3H3VH

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00575 S1 S1 RNA binding domain
H PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vH02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h3vH01
2WAQE 1WYDA 1PH4A 2R92G 3HOZG 2AMCB 2A8VA 1HNWQ 3D31A 5LMUQ 4UP9A 1PA6A 3H3VH 1NJIC 3KJPA 1IBLL 4H02A 3F8TA 5C0XJ 4JI8L 1CKNB 2E2JH 4OONA 4DR6L 1PH1A 3L2PA 3Q8DA 3KF6A 3PSIA 5IYDG 3RNUA 4P72A 1VQJA 1A8VA 1CKOA 1YJNA 1QZHA 2IT1A 2LXJA 4PG3A 1VQ7A 4KHPL 2Z0SA 3J7ZC 2R7ZG 2JEBI 2UUBQ 2R93G 1WCMG 2HT1A 1CUKA 4LF7L 1JE5A 1UWVA 2JK8A 3CC7A 4LWCA 1H95A 4WJ3M 1B7YB 1GVPA 1Q12A 1HJPA 4KHPQ 4IFDI 2JA5G 1K73C 4LF4L 4GKJL 1IBML 2JA6G 2GN5A 4IPHA 3GTQH 1Q86C 1XPOA 4GKKL 1U0LA 3G6EA 3UDFA 2UU9L 1N36Q 2YTYA 1C9OA 2OCEA 3PUZA 1YHAA 4BXXH 4BBRG 3TRZA 1BBWA 3HOWG 4GOPC 2VQFL 4MTNA 1LYLA 4MZ9A 5M3FG 4HJ8A 3H3VI 3D0FA 4BY1H 1Q8KA 2EIFA 3PIOA 4JI4Q 4R1JA 3ULLA 1FVIA 4A3FG 4GN5A 2PI2A 3M9BA 2VQFQ 3GDEA 1NMGA 4LFAL 4JI6L 4R4QA 2K75A 1SMXA 1KL9A 3J81i 4DUZL 3W5OA 4DUYQ 4A76A 3FKIH 1VQHA 4A3MH 3I7FA 1KQSA 1RL2A 4GNXA 1QVCA 3F1ZA 4ALPA 2R93H 3CCMA 4LNQA 1JJGA 4X65Q 3CCLA 2I5LX 2I5MX 3AYHB 3F2DA 1XMQQ 1Y1VH 2WFWA 4LFAQ 4A3EH 1VQLA 4OX9L 1SE8A 2ZTDA 2LXKA 2E2HH 1L1OC 2OQ0A 4JBMA 4TVAB 1VQEA 3RR5A 4HIOA 4POFA 2RHQB 1S72A 1LUZA 3AQQA 4KI0A 1VQIA 1K8AC 2VNUD 1N32L 3ULJA 3CCQA 1C0AA 1E1TA 3CP0A 4DV7Q 1NTGA 3HKZE 2YYZA 5JJIA 2N49A 2E5LL 4DUYL 5C4XH 2EXDA 4B3RQ 1E7ZA 3KDFA 1ASYA 4DKAC 4GOPA 1HZAA 2VS1A 3I4NH 4A3IH 1HNZQ 3H15A 4LF8L 1QVFA 3CC4A 2NVYH 4XIGS 4DV6Q 3S1RH 1KXLA 3UE0A 3F2CA 1VQAA 5IE8A 3A5UA 2JA8G 3M4PA 3B6YA 2KBNA 2VQEL 4AIMA 1G291 1Q1BA 3CCJA 2WB1G 3T1HQ 1IXRA 1EWIA 3DLLA 1HNZL 1VQKA 3S14H 1X3GA 3S1NH 1WOCA 2CWPA 4L5QA 5DLQE 4DR3Q 5GQOA 4YWLA 5GAGC 4B3SQ 2UUCL 4DV1L 2UXCL 1HR0W 1UE6A 1Q82C 3CW2C 4GNXC 4LF7Q 3I4MG 2E2IH 3K7UC 2ZJRA 3I2ZA 4QIWE 5LMNQ 2UXDQ 1Q7YC 4KHZA 4HIKA 3H0GG 1IBMQ 1Z47A 1XNRL 2JA7H 4LF4Q 1XMQL 1VQDA 1X55A 4RMFA 1PH9A 3ZJYC 1NMFA 3TEHB 4JV5Q 1QUQA 2K14A 3PO2G 1CKMA 3HKSA 4DV1Q 2IHFA 2JJQA 4JC0A 4AQYL 4A3EG 4IPDA 1I94L 4JI0L 4OXPA 4B3MQ 3JAMi 2ZJPA 3KFUA 3J80i 4DR3L 3CCSA 2QGQA 3RZOH 4B3SL 1TWGH 2CKZB 3M85A 1XJVA 4A3LH 4A3JG 3HOXH 3F2BA 3OW2A 4PZ8A 4FDBA 3HOVG 2QEXA 4TQUS 4JI4L 3S15H 4O0AA 1Y1WH 5JEAG 2UUAQ 2QA4A 1SLJA 1Y1VG 1WFQA 3I56A 3UDGA 2A19A 4BA2I 4R4CA 2MNAA 4LF8Q 4R4OA 1YNXA 4DR7L 4A3GH 3S1QH 2OTLA 3CMAA 2E8GA 1PH2A 1WJJA 2NVTH 5GROA 4A3KG 3J81c 3STBD 3GTLH 3M3YH 2B3GA 4DR5L 1CSQA 2KCTA 3K8AA 3PIPA 2A1AA 3UDXA 3RLFA 2JA9A 2PMZE 3T1YQ 3K80C 4P75A 4APVA 3PUVA 1PV4A 2UXDL 1G6PA 4YY3Q 1JJCB 1KD1C 4JI3Q 3GTKH 5GAEC 2D62A 4DV5Q 4JI7L 1VQNA 4GOPB 3G4SA 3UDIA 1VS0A 3ULPA 2K52A 3KDFB 3KLWA 3U4ZA 5JJKA 4EQ5A 1K0RA 4DAMA 3GTJH 2Z6KA 2JEAI 3HOWH 3PO3H 1HNXL 3PV0A 5EAYA 3L7ZC 4JI3L 1XTDA 1EOVA 5H1SE 2N3SA 2L15A 1WCMH 1QVGA 1HZBA 1P8LA 1TWFH 4J15A 5IWAQ 4PMWA 4DV0L 1Y1WG 2H5XA 4X64Q 3RN2A 1PFSA 1VQ4A 2JA5H 4DV6L 2JQOA 4ME3A 2PI2E 1BKBA 2JA7G 1AE3A 3MXNB 1J5EL 1FGUA 3ERSX 4UPAA 1KIXA 1AE2A 1CSPA 4P71A 2F3IA 4PZ7A 5JEAJ 3TQYA 5BR8Q 1IBKL 5HY6A 4JI2Q 1Q81C 4POGA 4DR4L 4A93H 5IP7H 4HJ9A 1N33Q 1T9HA 2WB1E 3A74A 3TREA 3JC66 2HHHQ 4YCWA 2CWAA 1K9MC 4LF5Q 3S16H 4MNOA 4A4IA 4RG1A 1GKHA 3TS0A 4JI2L 4DR4Q 4A3DG 5FJ8G 2UU9Q 5K36G 1GO3E 2YTVA 4JV5L 1Y14B 3PF4A 1VQ9A 1PH6A 1XNRQ 2MQHA 4QJFA 1N8RC 1I6HH 3RZDH 5IYDH 3M4QA 2AHOB 4X66L 2F4VL 3HOUH 1A0IA 1DGSA 5C0XI 2Q2TA 1OXTA 3A0JA 2PNHA 1VQBA 2LSSA 4YY3L 1VQOA 4R4IA 4O2DA 4LUOA 2R6GA 2CQOA 1TWHH 4C2MH 4DV5L 3M4OH 3TS2A 2Z6KC 2AKWB 2OWOA 4GNXB 4DK3C 2F4VQ 3I4OA 1N34Q 1AH9A 1OXSC 2FXQA 1V9PA 2YU9H 2ZM6Q 1YVCA 2R7DA 3CCUA 4L5RC 2ES2A 1B70B 2UUAL 2WP8J 1HH2P 4DV4L 1IYJB 4C3JH 3NENA 3STBC 1YZ6A 1E24A 3CQZH 1VQ6A 1XMOL 4A75A 2IHEA 5IYBH 4UP7A 1B8AA 1GD7A 3PO3G 4A3BG 1IBKQ 3L0OA 1K3RA 1X3EA 3AFPA 5IP7G 4DV3L 4AH6A 2JA8H 1EIFA 1W3SA 4GLXA 2ZTEA 1M90C 4NB3A 3HKZG 4JYAL 2EQSA 5GAHC 4IJHA 5FJ8H 1G51A 4GLAC 3I4MH 2K5NA 4C3IH 5AJ3Q 3IRBA 1XMOQ 1I94Q 4JI5L 5GADC 1L1OB 4AYBE 4LW1A 1HZCA 2K5HA 5IYBG 2Q2UA 4B3ML 2NZOA 3GTPH 4X66Q 1VQMA 1M1KC 3NBHB 4A3DH 2CCZA 4LF6L 4JI7Q 3CAMA 2VUMG 4L5TA 3PCOB 1SRUA 4DAYB 2GVAA 4B3TL 1X9NA 1X6OA 2IX0A 1FJGQ 1UE5A 2ID0A 3HFZB 1OTCA 1VQ5A 4OX9Q 2UUCQ 4DR6Q 5IP9H 1PVOA 4BBRH 4BA1I 4A3JH 2NZHA 3HOYH 1QUQB 3RLNA 3CCVA 1I5FA 3KF6B 3KF8B 4DR7Q 1V1QA 4DPGA 4P74A 4YCVA 1PH3A 2HHHL 2BA1A 5IY0A 3J7A5 1YHQA 1XPRA 2XTIA 3GO5A 2B29A 2PQAA 1J6QA 4JI1Q 4IOCA 4LF9Q 4A3CH 1E1OA 2K5VA 3HOVH 5C0XG 4LFCL 1XPUA 1X56A 2B63H 4B3RL 1NE3A 4DR1Q 4R4TA 4DNIA 4A3IG 2E5LQ 2XGTA 4HIMA 4GKJQ 3S17H 2R7FA 4HJ5A 3PF5A 3GTMH 3W1GA 3SGIA 1Z9FA 1WI5A 1KC8C 3KYHC 2NVXH 3DM3A 1EQQA 2IY5B 1JJ2A 1MJCA 2YTXA 3KJOA 4C3HH 4A93G 1LTLA 4JBKA 4A3FH 4Y7NH 2OQKA 3W1BA 3UE1A 2IX1A 2UXBL 4X64L 2DUDA 1EIYB 4GKKQ 1VQ8A 4UP8A 4NXNL 5FLMG 2Q2IA 2HQLA 3E0EA 5IWAL 5IYCH 1TWAH 1X65A 3K0XA 1UE7A 1GM5A 2Q2HA 4HJ7A 1LM0A 2UXCQ 2F52A 5J3BA 1JB7A 3BZKA 2NVQH 2R92H 3HOZH 5C4JH 3GTGH 2VL6A 1YITA 2N78A 3PO2H 1P16A 1N33L 4BBSG 2UUBL 3OTOQ 4AYBG 2WAQG 3BU2A 3EBEA 2VZAA 1O7IA 1JMCA 1A63A 3KOJA 2KENA 4Y52H 2GVBA 1YBYA 2I5HA 4JYAQ 2V1CC 3CC2A 2VUMH 3J80c 4K0KL 4A3CG 3LGJA 4DV3Q 4JI1L 3I55A 1KHIA 3PGZA 1PYBA 2NN6G 3I4NG 2RCNA 3NEMA 4NXMQ 3OTOL 2BH2A 1VCIA 4QQBX 4BBSH 1MIUA 5C44G 2RF4A 4GN4B 3AFQA 2R7ZH 2B63G 1N32Q 4YHHQ 4JI5Q 4A3GG 3FP9A 1QZGA 1D7QA 1FJGL 4GN3B 4EX5A 2ZM6L 1SR3A 3T1YL 4LF6Q 2DGYA 1L1OA 4OWTB 3E9IA 3J81j 4B3TQ 5FLMH 3NELA 2RHSB 5ELNA 4YHHL 1I3QH 3FHWA 1Q1EA 2Y0SE 4LF9L 2VY3A 3HOUG 1YJWA 1E22A 1MJEA 4OO1I 1N9WA 5M3MH 4DUZQ 1NBWA 5C3EH 1K83H 2VQEQ 2OTJA 2ZTCA 4JBJA 2KHJA 1YHBA 1YEZA 3ICEA 1V43A 4DR1L 3T1HL 3A5ZB 4GS3A 4IFDJ 2C35B 1U5KA 1J5EQ 2YV5A 4LFCQ 3JAMc 1IBLQ 1IL2A 4DV2L 4P73A 4HJAA 1TXYA 1HR0Q 3HOXG 1HNWL 4XTCS 1N34L 2K50A 5LMNW 5LMUL 3BZCA 4DV7L 3CD6A 3BJUA 4DV2Q 1BBUA 3CCEA 3WWVA 2KCMA 3K81C 4LUVA 5FLXc 4LFBQ 4AQYQ 5BR8L 2D0OA 5E7NA 1KRTA 4QGUA 4DV4Q 1SFOH 4DR2L 1SROA 3U4VA 2K4KA 4NXNQ 3ER0A 1S3OA 3PUYA 3G71A 1VQCA 1CKNA 2VW9A 2HIVA 3PUWA 4QY7A 5JJLA 2UXBQ 2BA0A 4A3LG 4IPGA 1FL0A 1KAWA 1X54A 4KLKA 4DR2Q 1YIJA 1ASZA 3M7NA 1HZ9A 1OXUA 1UE1A 3RN5A 4LFBL 4JCVE 4UY8C 1EUJA 4JI6Q 4LUZA 5M3MG 4IJLA 4X65L 5C44H 5C4XG 3OYYA 1IZ6A 3PUXA 2ATWA 1MKHA 1EQRA 1PH5A 5IP9G 2NN6I 4WJ4A 4K0KQ 4JOIA 2AWNA 4DK6C 5LMNL 3VDYA 5M5YH 1X3FA 3G48A 1BVSA 1I50H 3CPFA 5HGQA 4X62L 1L2FA 4YWKA 4IO9A 4DR5Q 5C3EG 3RLOA 1PH8A 3GD7A 4IFDG 3S1MH 4A3KH 4IPCA 1VQGA 1VQPA 2HIXA 2BH8A 4JI8Q 4NXML 1PH7A 4L5SA 1NY4A 3HOYG 1N36L 1E3PA 1OXXK 1HR0L 4OWXB 4HIDA 5IT9c 1W2BA 4OWWB 4BY7G 4X62Q 2MO0A 3U50C 4JI0Q 2JE6I 1EFWA 3S24A 3H0GH 4BY7H 1XNQL 2JA6H 2D0PA 2Y0SG 1D8LA 2N8NA 3CXCA 1SN8A 1KRSA 3EN2A 4DV0Q 1A62A 1UEBA 2PQAB 1L0WA 3CPWA 4OO1G 1YJ9A 3GTOH 1HNXQ 1JT8A 3S2DH 4A3BH 5M3FH 1PYSB 5ELOA 5M5XH 1OXVA 2MFIA 4NPSA 4YWMA 5M5WH 1S40A 4QL5A 4BXXG 3CCRA 3S2HH 4PZ6A 1TWCH 2I0QA 2ASBA 4X6AH 2AWOA 3CF5A 2KHIA 1C7YA 2CFMA 2ALYB 1YI2A 1XNQQ 5AJ3L 4YCUA 2ZJQA 4JG2A 3E9HA 3MEFA 1RIPA 4IOAA 4JOIC 1Q46A 1R9TH 5IYCG 1EYGA 3U58A 3EIVA 3K7AH 1VQFA 1K8GA 3AEVA 4JBWA 3FKIG 4BY1G 2MO1A 3CMEA 4A3MG 4GLVB 4LF5L 1PHJA
chains in the Genus database with same CATH superfamily
1WYDA 2CW0D 2SEBD 2A8VA 3WDNA 4KJOA 4UP9A 2AQ3B 1PA6A 1NJIC 1IBLL 1BOSA 3CVZA 2PW7A 4A3FB 5FPOA 2WACA 3F8TA 3BQ2A 1CKNB 4GKKH 2IL8A 1PH1A 3PSIA 2PYKA 5CAEB 4DL7A 4UCRA 1CKOA 4WJWA 1AEXA 2IT1A 1II3A 4QUFA 1VQ7A 4KHPL 2IBKA 1YNJD 3J7ZC 2JEBI 3HOWB 2YW2A 1BCPC 1AUVA 1SXTA 1T36A 1UWVA 2OT2A 4LWCA 2RSOA 4I7AA 3JSLA 2EYLA 3RB0A 4WJ3M 2QDBA 3QB3A 5IOCA 3N42B 4CGYB 2WYOA 1U9RA 2WINB 2JA5G 4IFDI 1B4OA 2FJ2A 1IBML 4ILWA 2GN5A 3G7LA 2A6HD 4IPHA 4GC7A 2V59A 1H9RA 1U0LA 1LTID 4ZRZA 1N36Q 2YTYA 1G2SA 3J7AF 1PXUA 4IUUA 3VPDA 4BBRG 3HOWG 4O4IF 2F0PA 4MTNA 4MZ9A 4EFEA 5KFKA 5HV6A 3PIO3 3GIIA 5L1LA 3R8BA 4ZQIA 1R4PB 4HCSA 3GILA 1FYCA 4C3IG 2EIFA 4JI4Q 4RFBA 3C0FB 1KLUD 3ULLA 5KG7A 3BA8A 2E2DC 4B3SH 2D5DA 1ESRA 2JA5B 2PI2A 3GIMA 2HJWA 3GTJB 2HGSA 3X3NA 3HOZB 2RDFA 3J7YW 2R85A 3NGDA 1SMXA 1KL9A 1KQSA 2K1BA 4FNFA 4X65Q 1PZJD 1XMQQ 1SNOA 4LFAQ 2VUMA 1EFID 2E2HH 2OQ0A 4JBMA 2W9BA 4EFBA 4B3MH 3CQZB 5A2QL 5LL6X 1LUZA 3IKJA 1RJPA 1VQIA 3CRLC 1CQJB 1JR0D 3I12A 1O7LA 1HFGA 4B3RH 1A3VA 4KKSA 1E0BA 1C0AA 4ZAIA 1WTVA 4ETSA 3HKZE 3NXWA 2N49A 4L6TB 4DUYL 2E5LL 3KDFA 3R23A 3SDZA 3P1HA 3KHRA 3TN2A 4DKAC 2NVXA 2G5DA 1JOOA 3CC4A 1SYXB 1KEEA 4NKLA 3V2TA 1KXLA 1VQAA 5IE8A 2PNRC 3B6YA 5KNDA 3J7AV 3H6MA 3TP6A 3H0GA 3DMUA 4AIMA 1Q1BA 3CCJA 2WB1G 1VQKA 3S14H 4WBNF 5A2QW 4A3JB 2J9GA 4K2LA 4L5QA 1ET6A 4DR3Q 4RNOA 5GAGC 3E5NA 1RHPA 2K7VA 2VB3X 1EYAA 1HR0W 2UXCL 1KBLA 3T53B 3CW2C 5J2TF 1GUTA 2C00A 1WD1A 3K7UC 2UXDQ 4QIWE 5H80A 4IN3A 4LJZC 4KHZA 4HIKA 3H0GG 1IBMQ 2FB9A 1XNRL 4K5WA 1VQDA 4RMFA 1PH9A 2JSOA 4Q8FA 2K14A 4K8JA 3PO2G 4DV1Q 4KV6A 4QMGA 3GTMB 1MBYA 3Q22A 1B3QA 1CHPD 2CVRA 4XX0B 5DG8A 5E4XA 2ZJPA 3CCSA 3AB9A 2QGQA 4APMA 4ECVA 1XJVA 4X62H 3M85A 1HA5A 2EYHA 4A3JG 5M5XB 3HOXH 2JEIA 4JI7H 5JEAG 2Z6BA 3N41B 1B50A 3C3LA 5KT4A 1UNSA 2MNAA 4LF8Q 1HNZH 1A2UA 1WCMA 2CH4W 3S1QH 1GXDC 1PH2A 2Z4HA 3TZDA 2F0QA 3H94A 2NVTH 5M3MB 1TWHB 5GROA 3VR2A 3M4OB 5C4XB 1K83B 3TBIB 4IHJF 3SE7A 2V9WA 2YRXA 2K28A 1EUDB 3MR5A 3PN1A 3NSWA 1CSQA 2M9VA 3SEBA 2VPSA 2KCTA 4CDFC 5C4ZA 3UDXA 2JA9A 3K58A 3CKIB 2L0CA 4HMIA 1TS4A 4P75A 1T5XD 3V6JA 1QG7A 3TP8A 1PV4A 2UXDL 3UI2A 4O4LF 3TIIA 1JJCB 1NR4A 3CU7A 5GAEC 2D62A 4JI7L 3G4SA 2XIWA 3DF7A 5JJKA 1K0RA 4DAMA 3PO3H 5KFDA 1HNXL 5EAYA 4EBDA 3L7ZC 2N3SA 2L15A 4CBVA 1WCMH 1QVGA 1ILQA 1TQOA 4PMWA 2M2LA 5CBAE 4J9OA 5BR8H 4ED6A 1PFSA 2JA5H 2JQOA 5FOBB 2F3WA 1XX8A 1IBKH 2UUBH 5JEAJ 2HQEA 3NTKA 5JUMA 1T9HA 1UAPA 3TREA 2HHHQ 4LF5Q 3MJFA 5I6YA 3S16H 2I07B 3CRKC 2RQXA 4JI2L 4A3DG 5FJ8G 1LO5D 2Y0SB 2KUMA 5C5MA 4QUCA 3NTIA 3W3AA 1LT3D 1VQ9A 3GQBA 