A 5I0UA 1U0AA 3M3EA 3AKSA 4Y1YA 3POBA 1I50J 2O0OA 4YZ2A 1QOTA 4QWQA 4AL9A 2XJTA 3POIA 1PVEA 4UFKA 4AGGA 4RN5A 1FOXA 5GZEA 3FLTA 3A4CA 2DFBA 2JEMA 4W50A 3LSTA 5FQ0B 1GQHA 5F64A 1MEC2 4KN7X 2KIFA 1R092 2VBWA 1JTXA 1PIV2 4MYEA 1QRYA 2WO1A 4L9JA 3JRDA 3N9QA 1XSXA 1MS8A 1IN6A 2LM3A 3JQXA 2E2IJ 5FZAA 1TWGJ 2DXIA 2VL8A 3O1TA 2CQXA 1SACA 3KYLA 5L3BA 5JFRA 3NARA 2QSHX 5FKLA 3TW6A 2BP6A 2DUPA 2R30A 5IPAA 1PZ7A 1Q3EA 2HWF1 1W06A 5DUWA 1R22A 1UG2A 1WPKA 5FXXA 2JWTA 2X8KA 1SFXA 3FHIB 1WMFA 3CJIB 2FCVA 2Y26A 1MJBA 2VOKA 2EFOA 2QQNA 4XM3A 3OWTA 4EYUA 3C7FA 3HSFA 2VY0A 2LTNA 1XNBA 4CXFA 5IAXA 2VASA 5J48A 3EO6A 2RS52 2YYOA 1IG7A 4DJAA 5LK5A 1U9OA 1LDDA 3POGA 2Y6HA 3SYTA 2LOOA 3KQ4B 5JI6A 1UY1A 2RJLA 1D5VA 1QJEA 1NUKA 3RMYA 2KA3A 3AMNA 2B4KA 3VWBA 4LO8A 1A6QA 1J83A 5M3MJ 4QKBA 1M4WA 2ZKNA 4CZZA 4LKFA 5D8LB 1HXS2 3SXWA 3K2AA 5B2GB 1WFXA 5A3PA 2W0XA 2QE3A 3DKWA 2WL1A 1JI8A 2BVMA 4Y52J 1XBFA 4HETA 5JI7A 5GP9A 1TL8A 1VE0A 2Q8DA 3KYCB 1ZQ3P 2A6WA 2OZ6A 2CH0A 2YFUA 3BCWA 4AR2A 4AWXB 2HWD3 3GXOA 2HEOA 2W95A 4BISA 3I3QA 3T8RA 3I0TA 2XMLA 1MIJA 2IAIA 4IJAA 3CCVI 3BPZA 2PMHA 5L3CA 1PGL1 4PJYA 1IV8A 3P6BA 2X09A 3IL2A 3T4VA 2TBVA 3F8FA 3HTUA 2V09A 5FD6A 3ZQCA 2YS9A 1HDKA 1BR2A 2FZ2A 4UFIA 3BPVA 5ACA1 4HKLA 5J09A 4QX1A 2ARCA 5T5JA 1K4SA 4DEQA 5DDJ1 4KWKA 4PDWA 3VBSB 2Y34A 5E3MA 3QOPA 3OPWA 5FPUA 3VD7A 2A7AA 2HH9A 4CDWB 1LEMA 3DQVC 4BKXA 1J5YA 1IO2A 4HPQA 1AYM2 3GWZA 1UO9A 3THCA 4B29A 2ESHA 1JZ5A 4AIDA 2EA4A 1JYIA 3CMMA 3TEZA 2G9FA 3H9JA 3HPGA 3TOJA 1TW2A 2VI6A 2GDFA 1VQOI 4BUPA 4KGQA 4NHYA 4JGYB 4A3KJ 4SLIA 5DD4A 3K69A 3HPNA 3G6EI 2JDKA 1SFEA 1W6QA 1BKZA 2DDUA 2YC4A 4I0WB 4Y20B 1QGLA 3KYDB 1BOBA 3EMRA 3DKYA 3JRAA 2ME0A 1YFUA 3I3EA 2BUKA 3CIHA 3I3DA 3RGBA 4COUA 3OF1A 1RUE3 1GANA 4A3JJ 4FTEA 4RFRB 5CU1A 3FHNA 3CJIC 2E60A 1MPXA 1JODA 1R1A3 1MBKA 1OPMA 1YJ9I 1ZARA 4XMIA 4UUTA 3W20A 3GF2A 2HWF2 2OVUA 4A6OA 1B59A 4BQQA 5G04L 3JRIA 4YG6A 2EZIA 1D0GA 1LU1A 4Y24A 3QU6A 5FLXZ 5FRAA 4MO3M 4FPLA 1SD7A 5FLXK 1SFOJ 2ZSHB 5I8SA 2D2WA 2UU8A 4RBOA 2GA2A 5H6RA 2GXAA 4HX7A 1VBB3 4M9XA 2LUWA 2VE9A 4GAZA 1RUC2 1OISA 4MSVA 5HCHA 3WY6A 3WV6A 2LY1A 3U4SA 2HEWF 4QHOA 1AL23 3NJYA 2L01A 2XDVA 4XHXA 5KNLA 4IHXA 1ZRRA 2QZ8A 1IUFA 4K2EA 3NJZA 4OHVA 4CSWA 2VQHA 2M7AA 4Q4W3 1LR5A 1T95A 2VVFA 4Y15A 3EUAA 2F4LA 1XPWA 1FWZA 2RV8A 3SCFA 2N8GA 2V26A 4FTBA 3D3AA 4K1YA 3NAUA 1MBJA 4YW7A 2VBPA 3ZLIA 1OPCA 4XKVA 4QKDA 3MW4A 2VUCA 1LECA 4Y33A 2VBYA 3K77A 4EJVA 1HSTA 2GNTA 4A2UA 5A33A 1UJ8A 3IH4A 3VDDA 1RUI1 4D7TA 5DYMA 4O9EA 4LORA 4B48A 1QZYA 2VCMA 1S4CA 2IGOA 3AG3H 2JDMA 1A78A 3MO4A 4Y1UA 4YWAA 3JAMZ 4XQFA 3A0KA 3O2PE 4S04A 2XLAA 5JSPA 2XROA 1PGL2 2BNOA 1KXGA 1D7PM 3W6KB 2OKXA 5T5OA 4M3BA 4FTSA 1T98A 2XB0X 3C3WA 3CDLA 2G7UA 3VD5A 3DN7A 3FMSA 3VBSC 2K3PA 4Z2WA 2VJJA 3VB2A 2QQ8A 2WZR3 3ZMVA 1JZ3A 2Y6FA 1LGNA 1HLCA 1DP3A 2PFWA 1YRZA 1R36A 2JUCA 4CDWC 5ACA2 4XJ9A 1UZVA 2RS11 5FK7A 3BTJA 1QA6A 1CAUB 3J80K 3O1PA 2FOKA 5DDJ2 2DI3A 1POQA 2QKLB 2BFUL 1U6GA 5CEHA 1PNGA 1PK6A 5FY7A 3OOUA 5TISC 5C71A 3M7AA 4XMYA 2Y69H 1X7NA 2QDNA 4XZPA 4G7HF 3K48A 4JGYC 2RV9A 4P9YA 2HWB3 2PEXA 2RREA 1TG7A 1YLFA 2EIJH 1ULCA 5LRRA 1TNFA 1WCSA 4FFIA 5IYCJ 1Q8QA 3D6EA 