1PH6A 4QJFA 1I6HH 4MV3A 4Q45A 2EZVA 1A0IA 1RJQA 1S5CD 1K0SA 3EVQA 1KABA 2R6GA 4YY3H 2ALZA 3TS2A 4TV9F 2F0JA 2F4VQ 5KFGA 4DR6H 2W71A 4F50A 4MTKA 3VR4A 5KFZA 2F1MA 3DWAA 4MV6A 2ZM6Q 4MHEA 2HVSA 2R7DA 2HVRA 2ES2A 1I7LA 2VQFH 2NU7B 4C3JH 4K5XA 1VQ6A 3V4SA 4A75A 3IFTA 2P5ZX 2IHEA 4XT1B 4JV0A 4ED1A 4UP7A 1GD7A 3PO3G 4A3BG 1JWSD 5CMDA 3GV3A 1X3EA 4G4KA 5ELBA 4DV3L 3G8CA 1EIFA 4GLXA 4JV1A 4LF4H 4J9NA 1TVXA 4DF7A 4IJHA 2CW0C 1G51A 3EJIA 3T51B 1K83A 1ULZA 1EQVA 2N88A 3IRBA 1JOKA 2EJFC 4DNTB 3GTPH 2O5IC 1M1KC 1I4RA 3NBHB 3TP5A 1VAJA 2FJZA 2F0GA 1STHA 3IFDA 2VUMG 3PCOB 1STEA 3L4JA 1TS2A 4F4ZA 1X9NA 2IX0A 4FF1A 2KHSA 1UE5A 1I4XA 1VQ5A 5KKNB 4DN4M 3PW2A 2UUCQ 1U4LA 1LABA 4XDXA 3R93A 4F7XA 5IP9H 1Y1WA 4A3JH 1SNQA 2NZHA 3Q0AA 3HOYH 2DY7A 4RNNA 5KFMA 1STGA 4U7CA 4LF9H 1KDBA 5I9PA 3ONAB 3QR8A 4FXGC 2BA1A 2B2YC 4FO2A 3PR5B 5IY0A 2H1EA 4DR7H 3GO5A 3N6RA 2PQAA 1S5DD 2K5VA 3OW7A 4LFCL 2R93A 1IL8A 1IW7D 5FLXE 1JICA 1DZ1A 2CW8A 4DNIA 4A3IG 1N32H 1JIHA 3J80E 1M0WA 2R7FA 1TWFA 2F0EA 2XGQA 3C2PA 1BQQT 1KC8C 3KYHC 4JK1C 4YB8B 5CA0F 4M1UB 3K0YA 5C5LA 4A93G 2ASJA 1PYWD 1TY0A 1VBGA 4FP5D 1HTPA 2SNMA 3D4DA 2KECA 5C0XH 1U4MA 4NXNL 1VQ8A 3GTLB 3I8ZA 2RDJA 2R8JA 5IYCH 4IRCA 1X65A 1UE7A 1GM5A 4U6PA 4QW8A 2JA6B 1QOHA 2UXCQ 1C48A 2Z9HA 4KN7C 1C8CA 3HOZH 2R8IA 1D5XC 5NUCA 2VL6A 3GTKB 2A69C 1UNNC 5COYA 1N33L 1PTOC 4U673 2E74C 3OTOQ 3V6HA 3EBEA 2VZAA 1O7IA 3BQ0A 3C1EA 1QJOA 3BABA 4JYAQ 2V1CC 2SDFA 2PO4A 1VMCA 1M8AA 5D14A 4DV3Q 5JAVA 3H40A 1PYBA 3HG9A 2RCNA 2X6GA 2H4OA 3T13A 5DM73 5KFUA 4FM9A 1S0OA 5C44G 2A5HA 3G6JB 4YHHQ 4FF4A 1QZGA 5CYUA 3NBIA 4BY1B 3BQ1A 3T4AC 4ZK9B 4WRDA 2ZM6L 2RGRA 3RJ0A 3T1YL 1U4PA 4OWTB 3OHAA 3J81j 4HTHA 3HBLA 1YNJC 3A55A 5JVH3 3NELA 1AP0A 3M9MB 1I3QH 1LTTD 2Y0SE 4JV2A 4TQRA 2XC9A 4RB3C 2XGPA 4IRDA 4NLGA 4HNVA 1E22A 2PQEA 1MJEA 4OO1I 1RTNA 4YAKB 1J5EH 1I4HA 2R8GA 1WTWA 3T5HA 1B2TA 4U68A 1SFOB 1YHBA 2W6MA 1TAEA 4DR1L 2R7KA 3PR4A 2W7OA 2WKDA 3EFXD 3MXUA 5DM63 3JAMc 1GJXA 1ZETA 2XRSD 5IT9W 1HNWL 1E4EB 4MV1A 1CM9A 3VPCA 4XTCS 4Q44A 1EYCA 1NSNS 1SNDA 2F0FA 4DV7L 5D1PA 3BJUA 3CCEA 3WWVA 4LUVA 1SMYC 3FDSA 4LFBQ 5EWFA 4DV0H 4AQYQ 4QGUA 1TWFB 1Y8PB 1RODA 2XWBB 5CV8A 1TA8A 2ASLA 4DR2H 5IGBA 2NVQB 3U4VA 4NXNQ 4HR7B 3OHBA 3PUYA 4DV6H 3WOFA 5JJLA 1QNKA 1H9MA 2HIVA 4QY7A 4CJ2C 3OUUA 4RAYA 4EGQA 3N8DA 3M7NA 1KAWA 1X54A 4A3BB 3S14B 1UE1A 3OWFA 3T1HH 3HS0C 3WO0A 4LFBL 4BWSC 3JRWA 5C4XG 4LUZA 3NPPA 1DXMA 5M3MG 2SCUB 1R4QB 4QIWA 2NVYB 3S1RB 3R3OA 1PFBA 5BN5A 2VXWA 2NN6I 4K0KQ 2VA3A 4IQZA 3VDYA 4JI0H 5A35A 3G48A 5HGQA 4IO9A 4PMBA 3GV8B 4YWKA 4MAMA 2EXZA 3GD7A 5T1IA 4IFDG 4A3KH 1BBXC 5KFWA 2BH8A 3CHBD 4JI8Q 5KRUA 4DV7H 2X6LA 3EPIA 1RK5A 1E3PA 3MA2B 1JX4A 4XQQA 1DONA 2R8HA 1HR0H 3A54A 3RGZA 4JI0Q 3HOXB 3M7GA 4KY5A 1CQVA 1D8LA 1AZPA 1RYSA 4K6LA 3GTGB 1UEBA 2PQAB 1YJ9A 3GTOH 3Q23A 1EEFD 2BQUA 3V4ZA 4NPSA 3L3OC 1STYA 4BXXG 5KT2A 1LTAD 1VMPA 1D1IA 5EGTA 4HAEA 1O7ZA 2AWOA 2NBFA 2KHIA 2F0VA 3CF5A 4A3MB 2CFMA 2ALYB 5AJ3L 3MEFA 1ML0D 3U58A 3EYYA 2NVYA 1GHJA 2N55A 4JBWA 4BY1G 2MO1A 4WJ4A 4O3PA 3BZDB 1PHJA 4R8NA 5EWEA 5KG4A 3HOZG 4RHSA 3SVMA 1HNWQ 1VBHA 5CB4F 4JI5H 5LMUQ 3V96A 3PO3B 5C0XJ 4OONA 4PMCA 1QCBD 4UCOA 3L2PA 2AGQA 5IYDG 3NUCA 2EOTA 2ZT9C 4PG3A 2GLTA 2LKVA 2MP1A 3GIQA 3VR5A 4BBRB 1ZXTA 5KFAA 4DAYA 3BG5A 1SNMA 2HT1A 1CUKA 3RGXA 4LF7L 1JE5A 1SBBB 1SEBD 1B7YB 2F0WA 3EA6A 3NQTA 4HQ6A 1Y69U 1K8OA 4FXKC 1B04A 1N36H 3WOEA 3GTQH 5A2QE 1Q86C 3IL8A 2NTSA 1XPOA 2B63B 3QOJA 4CJ0B 3G6EA 2P0AA 3T5KA 3VR3A 4FF2A 1KNAA 3TRZA 5D8DA 1BBWA 1A9XA 5M3FG 2W9CA 1E2VA 3Q8QB 4BY1H 1WTOA 3OHXC 4LF6H 1IYVA 2FINB 3J81L 5JVLA 2YS6A 2VR1A 4A3FG 4GN5A 1SFOA 2J6SA 1D6EC 3D6CA 2I87A 1I3QB 4DL3A 4R4QA 1ENFA 4A76A 4YJ2F 4DUYQ 4A3MH 2R93H 4DUZH 1N56A 3VR6A 4ALPA 1JJGA 1QVCA 3F1ZA 1X32A 4FVMA 2IWHA 4EQPA 4A3EH 2V4RA 1VQLA 1SJHD 2PVPA 1SE8A 4I55F 5CV5A 5C5JA 1DD2A 3T5JA 2HUGA 3M3YB 1WTQA 5KFRA 4LFCH 2L55A 4A2AA 1S72A 4HIOA 3AQQA 4KI0A 3ULJA 1I3QA 3JAMW 3CCQA 4MTDA 4DL6A 3D4RA 3HKZA 5KT6A 4O3SA 2EXDA 1ASYA 1L0YB 3K5HA 2VS1A 3I4NH 4A3IH 4IFDH 4IZ8A 4ZUJA 4MIUA 1JB3A 4KY6A 3LWEA 3F2CA 1B44D 2JA8G 4DR3H 1SYGA 5FO9B 1DOLA 1SMYD 3RF2A 4F87A 1OO9B 3VYTA 4BS9A 1LT6D 2BE5D 4C5CA 2CWPA 4HN7A 2UUCL 4DV1L 1E2WA 1UE6A 2NTTA 4F8MA 4LF7Q 1Q90A 3KBXA 2A73B 2E2IH 2ATLA 3VYUA 1VF5C 3K7AB 3K59A 2JA7H 3DM1A 4ED8A 3LWUA 2MHVA 3QO2A 1CKMA 3HKSA 4JC0A 2JJQA 4A3EG 2ZDHA 5J39A 1KC7A 4OXPA 2NUAB 3JAMi 5LOVF 1HA6A 3RZOH 4B3SL 3MR3A 2DN8A 1DOKA 4PQXA 1SE3A 1W6KA 4LF8H 3OW2A 4FDBA 4HCEA 1N33H 1Y1VG 1WFQA 2A19A 2SOBA 1ESFA 3TMEA 1WTRA 4R4OA 1X3PA 4A3GH 1V1OA 4PNYA 3CMAA 3N44B 2XWJB 1B6SA 2X0SA 3SR1A 4EYIB 4KHPH 3M3YH 1W96A 4J9QA 2RDHA 5L1IA 3GTQB 4XQNA 3NHHA 3RLFA 3LNNA 2PMZE 3HGBA 1JKJB 1I50B 5KT7A 1DM0B 1SDFA 1Q8IA 1KD1C 5BMVF 1VQNA 3N43B 3T1YH 2V5AA 3LX0A 3U4ZA 4A2BA 5KFEA 3H4DA 2A6ED 1BNZA 4JV5H 1MD2D 4O4HF 4JUZA 5EKLA 5EBCA 1XTDA 3I73A 3RMHA 5IWAQ 4J15A 4DV0L 1EHIA 4X64Q 2R8KA 2IA6A 1EWHA 1BKBA 2PI2E 3TP7A 5D3DA 5EQ0A 3MXNB 4QCLA 1TS5A 1KIXA 3TQYA 1CSPA 2F3IA 4X3UA 3HRZC 5HY6A 1Y1VA 2NZ1D 1Q81C 4ZOLF 4C3HB 5IP7H 1F9QA 3NWSA 4C5AA 4RNMA 2WB1E 2LMCB 3RUPA 1TT2A 1HQRD 4MNOA 3G6XA 1RCVD 2IW3A 1M7JA 3MVVA 4DR4Q 1GKHA 3R2IA 3RIZA 1L0XB 4B9WA 4XT3B 2RBMA 2XN9C 2UU9Q 3TQTA 4K14A 2YTVA 1I6VC 2FE3A 5JPNC 1XNRQ 1KJ8A 3KAJA 2W57A 4FBTA 5IYDH 2CQYA 4CKBA 4OL7A 3SI8A 2FLPA 2F4VH 1OXTA 1VQOA 4JI3H 4HYKA 4L63B 4DK3C 2EE1A 1EIGA 1AH9A 1BR9A 1IHZA 4P2CB 2YU9H 1H9SB 3P7JA 1WSCA 1YVCA 1Y8OB 1KNEA 2ZXPA 4ZI7F 2UUAL 1HH2P 4DV4L 1IYJB 1ONLA 3GTOB 3STBC 5JH7F 3CQZH 1XMOL 2F0IA 5C3WA 5L1JA 2RA4A 1B8AA 2FFKB 2K03A 5CA1F 1PRTD 3GTPB 1TWCB 4IWXA 4AH6A 2ZTEA 1M90C 3KXYT 4IAJA 1H9KA 3HKZG 2ZJTA 3SK8A 1SSOA 4JYAL 5GAHC 5FJ8H 4LAAA 5KFIA 4GLAC 2Q8TA 3I4MH 4FBUA 4OELB 5IGDA 5KFJA 5LYJF 4RGTA 4ZHQF 1HXYD 1XMOQ 2HDLA 1WCMB 2AU0A 1N48A 2F4IA 4LW1A 2K5HA 1SYBA 4B3ML 4E4TA 3PW0A 5CV4A 3EROA 2AQ4A 1FR3A 4L5TA 4B3TL 4H44C 4MV8A 3HFZB 1EY5A 5KFNA 4OX9Q 3QWNA 4IUNA 3TQ1A 2PBZA 3FKIA 3RAXA 1HQMC 4BBRH 3S17B 5DAUA 5I47A 2W6NA 4ULLA 4DR7Q 1V1QA 2DPJA 2NWGA 3DXJC 1CTMA 2HHHL 4CC6A 2CZGA 5DGBA 3J7A5 3RD4A 1XPRA 4FYDA 2B29A 4K6DA 4X3TA 5CV9A 4MN3A 4ECYA 5C0XG 4XYMB 4IUQA 2B2TA 2F0MA 2B63H 1NE3A 1VDZA 2MUYA 3H3VC 4DV1H 5JVG3 1F2YA 4HIMA 2E5LQ 4HJ5A 3PF5A 5C44B 1Z9FA 4A3KB 3VYRA 2J0TD 1EQQA 2IY5B 4MA0A 1MJCA 1TWGB 5EZYF 5KFSA 4KD3A 2YCHA 1LTLA 2L11A 2IX1A 4CDEC 3W1BA 4HNTA 3K3VA 2VQDA 4X64L 1E4GT 3D3RA 1I94H 2KQ3A 2HQLA 2J4XA 2Q2IA 5IWAL 2I46A 4ZUIA 4RKBA 4O3OA 1LM0A 1JB7A 2J7ZA 3BZKA 1L2ZA 1FD7D 1SJED 1FJGH 3MXGA 3GTGH 4O2AF 1YITA 2PMZB 1W93A 3PO2H 1P16A 2UUBL 5K2MA 3BU2A 3FEWX 5KFQA 3KTMA 1JMCA 1A63A 1M4VA 2KENA 1YBYA 2I5HA 1RF2D 1PX2A 2VUMH 2B8FA 2PZUA 4K0KL 1TWCA 2M05A 4JI1L 4DV2H 2B2TC 2HCCA 2NN6G 2L12A 4Z9CB 3Q1KA 4QQBX 3PW5A 1MIUA 3M4IA 4DR1H 1C4QA 2XVSA 3AFQA 5FPRA 1V4YA 3NWTA 4LMQD 5G3LD 4A3GG 4RHRA 1B9MA 4J0MA 4TQSA 3J7AK 1EYZA 4EX5A 1F9PA 1E4FT 2JA8B 1Z2OX 3RTXA 2DGYA 1GLVA 2D9UA 4XXEA 3E9IA 4OIKA 1B6RA 5ELNA 1Q1EA 1GUWA 3QIAA 2VY3A 2VQEQ 2OTJA 3KALA 2ZTCA 1EOTA 1GSOA 1V43A 4R8UB 3A5ZB 4GS3A 2EY6A 4IFDJ 2JA7B 1BCPF 4ECZA 1IBLQ 4YAJB 4V0BA 1SNCA 3HOXG 2FP4B 2JA7A 2R82A 5C4JB 1LV9A 5LMNW 2CQAA 3BAAA 1PRTB 1BBUA 4F4XA 5FLXc 2DPIA 1C30A 3H20A 2FK1A 3ERQA 4DR2L 1PTOD 1F2LA 2ZM6H 2A6HC 1S3OA 4HSVA 1ZQ7A 4O3QA 1K28A 5KT3A 3PUWA 1BCPD 2ZXRA 4F4WA 2UXBQ 2BA0A 4A3LG 5EKIA 1FL0A 5AFWA 4KLKA 1YIJA 2YYAA 3GV5B 3S1NB 3HZXA 3MWYW 4JI6Q 4X65L 3VA5A 3PUXA 5ELEA 1JOQA 2JEFA 1PZID 4KHVA 1MKHA 2F0LA 1EQRA 5I9OA 1PTOH 5IP9G 3F2UA 3TINA 1TR5A 5LMNH 4ECQA 2AWNA 5M5YH 1BVSA 1I50H 3I4LA 4LF9L 3I4MB 2EY2A 3RLOA 1PH8A 4OHJA 3J81E 3S1MH 2UVUA 5LP6F 4IPCA 1VQGA 3DEOA 3DEPA 2CH4A 4C2MA 5JQWA 4YR2A 1D1KA 2HIXA 3VMMA 5G3LF 4L5SA 3FVQA 2V4DA 2EYMA 4OWXB 3T5LA 4OWWB 3A8KE 3MHBA 2JE6I 1EFWA 2QF7A 2DIKA 5I2XA 1XNQL 4DLKA 5C8YF 1RKNA 1PTOF 2Y0SG 2UUCH 2UUAH 1DOMA 2TMPA 3EN2A 1A62A 4OO1G 4I50F 1JT8A 4Y8VB 2NUCA 5M3FH 4TUYF 1OXVA 4NDXA 5M5WH 1ZHSA 5ELCA 4QL5A 2AUJD 3MR6A 3PQIA 2ASBA 4X6AH 1HFNA 4QWAA 2R92A 5C4HA 2UVWA 3OSOA 3FKIB 4RGNA 4BY7B 1FKAH 1BGWA 1IYUA 3E9HA 1R9TH 5DLGA 5D1OA 3M9OB 2ICIA 3K7AH 2BOSA 1EYDA 4LF5L 3FKIG 1XNQH 2MGSA 3CMEA 4GLVB 1QNUA 5DG7A 2LY7A 4KMUC 4A3DH 2ZDGA 1PH4A 5FO8B 3W2DA 2R92G 3D31A 4G7ZC 3H3VH 2R61A 2FLNA 3MZ5A 2EY5A 4HSPA 3SE0A 1DYQA 2EYFA 4JI8L 4DR6L 1XDNA 2FK2A 3RV3A 3KF8A 5JJZA 4P72A 5KFPA 1A8VA 1QZHA 4MV7A 4B3TH 3Q6SA 3IAYA 1PZKD 4Q5VA 2Z0SA 2Y0SA 2F0KA 2R7ZG 4UCUA 2R93G 2Z1CA 3UQ8A 2WAQB 5EBDA 1WCMG 2OXPA 2QK4A 4LFAH 4ECXA 5LL6b 1EUCB 4ECWA 3CC7A 2R84A 1H95A 5IGFA 2L4NA 2K01A 1GVPA 2WKCA 4B9XA 1KJJA 1HJPA 1K8MA 3FMCA 4LF4L 3RFCA 2K04A 5KYLA 2JA6G 4JYAH 2XRQD 1EY7A 1IOVA 5IGEA 2FK3A 4HR7A 5JOBA 4GKKL 3G6YA 4IUTA 1MGSA 2IJ0A 4MV9A 4XYLB 3UDFA 2UU9L 3OSPA 1H9JA 5EKKA 3SK4A 3PUZA 1YHAA 4R9WA 2W6OA 4BXXH 5FKAC 4EBEA 2R93B 4CJ1B 2VQFL 2M00A 4GOPC 2R7ZB 3FMAA 1EU3A 2QKIC 4DV4H 4DAVA 4EG0A 1Z6HA 3Q24A 3N52A 5DGAA 2ICEC 2F0HA 3PIOA 1N34H 2E2HB 4LH6A 3ETJA 3RZDB 4R1JA 4DXFA 4EEQA 5C1PA 3R5HA 2W9CB 1FVIA 3D4WA 4RZRA 3M9BA 1JE4A 1Y1WB 5KG0A 2X69A 2G9DA 1SYCA 1NMGA 4LFAL 4JI6L 1K1QA 2K75A 4DFAA 3J81i 3S2HB 5IGCA 3HXLA 3FKIH 3I7FA 4GNXA 2YL2A 3ND8A 3CCLA 2I5MX 2WFWA 1L1OC 3JZIA 1F77A 4TVAB 4C3JB 2KCNA 1CQFA 2NU9B 3RR5A 2BCOA 4POFA 2RHQB 1N32L 1JORA 3O13A 2R7LA 1TU2B 5F9LA 1G6ZA 3FDTA 2AQ2B 4ZCKA 2JP1A 2I80A 5C4XH 3MAQA 1E7ZA 2A68C 2BQ3A 4GOPA 2DJFC 2B2YA 5KX5F 1HNZQ 3H15A 4NXNH 2DJGC 2NVYH 1QE6A 4XIGS 4DV6Q 3S1RH 2KA7A 3A5UA 1BCPB 1HNXH 1D2BA 3GIPA 3VA7A 2VQEL 3T1HQ 1G291 4YIJA 4ZKCB 1HNZL 4BY7G 3DLLA 1EWIA 2K5WA 1ZHQA 1GUSA 3S1NH 1X3GA 3QFFA 1WOCA 1NAPA 1CS0A 3Q2OA 1I6UA 5GQOA 4YWLA 4B3SQ 2RGVA 1Q82C 5C3EB 4GNXC 2B2UA 3QZ7A 2ZJRA 2DNEA 3I2ZA 3I90A 4NMZA 2J6UA 2E2JB 1Z47A 3MFGA 1GSHA 3A8IE 2RCFA 1MI2A 3URYA 1X55A 1XMQL 4LF4Q 2XD4A 1CK1A 1NMFA 1QUQA 4EYHB 2IHFA 1I94L 4IPDA 4JI0L 1JDEA 3LP8A 2R3ZA 1STBA 4H13C 4B3MQ 2W8KA 1BNCA 3J80i 3RBDA 4A3LH 5L9XA 1TWGH 2CKZB 5ISRA 2HVQA 2EYPA 3PZPA 3RB6A 1WVLA 1E4EA 4PZ8A 1D5ZC 1AUXA 2QEXA 3HKZB 4IALA 1M6VA 4JI4L 5K36H 2L9HA 4O0AA 2QA4A 3UDGA 2C2RA 4BA2I 4R4CA 3MR2A 2W9BB 5CBEE 1ENCA 4H7BA 2Q8IB 4KN4C 4QF4A 1CE8A 4A3EB 5LA6F 5C3XA 5E1FA 3NP8A 2R87A 4A3KG 5T14A 3U9SA 5C6AA 1GYFA 4DR5L 3K8AA 3H91A 3PIPA 2B2UC 4DA2A 5FO7B 3KLSX 3GTMA 3T1YQ 3K80C 3KHGA 1GUNA 4RH6A 3E3XA 4YY3Q 4QIWB 1GUOA 4G3IA 3S1QB 1EY0A 1HNWH 3BYTB 5IWAH 2K52A 3KDFB 3KLWA 4NXMH 2WAQA 1I50A 2WB1B 2JEAI 3HOWH 2W7PA 3PV0A 4DV5H 5H1SE 3TSSA 1HZBA 1P8LA 1TWFH 1XYIA 1Y1WG 2H5XA 1VQ4A 4DV6L 4YR3A 4ME3A 4B08A 2JA7G 2VA2A 1F9RA 3ND9A 3ERSX 1AE2A 2K5QA 4P71A 1IBKL 3S2HH 3QJYA 5DLFA 4DR4L 4DAPA 4A93H 2O5JC 1WR2A 1QWYA 5BN3A 4ZQ3A 1EZ1A 3KUPA 4YCWA 1QILA 4IUPA 4JI2H 3PVXA 4LSXA 5J1ZA 1RDPD 3OTOH 4ED2A 1SE2A 4RGOS 1GO3E 2PZTA 4JV5L 5K36G 4I7HA 1Y14B 1AZQA 3PF4A 2MQHA 4ZYSA 1N8RC 1HRJA 3HOVB 3M4QA 4DV3H 2AHOB 4X66L 1EEID 2F4VL 5C0XI 1DGSA 4A3GB 1AFPA 3I91A 2LSSA 4R4IA 1ICFB 4C2MH 1BDOA 1TWHH 4DV5L 3M4OH 3RBEA 4GNXB 3I4OA 1GGOA 4YHHH 1G8ZD 1BJTA 5EPLA 1OXSC 2FXQA 4LH7A 1V9PA 4S3SA 3QG1A 4O3NA 3H09A 3NENA 1YZ6A 4IURA 5EPJA 2XIGA 3J81W 1JXLA 1WTXA 1IBKQ 3L0OA 3AFPA 2F0OA 1B3AA 1Y1VB 2K5DA 1W3SA 3Q8RB 1IBMH 4HEDA 3LMLA 1LTGD 4NB3A 2NU6B 4ECRA 2IP4A 1DV1A 2BDOA 1TWHA 1OWTA 3S15B 2UVVA 2K5NA 1ZEQX 2B39A 5AJ3Q 4A3DB 2Z8LA 4UCVA 5L1KA 2UVRA 5KT5A 1EIHA 3U9OA 1BUVT 3R2TA 2NZOA 4X66Q 4JI7Q 3CAMA 2K6AA 2K32A 3OPOA 1VKZA 4LFBH 2I8CA 5LHY1 2GVAA 5CORA 4G57A 3JRXA 3MFIA 1X6OA 4KY7A 4ECTA 2ID0A 1LTSD 2Z4IA 4L8JA 1T5EA 4XYOA 5KYIA 4DR6Q 4BA1I 2XCLA 1EL0A 1QUQB 1NR2A 3CCVA 1I5FA 3KF8B 3BDCA 4CHTB 4DPGA 4P74A 2VPQA 4YCVA 1PH3A 4Q0FA 1I4QA 1YHQA 2XTIA 1S97A 1J6QA 1F2MA 3KLRA 3K5IA 3DUZA 2E75C 1XPUA 3QZ8A 4R8IA 1B9NA 4B3RL 4R4TA 4JI1H 1HCZA 4GKJQ 5CV6A 4GC6A 4J9SA 1WI5A 5L37A 4FS1A 3DM3A 2YTXA 3KJOA 4Y7NH 2FMCA 2XCPA 1KLGD 1PFNA 2DUDA 1EIYB 2EJGC 4GKKQ 5KFOA 5KG6A 1A3TA 4QB4A 1GHKA 3E0EA 1IOWA 2CW7A 4AYBA 5CGKA 1HUNA 3VPBA 1TWAH 1RTOA 4J9MA 3E0JA 2F52A 4G7OC 2W6ZA 1SEIA 3V05A 1E2ZA 2QYZA 2N78A 1A3UA 2XCAA 3PW4A 5M5WB 4EGJA 4AYBG 1SE4A 3GIDA 1S0MA 3AMUA 4YBZB 3KOJA 2ASDA 2AQ1B 4YJ3F 3CC2A 1Z2NX 3J80c 1SAPA 2RSNA 4DU9A 1KHIA 3PGZA 4AQYH 3BJYA 2BH2A 1VCIA 1EY9A 4BBSH 1GOZA 2RKSA 3GTOA 2RF4A 4GN4B 1CA6A 2R7ZH 1N32Q 3ORRA 4JI5Q 1D7QA 4M8AA 2YS7A 4ED3A 3WNZA 4X64H 4GN3B 2C28A 2C2EA 4QWEA 4UHVA 2PPBC 3OIPA 4GZYC 1V51A 4FF3A 2R6FA 1EY4A 4JI4H 2FPPB 1TKWB 3GV6A 1MZBA 2F0UA 5FLMH 3PMFA 1B53A 2RHSB 5D3IB 1A6XA 2VQEH 4YHHL 2L1BA 3FHWA 3RUZA 4KK7A 1Z2PX 4UCTA 2BDNA 1YJWA 4K0KH 5M3MH 4PWQA 4R7RA 5C3EH 4NW2A 3OOCA 1SYEA 3SK6A 4JBJA 3J80W 2KHJA 2O4XA 1YEZA 3ICEA 4RGMA 1XNRH 1FNWA 1U5KA 3AU7A 2C9OA 3GTLA 4HJAA 1TXYA 4KTAA 3FPUB 1HR0Q 4OEMB 3F8NA 1XWEA 1N34L 2K50A 2WV6D 5CR3A 2SNSA 1DV2A 3SK5A 3BZCA 1V1PA 5LMUL 4C1NI 4CKEA 4RB0A 3GTQA 3OUZA 2KCMA 4OO1H 4KKUA 2NN6H 5E7NA 1KRTA 5BR8L 1S5FD 2DLNA 2KSWA 1UC8A 3WO1A 2K4KA 3K5NA 3ER0A 3G71A 1VQCA 1CKNA 1EY8A 1CI3M 4IPGA 5KNBA 1ASZA 2C5CA 2ZDQA 1HZ9A 1OXUA 1CZWA 1JLLB 3GIKA 4JCVE 4UY8C 4MA5A 4IJLA 1ICWA 2F3VA 3OYYA 1BF4A 3D6WA 4FU0A 1IZ6A 1LT5D 1I4GA 2GA4B 5DQGA 4N8X1 2A69D 1UEAB 3C1FA 1PH5A 4QWBA 4JOIA 5LMNL 2C2DA 4X62L 3GTJA 2EJMA 4DR5Q 1L2FA 2HDMA 5C3EG 3S9WA 3OWEB 1TWGA 3HOYG 5IGGA 3KAKA 2FPIB 4WORA 5IT9c 4HIDA 4X62Q 2MO0A 3U50C 4ECUA 5KNCA 4RB1A 3S24A 3H0GH 2HCIA 3PW7A 3IG0A 3OMGA 2D0PA 3NTHA 4ABNA 2QCPX 2N8NA 5D1OB 5EJWA 1SN8A 4DV0Q 2NYZD 3P75A 3CPWA 3MEHA 1SYDA 3Q8PB 3S2DH 1LTBD 1LLRD 4I65A 5ELFA 2F0NA 5M5XH 4DK1A 4YWMA 4J9LA 3CCRA 4PZ6A 2QW7A 1G2TA 1DIKA 1XNQQ 4YCUA 3E6ZX 4JG2A 3JAML 4JOIC 1Q46A 5IYCG 1EYGA 2DWCA 3K5MA 4ME6A 2B8GA 1VQFA 5JJIA 3AEVA 5BN4A 4A3MG 2IX3A 4A3BH 1PRTC 1A2TA 2WAQE 3BDLA 5KFBA 3MWMA 2AMCB 1S0NA 4F4YA 2PZWA 2D2CC 3A8JE 5DEHA 3KJPA 4H02A 1KDCA 2E2JH 4O3RA 3Q8SB 2AUKA 4DGZA 2WE6A 3A56A 4M7EA 4JI8H 3Q8DA 3KF6A 5EWGA 3RNUA 1KJIA 2WTFA 1VQJA 1YJNA 2LXJA 2W8LA 4DUYH 1Q3LA 1I4PA 5KFHA 1HTLD 2FHTA 2UUBQ 4CDCC 1JC7A 1MSHA 3K6OA 5E3FA 4K8IA 2JK8A 5IT9L 3BS1A 4LF5H 3KK7A 2HHHH 1Q12A 2VOBA 5J2UF 4KHPQ 4R8UA 1K73C 4KD4A 4GKJL 4H0LC 2DZDA 3E5SA 2KEEA 2NB0A 2G9HD 1C3OA 4XYQA 4J9RA 1EU4A 3TDQA 1C9OA 3V6KA 2OCEA 5KFXA 1SCUB 5KG2A 4RZQA 3IN5A 4ODGA 3RB4A 2O03A 3M9NB 3BVMA 1LYLA 4HJ8A 3H3VI 2VUGA 4EEYA 3D0FA 1KJ9A 1Q8KA 4WFN3 4RKLA 4C5BA 3MWDA 2W70A 4Q8EA 2VQFQ 3GDEA 1IW7C 2R92B 3EPGA 2FMMA 4DUZL 2EYOA 3W5OA 1VQHA 1LTRD 2EPBA 4IR9A 1RL2A 3CCMA 3EQLC 2YU9B 4LNQA 2YRWA 2I5LX 3F2DA 3AYHB 3OIQA 1Y1VH 2JEJA 3QOLA 4OX9L 1RD9D 2ZTDA 1KDAA 2LXKA 1CFMA 3MWEA 5KFFA 4EQOA 1VQEA 4DL5A 1SNPA 3TZUA 4X65H 1IBLH 4JW0A 1STAA 5E4WC 1K8AC 1XMQH 3T56B 2VNUD 4C56C 2IMWP 2LS01 2PMZA 1E1TA 3BG3A 3CP0A 4DV7Q 4N8FA 1NTGA 1V8QA 2JA6A 2YYZA 4X3SA 4B3RQ 1KAAA 1F2ZA 1ET9A 1YNNC 1QB5D 1HZAA 4C2MB 3LWBA 4LF8L 1QVFA 4C3JG 1RJRA 2O2LD 3UE0A 3BA9A 3M4PA 1HUMA 4I4TF 4ED0A 1T3NA 2KBNA 5HGTA 1TWAA 1IXRA 3HEJA 4BWGB 2L5TA 4JI6H 4V190 2B2WA 3ETHA 1BXTA 1W6JA 3M4YA 5DLQE 3UFXB 5TSSA 1CT1D 4TSSA 3I4MG 3I4NB 4CC5A 5F2DA 5LMNQ 3CQZA 1S9FA 1Q7YC 4ED7A 3S16B 4JPBW 5EDWA 2F0DA 1CQIB 3ZJYC 2UXDH 4JV5Q 3TEHB 5IIFA 2YU9A 3G6VA 4XQJA 5KIXA 4AQYL 4IWYA 5LMUH 1KJQA 3KFUA 1LACA 4DR3L 5FD5A 2NVXB 4O2BF 2QEJC 3C46A 2FMAA 1EY6A 1DJRD 3F2BA 2EDGA 3HOVG 1S10A 2FLLA 2A6EC 4TQUS 3L9AX 4Q43A 3S15H 1Y1WH 2UUAQ 1SLJA 3L4KA 3R5FA 1MSGA 3I56A 4CKCA 4N9TA 5IODA 5DNFA 4OX9H 1JWUD 1YNXA 4DR7L 4DR4H 3N40P 2OTLA 2E8GA 2KEDA 2RVLA 1WJJA 2FKLA 2B2WC 3ZYYX 3J81c 3STBD 3GTLH 5C1OA 2JN4A 1HPCA 2B3GA 3HB9A 1X3QA 1WTHA 4ZKBB 5CC4A 2A1AA 4A3IB 2OF1A 5CV7A 4FS2A 4APVA 3KBGA 5JEAH 1NUCA 3PUVA 1G6PA 4JI3Q 3GTKH 1K1SA 2DNCA 4DV5Q 4GOPB 3GV7B 3UDIA 1VS0A 1TS3A 3ULPA 1IKLA 3T16A 4EQ5A 2NVTB 3GTJH 2R7ZA 2Z6KA 2OH2A 2IPKD 2YZNA 4JI3L 1EOVA 5FK9C 2PN1A 3MFYA 1XXGA 4FXDA 3MXPA 1RYRA 2ENBA 3RN2A 3GLKA 4MTEA 2KCCA 4J6HA 1AE3A 1J5EL 1S68A 1FGUA 4RUAA 4RB2C 4UPAA 1PLFA 4HNUA 3BYYB 5BR8Q 4PZ7A 4ECSA 1V1PB 4JI2Q 4POGA 3DWPA 4C3HG 3GIJA 5I4DA 4HJ9A 1N33Q 1UC9A 1PMRA 3A74A 5ELDA 1HHVA 3JC66 1K9MC 2CWAA 3GTKA 3OMCA 3RZOB 1TIID 1XTCD 3D8GA 4A4IA 4RG1A 3TS0A 5BPHA 3RAQA 4UFZA 2R7NA 1EZ8A 1M0TA 1PTOB 1MHWC 1JDBB 3P20A 4QWCA 3RZDH 5KFYA 3HOYB 3HOUH 2Q2TA 1ZYRC 2GPSA 4LMYA 3A0JA 2PNHA 1VQBA 4YY3L 2KOLA 5IT9E 4O2DA 4LUOA 2CQOA 3GTGA 2Z6KC 1YNND 2AKWB 3MXNA 4RAUC 1D5MC 2OWOA 1N34Q 2WDTA 2E2IB 5FD6A 2ZXOA 4WD3A 3CCUA 4L5RC 2C22A 1B70B 1FGBD 2WP8J 1E24A 4O1NA 2F0TA 3I3CA 5IYBH 2GPWA 1CHQD 4LF7H 1K3RA 1O78A 1B33N 5IP7G 4RAZA 2JA8H 2W9AA 1NCVA 1I7NA 2WIIB 2QILA 4EBCA 2XNAC 4I7ZC 2JXMB 2EQSA 2F0SA 2VB2X 1FNUA 4C3IH 3I72A 4EQNA 2RDGA 4X66H 4IUVA 3X3MA 5EPKA 1PFMA 4A93B 4G7HC 3ITPA 4L1KA 2HD3A 1I94Q 1KTKA 4JI5L 4LSAA 5GADC 1L1OB 4AYBE 4QW9A 3KHHA 1J8IA 5IYBG 1HZCA 3PO2B 2Q2UA 5LL6S 1VQMA 5M5YB 2CCZA 4RUCA 4LF6L 2OEOA 2LFNA 2R86A 1SRUA 3A7LA 4DAYB 2NU8B 1FJGQ 2BE5C 4EGVA 1OTCA 1STNA 2JEGA 1PVOA 2UXBH 3S2DB 3RLNA 4EVOA 1S5ED 4O42A 3KF6B 4DXGA 1S4ZA 5T1GA 2PCFB 5D65A 2YZMA 1WD0A 5DG9A 2E2HA 4N9PA 3R5XA 2OLSA 4PDBA 2PW5A 4LF9Q 3NBHA 4JI1Q 4IOCA 4TRDA 4A3CH 4GKJH 1E1OA 1R9TA 1UUPA 3HOVH 5F9NA 3BVZA 4E6IA 4CDDC 1X56A 3A7AB 4F88A 5HURA 2MCTA 4Q0YA 4DR1Q 2XGTA 3NK9A 3S17H 1GUGA 3GTMH 3GP7A 3MC0B 3W1GA 3SGIA 5KFTA 4J8QA 2NVXH 2E76C 3VYSA 1JJ2A 3H4BA 3NE5B 4C3HH 4JBKA 4J1MA 4A3FH 2UXBL 2OQKA 5IYZF 3UE1A 5DQHA 1XMOH 4UP8A 2B2VA 5FLMG 3NQIA 5LXTF 3S1MB 3K0XA 4MV4A 2Q2HA 4HJ7A 4QWDA 1EZ6A 4M9UA 1Z7TA 1PK8A 5J3BA 2NVQH 4RA8A 2R92H 1F9SA 1H9SA 5C4JH 4OGQC 5I2YA 2UXCH 2E2IA 3HP3A 4C1NK 4BBSG 1JQYD 2KJXA 4YQWA 1A15A 1JWMD 4LK1C 3OSNA 2WAQG 2J6TA 2UU9H 3FPPA 1S03G 2CHBD 4Y52H 4C3IB 2GVBA 1B1ZA 5FLXL 4A3CG 3LGJA 5M3FB 4JVZA 3I55A 1T94A 3I4NG 1K3BC 4PV1C 3NEMA 4NXMQ 1S5BD 3OTOL 2W6QA 3TIGA 3RB3A 3KLSA 2QDLA 4DL4A 3RV4A 4YR0A 1TY2A 2E5LH 2B63G 2JYOA 1WTPA 3FP9A 5EOYA 1FJGL 1NNXA 1EWCA 5DQIA 1SR3A 4X3KA 4XZ3B 4LF6Q 4DNRB 2Q8RE 2B2VC 1L1OA 3BDOA 5BPFA 4B3TQ 3JAME 5FLXW 4NP5A 1RK6A 1AN8A 4DL2A 3HOUG 1ZKOA 2DY8A 1N9WA 2AGOA 4UDUC 4DUZQ 1NBWA 4KKTA 1K83H 3N6XA 5JVDF 1CA5A 2JA5A 3T1HL 3FRPB 2C35B 1J5EQ 1TWAB 2KVMA 1CZGA 2YV5A 4LFCQ 1IL2A 1I6HB 4UAIA 4DK0A 4DV2L 4P73A 4K2KA 3DWQA 3HOUB 1RJTA 2R7MA 5GONF 2FPGB 4J9PA 5KEEA 2TSSA 2K05A 2V58A 3CD6A 3SHLA 1O7YA 5J22A 4DV2Q 3K81C 1AW7A 5K5PA 2D0OA 5KG1A 1O80A 4OIJA 4DV4Q 1SFOH 3MFHA 1AN7A 4HMJA 2B63A 1SROA 4ME5A 1BO0A 4TKOB 3J80L 2MJ8A 4K5VA 2AGPA 2VW9A 2A74C 1SYFA 1ENAA 2EY1A 1LT4D 3SXHA 4ZLTF 4RU9A 2WB1A 4DR2Q 3KHLA 1PDQA 3JSNA 3RN5A 3MTSA 2V4QA 1EUJA 3K5LA 3DHQA 5C44H 5JPMC 1JCKB 2BR0A 3PIP3 5HBRB 4DR5H 2ATWA 1WH2A 3BVGA 3GQCA 3H0GB 4IZOA 4TV8F 4DK6C 1ILPA 2EYJA 1J9OA 1X3FA 2BQRA 5KFLA 3CPFA 2K33A 4AYBB 3I70A 3K57A 1Y8NB 4BBSB 1VQPA 1U4RA 5M9OA 5KG5A 1O75A 4NXML 3U9TA 2F03A 1PH7A 1NY4A 1N36L 5KG3A 1OXXK 1HR0L 5KFCA 1W2BA 1DCZA 4RCOA 2YZGA 3K5OA 4BY7H 1IKMA 4IR1A 2JA6H 5KFVA 3CXCA 4YP3A 2EVBA 1KRSA 4RCNA 5KGUA 1R9TB 1L0WA 4ID6A 2RDIA 3ORQA 2VUMB 1HNXQ 1PRTF 1PYSB 5ELOA 2MPMA 3GTPA 2MFIA 2XSCA 1S40A 1FNVA 3K3PA 1VF7A 1TWCH 2I0QA 1BXRA 4RWSC 1C7YA 5I6WA 1YI2A 4UCSA 4KJNA 2ZJQA 4Y7NB 2W6PA 1ZYRD 1G91A 1RIPA 4IOAA 4IRKA 1EQTA 1GSAA 3EIVA 1K8GA 2A68D 4J9KA
chains in the Genus database with same CATH topology