1QF3A 4XILA 4XUQA 1CAXB 2PQ8A 3THDA 5FYBA 5FPAA 4FOWA 1T08B 1S7EA 4YPJA 4AFAA 3J7MA 1V6KA 2BXZA 5DTDA 4OIRF 5F3IA 1NAEA 4OAZA 4AOCA 2JK3A 1QU3A 4YG0A 3LSDA 2I5UA 3KCXA 4A3ZA 3OS2A 5HXVA 3WTUC 3CZJA 3ZYIB 4F83A 4CCKA 4FPCA 4CXXA 2RJKA 5JSRA 4IESA 2IEKA 2CQQA 4GIQA 5IFTA 5AIQA 2LBFA 3TAYA 3HOTA 2VNOA 5GLVA 4CDUB 4IXLA 4FOYA 1ACCA 1E5SA 4XICA 3LSRA 4HLYA 3WU0A 4XW3A 4P14A 1VQKI 3H36A 3WDXA 5FZDA 1K6YA 2WNEA 5DZEA 2O8KA 3ZYRA 1DGRN 5EGOA 2E51A 2HDWA 4CTEA 4QQ2A 3OUHA 2IUWA 3VBFB 3WVJA 1WJAA 3NRVA 3MFAA 4FSJA 4HKOA 4XQWA 3IV5A 3EHKA 5KCMA 4BJ5C 3JR9A 5DUIA 1H6XA 5CADA 3PSIA 3CCRI 2KDZA 1RUE1 4CDXB 2WAOA 2JXAA 3EBRA 2VUAA 1MZ5A 4ZYDA 1B35B 4D3WA 4D9JA 3ZXEA 4YIRX 1X9PA 2W46A 1JU4A 1K12A 3OCPA 1RNLA 5KXCA 1ETWA 2DK5A 5FYVA 1NXD1 3FLPA 4YIIA 2X5IB 4IZZA 1AKHB 1HW2A 4Y3OA 5FKMA 2O7OA 3F22A 1RUI2 1J3RA 2CV0A 3M8JA 2WIIB 4BAYA 1R58A 5EG0B 4ZS3A 5HPOA 2SLIA 1W8TA 4UBHA 2KP6A 5H2FC 3UKTA 3KX2A 4EM2A 1LEDA 1VBB1 3WCSA 5F0CA 2NVTJ 3LPGA 1SC7A 3LF7A 4I7HA 1RUH1 3ZFGA 5CA6A 4E2GA 4LMYA 1AL21 3K70D 1AZDA 3HQXA 3ULQB 4B43A 1JKOC 2RR13 2QQVA 2DBIA 3FKJA 3HKZN 2JX9A 3GCWA 1A3KA 5BXXA 1RITA 3JU9A 3K46A 2E34A 4HFSA 2WWJA 4EWAA 4E27A 2RS12 1MDMA 3M3IA 3FHZA 3H5AA 5LGTA 2FZ1A 5FRMA 2OQGA 2YU1A 4AFMA 4HL0A 3WX5A 1JYWA 5L3FA 2FMLA 1C8M3 2DU9A 1HJFA 5IVJA 2ZKLA 1JMUB 5EQUA 1STMA 3VZOA 1C1FA 2DVBA 4BJ6C 3QLQA 1OF4A 2HDCA 3ILNA 5FRNA 4B4QA 4GFBA 3OIQA 4AD9A 1ZZCA 4KITB 1IRZA 2ZGSA 1NLRA 2EILH 1UHMA 4JQTA 1O8SA 3CCMI 1G2HA 1ETKA 3FZVA 3ZX7A 2RMU3 4JVAA 1QOOA 4GULA 1MVQA 1WGPA 1DPRA 2XVKA 2XGDA 4N8MA 4UB6C 3IDEA 1H1AA 4CDUC 4BOWA 3DYMA 2Y0MA 1POGA 4BQWA 4EN9B 4XFAA 2X1DA 2Z69A 2CDOA 1H9TA 3R4SA 4CEYB 4BE2A 3ACLA 4LUKA 4OLLA 2R5ZA 3V0AB 3RJRA 2XOMA 1W2AX 4ZYGA 2DT6A 1LOFC 4MTEA 2C26A 3A01A 2PJRA 1X2NA 1C8NA 3ZYFA 1S9HA 5IOYA 1F5TA 1X9TA 4I6ZA 1EUTA 1R6RA 4NJ4A 1NYWA 3AMPA 2LW8A 2AQFA 4FI9A 5A70A 3CF5F 4FFHA 1OR7C 1RUF3 3QYFA 3TP0A 2NPIA 3IIAA 1FPN3 4QX0A 4L0ZB 5GZGA 1UFMA 2BGCA 1FATA 4CDXC 2QQWA 3BOPA 2GA1A 5BV6A 1ZKGA 4BQ5A 1B35C 3WTSC 1GLHA 1XPXA 2Q30A 1OXCA 1JJ8C 2NS8A 4S0HB 2W5FA 1SCRA 2W91A 3ALQA 4JKLA 4NWWA 1PZ8A 4CDQB 1OT5A 4XJAA 4AVZA 5FYMA 1RUE2 3R4KA 2ZB9A 1W99A 4YM2A 2LYCA 4IX7A 1W0PA 2R4GA 1I6HJ 3V4GA 3AXDA 1FBQA 2WYFA 2YV8A 3CC4I 3C2HA 1A31A 2LH9A 5F0HA 3IDAA 4BY1J 3DBRB 1JBCA 1OD3A 1ODMA 4CDGA 4D6QA 1G9DA 4QU1A 4UUSB 1I6XA 1R1VA 1VBB2 4FPOB 2GXGA 4OCTA 1UYXA 1MH4A 4JRAA 3RZHA 5K0UB 4QB2A 4CZCA 1RUH2 1SMYF 2FA5A 2VC9A 3IM0A 1VNDA 3WE3A 3PIGA 4EJUA 1VAKA 5M5WJ 1N1TA 1JKQC 4E70A 2VOPA 1OH3A 5FQ0A 4DXSA 4H7LA 4XFHA 4ZXEA 5DCMB 2B39A 3IT8A 2FQPA 4GXOA 2XHKA 5C4JJ 4RHV3 2PAEA 2K40A 3QYBA 3FFZA 3RVHA 4AAXA 1I27A 1FYMA 4YW1A 3SKVA 4I98B 1UG0A 2Q5TA 2AGSA 4D5FA 4M9ZA 4EEFG 4MXWB 1AR93 1Q8SA 5KXBA 2VQUA 4AC0A 1GWKA 4Y22B 4ATFA 4C91A 3H1CA 3THPA 2J22A 2K3FA 1OCCH 5C3EJ 3JZVA 2VBBA 3INAA 3I2HA 3CJIA 4LA2A 4AVBA 3O14A 2ES3A 4YM3A 3N9PA 2XJVA 4XHBA 4ONUA 1VMFA 5D8KB 3AZZA 3MEPA 3N9MA 3U4XA 1URXA 2W92A 2G0EA 2Y6GA 3DL3A 4A69C 1YJKA 2M5WA 2ZEWA 1KITA 3VL8A 5I0RA 2PN5A 5F3GA 2QLZA 1LULA 2J1EA 3PUFA 3ZN1A 3RI8A 1N78A 4P1WA 4LB5A 1AJKA 2ZAHA 1UHWA 2JG8B 4AQSA 4EN8B 1OLME 5FZ7A 2ZX4A 2Y0SA 5KXDA 2BHYA 4GDFA 