2WAQE 1WYDA 1PH4A 2R92G 3HOZG 2AMCB 2A8VA 1HNWQ 3D31A 5LMUQ 4UP9A 1PA6A 3H3VH 1NJIC 3KJPA 1IBLL 4H02A 3F8TA 5C0XJ 4JI8L 1CKNB 2E2JH 4OONA 4DR6L 1PH1A 3L2PA 3Q8DA 3KF6A 3PSIA 5IYDG 3RNUA 4P72A 1VQJA 1A8VA 1CKOA 1YJNA 1QZHA 2IT1A 2LXJA 4PG3A 1VQ7A 4KHPL 2Z0SA 3J7ZC 2R7ZG 2JEBI 2UUBQ 2R93G 1WCMG 2HT1A 1CUKA 4LF7L 1JE5A 1UWVA 2JK8A 3CC7A 4LWCA 1H95A 4WJ3M 1B7YB 1GVPA 1Q12A 1HJPA 4KHPQ 4IFDI 2JA5G 1K73C 4LF4L 4GKJL 1IBML 2JA6G 2GN5A 4IPHA 3GTQH 1Q86C 1XPOA 4GKKL 1U0LA 3G6EA 3UDFA 2UU9L 1N36Q 2YTYA 1C9OA 2OCEA 3PUZA 1YHAA 4BXXH 4BBRG 3TRZA 1BBWA 3HOWG 4GOPC 2VQFL 4MTNA 1LYLA 4MZ9A 5M3FG 4HJ8A 3H3VI 3D0FA 4BY1H 1Q8KA 2EIFA 3PIOA 4JI4Q 4R1JA 3ULLA 1FVIA 4A3FG 4GN5A 2PI2A 3M9BA 2VQFQ 3GDEA 1NMGA 4LFAL 4JI6L 4R4QA 2K75A 1SMXA 1KL9A 3J81i 4DUZL 3W5OA 4DUYQ 4A76A 3FKIH 1VQHA 4A3MH 3I7FA 1KQSA 1RL2A 4GNXA 1QVCA 3F1ZA 4ALPA 2R93H 3CCMA 4LNQA 1JJGA 4X65Q 3CCLA 2I5LX 2I5MX 3AYHB 3F2DA 1XMQQ 1Y1VH 2WFWA 4LFAQ 4A3EH 1VQLA 4OX9L 1SE8A 2ZTDA 2LXKA 2E2HH 1L1OC 2OQ0A 4JBMA 4TVAB 1VQEA 3RR5A 4HIOA 4POFA 2RHQB 1S72A 1LUZA 3AQQA 4KI0A 1VQIA 1K8AC 2VNUD 1N32L 3ULJA 3CCQA 1C0AA 1E1TA 3CP0A 4DV7Q 1NTGA 3HKZE 2YYZA 5JJIA 2N49A 2E5LL 4DUYL 5C4XH 2EXDA 4B3RQ 1E7ZA 3KDFA 1ASYA 4DKAC 4GOPA 1HZAA 2VS1A 3I4NH 4A3IH 1HNZQ 3H15A 4LF8L 1QVFA 3CC4A 2NVYH 4XIGS 4DV6Q 3S1RH 1KXLA 3UE0A 3F2CA 1VQAA 5IE8A 3A5UA 2JA8G 3M4PA 3B6YA 2KBNA 2VQEL 4AIMA 1G291 1Q1BA 3CCJA 2WB1G 3T1HQ 1IXRA 1EWIA 3DLLA 1HNZL 1VQKA 3S14H 1X3GA 3S1NH 1WOCA 2CWPA 4L5QA 5DLQE 4DR3Q 5GQOA 4YWLA 5GAGC 4B3SQ 2UUCL 4DV1L 2UXCL 1HR0W 1UE6A 1Q82C 3CW2C 4GNXC 4LF7Q 3I4MG 2E2IH 3K7UC 2ZJRA 3I2ZA 4QIWE 5LMNQ 2UXDQ 1Q7YC 4KHZA 4HIKA 3H0GG 1IBMQ 1Z47A 1XNRL 2JA7H 4LF4Q 1XMQL 1VQDA 1X55A 4RMFA 1PH9A 3ZJYC 1NMFA 3TEHB 4JV5Q 1QUQA 2K14A 3PO2G 1CKMA 3HKSA 4DV1Q 2IHFA 2JJQA 4JC0A 4AQYL 4A3EG 4IPDA 1I94L 4JI0L 4OXPA 4B3MQ 3JAMi 2ZJPA 3KFUA 3J80i 4DR3L 3CCSA 2QGQA 3RZOH 4B3SL 1TWGH 2CKZB 3M85A 1XJVA 4A3LH 4A3JG 3HOXH 3F2BA 3OW2A 4PZ8A 4FDBA 3HOVG 2QEXA 4TQUS 4JI4L 3S15H 4O0AA 1Y1WH 5JEAG 2UUAQ 2QA4A 1SLJA 1Y1VG 1WFQA 3I56A 3UDGA 2A19A 4BA2I 4R4CA 2MNAA 4LF8Q 4R4OA 1YNXA 4DR7L 4A3GH 3S1QH 2OTLA 3CMAA 2E8GA 1PH2A 1WJJA 2NVTH 5GROA 4A3KG 3J81c 3STBD 3GTLH 3M3YH 2B3GA 4DR5L 1CSQA 2KCTA 3K8AA 3PIPA 2A1AA 3UDXA 3RLFA 2JA9A 2PMZE 3T1YQ 3K80C 4P75A 4APVA 3PUVA 1PV4A 2UXDL 1G6PA 4YY3Q 1JJCB 1KD1C 4JI3Q 3GTKH 5GAEC 2D62A 4DV5Q 4JI7L 1VQNA 4GOPB 3G4SA 3UDIA 1VS0A 3ULPA 2K52A 3KDFB 3KLWA 3U4ZA 5JJKA 4EQ5A 1K0RA 4DAMA 3GTJH 2Z6KA 2JEAI 3HOWH 3PO3H 1HNXL 3PV0A 5EAYA 3L7ZC 4JI3L 1XTDA 1EOVA 5H1SE 2N3SA 2L15A 1WCMH 1QVGA 1HZBA 1P8LA 1TWFH 4J15A 5IWAQ 4PMWA 4DV0L 1Y1WG 2H5XA 4X64Q 3RN2A 1PFSA 1VQ4A 2JA5H 4DV6L 2JQOA 4ME3A 2PI2E 1BKBA 2JA7G 1AE3A 3MXNB 1J5EL 1FGUA 3ERSX 4UPAA 1KIXA 1AE2A 1CSPA 4P71A 2F3IA 4PZ7A 5JEAJ 3TQYA 5BR8Q 1IBKL 5HY6A 4JI2Q 1Q81C 4POGA 4DR4L 4A93H 5IP7H 4HJ9A 1N33Q 1T9HA 2WB1E 3A74A 3TREA 3JC66 2HHHQ 4YCWA 2CWAA 1K9MC 4LF5Q 3S16H 4MNOA 4A4IA 4RG1A 1GKHA 3TS0A 4JI2L 4DR4Q 4A3DG 5FJ8G 2UU9Q 5K36G 1GO3E 2YTVA 4JV5L 1Y14B 3PF4A 1VQ9A 1PH6A 1XNRQ 2MQHA 4QJFA 1N8RC 1I6HH 3RZDH 5IYDH 3M4QA 2AHOB 4X66L 2F4VL 3HOUH 1A0IA 1DGSA 5C0XI 2Q2TA 1OXTA 3A0JA 2PNHA 1VQBA 2LSSA 4YY3L 1VQOA 4R4IA 4O2DA 4LUOA 2R6GA 2CQOA 1TWHH 4C2MH 4DV5L 3M4OH 3TS2A 2Z6KC 2AKWB 2OWOA 4GNXB 4DK3C 2F4VQ 3I4OA 1N34Q 1AH9A 1OXSC 2FXQA 1V9PA 2YU9H 2ZM6Q 1YVCA 2R7DA 3CCUA 4L5RC 2ES2A 1B70B 2UUAL 2WP8J 1HH2P 4DV4L 1IYJB 4C3JH 3NENA 3STBC 1YZ6A 1E24A 3CQZH 1VQ6A 1XMOL 4A75A 2IHEA 5IYBH 4UP7A 1B8AA 1GD7A 3PO3G 4A3BG 1IBKQ 3L0OA 1K3RA 1X3EA 3AFPA 5IP7G 4DV3L 4AH6A 2JA8H 1EIFA 1W3SA 4GLXA 2ZTEA 1M90C 4NB3A 3HKZG 4JYAL 2EQSA 5GAHC 4IJHA 5FJ8H 1G51A 4GLAC 3I4MH 2K5NA 4C3IH 5AJ3Q 3IRBA 1XMOQ 1I94Q 4JI5L 5GADC 1L1OB 4AYBE 4LW1A 1HZCA 2K5HA 5IYBG 2Q2UA 4B3ML 2NZOA 3GTPH 4X66Q 1VQMA 1M1KC 3NBHB 4A3DH 2CCZA 4LF6L 4JI7Q 3CAMA 2VUMG 4L5TA 3PCOB 1SRUA 4DAYB 2GVAA 4B3TL 1X9NA 1X6OA 2IX0A 1FJGQ 1UE5A 2ID0A 3HFZB 1OTCA 1VQ5A 4OX9Q 2UUCQ 4DR6Q 5IP9H 1PVOA 4BBRH 4BA1I 4A3JH 2NZHA 3HOYH 1QUQB 3RLNA 3CCVA 1I5FA 3KF6B 3KF8B 4DR7Q 1V1QA 4DPGA 4P74A 4YCVA 1PH3A 2HHHL 2BA1A 5IY0A 3J7A5 1YHQA 1XPRA 2XTIA 3GO5A 2B29A 2PQAA 1J6QA 4JI1Q 4IOCA 4LF9Q 4A3CH 1E1OA 2K5VA 3HOVH 5C0XG 4LFCL 1XPUA 1X56A 2B63H 4B3RL 1NE3A 4DR1Q 4R4TA 4DNIA 4A3IG 2E5LQ 2XGTA 4HIMA 4GKJQ 3S17H 2R7FA 4HJ5A 3PF5A 3GTMH 3W1GA 3SGIA 1Z9FA 1WI5A 1KC8C 3KYHC 2NVXH 3DM3A 1EQQA 2IY5B 1JJ2A 1MJCA 2YTXA 3KJOA 4C3HH 4A93G 1LTLA 4JBKA 4A3FH 4Y7NH 2OQKA 3W1BA 3UE1A 2IX1A 2UXBL 4X64L 2DUDA 1EIYB 4GKKQ 1VQ8A 4UP8A 4NXNL 5FLMG 2Q2IA 2HQLA 3E0EA 5IWAL 5IYCH 1TWAH 1X65A 3K0XA 1UE7A 1GM5A 2Q2HA 4HJ7A 1LM0A 2UXCQ 2F52A 5J3BA 1JB7A 3BZKA 2NVQH 2R92H 3HOZH 5C4JH 3GTGH 2VL6A 1YITA 2N78A 3PO2H 1P16A 1N33L 4BBSG 2UUBL 3OTOQ 4AYBG 2WAQG 3BU2A 3EBEA 2VZAA 1O7IA 1JMCA 1A63A 3KOJA 2KENA 4Y52H 2GVBA 1YBYA 2I5HA 4JYAQ 2V1CC 3CC2A 2VUMH 3J80c 4K0KL 4A3CG 3LGJA 4DV3Q 4JI1L 3I55A 1KHIA 3PGZA 1PYBA 2NN6G 3I4NG 2RCNA 3NEMA 4NXMQ 3OTOL 2BH2A 1VCIA 4QQBX 4BBSH 1MIUA 5C44G 2RF4A 4GN4B 3AFQA 2R7ZH 2B63G 1N32Q 4YHHQ 4JI5Q 4A3GG 3FP9A 1QZGA 1D7QA 1FJGL 4GN3B 4EX5A 2ZM6L 1SR3A 3T1YL 4LF6Q 2DGYA 1L1OA 4OWTB 3E9IA 3J81j 4B3TQ 5FLMH 3NELA 2RHSB 5ELNA 4YHHL 1I3QH 3FHWA 1Q1EA 2Y0SE 4LF9L 2VY3A 3HOUG 1YJWA 1E22A 1MJEA 4OO1I 1N9WA 5M3MH 4DUZQ 1NBWA 5C3EH 1K83H 2VQEQ 2OTJA 2ZTCA 4JBJA 2KHJA 1YHBA 1YEZA 3ICEA 1V43A 4DR1L 3T1HL 3A5ZB 4GS3A 4IFDJ 2C35B 1U5KA 1J5EQ 2YV5A 4LFCQ 3JAMc 1IBLQ 1IL2A 4DV2L 4P73A 4HJAA 1TXYA 1HR0Q 3HOXG 1HNWL 4XTCS 1N34L 2K50A 5LMNW 5LMUL 3BZCA 4DV7L 3CD6A 3BJUA 4DV2Q 1BBUA 3CCEA 3WWVA 2KCMA 3K81C 4LUVA 5FLXc 4LFBQ 4AQYQ 5BR8L 2D0OA 5E7NA 1KRTA 4QGUA 4DV4Q 1SFOH 4DR2L 1SROA 3U4VA 2K4KA 4NXNQ 3ER0A 1S3OA 3PUYA 3G71A 1VQCA 1CKNA 2VW9A 2HIVA 3PUWA 4QY7A 5JJLA 2UXBQ 2BA0A 4A3LG 4IPGA 1FL0A 1KAWA 1X54A 4KLKA 4DR2Q 1YIJA 1ASZA 3M7NA 1HZ9A 1OXUA 1UE1A 3RN5A 4LFBL 4JCVE 4UY8C 1EUJA 4JI6Q 4LUZA 5M3MG 4IJLA 4X65L 5C44H 5C4XG 3OYYA 1IZ6A 3PUXA 2ATWA 1MKHA 1EQRA 1PH5A 5IP9G 2NN6I 4WJ4A 4K0KQ 4JOIA 2AWNA 4DK6C 5LMNL 3VDYA 5M5YH 1X3FA 3G48A 1BVSA 1I50H 3CPFA 5HGQA 4X62L 1L2FA 4YWKA 4IO9A 4DR5Q 5C3EG 3RLOA 1PH8A 3GD7A 4IFDG 3S1MH 4A3KH 4IPCA 1VQGA 1VQPA 2HIXA 2BH8A 4JI8Q 4NXML 1PH7A 4L5SA 1NY4A 3HOYG 1N36L 1E3PA 1OXXK 1HR0L 4OWXB 4HIDA 5IT9c 1W2BA 4OWWB 4BY7G 4X62Q 2MO0A 3U50C 4JI0Q 2JE6I 1EFWA 3S24A 3H0GH 4BY7H 1XNQL 2JA6H 2D0PA 2Y0SG 1D8LA 2N8NA 3CXCA 1SN8A 1KRSA 3EN2A 4DV0Q 1A62A 1UEBA 2PQAB 1L0WA 3CPWA 4OO1G 1YJ9A 3GTOH 1HNXQ 1JT8A 3S2DH 4A3BH 5M3FH 1PYSB 5ELOA 5M5XH 1OXVA 2MFIA 4NPSA 4YWMA 5M5WH 1S40A 4QL5A 4BXXG 3CCRA 3S2HH 4PZ6A 1TWCH 2I0QA 2ASBA 4X6AH 2AWOA 3CF5A 2KHIA 1C7YA 2CFMA 2ALYB 1YI2A 1XNQQ 5AJ3L 4YCUA 2ZJQA 4JG2A 3E9HA 3MEFA 1RIPA 4IOAA 4JOIC 1Q46A 1R9TH 5IYCG 1EYGA 3U58A 3EIVA 3K7AH 1VQFA 1K8GA 3AEVA 4JBWA 3FKIG 4BY1G 2MO1A 3CMEA 4A3MG 4GLVB 4LF5L 1PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ E;  1WYD A;  1PH4 A;  2R92 G;  3HOZ G;  2AMC B;  2A8V A;  1HNW Q;  3D31 A;  5LMU Q;  4UP9 A;  1PA6 A;  3H3V H;  1NJI C;  3KJP A;  1IBL L;  4H02 A;  3F8T A;  5C0X J;  4JI8 L;  1CKN B;  2E2J H;  4OON A;  4DR6 L;  1PH1 A;  3L2P A;  3Q8D A;  3KF6 A;  3PSI A;  5IYD G;  3RNU A;  4P72 A;  1VQJ A;  1A8V A;  1CKO A;  1YJN A;  1QZH A;  2IT1 A;  2LXJ A;  4PG3 A;  1VQ7 A;  4KHP L;  2Z0S A;  3J7Z C;  2R7Z G;  2JEB I;  2UUB Q;  2R93 G;  1WCM G;  2HT1 A;  1CUK A;  4LF7 L;  1JE5 A;  1UWV A;  2JK8 A;  3CC7 A;  4LWC A;  1H95 A;  4WJ3 M;  1B7Y B;  1GVP A;  1Q12 A;  1HJP A;  4KHP Q;  4IFD I;  2JA5 G;  1K73 C;  4LF4 L;  4GKJ L;  1IBM L;  2JA6 G;  2GN5 A;  4IPH A;  3GTQ H;  1Q86 C;  1XPO A;  4GKK L;  1U0L A;  3G6E A;  3UDF A;  2UU9 L;  1N36 Q;  2YTY A;  1C9O A;  2OCE A;  3PUZ A;  1YHA A;  4BXX H;  4BBR G;  3TRZ A;  1BBW A;  3HOW G;  4GOP C;  2VQF L;  4MTN A;  1LYL A;  4MZ9 A;  5M3F G;  4HJ8 A;  3H3V I;  3D0F A;  4BY1 H;  1Q8K A;  2EIF A;  3PIO A;  4JI4 Q;  4R1J A;  3ULL A;  1FVI A;  4A3F G;  4GN5 A;  2PI2 A;  3M9B A;  2VQF Q;  3GDE A;  1NMG A;  4LFA L;  4JI6 L;  4R4Q A;  2K75 A;  1SMX A;  1KL9 A;  3J81 i;  4DUZ L;  3W5O A;  4DUY Q;  4A76 A;  3FKI H;  1VQH A;  4A3M H;  3I7F A;  1KQS A;  1RL2 A;  4GNX A;  1QVC A;  3F1Z A;  4ALP A;  2R93 H;  3CCM A;  4LNQ A;  1JJG A;  4X65 Q;  3CCL A;  2I5L X;  2I5M X;  3AYH B;  3F2D A;  1XMQ Q;  1Y1V H;  2WFW A;  4LFA Q;  4A3E H;  1VQL A;  4OX9 L;  1SE8 A;  2ZTD A;  2LXK A;  2E2H H;  1L1O C;  2OQ0 A;  4JBM A;  4TVA B;  1VQE A;  3RR5 A;  4HIO A;  4POF A;  2RHQ B;  1S72 A;  1LUZ A;  3AQQ A;  4KI0 A;  1VQI A;  1K8A C;  2VNU D;  1N32 L;  3ULJ A;  3CCQ A;  1C0A A;  1E1T A;  3CP0 A;  4DV7 Q;  1NTG A;  3HKZ E;  2YYZ A;  5JJI A;  2N49 A;  2E5L L;  4DUY L;  5C4X H;  2EXD A;  4B3R Q;  1E7Z A;  3KDF A;  1ASY A;  4DKA C;  4GOP A;  1HZA A;  2VS1 A;  3I4N H;  4A3I H;  1HNZ Q;  3H15 A;  4LF8 L;  1QVF A;  3CC4 A;  2NVY H;  4XIG S;  4DV6 Q;  3S1R H;  1KXL A;  3UE0 A;  3F2C A;  1VQA A;  5IE8 A;  3A5U A;  2JA8 G;  3M4P A;  3B6Y A;  2KBN A;  2VQE L;  4AIM A;  1G29 1;  1Q1B A;  3CCJ A;  2WB1 G;  3T1H Q;  1IXR A;  1EWI A;  3DLL A;  1HNZ L;  1VQK A;  3S14 H;  1X3G A;  3S1N H;  1WOC A;  2CWP A;  4L5Q A;  5DLQ E;  4DR3 Q;  5GQO A;  4YWL A;  5GAG C;  4B3S Q;  2UUC L;  4DV1 L;  2UXC L;  1HR0 W;  1UE6 A;  1Q82 C;  3CW2 C;  4GNX C;  4LF7 Q;  3I4M G;  2E2I H;  3K7U C;  2ZJR A;  3I2Z A;  4QIW E;  5LMN Q;  2UXD Q;  1Q7Y C;  4KHZ A;  4HIK A;  3H0G G;  1IBM Q;  1Z47 A;  1XNR L;  2JA7 H;  4LF4 Q;  1XMQ L;  1VQD A;  1X55 A;  4RMF A;  1PH9 A;  3ZJY C;  1NMF A;  3TEH B;  4JV5 Q;  1QUQ A;  2K14 A;  3PO2 G;  1CKM A;  3HKS A;  4DV1 Q;  2IHF A;  2JJQ A;  4JC0 A;  4AQY L;  4A3E G;  4IPD A;  1I94 L;  4JI0 L;  4OXP A;  4B3M Q;  3JAM i;  2ZJP A;  3KFU A;  3J80 i;  4DR3 L;  3CCS A;  2QGQ A;  3RZO H;  4B3S L;  1TWG H;  2CKZ B;  3M85 A;  1XJV A;  4A3L H;  4A3J G;  3HOX H;  3F2B A;  3OW2 A;  4PZ8 A;  4FDB A;  3HOV G;  2QEX A;  4TQU S;  4JI4 L;  3S15 H;  4O0A A;  1Y1W H;  5JEA G;  2UUA Q;  2QA4 A;  1SLJ A;  1Y1V G;  1WFQ A;  3I56 A;  3UDG A;  2A19 A;  4BA2 I;  4R4C A;  2MNA A;  4LF8 Q;  4R4O A;  1YNX