2P1BA 2O0YA 5LK7B 1IGOA 4ZYHA 2TEPA 1GZWB 3B9CA 2P5VA 3MCZA 1ZM1A 4CYCB 4FQ4A 2XJUA 1CVNA 4QQOA 1MBHA 3I2OA 1R5ID 4H0EA 3S5AA 3L2CA 3DFGA 3OYHA 3GTQJ 2R7RA 1EPZA 2OA2A 3ASIA 4L92A 3LA7A 2IC1A 2IA0A 2YXSA 1V70A 4LITA 3VKLA 4Q4X1 5M5XJ 3U21A 4E2SA 4DW6A 4CU8A 4ZDLA 2RMU1 1NCQB 2D7FA 4L99A 4LO4B 1KRIA 2X48A 1OA2A 2P34A 2AEZA 2R7QA 5CLSA 4PCQA 1OH4A 4JX6A 2H1LA 3W6JB 2R32A 4IE4A 3A7QA 2VOVA 1KU9A 4KWJA 1ZK8A 4CCOA 2OW4A 2W85A 5BNOB 4C30A 4EZ4A 4XF1A 3CZ6A 5TSWA 2V1XA 4B44A 5HCFA 1KONA 1TQMA 5K0UC 3VBSA 4LHSA 1XG1A 3ZMSA 1O6UA 2V9VA 2WO2A 3C7GA 1GU3A 3JW4A 4O3MA 3EYPA 2WRAA 1YQ6A 1FOD1 4IEXA 4AIKA 2Y6LA 3AP9A 5IP6A 4CDWA 3HM5A 3SC7X 4HA8A 2ZGQA 2OF7A 2V4AA 4XJUA 5F27A 4AVPA 1S72I 1FPN1 3L2WA 3BWGA 2WFF1 4Q4V3 3K4KA 1UXZA 4Y7NJ 2A6HF 2H94A 4BWOA 4AEJA 3N7JA 4P9XA 4KDPA 5FYHA 5GTIC 3AKQA 4YGDA 4AAPA 1WI3A 4ENNA 4LIVA 4BS9A 4JGYA 1RUJ1 2LRPA 5F1JA 3J8F3 5EXOA 1AU7A 1TNTA 1VJ2A 3K3OA 1AF9A 3A21A 1I3AA 2HWC1 3B93A 3O3KA 5HDKA 3WG2A 1Z9CA 4Y20A 4XLHA 4PUSA 2VNVA 3KZIC 4Y17A 1UN1A 3SH3A 4Q4ZF 4FX4A 1QJY3 2ZX1A 4RAYA 4LFUA 2VVDA 1Z7S3 2WA4A 3LFMA 5H9SA 5IUQA 4CCDA 3QRFF 1XNDA 1N47A 3S6PA 3WDWA 3LIHA 3BGAA 3I4IA 3WW2A 5FZFA 3OD4A 1UYYA 4O6JA 3OTFA 4IE7A 4JDMA 4XUOA 3OBAA 1V6JA 1VRH3 3J81Z 3NW4A 1TLHB 4Q8LA 1VQPI 3ZSKA 5B1AH 1BYHA 2L7FP 2R7ZJ 5ISLA 2VOTA 1LHWA 4H2AA 1RRJA 2P7CB 3VFZA 3BR6A 2JG8C 4TWTA 3E6DA 3VBUB 3H8OA 5FPZA 4MIMA 1GQPA 2VBZA 4NR1A 2OIIA 5C7GA 1U8BA 3AP7A 1R71A 2L02A 5LA2A 3LMMA 1FSHA 3Q8FA 3FIWA 3ZXSA 1OLQA 4QIWN 4IGQA 5FYZA 1DYKA 2HVRA 4RHV1 2CL2A 2R071 2KKOA 4I0BA 3ABZA 2CU5A 3K4NA 1WBLA 4Q0SA 2W9XA 1VBA3 1A5JA 4BIFA 1M06G 4FPHA 1YW7A 4FASD 2J5PA 2K9MA 3BT9A 2M3AA 5E1XA 1AR91 2BV4A 1AYN3 1JTYA 2VLAA 4RFT0 1POV3 3ZYHA 3OGJA 1NCQC 4BK5A 3GVAA 4OHXA 2K9QA 5JVVA 3AL5A 4YW4A 3EXUA 3OGVA 1QDOA 2P81A 2JD4A 2YY1A 1CONA 4HONA 3S57A 3CF6E 3H7YA 4PFPA 4Q4X2 4KN4X 2SBAA 2CQKA 4UUVA 5CNAA 1ZNPA 5F9TA 3KQRA 5BNOC 1QQP3 2DU1A 2X4HA 4DQ2A 5LBCA 1PVC2 4D0QA 2O6GE 4EJTA 1Y3TA 4YM0A 2HQNA 4XNFA 5LRSA 1W7PD 1I1GA 5F04A 2M45A 4E7ZA 2AZ5A 2XL9A 4I3GA 1DLCA 2UY8A 4BPZA 1SLAA 1F15A 5JCTA 1CAUA 4JTOA 3BR0A 4PK4A 1IRGA 5D1IA 4O7XA 3MLLA 9ANTA 2W82A 1BR1A 2CW7A 1LJ9A 2VW0A 2EF6A 4XPVA 1ZZ7A 1A04A 1CZSA 2LY2A 1Z77A 2A69F 5F6LB 1WJEA 1FOD2 1ZG5A 2QKMB 5IOZA 2XAFA 1R1UA 2EFPA 2LRDA 4DYRA 1FPN2 2VKVA 5JOYA 2IS4A 3T08A 2QSFX 2WFF2 5FY9A 5IP9J 2VNRA 5FBZA 1CAXA 5C4XJ 2WZ8A 4D7MA 1HDPA 3HNYM 5DS9A 4LJZF 2PN6A 5CJ9A 2XRNA 1ENRA 1BN5A 3ZYPA 2CWEA 1RUJ2 3G71I 1E57A 2VZTA 1SD4A 2PX9A 2HWC2 4M9SA 4N0BA 4XDPA 3CMEI 4LLGF 3K4ZA 4MUVA 1BC7C 3ACGA 3TMOA 2JDHA 3FBIB 1MACA 2VJIA 3A0NA 2YU3A 5GLTA 4AEMA 2XGCA 3DEMA 2RJ2A 1MD0A 3WW3A 4PQQA 2E7QA 2O8XA 2EXJA 5AIPA 2UWAA 1XGSA 2TRTA 3FXMA 1QPMA 2IXCA 1DU3D 4R4XA 1TZLA 5J3UA 2OJED 1TP4A 3SZGA 2WUHA 3I3LA 2YR2A 4HDVA 1FYUA 4CDUA 5IT9K 4S2GA 3VBUC 4X8PA 3D1NI 1W9FA 2VPLA 2BGPA 5EP9A 4G4FA 4M6VA 2OQ7A 1U8RA 2E7AA 2KIUA 5F39A 4Q4V1 4PI0A 2WSUA 2VKDA 3UETA 4Z1VA 4RLQA 3VBFA 5FYIA 3VKFC 4LXLA 3CZUA 3KCCA 2R5YB 1YE9A 3GJBA 1L0OC 4YW6A 3J8F1 2C4XA 3RS6A 2GOXB 3TRSB 5LGUA 1OR7A 5HLIA 2OX0A 5BNGA 1Q8PA 5FDBA 1EH8A 1PUEE 3CCLI 4K21A 4QTRA 2QSGX 2X1CA 1FXZA 2W1WA 4RHV2 2BOLA 4CDXA 3SFZA 4OINF 2R072 5FPLA 5D4RA 2UXXA 3WGGA 1V6MA 1B35A 2VZQA 4AHZA 3D82A 3CDHA 3QPHA 4NPLA 3HBZA 1ZRCA 1AR92 4FFFA 3JB8A 2X05A 3VHPA 1BZWA 1LESA 4OQ9A 2X5IA 1AKHA 2ZGPA 3B6CA 4QAWA 1BIAA 2A5ZA 4HF1A 3G1OA 4DXRA 2DVDA 5EG0A 1PUFB 4EGZA 1QXJA 1M1EB 1QY4A 2ZGUA 3WU1B 4BDZA 1YQ2A 4LHKA 3CLQA 2IVMA 3GALA 3PTRB 5E88A 1YI7A 3ACIA 4R4ZA 4BQYA 3VV1A 1HN0A 3U11A 5LW9A 1ZA4A 1EH7A 4NROA 1PMIA 2KPMA 1Y9MA 4GMP3 1YJLA 4U2AA 3ZYJB 5C3PA 1XGMA 2E36A 4EMSA 3RZKA 1D8KA 5FZ3A 1OUXA 1DU0A 3H9AA 3T2OA 3GZ5A 1HW5A 1MS0A 1F4HA 1VBA1 3JXSA 1H4HA 3I58A 4OMZA 1QXRA 3OUIA 3N05A 2EINH 1UU4A 3HUGB 3I64A 3RYKA 3IKTA 1WUVA 5BS6A 3E5UA 3T2PA 2R7UA 2A3XA 4FPJA 2DT7B 4NIIA 4CCNA 2QBYB 1W1WE 3DLAA 3OYFA 3H0DA 2J7MA 2OA4A 5J1YA 3CHXA 1YHFA 2JSCA 4XIKA 4XBQA 5DUVA 4Q0PA 1YRNB 5LD2C 2WABA 2X0LA 4X0GA 2L9NA 2CYYA 2HXIA 1OBNA 4LE4A 1QNWA 1SFKA 4M3CE 1ITYA 2D3PA 2ZHLA 1L7QA 3FL7A 2JD9A 1WWXA 4DUXA 2DT5A 1YO8A 5C44J 5KAFC 1X8MA 1LCLA 1LAJA 4RGXA 4XYXA 5F5CA 1UAAA 3DEUA 5CKNA 4CEYA 1XYOA 4BLIA 2HLEA 5EYXA 3V0AA 1QHGA 2D45A 2CV1A 4PFOA 2RM23 3BJ6A 3DXTA 1SZBA 1X1PA 4FHTA 2KRFA 4RQPB 4XXAA 3NMBA 3S7EA 2WV0A 3HN3A 1FIPA 3VYTB 2GIZA 2JDUA 1BI0A 1C4RA 1L7RA 4FXGB 3WNXA 3GUDA 5AONA 1NT0A 4U0WA 1I5ZA 4Q4V2 4P9UA 3KM5A 2WT0A 3HOVJ 1HDDC 1R23A 2P7VB 4G9YA 2VMEA 4XAAA 2BGOA 2KLOA 1QH7A 4QKFA 3ONQA 1NG0A 1W04A 4XRFA 2VJXA 1HXDA 3POEA 3CO7C 3GTGJ 5ABJB 3J8F2 3CESA 1W05A 3LSPA 4D7SA 3OSDA 1UIJA 3OYAA 2WB1N 4EGYA 1DGRA 4CDQA 2DV9A 4QX7A 5LWBA 1MNMC 1GKBA 2EJRA 4EJOA 4ATEA 3SQOA 4NHXA 3KP3A 2EIEA 3FLRA 2BNMA 1FJLA 2JE9A 1WZXA 4L5JA 5FY4A 2MFZA 2LLKA 3R61A 3L2UA 4GQ7A 3VYRB 3NNJA 2JE7A 3AC0A 3ZSLA 1MNEA 3GBWA 4P9JA 1AR63 1LFBA 4X6QB 3AJYA 3OY8B 1QJZA 1Q1HA 3ZDVA 4B8EA 2DJNA 1XU1A 4FPGA 5JLVA 1BK1A 4FP3A 3MPPG 3RZZA 4KFCA 3SXYA 4UUSA 3OR2C 5IWFA 1W6MA 3KMHA 1Y0UA 4QLCU 4AQTA 2JMWA 2DDBA 5K0UA 3WQ7A 1YQCA 3GZEA 2CW8A 1ULPA 5T52A 2OTLI 2DA3A 1NA1B 3OGSA 1XCBA 5D8AB 3B7MA 5AVAA 2BY0A 2L4MA 4IE0A 5C9AB 1W9TA 4XCAA 2OZUA 5CPRB 4GJZA 5DCMA 1RUD3 4L11A 4C3HJ 2IXSA 4QM9A 3WR0A 3ZN5A 4MQVA 1V4RA 2W47A 1W2TA 1OCPA 5TRDA 1K3IA 2JVHA 4QM8A 1MQTB 2EIDA 3P5BA 3BR2A 3FUQA 4Q27A 2CV6A 3HKZA 1KS5A 4MXWA 2E63A 4Y22A 4Q5OA 3ZQGA 4UOJA 2PFBA 1V6IA 4L5EA 1K4TA 4AEDB 1PVXA 2JENA 5EJ3A 4KMQA 2DCZA 2HJIA 3LQRA 1W5TA 1W28A 3ETQA 4IL7A 1SAXA 2XB6C 4XQ4A 2JDAA 4B1MA 3HB9A 1LHNA 1S0GA 4Q4Y3 1W4MA 1S0DA 2L7ZA 1QMJA 5BNPB 5A3OA 2XBO1 2X85A 1GT0C 2DFCA 4ABZA 1US3A 4HSTA 3KV6A 3BG7A 1MMNA 3DU5A 1AHDP 1ALYA 2EIMH 2DCTA 4AWDA 2BPA2 4GMP1 3KFWX 4N4OB 1IQAA 1COV3 3M2MA 1TMF1 3LNQA 3WHUA 2D6OX 4TZDA 2MLKA 1F31A 1NLQA 2JG8A 3RWKX 2E33A 1POV0 3ZPYA 4HMZA 3PO3J 4QGLA 3D5OA 4PSXA 3FFQA 3H3LA 1GZWA 2YG0A 4IEQA 1OQ1A 4UFLA 4N7IA 4XORA 1A6CA 2A73B 4B7KA 4AIHA 4LK1F 2HOTA 2XONA 1E5IA 1S1AA 2DMPA 3K2ZA 4QPIB 3BOWA 4P55A 5K8SA 2EFNA 2LC2A 2AXTC 1HB1A 1V9U1 1LUJB 2LMDA 2OPTA 2Z16A 5JI9A 2MH9A 5FZ9A 1O57A 1NCQA 4HV5A 3E1SA 3M4FA 3RPQA 3NKTA 4RM3A 1TT0A 4E7JA 2B7EA 2DFIA 4ASLA 4D6SA 1KGSA 3T1LA 1DFQA 1IRXA 1J9IA 1YCIA 5D6FA 4JX4A 4LLLA 2ISYA 4CE8A 5C33A 2FBKA 3P7NA 4OI1A 2FE3A 5BNOA 2DVAA 1J84A 1YEWA 3U78A 3ILFA 3MIFA 2V1NA 1IPJA 4Q1RA 3RZMA 1GLNA 2BY3A 1ZHFA 4U87A 