A;  4DR7 L;  4A3G H;  3S1Q H;  2OTL A;  3CMA A;  2E8G A;  1PH2 A;  1WJJ A;  2NVT H;  5GRO A;  4A3K G;  3J81 c;  3STB D;  3GTL H;  3M3Y H;  2B3G A;  4DR5 L;  1CSQ A;  2KCT A;  3K8A A;  3PIP A;  2A1A A;  3UDX A;  3RLF A;  2JA9 A;  2PMZ E;  3T1Y Q;  3K80 C;  4P75 A;  4APV A;  3PUV A;  1PV4 A;  2UXD L;  1G6P A;  4YY3 Q;  1JJC B;  1KD1 C;  4JI3 Q;  3GTK H;  5GAE C;  2D62 A;  4DV5 Q;  4JI7 L;  1VQN A;  4GOP B;  3G4S A;  3UDI A;  1VS0 A;  3ULP A;  2K52 A;  3KDF B;  3KLW A;  3U4Z A;  5JJK A;  4EQ5 A;  1K0R A;  4DAM A;  3GTJ H;  2Z6K A;  2JEA I;  3HOW H;  3PO3 H;  1HNX L;  3PV0 A;  5EAY A;  3L7Z C;  4JI3 L;  1XTD A;  1EOV A;  5H1S E;  2N3S A;  2L15 A;  1WCM H;  1QVG A;  1HZB A;  1P8L A;  1TWF H;  4J15 A;  5IWA Q;  4PMW A;  4DV0 L;  1Y1W G;  2H5X A;  4X64 Q;  3RN2 A;  1PFS A;  1VQ4 A;  2JA5 H;  4DV6 L;  2JQO A;  4ME3 A;  2PI2 E;  1BKB A;  2JA7 G;  1AE3 A;  3MXN B;  1J5E L;  1FGU A;  3ERS X;  4UPA A;  1KIX A;  1AE2 A;  1CSP A;  4P71 A;  2F3I A;  4PZ7 A;  5JEA J;  3TQY A;  5BR8 Q;  1IBK L;  5HY6 A;  4JI2 Q;  1Q81 C;  4POG A;  4DR4 L;  4A93 H;  5IP7 H;  4HJ9 A;  1N33 Q;  1T9H A;  2WB1 E;  3A74 A;  3TRE A;  3JC6 6;  2HHH Q;  4YCW A;  2CWA A;  1K9M C;  4LF5 Q;  3S16 H;  4MNO A;  4A4I A;  4RG1 A;  1GKH A;  3TS0 A;  4JI2 L;  4DR4 Q;  4A3D G;  5FJ8 G;  2UU9 Q;  5K36 G;  1GO3 E;  2YTV A;  4JV5 L;  1Y14 B;  3PF4 A;  1VQ9 A;  1PH6 A;  1XNR Q;  2MQH A;  4QJF A;  1N8R C;  1I6H H;  3RZD H;  5IYD H;  3M4Q A;  2AHO B;  4X66 L;  2F4V L;  3HOU H;  1A0I A;  1DGS A;  5C0X I;  2Q2T A;  1OXT A;  3A0J A;  2PNH A;  1VQB A;  2LSS A;  4YY3 L;  1VQO A;  4R4I A;  4O2D A;  4LUO A;  2R6G A;  2CQO A;  1TWH H;  4C2M H;  4DV5 L;  3M4O H;  3TS2 A;  2Z6K C;  2AKW B;  2OWO A;  4GNX B;  4DK3 C;  2F4V Q;  3I4O A;  1N34 Q;  1AH9 A;  1OXS C;  2FXQ A;  1V9P A;  2YU9 H;  2ZM6 Q;  1YVC A;  2R7D A;  3CCU A;  4L5R C;  2ES2 A;  1B70 B;  2UUA L;  2WP8 J;  1HH2 P;  4DV4 L;  1IYJ B;  4C3J H;  3NEN A;  3STB C;  1YZ6 A;  1E24 A;  3CQZ H;  1VQ6 A;  1XMO L;  4A75 A;  2IHE A;  5IYB H;  4UP7 A;  1B8A A;  1GD7 A;  3PO3 G;  4A3B G;  1IBK Q;  3L0O A;  1K3R A;  1X3E A;  3AFP A;  5IP7 G;  4DV3 L;  4AH6 A;  2JA8 H;  1EIF A;  1W3S A;  4GLX A;  2ZTE A;  1M90 C;  4NB3 A;  3HKZ G;  4JYA L;  2EQS A;  5GAH C;  4IJH A;  5FJ8 H;  1G51 A;  4GLA C;  3I4M H;  2K5N A;  4C3I H;  5AJ3 Q;  3IRB A;  1XMO Q;  1I94 Q;  4JI5 L;  5GAD C;  1L1O B;  4AYB E;  4LW1 A;  1HZC A;  2K5H A;  5IYB G;  2Q2U A;  4B3M L;  2NZO A;  3GTP H;  4X66 Q;  1VQM A;  1M1K C;  3NBH B;  4A3D H;  2CCZ A;  4LF6 L;  4JI7 Q;  3CAM A;  2VUM G;  4L5T A;  3PCO B;  1SRU A;  4DAY B;  2GVA A;  4B3T L;  1X9N A;  1X6O A;  2IX0 A;  1FJG Q;  1UE5 A;  2ID0 A;  3HFZ B;  1OTC A;  1VQ5 A;  4OX9 Q;  2UUC Q;  4DR6 Q;  5IP9 H;  1PVO A;  4BBR H;  4BA1 I;  4A3J H;  2NZH A;  3HOY H;  1QUQ B;  3RLN A;  3CCV A;  1I5F A;  3KF6 B;  3KF8 B;  4DR7 Q;  1V1Q A;  4DPG A;  4P74 A;  4YCV A;  1PH3 A;  2HHH L;  2BA1 A;  5IY0 A;  3J7A 5;  1YHQ A;  1XPR A;  2XTI A;  3GO5 A;  2B29 A;  2PQA A;  1J6Q A;  4JI1 Q;  4IOC A;  4LF9 Q;  4A3C H;  1E1O A;  2K5V A;  3HOV H;  5C0X G;  4LFC L;  1XPU A;  1X56 A;  2B63 H;  4B3R L;  1NE3 A;  4DR1 Q;  4R4T A;  4DNI A;  4A3I G;  2E5L Q;  2XGT A;  4HIM A;  4GKJ Q;  3S17 H;  2R7F A;  4HJ5 A;  3PF5 A;  3GTM H;  3W1G A;  3SGI A;  1Z9F A;  1WI5 A;  1KC8 C;  3KYH C;  2NVX H;  3DM3 A;  1EQQ A;  2IY5 B;  1JJ2 A;  1MJC A;  2YTX A;  3KJO A;  4C3H H;  4A93 G;  1LTL A;  4JBK A;  4A3F H;  4Y7N H;  2OQK A;  3W1B A;  3UE1 A;  2IX1 A;  2UXB L;  4X64 L;  2DUD A;  1EIY B;  4GKK Q;  1VQ8 A;  4UP8 A;  4NXN L;  5FLM G;  2Q2I A;  2HQL A;  3E0E A;  5IWA L;  5IYC H;  1TWA H;  1X65 A;  3K0X A;  1UE7 A;  1GM5 A;  2Q2H A;  4HJ7 A;  1LM0 A;  2UXC Q;  2F52 A;  5J3B A;  1JB7 A;  3BZK A;  2NVQ H;  2R92 H;  3HOZ H;  5C4J H;  3GTG H;  2VL6 A;  1YIT A;  2N78 A;  3PO2 H;  1P16 A;  1N33 L;  4BBS G;  2UUB L;  3OTO Q;  4AYB G;  2WAQ G;  3BU2 A;  3EBE A;  2VZA A;  1O7I A;  1JMC A;  1A63 A;  3KOJ A;  2KEN A;  4Y52 H;  2GVB A;  1YBY A;  2I5H A;  4JYA Q;  2V1C C;  3CC2 A;  2VUM H;  3J80 c;  4K0K L;  4A3C G;  3LGJ A;  4DV3 Q;  4JI1 L;  3I55 A;  1KHI A;  3PGZ A;  1PYB A;  2NN6 G;  3I4N G;  2RCN A;  3NEM A;  4NXM Q;  3OTO L;  2BH2 A;  1VCI A;  4QQB X;  4BBS H;  1MIU A;  5C44 G;  2RF4 A;  4GN4 B;  3AFQ A;  2R7Z H;  2B63 G;  1N32 Q;  4YHH Q;  4JI5 Q;  4A3G G;  3FP9 A;  1QZG A;  1D7Q A;  1FJG L;  4GN3 B;  4EX5 A;  2ZM6 L;  1SR3 A;  3T1Y L;  4LF6 Q;  2DGY A;  1L1O A;  4OWT B;  3E9I A;  3J81 j;  4B3T Q;  5FLM H;  3NEL A;  2RHS B;  5ELN A;  4YHH L;  1I3Q H;  3FHW A;  1Q1E A;  2Y0S E;  4LF9 L;  2VY3 A;  3HOU G;  1YJW A;  1E22 A;  1MJE A;  4OO1 I;  1N9W A;  5M3M H;  4DUZ Q;  1NBW A;  5C3E H;  1K83 H;  2VQE Q;  2OTJ A;  2ZTC A;  4JBJ A;  2KHJ A;  1YHB A;  1YEZ A;  3ICE A;  1V43 A;  4DR1 L;  3T1H L;  3A5Z B;  4GS3 A;  4IFD J;  2C35 B;  1U5K A;  1J5E Q;  2YV5 A;  4LFC Q;  3JAM c;  1IBL Q;  1IL2 A;  4DV2 L;  4P73 A;  4HJA A;  1TXY A;  1HR0 Q;  3HOX G;  1HNW L;  4XTC S;  1N34 L;  2K50 A;  5LMN W;  5LMU L;  3BZC A;  4DV7 L;  3CD6 A;  3BJU A;  4DV2 Q;  1BBU A;  3CCE A;  3WWV A;  2KCM A;  3K81 C;  4LUV A;  5FLX c;  4LFB Q;  4AQY Q;  5BR8 L;  2D0O A;  5E7N A;  1KRT A;  4QGU A;  4DV4 Q;  1SFO H;  4DR2 L;  1SRO A;  3U4V A;  2K4K A;  4NXN Q;  3ER0 A;  1S3O A;  3PUY A;  3G71 A;  1VQC A;  1CKN A;  2VW9 A;  2HIV A;  3PUW A;  4QY7 A;  5JJL A;  2UXB Q;  2BA0 A;  4A3L G;  4IPG A;  1FL0 A;  1KAW A;  1X54 A;  4KLK A;  4DR2 Q;  1YIJ A;  1ASZ A;  3M7N A;  1HZ9 A;  1OXU A;  1UE1 A;  3RN5 A;  4LFB L;  4JCV E;  4UY8 C;  1EUJ A;  4JI6 Q;  4LUZ A;  5M3M G;  4IJL A;  4X65 L;  5C44 H;  5C4X G;  3OYY A;  1IZ6 A;  3PUX A;  2ATW A;  1MKH A;  1EQR A;  1PH5 A;  5IP9 G;  2NN6 I;  4WJ4 A;  4K0K Q;  4JOI A;  2AWN A;  4DK6 C;  5LMN L;  3VDY A;  5M5Y H;  1X3F A;  3G48 A;  1BVS A;  1I50 H;  3CPF A;  5HGQ A;  4X62 L;  1L2F A;  4YWK A;  4IO9 A;  4DR5 Q;  5C3E G;  3RLO A;  1PH8 A;  3GD7 A;  4IFD G;  3S1M H;  4A3K H;  4IPC A;  1VQG A;  1VQP A;  2HIX A;  2BH8 A;  4JI8 Q;  4NXM L;  1PH7 A;  4L5S A;  1NY4 A;  3HOY G;  1N36 L;  1E3P A;  1OXX K;  1HR0 L;  4OWX B;  4HID A;  5IT9 c;  1W2B A;  4OWW B;  4BY7 G;  4X62 Q;  2MO0 A;  3U50 C;  4JI0 Q;  2JE6 I;  1EFW A;  3S24 A;  3H0G H;  4BY7 H;  1XNQ L;  2JA6 H;  2D0P A;  2Y0S G;  1D8L A;  2N8N A;  3CXC A;  1SN8 A;  1KRS A;  3EN2 A;  4DV0 Q;  1A62 A;  1UEB A;  2PQA B;  1L0W A;  3CPW A;  4OO1 G;  1YJ9 A;  3GTO H;  1HNX Q;  1JT8 A;  3S2D H;  4A3B H;  5M3F H;  1PYS B;  5ELO A;  5M5X H;  1OXV A;  2MFI A;  4NPS A;  4YWM A;  5M5W H;  1S40 A;  4QL5 A;  4BXX G;  3CCR A;  3S2H H;  4PZ6 A;  1TWC H;  2I0Q A;  2ASB A;  4X6A H;  2AWO A;  3CF5 A;  2KHI A;  1C7Y A;  2CFM A;  2ALY B;  1YI2 A;  1XNQ Q;  5AJ3 L;  4YCU A;  2ZJQ A;  4JG2 A;  3E9H A;  3MEF A;  1RIP A;  4IOA A;  4JOI C;  1Q46 A;  1R9T H;  5IYC G;  1EYG A;  3U58 A;  3EIV A;  3K7A H;  1VQF A;  1K8G A;  3AEV A;  4JBW A;  3FKI G;  4BY1 G;  2MO1 A;  3CME A;  4A3M G;  4GLV B;  4LF5 L;  1PHJ A; 
#chains in the Genus database with same CATH topology
 1WYD A;  2CW0 D;  2SEB D;  2A8V A;  3WDN A;  4KJO A;  4UP9 A;  2AQ3 B;  1PA6 A;  1NJI C;  1IBL L;  1BOS A;  3CVZ A;  2PW7 A;  4A3F B;  5FPO A;  2WAC A;  3F8T A;  3BQ2 A;  1CKN B;  4GKK H;  2IL8 A;  1PH1 A;  3PSI A;  2PYK A;  5CAE B;  4DL7 A;  4UCR A;  1CKO A;  4WJW A;  1AEX A;  2IT1 A;  1II3 A;  4QUF A;  1VQ7 A;  4KHP L;  2IBK A;  1YNJ D;  3J7Z C;  2JEB I;  3HOW B;  2YW2 A;  1BCP C;  1AUV A;  1SXT A;  1T36 A;  1UWV A;  2OT2 A;  4LWC A;  2RSO A;  4I7A A;  3JSL A;  2EYL A;  3RB0 A;  4WJ3 M;  2QDB A;  3QB3 A;  5IOC A;  3N42 B;  4CGY B;  2WYO A;  1U9R A;  2WIN B;  2JA5 G;  4IFD I;  1B4O A;  2FJ2 A;  1IBM L;  4ILW A;  2GN5 A;  3G7L A;  2A6H D;  4IPH A;  4GC7 A;  2V59 A;  1H9R A;  1U0L A;  1LTI D;  4ZRZ A;  1N36 Q;  2YTY A;  1G2S A;  3J7A F;  1PXU A;  4IUU A;  3VPD A;  4BBR G;  3HOW G;  4O4I F;  2F0P A;  4MTN A;  4MZ9 A;  4EFE A;  5KFK A;  5HV6 A;  3PIO 3;  3GII A;  5L1L A;  3R8B A;  4ZQI A;  1R4P B;  4HCS A;  3GIL A;  1FYC A;  4C3I G;  2EIF A;  4JI4 Q;  4RFB A;  3C0F B;  1KLU D;  3ULL A;  5KG7 A;  3BA8 A;  2E2D C;  4B3S H;  2D5D A;  1ESR A;  2JA5 B;  2PI2 A;  3GIM A;  2HJW A;  3GTJ B;  2HGS A;  3X3N A;  3HOZ B;  2RDF A;  3J7Y W;  2R85 A;  3NGD A;  1SMX A;  1KL9 A;  1KQS A;  2K1B A;  4FNF A;  4X65 Q;  1PZJ D;  1XMQ Q;  1SNO A;  4LFA Q;  2VUM A;  1EFI D;  2E2H H;  2OQ0 A;  4JBM A;  2W9B A;  4EFB A;  4B3M H;  3CQZ B;  5A2Q L;  5LL6 X;  1LUZ A;  3IKJ A;  1RJP A;  1VQI A;  3CRL C;  1CQJ B;  1JR0 D;  3I12 A;  1O7L A;  1HFG A;  4B3R H;  1A3V A;  4KKS A;  1E0B A;  1C0A A;  4ZAI A;  1WTV A;  4ETS A;  3HKZ E;  3NXW A;  2N49 A;  4L6T B;  4DUY L;  2E5L L;  3KDF A;  3R23 A;  3SDZ A;  3P1H A;  3KHR A;  3TN2 A;  4DKA C;  2NVX A;  2G5D A;  1JOO A;  3CC4 A;  1SYX B;  1KEE A;  4NKL A;  3V2T A;  1KXL A;  1VQA A;  5IE8 A;  2PNR C;  3B6Y A;  5KND A;  3J7A V;  3H6M A;  3TP6 A;  3H0G A;  3DMU A;  4AIM A;  1Q1B A;  3CCJ A;  2WB1 G;  1VQK A;  3S14 H;  4WBN F;  5A2Q W;  4A3J B;  2J9G A;  4K2L A;  4L5Q A;  1ET6 A;  4DR3 Q;  4RNO A;  5GAG C;  3E5N A;  1RHP A;  2K7V A;  2VB3 X;  1EYA A;  1HR0 W;  2UXC L;  1KBL A;  3T53 B;  3CW2 C;  5J2T F;  1GUT A;  2C00 A;  1WD1 A;  3K7U C;  2UXD Q;  4QIW E;  5H80 A;  4IN3 A;  4LJZ C;  4KHZ A;  4HIK A;  3H0G G;  1IBM Q;  2FB9 A;  1XNR L;  4K5W A;  1VQD A;  4RMF A;  1PH9 A;  2JSO A;  4Q8F A;  2K14 A;  4K8J A;  3PO2 G;  4DV1 Q;  4KV6 A;  4QMG A;  3GTM B;  1MBY A;  3Q22 A;  1B3Q A;  1CHP D;  2CVR A;  4XX0 B;  5DG8 A;  5E4X A;  2ZJP A;  3CCS A;  3AB9 A;  2QGQ A;  4APM A;  4ECV A;  1XJV A;  4X62 H;  3M85 A;  