3P3NA 1AL0G 2GH8A 4WM8A 4M3GA 1UZWA 1RINA 1SVLA 2HKXA 3S1NJ 2E7TA 2DA4A 4QKNA 1NA1C 1BL0A 4NE9A 5D8AC 5C9AC 1RMU3 2FEZA 2V1UA 1ZZ9A 4IHVA 1D0ZA 1LPQA 2A6XA 1H9GA 4G7ZF 1UOGA 5A7SA 2IGKA 1W0NA 2GOMA 2QBXA 3HIFA 3PDQA 1MQTC 1W8NA 5B3SH 4ZONA 2O8OA 2XXZA 4BLJA 4S2HA 5A3MA 3QP5A 4ORFA 5FYSA 4ASKA 4U36A 5E18F 4HN1A 4MOAA 2P3KA 3FXLA 2Q0AA 2Q8EA 2NS0A 1X1BA 2DMTA 4AEDC 4N4NB 5FZLA 4CCEA 5IK7A 3G73A 1SANA 5A2QZ 3ZOIA 1BW5A 2JJ7A 4YVWB 1JGSA 4IEOA 3A02A 5FP7A 3QBQA 1K5MB 3BR1A 5BNPC 2EIBA 4BNCA 4AVTA 4XBNA 1EH6A 3LEGA 2Y9ZA 3BVCA 2HOAA 2TUNA 3ZKUA 1FP2A 3TO7A 3DPTA 4NNJA 1GICA 1VQ7I 1W8WA 4OHYA 1JZ2A 4KG0A 3MF9A 4PCRA 3Q0WA 3WTZA 5FKBA 2XBO2 3VBUA 4OAYA 1VZ0A 3WE2A 4XTMA 1UU5A 4E7LA 1UX6A 3NNLA 4D1QA 1QJX3 4ESFA 2ZTNA 3KP2A 3WOGA 3SJMA 2XAHA 1TMF2 2ZXHA 1W03A 3IWZA 1NCRB 2QQUA 4KGGA 2M8GX 1CN1A 1VB2A 3K4CA 3Q8EA 2VZ3A 4Q5SF 1U5ZA 2BZTA 3HD8B 2ZGOA 3MLJA 1ETYA 2XUMA 2TDXA 4CCMA 1DQ6A 3JRHA 1NH3A 5GPCA 4KYWA 5TJJA 4DOUA 3H1MA 4BQOA 1RETA 4V2WA 3UR3C 3LAJA 2QZ3A 1LE8B 3ASOH 2D6PA 3I4PA 4BDVB 4DB5A 4XSZF 3NWKA 4XONA 1ND3A 1YO5C 4YVSB 5FROA 1SFNA 3MLKA 3S15J 1X82A 5EJ1B 3ZMNA 4Q4Y1 5M5YJ 4GMP0 3KEYA 1V9U2 1DDNA 4PJJA 3A1YA 3S14J 1X19A 3NAPB 4XJ8A 4LK6A 3TKYA 3LKJA 1B8IB 3ACHA 5F5IA 4Z2AA 1WCMJ 1QH6A 3CJRB 2VQGA 3WUCA 1COV1 1OPOA 4HT1T 2WBMA 1YWKA 1UMHA 1KU3A 3OL4A 2ZHNA 2STTA 2RVAA 1MS5A 5GAGJ 4IOAF 2NYXA 3F2ZA 4ZKTB 1IN5A 4P5OA 5CB7A 4Y4YA 4HV6A 2EAAA 5A1FA 4UVAA 5FKNA 2LP0A 3F6VA 4M6YA 2STWA 5F7UA 4EJWA 3SNMA 1QJU3 5KR7A 1BVVA 1WCUA 2QVSB 1W9SA 5FY5A 4XN0A 3FBMA 2VG9A 4LBJA 3CCQI 5DEQA 1MZ6A 4BH9A 2AREA 4TSVA 3L9FA 2FBEA 3PIOF 1IZ1A 1XDSA 1VMJA 3HVDA 1JT0A 2EFQA 2YC2A 3BU7A 4W6XA 1K7AA 4P9LA 3S5QA 3T1BA 3NJXA 2W52A 4GWNA 5KK1A 4V2GA 4Q26A 4R79A 2P17A 1JE8A 1QVTA 1SDWA 4YVWC 4YG2F 3IAQA 3JRGA 5JHUA 3LEKA 4CPBD 4RS8A 4RS5B 4RB3C 2A5YB 4M3CF 4MFEA 1K5MC 1V5EA 2ZEYA 3PVOA 2HWE3 2DQLA 1Q56A 1SBDA 2WS93 1K45A 5JPMB 3E6CC 4TV7A 5IVFA 5DG2A 5BUVA 3IZOA 3MICA 3OY9A 2VBXA 3MKYB 1VQ5I 1VRBA 1ZBA3 4HLXA 2VQTA 3FBNB 5IY5H 3RKWA 2I07B 3RDIA 1O4XA 3MZYA 4IV1B 2E35A 2PHUA 2K02A 1NKGA 2DURA 4GALA 1JUMA 3WDUA 2CAUA 4BHBA 3KV5A 5F2WA 5HNHA 1N75A 2YROA 3KT4A 4E4HA 2F4MB 1TWFJ 4LE3A 3QPLA 2JA8J 5GPAA 1HB3A 1LFUP 3OYKA 1NCRC 1UOFA 1YQ5A 3BZ6A 1D4M3 1ZZ8A 1ENSA 1V0AA 4W6WA 5JXIA 4RGAA 1MNDA 1UY0A 3NO8A 4D94A 2YX4A 4JRLA 5FY8A 1WBFA 4FPKA 2R5YA 3WG4A 2C6SA 2FCUA 3O6BB 2DTRA 4HNVA 5E3NA 3CCUI 4FE7A 3I3BA 4S2DA 3W59A 3MIGA 3L2QA 4NIDA 4DRRA 2VQAA 5FJ8J 1AX1A 4W65A 2CSOA 3SDGA 1R64A 2DUQA 3PU3A 4K20A 3K4MA 3S93A 2WLQA 4GH4A 4XIOA 3BB6A 4LGWA 3ZXKA 4PLNA 4YVSC 4I2OA 1W9WA 5JVGF 4C2UA 2Q4SA 1RI7A 1BHGA 1ZG1A 3EDPA 3NAPC 3ZKYA 2PHXA 1LODA 3MIEA 4II2A 1WW6A 4II3A 4AVSA 2IWGB 3G4SI 3IKVA 1KFUL 2CQ7A 1PUFA 2VMDA 2ISZA 3FHQA 5KXEA 3LQCA 2UYAA 1APNA 1MEC3 3MDPA 1R093 2DYCA 4CP9A 4Q4Y2 4AM3A 1DG6A 3V7CA 5C4WB 3CP2A 4XDOA 3HTSB 4HZFA 4HX8A 2XV4S 3LSHA 1H2LA 1J09A 4P9FA 5FO8B 1GZTA 2PLV3 1RIRA 2CTVA 2N7GA 3WU2C 1QJX1 5A80A 2RDNA 2LF7A 1COV2 5AFEA 2DFEA 1VQ8I 1Z05A 4C2TA 4IEUA 1DQ2A 4DXTA 3TDZC 2BOJA 3H8XA 2WINB 1PX3A 2VZUA 4NBQA 4NUBA 4FOQA 1JZ8A 2HFHA 3HUGA 2R061 3JB4C 1Z3XA 4QHZA 4E2QA 2PHWA 3X2QH 1Y1WJ 3QODA 4L9VA 1MW7A 1H9WA 4RS5C 2QBYA 2Z79A 1UYPA 3J7ZI 1E3HA 2ESNA 4FOVA 1OQEA 2RDRA 1S29A 4BE0A 4MNUA 1YRNA 4LBQB 4CUBA 3OD0A 1VI0A 5IK5A 4Z6YA 2OQ6A 1XOYA 2XJQA 3WLUA 1ENHA 4IV1C 2DMQA 2GBYA 2YPDA 5JPNB 4QDSA 2F4IA 1HKDA 1QEXA 2XQRA 4EN0A 5GZCA 1OFCX 4RSUA 1OYIA 5IYYA 2PI0A 1F9KA 1YG2A 3MVPA 3IPVB 4Q29A 2NVUB 3FHAA 4CP0A 1QJU1 5LBFA 4RQPA 2FJ1A 2VECA 2YU2A 5JVTA 4XUPA 4ESBA 2WY7Q 5GADJ 4CA9A 1QNYA 4FQGA 3LQQA 5H9RA 3MPBA 4K40A 2PMWB 5H20A 2VZOA 2A61A 4MGKE 1NY71 3ABKH 2CNAA 3NNFA 1NLSA 3BZKA 4NVPA 1I1EA 1X58A 1TC3C 4KNCA 3B02A 2L9RA 3K1MA 1FOWA 5ABJA 4OUEA 1ZBE1 4IEWA 1ZZ6A 4LUMA 4IL6C 4P5YA 4G9SB 5E1RA 4M72A 4IEYA 1Y9QA 2VXJA 3AL0B 4IF4A 5GJ6A 5SV8A 2HWE1 2COBA 3WEZA 2WS91 3RRDA 2HYKA 2BBYA 4QXKA 2AHQA 2JKXA 4IV3A 2NAZA 1REPC 3BTCA 3PMSA 4TXWA 4DIQA 2WY8Q 1REFA 5F8PA 4LLNA 1N1SA 2EICA 1KQ8A 5HLHA 1AYM3 1S7AA 5C4WC 1DGWY 1WZ2A 2Z4FA 1P9QC 4KWLA 5LBBA 3OY8A 4YZ4A 3EUKL 1BA5A 4ZU7A 3LSIA 2A05A 1HA8A 2XAGA 2BYVE 1NG7A 3KEOA 3FMGA 5DABA 3VEPA 3RPUD 2DLLA 5L9RA 4FAHA 4KICA 2KRHA 1RUOA 1ZA7A 1GZCA 1T38A 4RB1A 3GFMA 1FV3A 3LSKA 1DQ4A 4I0AA 3I9V2 2BE5F 1ETQA 2MA3A 1E5RA 1SLBA 3VBOB 1QHDA 1NA1A 1WHUA 1DIWA 4RMNA 2GC2A 5D8AA 1PM4A 1QJX2 2J1UA 5C9AA 1ON2A 4S2FA 4UI9L 4V2FA 1RC9A 4AZZA 4GZ9A 4DS0A 3KP5A 1GOGA 1D1BA 3D0SA 4LHNA 5J47A 1MQTA 5CKMA 1HQCA 1NK3P 1GHCA 1XNKA 3KETA 2RNJA 3S2DJ 2GU9A 2R062 4JDOA 3AYEA 2ZHMA 1L7LA 2NQYA 1RUC3 5FY1A 5ICCA 4BMEA 1XQNA 2BWCA 4AEDA 1IKPA 3E1F1 1USTA 4AI3A 4BHCA 2CFOA 1US2A 4OU0A 1R091 2HQRA 3MN2A 3VYSB 1IN8A 2Q1FA 4ENKA 1DBNA 3PURA 1ULGA 3FXJA 3X29B 1EV11 5BNPA 2Q1ZB 3DPLC 3WQBA 4YGBA 2PLV1 1UU6A 3D8CA 4WXHA 4XL9A 3POJA 4CHUA 4CUGA 3P3PA 2NNNA 4C90A 5FD5A 4FPEA 3L2RA 1AR81 4H55A 3GMEA 4N53B 3UKNA 1JHNA 1YC61 2F4OB 2D93A 2H6BA 1CESA 2E5ZA 1QJU2 3MKWB 4JTNA 3M1HA 3AFKA 2XUBA 3GTLJ 1PO23 4KU7A 1VQ4I 2BFUS 4BEHB 2AS5F 2D98A 2YDEA 4F3JA 2HZDA 4NRQA 4RL7A 1DUXC 2ET7A 4FE4A 2B5HA 1BI3A 5E20A 1SFPA 3AX4A 4XSXF 1HB2A 1NY72 3KLSA 1LHUA 4QPIA 3HZJA 2IBDA 1O7LA 4NDLA 3DGTA 2K85A 2RHPA 5A7QA 5FY0A 2EA7A 1XB4A 5ACA3 5FMOL 4IEZA 5FYUA 1VBD3 4C9YA 3CUQB 1ZBE2 2L9LA 2YFZA 2FDIA 2QQMA 1PGW1 5DDJ3 5A6XA 2WZEA 2ELHA 2OD5A 3WW1A 1JOPA 3M1EA 1CAVB 5HCAA 2HWE2 1W9YA 5LCWL 2WS92 1BK0A 1QU0A 3V0BB 1F4AA 1LDJA 5FMDA 3IIIA 5C6CA 1BLZA 1AXYA 2FCTA 2GNDA 4M71A 3DEEA 5A7WB 1GP5A 2ZJ2A 2VONA 2WB1A 4A3BJ 3BOQA 3ZQFA 3LDRA 1ULDA 4Q0UA 3TN91 3WDVA 3MIDA 3VBOC 5I0SA 4MFDA 2JWPA 3PVNA 4XTPA 5FZMA 5KHGA 2BJSA 2RAEA 1P2FA 1D4VB 4MTDA 5HODA 4UT5A 4EN7B 4ZH4F 3GZTB 5BQTA 4E8CA 2YHJA 5CQGA 2RS31 2VR4A 2K86A 1WQ2A 3MMYB 2WNVB 1B9MA 2XPUA 5D5VB 4QGNA 3C2GA 2VCAA 4PSWA 4ITCA 4JOMA 3WTWC 4OMCA 4QXHA 3FBYA 1U0JA 3GTOJ 4GD4A 3AAFA 4UBGA 3M7GA 3D4KA 4YVWA 3ZQ7A 1EF4A 3HOYJ 1Y9GA 1CR7A 4GO1A 4XLNF 4IEVA 1OUSA 4YEJA 1K5MA 4CZSA 4Y4RA 4IPAA 3L1PA 1CF7B 2IVIB 4O9GA 4MGZE 3PUIA 1GWLA 4H7MA 5FREA 1O59A 5EZWA 5JIAA 5FOJB 3OS1A 3HRTA 4ZU5A 2WZPP 1GXQA 4L9NA 3S2HJ 5KHJA 4FAGA 1JYNA 2E1MB 2XH6A 3KF3A 2AUYA 2E26A 4N53C 1KYZA 2R7OA 5FUPA 1X2MA 1EV12 2BZDA 1UOJA 4KQ7A 3O1SA 2PLV2 2DA7A 4YZ1A 3L2VA 4XVHA 2W94A 2F5EA 2QJVA 4XUTA 1HCRA 2WLPA 4L5IA 3LDKA 1RVF1 1P4XA 1NCRA 3ON7A 1AR82 4HBLA 5KHKA 3COAC 2LY9A 2VQLA 