1HA5 A;  2EYH A;  4A3J G;  5M5X B;  3HOX H;  2JEI A;  4JI7 H;  5JEA G;  2Z6B A;  3N41 B;  1B50 A;  3C3L A;  5KT4 A;  1UNS A;  2MNA A;  4LF8 Q;  1HNZ H;  1A2U A;  1WCM A;  2CH4 W;  3S1Q H;  1GXD C;  1PH2 A;  2Z4H A;  3TZD A;  2F0Q A;  3H94 A;  2NVT H;  5M3M B;  1TWH B;  5GRO A;  3VR2 A;  3M4O B;  5C4X B;  1K83 B;  3TBI B;  4IHJ F;  3SE7 A;  2V9W A;  2YRX A;  2K28 A;  1EUD B;  3MR5 A;  3PN1 A;  3NSW A;  1CSQ A;  2M9V A;  3SEB A;  2VPS A;  2KCT A;  4CDF C;  5C4Z A;  3UDX A;  2JA9 A;  3K58 A;  3CKI B;  2L0C A;  4HMI A;  1TS4 A;  4P75 A;  1T5X D;  3V6J A;  1QG7 A;  3TP8 A;  1PV4 A;  2UXD L;  3UI2 A;  4O4L F;  3TII A;  1JJC B;  1NR4 A;  3CU7 A;  5GAE C;  2D62 A;  4JI7 L;  3G4S A;  2XIW A;  3DF7 A;  5JJK A;  1K0R A;  4DAM A;  3PO3 H;  5KFD A;  1HNX L;  5EAY A;  4EBD A;  3L7Z C;  2N3S A;  2L15 A;  4CBV A;  1WCM H;  1QVG A;  1ILQ A;  1TQO A;  4PMW A;  2M2L A;  5CBA E;  4J9O A;  5BR8 H;  4ED6 A;  1PFS A;  2JA5 H;  2JQO A;  5FOB B;  2F3W A;  1XX8 A;  1IBK H;  2UUB H;  5JEA J;  2HQE A;  3NTK A;  5JUM A;  1T9H A;  1UAP A;  3TRE A;  2HHH Q;  4LF5 Q;  3MJF A;  5I6Y A;  3S16 H;  2I07 B;  3CRK C;  2RQX A;  4JI2 L;  4A3D G;  5FJ8 G;  1LO5 D;  2Y0S B;  2KUM A;  5C5M A;  4QUC A;  3NTI A;  3W3A A;  1LT3 D;  1VQ9 A;  3GQB A;  1PH6 A;  4QJF A;  1I6H H;  4MV3 A;  4Q45 A;  2EZV A;  1A0I A;  1RJQ A;  1S5C D;  1K0S A;  3EVQ A;  1KAB A;  2R6G A;  4YY3 H;  2ALZ A;  3TS2 A;  4TV9 F;  2F0J A;  2F4V Q;  5KFG A;  4DR6 H;  2W71 A;  4F50 A;  4MTK A;  3VR4 A;  5KFZ A;  2F1M A;  3DWA A;  4MV6 A;  2ZM6 Q;  4MHE A;  2HVS A;  2R7D A;  2HVR A;  2ES2 A;  1I7L A;  2VQF H;  2NU7 B;  4C3J H;  4K5X A;  1VQ6 A;  3V4S A;  4A75 A;  3IFT A;  2P5Z X;  2IHE A;  4XT1 B;  4JV0 A;  4ED1 A;  4UP7 A;  1GD7 A;  3PO3 G;  4A3B G;  1JWS D;  5CMD A;  3GV3 A;  1X3E A;  4G4K A;  5ELB A;  4DV3 L;  3G8C A;  1EIF A;  4GLX A;  4JV1 A;  4LF4 H;  4J9N A;  1TVX A;  4DF7 A;  4IJH A;  2CW0 C;  1G51 A;  3EJI A;  3T51 B;  1K83 A;  1ULZ A;  1EQV A;  2N88 A;  3IRB A;  1JOK A;  2EJF C;  4DNT B;  3GTP H;  2O5I C;  1M1K C;  1I4R A;  3NBH B;  3TP5 A;  1VAJ A;  2FJZ A;  2F0G A;  1STH A;  3IFD A;  2VUM G;  3PCO B;  1STE A;  3L4J A;  1TS2 A;  4F4Z A;  1X9N A;  2IX0 A;  4FF1 A;  2KHS A;  1UE5 A;  1I4X A;  1VQ5 A;  5KKN B;  4DN4 M;  3PW2 A;  2UUC Q;  1U4L A;  1LAB A;  4XDX A;  3R93 A;  4F7X A;  5IP9 H;  1Y1W A;  4A3J H;  1SNQ A;  2NZH A;  3Q0A A;  3HOY H;  2DY7 A;  4RNN A;  5KFM A;  1STG A;  4U7C A;  4LF9 H;  1KDB A;  5I9P A;  3ONA B;  3QR8 A;  4FXG C;  2BA1 A;  2B2Y C;  4FO2 A;  3PR5 B;  5IY0 A;  2H1E A;  4DR7 H;  3GO5 A;  3N6R A;  2PQA A;  1S5D D;  2K5V A;  3OW7 A;  4LFC L;  2R93 A;  1IL8 A;  1IW7 D;  5FLX E;  1JIC A;  1DZ1 A;  2CW8 A;  4DNI A;  4A3I G;  1N32 H;  1JIH A;  3J80 E;  1M0W A;  2R7F A;  1TWF A;  2F0E A;  2XGQ A;  3C2P A;  1BQQ T;  1KC8 C;  3KYH C;  4JK1 C;  4YB8 B;  5CA0 F;  4M1U B;  3K0Y A;  5C5L A;  4A93 G;  2ASJ A;  1PYW D;  1TY0 A;  1VBG A;  4FP5 D;  1HTP A;  2SNM A;  3D4D A;  2KEC A;  5C0X H;  1U4M A;  4NXN L;  1VQ8 A;  3GTL B;  3I8Z A;  2RDJ A;  2R8J A;  5IYC H;  4IRC A;  1X65 A;  1UE7 A;  1GM5 A;  4U6P A;  4QW8 A;  2JA6 B;  1QOH A;  2UXC Q;  1C48 A;  2Z9H A;  4KN7 C;  1C8C A;  3HOZ H;  2R8I A;  1D5X C;  5NUC A;  2VL6 A;  3GTK B;  2A69 C;  1UNN C;  5COY A;  1N33 L;  1PTO C;  4U67 3;  2E74 C;  3OTO Q;  3V6H A;  3EBE A;  2VZA A;  1O7I A;  3BQ0 A;  3C1E A;  1QJO A;  3BAB A;  4JYA Q;  2V1C C;  2SDF A;  2PO4 A;  1VMC A;  1M8A A;  5D14 A;  4DV3 Q;  5JAV A;  3H40 A;  1PYB A;  3HG9 A;  2RCN A;  2X6G A;  2H4O A;  3T13 A;  5DM7 3;  5KFU A;  4FM9 A;  1S0O A;  5C44 G;  2A5H A;  3G6J B;  4YHH Q;  4FF4 A;  1QZG A;  5CYU A;  3NBI A;  4BY1 B;  3BQ1 A;  3T4A C;  4ZK9 B;  4WRD A;  2ZM6 L;  2RGR A;  3RJ0 A;  3T1Y L;  1U4P A;  4OWT B;  3OHA A;  3J81 j;  4HTH A;  3HBL A;  1YNJ C;  3A55 A;  5JVH 3;  3NEL A;  1AP0 A;  3M9M B;  1I3Q H;  1LTT D;  2Y0S E;  4JV2 A;  4TQR A;  2XC9 A;  4RB3 C;  2XGP A;  4IRD A;  4NLG A;  4HNV A;  1E22 A;  2PQE A;  1MJE A;  4OO1 I;  1RTN A;  4YAK B;  1J5E H;  1I4H A;  2R8G A;  1WTW A;  3T5H A;  1B2T A;  4U68 A;  1SFO B;  1YHB A;  2W6M A;  1TAE A;  4DR1 L;  2R7K A;  3PR4 A;  2W7O A;  2WKD A;  3EFX D;  3MXU A;  5DM6 3;  3JAM c;  1GJX A;  1ZET A;  2XRS D;  5IT9 W;  1HNW L;  1E4E B;  4MV1 A;  1CM9 A;  3VPC A;  4XTC S;  4Q44 A;  1EYC A;  1NSN S;  1SND A;  2F0F A;  4DV7 L;  5D1P A;  3BJU A;  3CCE A;  3WWV A;  4LUV A;  1SMY C;  3FDS A;  4LFB Q;  5EWF A;  4DV0 H;  4AQY Q;  4QGU A;  1TWF B;  1Y8P B;  1ROD A;  2XWB B;  5CV8 A;  1TA8 A;  2ASL A;  4DR2 H;  5IGB A;  2NVQ B;  3U4V A;  4NXN Q;  4HR7 B;  3OHB A;  3PUY A;  4DV6 H;  3WOF A;  5JJL A;  1QNK A;  1H9M A;  2HIV A;  4QY7 A;  4CJ2 C;  3OUU A;  4RAY A;  4EGQ A;  3N8D A;  3M7N A;  1KAW A;  1X54 A;  4A3B B;  3S14 B;  1UE1 A;  3OWF A;  3T1H H;  3HS0 C;  3WO0 A;  4LFB L;  4BWS C;  3JRW A;  5C4X G;  4LUZ A;  3NPP A;  1DXM A;  5M3M G;  2SCU B;  1R4Q B;  4QIW A;  2NVY B;  3S1R B;  3R3O A;  1PFB A;  5BN5 A;  2VXW A;  2NN6 I;  4K0K Q;  2VA3 A;  4IQZ A;  3VDY A;  4JI0 H;  5A35 A;  3G48 A;  5HGQ A;  4IO9 A;  4PMB A;  3GV8 B;  4YWK A;  4MAM A;  2EXZ A;  3GD7 A;  5T1I A;  4IFD G;  4A3K H;  1BBX C;  5KFW A;  2BH8 A;  3CHB D;  4JI8 Q;  5KRU A;  4DV7 H;  2X6L A;  3EPI A;  1RK5 A;  1E3P A;  3MA2 B;  1JX4 A;  4XQQ A;  1DON A;  2R8H A;  1HR0 H;  3A54 A;  3RGZ A;  4JI0 Q;  3HOX B;  3M7G A;  4KY5 A;  1CQV A;  1D8L A;  1AZP A;  1RYS A;  4K6L A;  3GTG B;  1UEB A;  2PQA B;  1YJ9 A;  3GTO H;  3Q23 A;  1EEF D;  2BQU A;  3V4Z A;  4NPS A;  3L3O C;  1STY A;  4BXX G;  5KT2 A;  1LTA D;  1VMP A;  1D1I A;  5EGT A;  4HAE A;  1O7Z A;  2AWO A;  2NBF A;  2KHI A;  2F0V A;  3CF5 A;  4A3M B;  2CFM A;  2ALY B;  5AJ3 L;  3MEF A;  1ML0 D;  3U58 A;  3EYY A;  2NVY A;  1GHJ A;  2N55 A;  4JBW A;  4BY1 G;  2MO1 A;  4WJ4 A;  4O3P A;  3BZD B;  1PHJ A;  4R8N A;  5EWE A;  5KG4 A;  3HOZ G;  4RHS A;  3SVM A;  1HNW Q;  1VBH A;  5CB4 F;  4JI5 H;  5LMU Q;  3V96 A;  3PO3 B;  5C0X J;  4OON A;  4PMC A;  1QCB D;  4UCO A;  3L2P A;  2AGQ A;  5IYD G;  3NUC A;  2EOT A;  2ZT9 C;  4PG3 A;  2GLT A;  2LKV A;  2MP1 A;  3GIQ A;  3VR5 A;  4BBR B;  1ZXT A;  5KFA A;  4DAY A;  3BG5 A;  1SNM A;  2HT1 A;  1CUK A;  3RGX A;  4LF7 L;  1JE5 A;  1SBB B;  1SEB D;  1B7Y B;  2F0W A;  3EA6 A;  3NQT A;  4HQ6 A;  1Y69 U;  1K8O A;  4FXK C;  1B04 A;  1N36 H;  3WOE A;  3GTQ H;  5A2Q E;  1Q86 C;  3IL8 A;  2NTS A;  1XPO A;  2B63 B;  3QOJ A;  4CJ0 B;  3G6E A;  2P0A A;  3T5K A;  3VR3 A;  4FF2 A;  1KNA A;  3TRZ A;  5D8D A;  1BBW A;  1A9X A;  5M3F G;  2W9C A;  1E2V A;  3Q8Q B;  4BY1 H;  1WTO A;  3OHX C;  4LF6 H;  1IYV A;  2FIN B;  3J81 L;  5JVL A;  2YS6 A;  2VR1 A;  4A3F G;  4GN5 A;  1SFO A;  2J6S A;  1D6E C;  3D6C A;  2I87 A;  1I3Q B;  4DL3 A;  4R4Q A;  1ENF A;  4A76 A;  4YJ2 F;  4DUY Q;  4A3M H;  2R93 H;  4DUZ H;  1N56 A;  3VR6 A;  4ALP A;  1JJG A;  1QVC A;  3F1Z A;  1X32 A;  4FVM A;  2IWH A;  4EQP A;  4A3E H;  2V4R A;  1VQL A;  1SJH D;  2PVP A;  1SE8 A;  4I55 F;  5CV5 A;  5C5J A;  1DD2 A;  3T5J A;  2HUG A;  3M3Y B;  1WTQ A;  5KFR A;  4LFC H;  2L55 A;  4A2A A;  1S72 A;  4HIO A;  3AQQ A;  4KI0 A;  3ULJ A;  1I3Q A;  3JAM W;  3CCQ A;  4MTD A;  4DL6 A;  3D4R A;  3HKZ A;  5KT6 A;  4O3S A;  2EXD A;  1ASY A;  1L0Y B;  3K5H A;  2VS1 A;  3I4N H;  4A3I H;  4IFD H;  4IZ8 A;  4ZUJ A;  4MIU A;  1JB3 A;  4KY6 A;  3LWE A;  3F2C A;  1B44 D;  2JA8 G;  4DR3 H;  1SYG A;  5FO9 B;  1DOL A;  1SMY D;  3RF2 A;  4F87 A;  1OO9 B;  3VYT A;  4BS9 A;  1LT6 D;  2BE5 D;  4C5C A;  2CWP A;  4HN7 A;  2UUC L;  4DV1 L;  1E2W A;  1UE6 A;  2NTT A;  4F8M A;  4LF7 Q;  1Q90 A;  3KBX A;  2A73 B;  2E2I H;  2ATL A;  3VYU A;  1VF5 C;  3K7A B;  3K59 A;  2JA7 H;  3DM1 A;  4ED8 A;  3LWU A;  2MHV A;  3QO2 A;  1CKM A;  3HKS A;  4JC0 A;  2JJQ A;  4A3E G;  2ZDH A;  5J39 A;  1KC7 A;  4OXP A;  2NUA B;  3JAM i;  5LOV F;  1HA6 A;  3RZO H;  4B3S L;  3MR3 A;  2DN8 A;  1DOK A;  4PQX A;  1SE3 A;  1W6K A;  4LF8 H;  3OW2 A;  4FDB A;  4HCE A;  1N33 H;  1Y1V G;  1WFQ A;  2A19 A;  2SOB A;  1ESF A;  3TME A;  1WTR A;  4R4O A;  1X3P A;  4A3G H;  1V1O A;  4PNY A;  3CMA A;  3N44 B;  2XWJ B;  1B6S A;  2X0S A;  3SR1 A;  4EYI B;  4KHP H;  3M3Y H;  1W96 A;  4J9Q A;  2RDH A;  5L1I A;  3GTQ B;  4XQN A;  3NHH A;  3RLF A;  3LNN A;  2PMZ E;  3HGB A;  1JKJ B;  1I50 B;  5KT7 A;  1DM0 B;  1SDF A;  1Q8I A;  1KD1 C;  5BMV F;  1VQN A;  3N43 B;  3T1Y H;  2V5A A;  3LX0 A;  3U4Z A;  4A2B A;  5KFE A;  3H4D A;  2A6E D;  1BNZ A;  4JV5 H;  1MD2 D;  4O4H F;  4JUZ A;  5EKL A;  5EBC A;  1XTD A;  3I73 A;  3RMH A;  5IWA Q;  4J15 A;  4DV0 L;  1EHI A;  4X64 Q;  2R8K A;  2IA6 A;  1EWH A;  1BKB A;  2PI2 E;  3TP7 A;  5D3D A;  5EQ0 A;  3MXN B;  4QCL A;  1TS5 A;  1KIX A;  3TQY A;  1CSP A;  2F3I A;  4X3U A;  3HRZ C;  5HY6 A;  1Y1V A;  2NZ1 D;  1Q81 C;  4ZOL F;  4C3H B;  5IP7 H;  1F9Q A;  3NWS A;  4C5A A;  4RNM A;  2WB1 E;  2LMC B;  3RUP A;  1TT2 A;  1HQR D;  4MNO A;  3G6X A;  1RCV D;  2IW3 A;  1M7J A;  3MVV A;  4DR4 Q;  1GKH A;  3R2I A;  3RIZ A;  1L0X B;  4B9W A;  4XT3 B;  2RBM A;  2XN9 C;  2UU9 Q;  3TQT A;  4K14 A;  2YTV A;  1I6V C;  2FE3 A;  5JPN C;  1XNR Q;  1KJ8 A;  3KAJ A;  2W57 A;  4FBT A;  5IYD H;  2CQY A;  4CKB A;  4OL7 A;  3SI8 A;  2FLP A;  2F4V H;  1OXT A;  1VQO A;  4JI3 H;  4HYK A;  4L63 B;  4DK3 C;  2EE1 A;  1EIG A;  1AH9 A;  1BR9 A;  1IHZ A;  4P2C B;  2YU9 H;  1H9S B;  3P7J A;  1WSC A;  1YVC A;  1Y8O B;  1KNE A;  2ZXP A;  4ZI7 F;  2UUA L;  1HH2 P;  4DV4 L;  1IYJ B;  1ONL A;  3GTO B;  3STB C;  5JH7 F;  3CQZ H;  1XMO L;  2F0I A;  5C3W A;  5L1J A;  2RA4 A;  1B8A A;  2FFK B;  2K03 A;  5CA1 F;  1PRT D;  3GTP B;  1TWC B;  4IWX A;  4AH6 A;  2ZTE A;  1M90 C;  3KXY T;  4IAJ A;  1H9K A;  3HKZ G;  2ZJT A;  3SK8 A;  1SSO A;  4JYA L;  5GAH C;  5FJ8 H;  4LAA A;  5KFI A;  4GLA C;  2Q8T A;  3I4M H;  4FBU A;  4OEL B;  5IGD A;  5KFJ A;  5LYJ F;  4RGT A;  4ZHQ F;  1HXY D;  1XMO Q;  2HDL A;  1WCM B;  2AU0 A;  1N48 A;  2F4I A;  4LW1 A;  2K5H A;  1SYB A;  4B3M L;  4E4T A;  3PW0 A;  5CV4 A;  3ERO A;  2AQ4 A;  1FR3 A;  4L5T A;  4B3T L;  4H44 C;  4MV8 A;  3HFZ B;  1EY5 A;  5KFN A;  4OX9 Q;  3QWN A;  4IUN A;  3TQ1 A;  2PBZ A;  3FKI A;  3RAX A;  1HQM C;  4BBR H;  3S17 B;  5DAU A;  5I47 A;  2W6N A;  4ULL A;  4DR7 Q;  1V1Q A;  2DPJ A;  2NWG A;  3DXJ C;  1CTM A;  2HHH L;  4CC6 A;  2CZG A;  5DGB A;  3J7A 5;  3RD4 A;  1XPR A;  4FYD A;  2B29 A;  4K6D A;  4X3T A;  5CV9 A;  4MN3 A;  4ECY A;  5C0X G;  4XYM B;  4IUQ A;  2B2T A;  2F0M A;  2B63 H;  1NE3 A;  1VDZ A;  2MUY A;  3H3V C;  4DV1 H;  5JVG 3;  1F2Y A;  4HIM A;  2E5L Q;  4HJ5 A;  3PF5 A;  5C44 B;  1Z9F A;  4A3K B;  3VYR A;  2J0T D;  1EQQ A;  2IY5 B;  4MA0 A;  1MJC A;  1TWG B;  5EZY F;  5KFS A;  4KD3 A;  2YCH A;  1LTL A;  2L11 A;  2IX1 A;  4CDE C;  3W1B A;  4HNT A;  3K3V A;  2VQD A;  4X64 L;  1E4G T;  3D3R A;  1I94 H;  2KQ3 A;  2HQL A;  2J4X A;  2Q2I A;  5IWA L;  2I46 A;  4ZUI A;  4RKB A;  4O3O A;  1LM0 A;  1JB7 A;  2J7Z A;  3BZK A;  1L2Z A;  1FD7 D;  1SJE D;  1FJG H;  3MXG A;  3GTG H;  4O2A F;  1YIT A;  2PMZ B;  1W93 A;  3PO2 H;  1P16 A;  2UUB L;  5K2M A;  3BU2 A;  3FEW X;  5KFQ A;  3KTM A;  1JMC A;  1A63 A;  1M4V A;  2KEN A;  1YBY A;  2I5H A;  1RF2 D;  1PX2 A;  2VUM H;  2B8F A;  2PZU A;  4K0K L;  1TWC A;  2M05 A;  4JI1 L;  4DV2 H;  2B2T C;  2HCC A;  2NN6 G;  2L12 A;  4Z9C B;  3Q1K A;  4QQB X;  3PW5 A;  1MIU A;  3M4I A;  4DR1 H;  1C4Q A;  2XVS A;  3AFQ A;  5FPR A;  1V4Y A;  3NWT A;  4LMQ D;  5G3L D;  4A3G G;  4RHR A;  1B9M A;  4J0M A;  4TQS A;  3J7A K;  1EYZ A;  4EX5 A;  1F9P A;  1E4F T;  2JA8 B;  1Z2O X;  3RTX A;  2DGY A;  1GLV A;  2D9U A;  4XXE A;  3E9I A;  4OIK A;  1B6R A;  5ELN A;  1Q1E A;  1GUW A;  3QIA A;  2VY3 A;  2VQE Q;  2OTJ A;  3KAL A;  2ZTC A;  1EOT A;  1GSO A;  1V43 A;  4R8U B;  3A5Z B;  4GS3 A;  2EY6 A;  4IFD J;  2JA7 B;  1BCP F;  4ECZ A;  1IBL Q;  4YAJ B;  4V0B A;  1SNC A;  3HOX G;  2FP4 B;  2JA7 A;  2R82 A;  5C4J B;  1LV9 A;  5LMN W;  2CQA A;  3BAA A;  1PRT B;  1BBU A;  4F4X A;  5FLX c;  2DPI A;  1C30 A;  3H20 A;  2FK1 A;  3ERQ A;  4DR2 L;  1PTO D;  1F2L A;  2ZM6 H;  2A6H C;  1S3O A;  4HSV A;  1ZQ7 A;  4O3Q A;  1K28 A;  5KT3 A;  3PUW A;  1BCP D;  2ZXR A;  4F4W A;  2UXB Q;  2BA0 A;  4A3L G;  5EKI A;  1FL0 A;  5AFW A;  4KLK A;  1YIJ A;  2YYA A;  3GV5 B;  3S1N B;  3HZX A;  3MWY W;  4JI6 Q;  4X65 L;  3VA5 A;  3PUX A;  5ELE A;  1JOQ A;  2JEF A;  1PZI D;  4KHV A;  1MKH A;  2F0L A;  1EQR A;  5I9O A;  1PTO H;  5IP9 G;  3F2U A;  3TIN A;  1TR5 A;  5LMN H;  4ECQ A;  2AWN A;  5M5Y H;  1BVS A;  1I50 H;  3I4L A;  4LF9 L;  3I4M B;  2EY2 A;  3RLO A;  1PH8 A;  4OHJ A;  3J81 E;  3S1M H;  2UVU A;  5LP6 F;  4IPC A;  1VQG A;  3DEO A;  3DEP A;  2CH4 A;  4C2M A;  5JQW A;  4YR2 A;  1D1K A;  2HIX A;  3VMM A;  5G3L F;  4L5S A;  3FVQ A;  2V4D A;  2EYM A;  4OWX B;  3T5L A;  4OWW B;  3A8K E;  3MHB A;  2JE6 I;  1EFW A;  2QF7 A;  2DIK A;  5I2X A;  1XNQ L;  4DLK A;  5C8Y F;  1RKN A;  1PTO F;  2Y0S G;  2UUC H;  2UUA H;  1DOM A;  2TMP A;  3EN2 A;  1A62 A;  4OO1 G;  4I50 F;  1JT8 A;  4Y8V B;  2NUC A;  5M3F H;  4TUY F;  1OXV A;  4NDX A;  5M5W H;  1ZHS A;  5ELC A;  4QL5 A;  2AUJ D;  3MR6 A;  3PQI A;  2ASB A;  4X6A H;  1HFN A;  4QWA A;  2R92 A;  5C4H A;  2UVW A;  3OSO A;  3FKI B;  4RGN A;  4BY7 B;  1FKA H;  1BGW A;  1IYU A;  3E9H A;  1R9T H;  5DLG A;  5D1O A;  3M9O B;  2ICI A;  3K7A H;  2BOS A;  1EYD A;  4LF5 L;  3FKI G;  1XNQ H;  2MGS A;  3CME A;  4GLV B;  1QNU A;  5DG7 A;  2LY7 A;  4KMU C;  4A3D H;  2ZDG A;  1PH4 A;  5FO8 B;  3W2D A;  2R92 G;  3D31 A;  4G7Z C;  3H3V H;  2R61 A;  2FLN A;  3MZ5 A;  2EY5 A;  4HSP A;  3SE0 A;  1DYQ A;  2EYF A;  4JI8 L;  4DR6 L;  1XDN A;  2FK2 A;  3RV3 A;  3KF8 A;  5JJZ A;  4P72 A;  5KFP A;  1A8V A;  1QZH A;  4MV7 A;  4B3T H;  3Q6S A;  3IAY A;  1PZK D;  4Q5V A;  2Z0S A;  2Y0S A;  2F0K A;  2R7Z G;  4UCU A;  2R93 G;  2Z1C A;  3UQ8 A;  2WAQ B;  5EBD A;  1WCM G;  2OXP A;  2QK4 A;  4LFA H;  4ECX A;  5LL6 b;  1EUC B;  4ECW A;  3CC7 A;  2R84 A;  1H95 A;  5IGF A;  2L4N A;  2K01 A;  1GVP A;  2WKC A;  4B9X A;  1KJJ A;  1HJP A;  1K8M A;  3FMC A;  4LF4 L;  3RFC A;  2K04 A;  5KYL A;  2JA6 G;  4JYA H;  2XRQ D;  1EY7 A;  1IOV A;  5IGE A;  2FK3 A;  4HR7 A;  5JOB A;  4GKK L;  3G6Y A;  4IUT A;  1MGS A;  2IJ0 A;  4MV9 A;  4XYL B;  3UDF A;  2UU9 L;  3OSP A;  1H9J A;  5EKK A;  3SK4 A;  3PUZ A;  1YHA A;  4R9W A;  2W6O A;  4BXX H;  5FKA C;  4EBE A;  2R93 B;  4CJ1 B;  2VQF L;  2M00 A;  4GOP C;  2R7Z B;  3FMA A;  1EU3 A;  2QKI C;  4DV4 H;  4DAV A;  4EG0 A;  1Z6H A;  3Q24 A;  3N52 A;  5DGA A;  2ICE C;  2F0H A;  3PIO A;  1N34 H;  2E2H B;  4LH6 A;  3ETJ A;  3RZD B;  4R1J A;  4DXF A;  4EEQ A;  5C1P A;  3R5H A;  2W9C B;  1FVI A;  3D4W A;  4RZR A;  3M9B A;  1JE4 A;  1Y1W B;  5KG0 A;  2X69 A;  2G9D A;  1SYC A;  1NMG A;  4LFA L;  4JI6 L;  1K1Q A;  2K75 A;  4DFA A;  3J81 i;  3S2H B;  5IGC A;  3HXL A;  3FKI H;  3I7F A;  4GNX A;  2YL2 A;  3ND8 A;  3CCL A;  2I5M X;  2WFW A;  1L1O C;  3JZI A;  1F77 A;  4TVA B;  4C3J B;  2KCN A;  1CQF A;  2NU9 B;  3RR5 A;  2BCO A;  4POF A;  2RHQ B;  1N32 L;  1JOR A;  3O13 A;  2R7L A;  1TU2 B;  5F9L A;  1G6Z A;  3FDT A;  2AQ2 B;  4ZCK A;  2JP1 A;  2I80 A;  5C4X H;  3MAQ A;  1E7Z A;  2A68 C;  2BQ3 A;  4GOP A;  2DJF C;  2B2Y A;  5KX5 F;  1HNZ Q;  3H15 A;  4NXN H;  2DJG C;  2NVY H;  1QE6 A;  4XIG S;  4DV6 Q;  3S1R H;  2KA7 A;  3A5U A;  1BCP B;  1HNX H;  1D2B A;  3GIP A;  3VA7 A;  2VQE L;  3T1H Q;  1G29 1;  4YIJ A;  4ZKC B;  1HNZ L;  4BY7 G;  3DLL A;  1EWI A;  2K5W A;  1ZHQ A;  1GUS A;  3S1N H;  1X3G A;  3QFF A;  1WOC A;  1NAP A;  1CS0 A;  3Q2O A;  1I6U A;  5GQO A;  4YWL A;  4B3S Q;  2RGV A;  1Q82 C;  5C3E B;  4GNX C;  2B2U A;  3QZ7 A;  2ZJR A;  2DNE A;  3I2Z A;  3I90 A;  4NMZ A;  2J6U A;  2E2J B;  1Z47 A;  3MFG A;  1GSH A;  3A8I E;  2RCF A;  1MI2 A;  3URY A;  1X55 A;  1XMQ L;  4LF4 Q;  2XD4 A;  1CK1 A;  1NMF A;  1QUQ A;  4EYH B;  2IHF A;  1I94 L;  4IPD A;  4JI0 L;  1JDE A;  3LP8 A;  2R3Z A;  1STB A;  4H13 C;  4B3M Q;  2W8K A;  1BNC A;  3J80 i;  3RBD A;  4A3L H;  5L9X A;  1TWG H;  2CKZ B;  5ISR A;  2HVQ A;  2EYP A;  3PZP A;  3RB6 A;  1WVL A;  1E4E A;  4PZ8 A;  1D5Z C;  1AUX A;  2QEX A;  3HKZ B;  4IAL A;  1M6V A;  4JI4 L;  5K36 H;  2L9H A;  4O0A A;  2QA4 A;  3UDG A;  2C2R A;  4BA2 I;  4R4C A;  3MR2 A;  2W9B B;  5CBE E;  1ENC A;  4H7B A;  2Q8I B;  4KN4 C;  4QF4 A;  1CE8 A;  4A3E B;  5LA6 F;  5C3X A;  5E1F A;  3NP8 A;  2R87 A;  4A3K G;  5T14 A;  3U9S A;  5C6A A;  1GYF A;  4DR5 L;  3K8A A;  3H91 A;  3PIP A;  2B2U C;  4DA2 A;  5FO7 B;  3KLS X;  3GTM A;  3T1Y Q;  3K80 C;  3KHG A;  1GUN A;  4RH6 A;  3E3X A;  4YY3 Q;  4QIW B;  1GUO A;  4G3I A;  3S1Q B;  1EY0 A;  1HNW H;  3BYT B;  5IWA H;  2K52 A;  3KDF B;  3KLW A;  4NXM H;  2WAQ A;  1I50 A;  2WB1 B;  2JEA I;  3HOW H;  2W7P A;  3PV0 A;  4DV5 H;  5H1S E;  3TSS A;  1HZB A;  1P8L A;  1TWF H;  1XYI A;  1Y1W G;  2H5X A;  1VQ4 A;  4DV6 L;  4YR3 A;  4ME3 A;  4B08 A;  2JA7 G;  2VA2 A;  1F9R A;  3ND9 A;  3ERS X;  1AE2 A;  2K5Q A;  4P71 A;  1IBK L;  3S2H H;  3QJY A;  5DLF A;  4DR4 L;  4DAP A;  4A93 H;  2O5J C;  1WR2 A;  1QWY A;  5BN3 A;  4ZQ3 A;  1EZ1 A;  3KUP A;  4YCW A;  1QIL A;  4IUP A;  4JI2 H;  3PVX A;  4LSX A;  5J1Z A;  1RDP D;  3OTO H;  4ED2 A;  1SE2 A;  4RGO S;  1GO3 E;  2PZT A;  4JV5 L;  5K36 G;  4I7H A;  1Y14 B;  1AZQ A;  3PF4 A;  2MQH A;  4ZYS A;  1N8R C;  1HRJ A;  3HOV B;  3M4Q A;  4DV3 H;  2AHO B;  4X66 L;  1EEI D;  2F4V L;  5C0X I;  1DGS A;  4A3G B;  1AFP A;  3I91 A;  2LSS A;  4R4I A;  1ICF B;  4C2M H;  1BDO A;  1TWH H;  4DV5 L;  3M4O H;  3RBE A;  4GNX B;  3I4O A;  1GGO A;  4YHH H;  1G8Z D;  1BJT A;  5EPL A;  1OXS C;  2FXQ A;  4LH7 A;  1V9P A;  4S3S A;  3QG1 A;  4O3N A;  3H09 A;  3NEN A;  1YZ6 A;  4IUR A;  5EPJ A;  2XIG A;  3J81 W;  1JXL A;  1WTX A;  1IBK Q;  3L0O A;  3AFP A;  2F0O A;  1B3A A;  1Y1V B;  2K5D A;  1W3S A;  3Q8R B;  1IBM H;  4HED A;  3LML A;  1LTG D;  4NB3 A;  2NU6 B;  4ECR A;  2IP4 A;  1DV1 A;  2BDO A;  1TWH A;  1OWT A;  3S15 B;  2UVV A;  2K5N A;  1ZEQ X;  2B39 A;  5AJ3 Q;  4A3D B;  2Z8L A;  4UCV A;  5L1K A;  2UVR A;  5KT5 A;  1EIH A;  3U9O A;  1BUV T;  3R2T A;  2NZO A;  4X66 Q;  4JI7 Q;  3CAM A;  2K6A A;  2K32 A;  3OPO A;  1VKZ A;  4LFB H;  2I8C A;  5LHY 1;  2GVA A;  5COR A;  4G57 A;  3JRX A;  3MFI A;  1X6O A;  4KY7 A;  4ECT A;  2ID0 A;  1LTS D;  2Z4I A;  4L8J A;  1T5E A;  4XYO A;  5KYI A;  4DR6 Q;  4BA1 I;  2XCL A;  1EL0 A;  1QUQ B;  1NR2 A;  3CCV A;  1I5F A;  3KF8 B;  3BDC A;  4CHT B;  4DPG A;  4P74 A;  2VPQ A;  4YCV A;  1PH3 A;  4Q0F A;  1I4Q A;  1YHQ A;  2XTI A;  1S97 A;  1J6Q A;  1F2M A;  3KLR A;  3K5I A;  3DUZ A;  2E75 C;  1XPU A;  3QZ8 A;  4R8I A;  1B9N A;  4B3R L;  4R4T A;  4JI1 H;  1HCZ A;  4GKJ Q;  5CV6 A;  4GC6 A;  4J9S A;  1WI5 A;  5L37 A;  4FS1 A;  3DM3 A;  2YTX A;  3KJO A;  4Y7N H;  2FMC A;  2XCP A;  1KLG D;  1PFN A;  2DUD A;  1EIY B;  2EJG C;  4GKK Q;  5KFO A;  5KG6 A;  1A3T A;  4QB4 A;  1GHK A;  3E0E A;  1IOW A;  2CW7 A;  4AYB A;  5CGK A;  1HUN A;  3VPB A;  1TWA H;  1RTO A;  4J9M A;  3E0J A;  2F52 A;  4G7O C;  2W6Z A;  1SEI A;  3V05 A;  1E2Z A;  2QYZ A;  2N78 A;  1A3U A;  2XCA A;  3PW4 A;  5M5W B;  4EGJ A;  4AYB G;  1SE4 A;  3GID A;  1S0M A;  3AMU A;  4YBZ B;  3KOJ A;  2ASD A;  2AQ1 B;  4YJ3 F;  3CC2 A;  1Z2N X;  3J80 