1RUI3 2KHMA 3RKXA 4BJ0A 4Y26A 1GNZA 3K51A 5IJRA 1H89C 2EFWA 3EYIA 1RUC1 2F17A 3NRUA 5F08A 3I49A 3MBWA 5I0TA 2M4GA 3CUQC 3F95A 2VOWA 2VMHA 1LE8A 3OGRA 4D6RA 2WKKA 1W2OA 3MV11 3VDXA 3OOPA 1P4WA 3NKGA 4YVSA 2CFXA 3I59B 3WODF 2R92J 2F5VA 4LOTA 4Z8BA 1I1SA 5K1YA 3NAPA 3O0WA 2P6HA 2RS13 3AB0A 3S30A 5B4NA 3UKGA 3ELKA 1B8IA 1K6OA 1PGW2 2HQ5A 1AA7A 4NC8A 3VKOA 4WBBA 1GWMA 1RR7A 1W36D 3JSOA 4IRIA 3BKZA 4DEVA 5HOOA 2B8MA 3OYBA 5APAA 2YC0A 4CU7A 3FK6A 5C5UA 1ENQA 1ETVA 4QT6A 3WNLA 5CVIA 2O1QA 4EJRA 1ACIA 1R4NB 3NQHA 1PO21 2H8RA 1FYKA 3TN92 4AGRA 4ZPIA 2QM3A 1N77A 1YIOA 3MV01 2FX0A 2WNVC 4YZ5A 2C1FA 5K7HA 3WDTA 3HOUJ 5F5QA 4MLOA 3LIGA 5J98B 3BTYA 1DYOA 2IVJA 2EBIA 2A6VA 1MR5A 4S05A 2NS7A 3E6MA 2DVFA 3GHMA 3HBKA 3MD2A 2BDRA 4ARYA 5E8IA 5J4YA 2RS32 4OWRB 1ERDA 5ILUA 4PF1A 3S17J 2ORZA 1VBD1 1JYTA 5FZ4A 2YPJA 3WT3A 1R5HA 4RS5A 2F5CA 1LHVA 3WF3A 5C8WA 3DXUA 1FNYA 1ZELA 3NL1A 3R0JA 2DUOA 5IP7J 2ACJA 3MUY1 3K10A 3BLYA 4BDYA 2PQQA 4MADA 3OYGA 3USUB 4NIGA 2EZHA 4ANJA 1YFXA 2ZMEC 4RB0A 1H30A 2E1MC 5CAZA 3ZFFB 3BCBA 2NVXJ 4OI4A 1C5IA 4IV1A 1U3EM 3O1MA 2E31A 2ZZJA 4UW3A 3TEXA 1R081 1YTYA 2CJJA 2Y0IA 5E79C 1V54H 3ZO0B 4ENJA 4XFIA 3OEAA 3SEPA 5FLMJ 4ISRA 5EEAA 2DTYA 1SAUA 2QNKA 4NWVA 5TGTA 1QWRA 4MGRA 4NIHA 1P92A 4KT5C 4LG3A 3C3VA 3J4UH 2JDPA 2ZXJA 1VBC3 1NTCA 1G9AA 3VHRA 1F5JA 3I2DA 1UL9A 1QXPA 4CICA 3WP6A 1A8MA 4MV2A 4JKMA 2BVVA 3C2UA 4AEKA 2GNBA 4JZRA 1RHI3 3W3CA 3NV2A 3TL4X 1QJFA 4YFNF 1D1AA 1Z0XA 1RVF2 3UJOA 2G4IA 2Y33A 2PQSA 3G6JB 4Q8KA 5CVVA 5HXMA 2UWMA 4HYEA 1TW3A 4HRIA 4MG2A 4MQ9F 1D8JA 3OPTA 4Y1ZA 1DGWA 5L3EA 1S0IA 3ERMA 3BTLA 5I8TA 3HOWJ 3DLLF 4WZFA 4RGGA 2AACA 3PIPF 3M3OA 2VVEA 3ZYBA 4LIUA 5GM0A 1RUH3 1TME1 1OOPB 3OYNA 5A7OA 1UYZA 2L54A 3E5XA 2ARAA 3FM3A 1WJFA 1HF0A 2VXZA 4OUMA 1YS7A 4OZXA 1LVAA 4YGCA 2K7LA 3OPZA 5C4WA 3FM5A 4E7SA 2HOSA 3KS7A 1T6BX 4LLOA 4HOOA 2ARXA 2XSDC 2LNBA 1LGBA 5JR7B 5FJKA 2XPVA 4KA4A 3OIPA 1YQ8A 3BODA 3I97A 3R6SA 1IS6A 3RWNA 4HQMA 1DZQA 1GOHA 3F3XA 3DPRB 2DPUA 2UZKA 1YIFA 1T2XA 5HBAA 1S6LA 1AVBA 2D5HA 5FK8A 4BB3A 1PO22 3AVSA 2GM4A 2XPJA 1H0BA 3JAMK 1RKWA 3RYRA 1H8TB 2P6TA 2YGMA 3S3NA 1PNFA 1CX1A 4BGDA 4XLEA 4I01A 2ORXA 2OCCH 5I8YA 3H3ZA 4XBFA 3N97A 4IXAA 1T56A 1Y4WA 3DTEA 3MUZ1 1LKNA 3SH4A 3DBHB 1HLVA 1E3OC 4LBQA 3PNTA 2W1QA 4ZY9A 3CEWA 1VBD2 5K5RA 1UCXA 4Y1XA 3C7JA 3ZFFC 4UV9A 3LWCA 1J1TA 5DAWA 4RGUA 5FZ8A 1U5IA 1TEIA 5BPDA 2XASA 4Z82A 4CP2A 3UJQA 2O61A 3NQOA 3SDBA 3B5LB 2FBIA 2VH9A 5FGMA 3FMRA 2GALA 2LROA 2DFFA 2GMMA 2UUZA 4JGZB 4O61A 3RSJA 1JN2P 1F1ZA 2NMOA 3H1WA 3NNMA 4META 3MWMA 2JE8A 4EM0B 3IPVA 4BU2A 1DGLA 5FV3A 4DRVA 1S7OA 4ES9A 5C3QA 3BTIA 3Q9SA 4WWCA 4N7UA 4LB6B 1YI2I 1K83J 5DZFA 2NP0A 1R082 4ETSA 4PDWB 4KIFA 1K61A 3MYXA 3ASNH 1G6NA 4XE9A 3O8HA 1XMXA 1XYNA 3K4DA 1V00A 4BYYA 4EE2A 4LHLA 5A3WA 1K79A 4LQRA 5KC6A 3VYUB 3LEIA 4UVCA 1RB8G 3WQ0A 3LSJA 3OBTA 5FKCA 1TWHJ 4URTA 2OU2A 4P00B 3TBDA 4F91B 4I3PA 5FWJA 2KISA 1ZN2A 4MHUA 3F6OA 5IYBJ 1CIWA 1G9CA 3ZN0A 4DNYA 3GJAA 5GAHJ 2KZGA 2DAOA 2YZ4A 1TWCJ 1OOPC 5D6EA 2A3WA 4MO7A 4QMAA 2PHLA 2E9QA 3PUAA 2BHZA 4JC1A 2F2EA 3SHFA 1RGSA 4MH0E 2V5YA 3G7DA 2HR3A 3SH5A 4FTHA 2ZJRF 2R16A 1E17A 2UURA 1AHSA 2EAKA 1DQ0A 4XKWA 4HSJA 4XF4A 2NLRA 2WADA 4DZGA 1TME2 1O5UA 4D69A 2CGNA 3OYDA 2FMDA 3HSEA 3GW2A 4A3LJ 1EAH1 5JXJA 3GXUA 4RGKA 1S3JA 4ESJA 3LSGA 3PUBA 2K9SA 1XSRA 3H9QA 4UFHA 3LB9A 3QCWA 1VBC1 2XG3A 3LCPA 1Y56A 2VODA 3DPRC 2P0WA 3CLPA 3WHCA 4OIOF 2LF8A 3LFUA 2R041 3VBOA 3VODA 2VOOA 1SBEA 2KR2A 3T30A 2VXRA 1RHI1 2C6YA 1BCXA 2ET1A 1G59A 4XKCA 2YX7A 2NOGA 1N3OA 3B69A 3ZN4A 3TEWA 5EPAA 1ZTRA 1H8TC 2BOIA 1XE7A 3IAPA 3VOEA 3I55I 4YRDA 2GC3A 2VBDA 3J7NA 1K5JA 3ZQQA 1HB4A 4FVVA 1YJWI 1B4AA 1W8ZA 4HNUA 4YW3A 4ASMB 4WXDA 5I93A 4HVRA 2M87A 2L0KA 3LL7A 3O1VA 3E97A 3AG4H 3MFCA 1RJ8A 2DDAA 2ZNYA 1KEXA 1GUIA 3T1MA 3FXOA 2TNFA 4Z92B 4C3JJ 4TLGA 3N36A 4A12A 1I3HA 1S0JA 1V6NA 3P9KA 2V9PA 4JGZC 3B00A 4YG3A 4DOZA 2LSOA 3KZZA 1QIQA 2AH2A 5L3DA 3OYLA 2XAQA 4UWDA 5FOBB 2ZAAA 4PDWC 2HTSA 4YW5A 2IXKA 1LRHA 3Q8BA 1MZFA 3HJRA 4N53A 5J96B 2DCEA 2LVSA 3ZXLA 2Q8KA 3JBG3 4LA3A 4KNYA 3KD4A 3EJKA 3MIHA 5HNFA 4YM1A 1W39A 1W8HA 4XETA 3WF0A 2Y31A 4XJWA 4OVEA 2HEYF 2WN2A 2FXAA 4Q4X3 4B4PA 2V9KA 2MHFA 3SCGA 4E9KA 3BYWA 5LBEA 1DQ5A 1PVC3 4NQWB 1MBEA 2ID4A 3VZKA 2WO7A 2G9ZA 2OBPA 2ZABA 3SZPA 2DTZA 1XGOA 1Y7BA 3WTVC 5JHFA 3GCMA 1JZ6A 2B9UA 2VUJA 1H8AC 3U1KA 3H8RA 3PTYA 5A6YA 3CUQA 1YOVB 3VDCA 5ILSA 3AZVA 4AE2A 1D0XA 1IXRC 2QQIA 4R9AA 2GH2A 3L2YA 1Z67A 5DM7F 1PHMA 2E1NA 2HYXA 1CAVA 2CQNA 5L36A 1IUYA 5T5LA 3H3VK 1NG6A 4MGYE 5JXGA 4KH9A 4KWUA 3UT0A 1FOD3 2VC1A 3CU7A 4IHWA 4NIAA 3V0BA 3IAS2 2B0LA 1G86A 3LE0A 3JUUA 3RKQA 2A6ZA 5D21A 5A7WA 3ABUA 1IDYA 2CDPA 2WFF3 1W90A 5F0FA 3HR9A 2JN6A 1PMJX 3WF1A 4RB2C 1H2KA 1RUJ3 1EAH2 2HQAA 1YIPA 1IN7A 3I4NJ 4MGTA 2HWC3 1Z6TA 4QPGB 3CUOA 1ZGJA 1PO11 1G9FA 1VBC2 3UKVA 5T50A 1DU6A 2E7WA 2R042 4XJZA 1G3TA 1RHI2 3CO2A 5JIUA 1QDCA 3F23A 2ATFA 2K46A 3HMYA 4GJYA 1Y43B 1RL3A 4BY7J 2ELJA 2RDSA 1O8PA 5F1RA 1D5YA 1A6IA 2P3JA 2FU4A 1X50A 1ULEA 1N1YA 4MHGA 3E0JB 5J3LA 5FZ1A 1D1CA 2HNHA 2P2KA 5FB2A 4NHKA 4XDQA 2ID6A 1SG3A 3HG9A 5E17F 2ZNZA 1CF7A 1CZTA 1FBSA 4FO9A 5DUUA 1JUSA 4ES8A 3U0ZA 4V1PA 3DYPA 3A4UA 3ZCOA 3T0YA 1QOSA 3ZMUA 4G6TB 2D6MA 4NMIA 2QTWB 3ME2A 5HVQC 2Q2EB 3VD9A 5ILVA 3HNMA 1IG3A 2J42A 2OUJA 3LOIA 4HAMA 2M8EA 2ZMNA 2L2OA 3OJBA 2FOWA 4HSLA 2R073 2D44A 2BRTA 1UMQA 2VT2A 4C1WA 2VULA 4MGQA 3W5MA 3MW2A 3TEDA 3AMQA 3Q3SA 2OQRA 4M6XA 1KS4A 2DJIA 2ECCA 2TCTA 3N9LA 2EXKA 1RPWA 1XX5A 1MDMB 1UXXX 1P4AA 2JDNA 3RKYA 3QYEA 4LKEA 4AVVA 2D5VA 3HNBM 1O4ZA 1JXSA 4SBVA 2Z3YA 1DQUA 2D1HA 1CQTA 3M8FA 1WI9A 3EB7A 1IOAA 1MZEA 3HPHA 1FX7A 3VUOA 5JLWA 3AP5A 3IB3A 2QUFA 1YNAA 1G8XA 5F37A 1G3WA 3A03A 5CYYA 3DKXA 1DHKB 4YRVA 4WK8F 2RG4A 1F9NA 2W25A 2BV6A 5FP9A 5FZCA 5DMYA 4TLFA 2A68F 3DP7A 4L9BA 1SVOA 3MF6A 2BVLA 2G9WA 2XQXA 4GRIA 1ND2B 3KCYA 2AC1A 4EROA 5JAXA 1FEXA 3S1RJ 1WJCA 3Q8CA 4XCBA 2H27A 2R7TA 5DUKA 4HW0A 1MKMA 3JBG1 2DCKA 4BQAA 4QPGC 2H6CA 1UY3A 1HN1A 1WLTA 1RTVA 5IFPA 4A5NA 3V8JA 2Z33A 2CHHA 5HCBA 4BQ4A 1GXPA 2D43A 2QQKA 1V55H 1HBXG 4AUXA 5HV4A 4Q47A 2QYOA 3M70A 4I76A 5DV5A 1DCSA 1FMD1 3BQZA 2EIKH 1MS4A 4XFCA 5FO9B 1PVC1 3LWFA 4ENMA 2IS1A 3TW7A 1PO12 1RC6A 3ZRGA 1AUYA 3OYCA 4QB1A 3CC7I 4JYKA 5CKQA 2IJLA 2V1DA 1KFXL 3L00A 2HPIA 2XAUA 3GDBA 3VL9A 4PDKA 3JCUC 1QHHD 2XF7A 1KDMA 1UW8A 5FZ6A 3ZSEA 4C0BA 4E8DA 5JLXA