c;  1SAP A;  2RSN A;  4DU9 A;  1KHI A;  3PGZ A;  4AQY H;  3BJY A;  2BH2 A;  1VCI A;  1EY9 A;  4BBS H;  1GOZ A;  2RKS A;  3GTO A;  2RF4 A;  4GN4 B;  1CA6 A;  2R7Z H;  1N32 Q;  3ORR A;  4JI5 Q;  1D7Q A;  4M8A A;  2YS7 A;  4ED3 A;  3WNZ A;  4X64 H;  4GN3 B;  2C28 A;  2C2E A;  4QWE A;  4UHV A;  2PPB C;  3OIP A;  4GZY C;  1V51 A;  4FF3 A;  2R6F A;  1EY4 A;  4JI4 H;  2FPP B;  1TKW B;  3GV6 A;  1MZB A;  2F0U A;  5FLM H;  3PMF A;  1B53 A;  2RHS B;  5D3I B;  1A6X A;  2VQE H;  4YHH L;  2L1B A;  3FHW A;  3RUZ A;  4KK7 A;  1Z2P X;  4UCT A;  2BDN A;  1YJW A;  4K0K H;  5M3M H;  4PWQ A;  4R7R A;  5C3E H;  4NW2 A;  3OOC A;  1SYE A;  3SK6 A;  4JBJ A;  3J80 W;  2KHJ A;  2O4X A;  1YEZ A;  3ICE A;  4RGM A;  1XNR H;  1FNW A;  1U5K A;  3AU7 A;  2C9O A;  3GTL A;  4HJA A;  1TXY A;  4KTA A;  3FPU B;  1HR0 Q;  4OEM B;  3F8N A;  1XWE A;  1N34 L;  2K50 A;  2WV6 D;  5CR3 A;  2SNS A;  1DV2 A;  3SK5 A;  3BZC A;  1V1P A;  5LMU L;  4C1N I;  4CKE A;  4RB0 A;  3GTQ A;  3OUZ A;  2KCM A;  4OO1 H;  4KKU A;  2NN6 H;  5E7N A;  1KRT A;  5BR8 L;  1S5F D;  2DLN A;  2KSW A;  1UC8 A;  3WO1 A;  2K4K A;  3K5N A;  3ER0 A;  3G71 A;  1VQC A;  1CKN A;  1EY8 A;  1CI3 M;  4IPG A;  5KNB A;  1ASZ A;  2C5C A;  2ZDQ A;  1HZ9 A;  1OXU A;  1CZW A;  1JLL B;  3GIK A;  4JCV E;  4UY8 C;  4MA5 A;  4IJL A;  1ICW A;  2F3V A;  3OYY A;  1BF4 A;  3D6W A;  4FU0 A;  1IZ6 A;  1LT5 D;  1I4G A;  2GA4 B;  5DQG A;  4N8X 1;  2A69 D;  1UEA B;  3C1F A;  1PH5 A;  4QWB A;  4JOI A;  5LMN L;  2C2D A;  4X62 L;  3GTJ A;  2EJM A;  4DR5 Q;  1L2F A;  2HDM A;  5C3E G;  3S9W A;  3OWE B;  1TWG A;  3HOY G;  5IGG A;  3KAK A;  2FPI B;  4WOR A;  5IT9 c;  4HID A;  4X62 Q;  2MO0 A;  3U50 C;  4ECU A;  5KNC A;  4RB1 A;  3S24 A;  3H0G H;  2HCI A;  3PW7 A;  3IG0 A;  3OMG A;  2D0P A;  3NTH A;  4ABN A;  2QCP X;  2N8N A;  5D1O B;  5EJW A;  1SN8 A;  4DV0 Q;  2NYZ D;  3P75 A;  3CPW A;  3MEH A;  1SYD A;  3Q8P B;  3S2D H;  1LTB D;  1LLR D;  4I65 A;  5ELF A;  2F0N A;  5M5X H;  4DK1 A;  4YWM A;  4J9L A;  3CCR A;  4PZ6 A;  2QW7 A;  1G2T A;  1DIK A;  1XNQ Q;  4YCU A;  3E6Z X;  4JG2 A;  3JAM L;  4JOI C;  1Q46 A;  5IYC G;  1EYG A;  2DWC A;  3K5M A;  4ME6 A;  2B8G A;  1VQF A;  5JJI A;  3AEV A;  5BN4 A;  4A3M G;  2IX3 A;  4A3B H;  1PRT C;  1A2T A;  2WAQ E;  3BDL A;  5KFB A;  3MWM A;  2AMC B;  1S0N A;  4F4Y A;  2PZW A;  2D2C C;  3A8J E;  5DEH A;  3KJP A;  4H02 A;  1KDC A;  2E2J H;  4O3R A;  3Q8S B;  2AUK A;  4DGZ A;  2WE6 A;  3A56 A;  4M7E A;  4JI8 H;  3Q8D A;  3KF6 A;  5EWG A;  3RNU A;  1KJI A;  2WTF A;  1VQJ A;  1YJN A;  2LXJ A;  2W8L A;  4DUY H;  1Q3L A;  1I4P A;  5KFH A;  1HTL D;  2FHT A;  2UUB Q;  4CDC C;  1JC7 A;  1MSH A;  3K6O A;  5E3F A;  4K8I A;  2JK8 A;  5IT9 L;  3BS1 A;  4LF5 H;  3KK7 A;  2HHH H;  1Q12 A;  2VOB A;  5J2U F;  4KHP Q;  4R8U A;  1K73 C;  4KD4 A;  4GKJ L;  4H0L C;  2DZD A;  3E5S A;  2KEE A;  2NB0 A;  2G9H D;  1C3O A;  4XYQ A;  4J9R A;  1EU4 A;  3TDQ A;  1C9O A;  3V6K A;  2OCE A;  5KFX A;  1SCU B;  5KG2 A;  4RZQ A;  3IN5 A;  4ODG A;  3RB4 A;  2O03 A;  3M9N B;  3BVM A;  1LYL A;  4HJ8 A;  3H3V I;  2VUG A;  4EEY A;  3D0F A;  1KJ9 A;  1Q8K A;  4WFN 3;  4RKL A;  4C5B A;  3MWD A;  2W70 A;  4Q8E A;  2VQF Q;  3GDE A;  1IW7 C;  2R92 B;  3EPG A;  2FMM A;  4DUZ L;  2EYO A;  3W5O A;  1VQH A;  1LTR D;  2EPB A;  4IR9 A;  1RL2 A;  3CCM A;  3EQL C;  2YU9 B;  4LNQ A;  2YRW A;  2I5L X;  3F2D A;  3AYH B;  3OIQ A;  1Y1V H;  2JEJ A;  3QOL A;  4OX9 L;  1RD9 D;  2ZTD A;  1KDA A;  2LXK A;  1CFM A;  3MWE A;  5KFF A;  4EQO A;  1VQE A;  4DL5 A;  1SNP A;  3TZU A;  4X65 H;  1IBL H;  4JW0 A;  1STA A;  5E4W C;  1K8A C;  1XMQ H;  3T56 B;  2VNU D;  4C56 C;  2IMW P;  2LS0 1;  2PMZ A;  1E1T A;  3BG3 A;  3CP0 A;  4DV7 Q;  4N8F A;  1NTG A;  1V8Q A;  2JA6 A;  2YYZ A;  4X3S A;  4B3R Q;  1KAA A;  1F2Z A;  1ET9 A;  1YNN C;  1QB5 D;  1HZA A;  4C2M B;  3LWB A;  4LF8 L;  1QVF A;  4C3J G;  1RJR A;  2O2L D;  3UE0 A;  3BA9 A;  3M4P A;  1HUM A;  4I4T F;  4ED0 A;  1T3N A;  2KBN A;  5HGT A;  1TWA A;  1IXR A;  3HEJ A;  4BWG B;  2L5T A;  4JI6 H;  4V19 0;  2B2W A;  3ETH A;  1BXT A;  1W6J A;  3M4Y A;  5DLQ E;  3UFX B;  5TSS A;  1CT1 D;  4TSS A;  3I4M G;  3I4N B;  4CC5 A;  5F2D A;  5LMN Q;  3CQZ A;  1S9F A;  1Q7Y C;  4ED7 A;  3S16 B;  4JPB W;  5EDW A;  2F0D A;  1CQI B;  3ZJY C;  2UXD H;  4JV5 Q;  3TEH B;  5IIF A;  2YU9 A;  3G6V A;  4XQJ A;  5KIX A;  4AQY L;  4IWY A;  5LMU H;  1KJQ A;  3KFU A;  1LAC A;  4DR3 L;  5FD5 A;  2NVX B;  4O2B F;  2QEJ C;  3C46 A;  2FMA A;  1EY6 A;  1DJR D;  3F2B A;  2EDG A;  3HOV G;  1S10 A;  2FLL A;  2A6E C;  4TQU S;  3L9A X;  4Q43 A;  3S15 H;  1Y1W H;  2UUA Q;  1SLJ A;  3L4K A;  3R5F A;  1MSG A;  3I56 A;  4CKC A;  4N9T A;  5IOD A;  5DNF A;  4OX9 H;  1JWU D;  1YNX A;  4DR7 L;  4DR4 H;  3N40 P;  2OTL A;  2E8G A;  2KED A;  2RVL A;  1WJJ A;  2FKL A;  2B2W C;  3ZYY X;  3J81 c;  3STB D;  3GTL H;  5C1O A;  2JN4 A;  1HPC A;  2B3G A;  3HB9 A;  1X3Q A;  1WTH A;  4ZKB B;  5CC4 A;  2A1A A;  4A3I B;  2OF1 A;  5CV7 A;  4FS2 A;  4APV A;  3KBG A;  5JEA H;  1NUC A;  3PUV A;  1G6P A;  4JI3 Q;  3GTK H;  1K1S A;  2DNC A;  4DV5 Q;  4GOP B;  3GV7 B;  3UDI A;  1VS0 A;  1TS3 A;  3ULP A;  1IKL A;  3T16 A;  4EQ5 A;  2NVT B;  3GTJ H;  2R7Z A;  2Z6K A;  2OH2 A;  2IPK D;  2YZN A;  4JI3 L;  1EOV A;  5FK9 C;  2PN1 A;  3MFY A;  1XXG A;  4FXD A;  3MXP A;  1RYR A;  2ENB A;  3RN2 A;  3GLK A;  4MTE A;  2KCC A;  4J6H A;  1AE3 A;  1J5E L;  1S68 A;  1FGU A;  4RUA A;  4RB2 C;  4UPA A;  1PLF A;  4HNU A;  3BYY B;  5BR8 Q;  4PZ7 A;  4ECS A;  1V1P B;  4JI2 Q;  4POG A;  3DWP A;  4C3H G;  3GIJ A;  5I4D A;  4HJ9 A;  1N33 Q;  1UC9 A;  1PMR A;  3A74 A;  5ELD A;  1HHV A;  3JC6 6;  1K9M C;  2CWA A;  3GTK A;  3OMC A;  3RZO B;  1TII D;  1XTC D;  3D8G A;  4A4I A;  4RG1 A;  3TS0 A;  5BPH A;  3RAQ A;  4UFZ A;  2R7N A;  1EZ8 A;  1M0T A;  1PTO B;  1MHW C;  1JDB B;  3P20 A;  4QWC A;  3RZD H;  5KFY A;  3HOY B;  3HOU H;  2Q2T A;  1ZYR C;  2GPS A;  4LMY A;  3A0J A;  2PNH A;  1VQB A;  4YY3 L;  2KOL A;  5IT9 E;  4O2D A;  4LUO A;  2CQO A;  3GTG A;  2Z6K C;  1YNN D;  2AKW B;  3MXN A;  4RAU C;  1D5M C;  2OWO A;  1N34 Q;  2WDT A;  2E2I B;  5FD6 A;  2ZXO A;  4WD3 A;  3CCU A;  4L5R C;  2C22 A;  1B70 B;  1FGB D;  2WP8 J;  1E24 A;  4O1N A;  2F0T A;  3I3C A;  5IYB H;  2GPW A;  1CHQ D;  4LF7 H;  1K3R A;  1O78 A;  1B33 N;  5IP7 G;  4RAZ A;  2JA8 H;  2W9A A;  1NCV A;  1I7N A;  2WII B;  2QIL A;  4EBC A;  2XNA C;  4I7Z C;  2JXM B;  2EQS A;  2F0S A;  2VB2 X;  1FNU A;  4C3I H;  3I72 A;  4EQN A;  2RDG A;  4X66 H;  4IUV A;  3X3M A;  5EPK A;  1PFM A;  4A93 B;  4G7H C;  3ITP A;  4L1K A;  2HD3 A;  1I94 Q;  1KTK A;  4JI5 L;  4LSA A;  5GAD C;  1L1O B;  4AYB E;  4QW9 A;  3KHH A;  1J8I A;  5IYB G;  1HZC A;  3PO2 B;  2Q2U A;  5LL6 S;  1VQM A;  5M5Y B;  2CCZ A;  4RUC A;  4LF6 L;  2OEO A;  2LFN A;  2R86 A;  1SRU A;  3A7L A;  4DAY B;  2NU8 B;  1FJG Q;  2BE5 C;  4EGV A;  1OTC A;  1STN A;  2JEG A;  1PVO A;  2UXB H;  3S2D B;  3RLN A;  4EVO A;  1S5E D;  4O42 A;  3KF6 B;  4DXG A;  1S4Z A;  5T1G A;  2PCF B;  5D65 A;  2YZM A;  1WD0 A;  5DG9 A;  2E2H A;  4N9P A;  3R5X A;  2OLS A;  4PDB A;  2PW5 A;  4LF9 Q;  3NBH A;  4JI1 Q;  4IOC A;  4TRD A;  4A3C H;  4GKJ H;  1E1O A;  1R9T A;  1UUP A;  3HOV H;  5F9N A;  3BVZ A;  4E6I A;  4CDD C;  1X56 A;  3A7A B;  4F88 A;  5HUR A;  2MCT A;  4Q0Y A;  4DR1 Q;  2XGT A;  3NK9 A;  3S17 H;  1GUG A;  3GTM H;  3GP7 A;  3MC0 B;  3W1G A;  3SGI A;  5KFT A;  4J8Q A;  2NVX H;  2E76 C;  3VYS A;  1JJ2 A;  3H4B A;  3NE5 B;  4C3H H;  4JBK A;  4J1M A;  4A3F H;  2UXB L;  2OQK A;  5IYZ F;  3UE1 A;  5DQH A;  1XMO H;  4UP8 A;  2B2V A;  5FLM G;  3NQI A;  5LXT F;  3S1M B;  3K0X A;  4MV4 A;  2Q2H A;  4HJ7 A;  4QWD A;  1EZ6 A;  4M9U A;  1Z7T A;  1PK8 A;  5J3B A;  2NVQ H;  4RA8 A;  2R92 H;  1F9S A;  1H9S A;  5C4J H;  4OGQ C;  5I2Y A;  2UXC H;  2E2I A;  3HP3 A;  4C1N K;  4BBS G;  1JQY D;  2KJX A;  4YQW A;  1A15 A;  1JWM D;  4LK1 C;  3OSN A;  2WAQ G;  2J6T A;  2UU9 H;  3FPP A;  1S03 G;  2CHB D;  4Y52 H;  4C3I B;  2GVB A;  1B1Z A;  5FLX L;  4A3C G;  3LGJ A;  5M3F B;  4JVZ A;  3I55 A;  1T94 A;  3I4N G;  1K3B C;  4PV1 C;  3NEM A;  4NXM Q;  1S5B D;  3OTO L;  2W6Q A;  3TIG A;  3RB3 A;  3KLS A;  2QDL A;  4DL4 A;  3RV4 A;  4YR0 A;  1TY2 A;  2E5L H;  2B63 G;  2JYO A;  1WTP A;  3FP9 A;  5EOY A;  1FJG L;  1NNX A;  1EWC A;  5DQI A;  1SR3 A;  4X3K A;  4XZ3 B;  4LF6 Q;  4DNR B;  2Q8R E;  2B2V C;  1L1O A;  3BDO A;  5BPF A;  4B3T Q;  3JAM E;  5FLX W;  4NP5 A;  1RK6 A;  1AN8 A;  4DL2 A;  3HOU G;  1ZKO A;  2DY8 A;  1N9W A;  2AGO A;  4UDU C;  4DUZ Q;  1NBW A;  4KKT A;  1K83 H;  3N6X A;  5JVD F;  1CA5 A;  2JA5 A;  3T1H L;  3FRP B;  2C35 B;  1J5E Q;  1TWA B;  2KVM A;  1CZG A;  2YV5 A;  4LFC Q;  1IL2 A;  1I6H B;  4UAI A;  4DK0 A;  4DV2 L;  4P73 A;  4K2K A;  3DWQ A;  3HOU B;  1RJT A;  2R7M A;  5GON F;  2FPG B;  4J9P A;  5KEE A;  2TSS A;  2K05 A;  2V58 A;  3CD6 A;  3SHL A;  1O7Y A;  5J22 A;  4DV2 Q;  3K81 C;  1AW7 A;  5K5P A;  2D0O A;  5KG1 A;  1O80 A;  4OIJ A;  4DV4 Q;  1SFO H;  3MFH A;  1AN7 A;  4HMJ A;  2B63 A;  1SRO A;  4ME5 A;  1BO0 A;  4TKO B;  3J80 L;  2MJ8 A;  4K5V A;  2AGP A;  2VW9 A;  2A74 C;  1SYF A;  1ENA A;  2EY1 A;  1LT4 D;  3SXH A;  4ZLT F;  4RU9 A;  2WB1 A;  4DR2 Q;  3KHL A;  1PDQ A;  3JSN A;  3RN5 A;  3MTS A;  2V4Q A;  1EUJ A;  3K5L A;  3DHQ A;  5C44 H;  5JPM C;  1JCK B;  2BR0 A;  3PIP 3;  5HBR B;  4DR5 H;  2ATW A;  1WH2 A;  3BVG A;  3GQC A;  3H0G B;  4IZO A;  4TV8 F;  4DK6 C;  1ILP A;  2EYJ A;  1J9O A;  1X3F A;  2BQR A;  5KFL A;  3CPF A;  2K33 A;  4AYB B;  3I70 A;  3K57 A;  1Y8N B;  4BBS B;  1VQP A;  1U4R A;  5M9O A;  5KG5 A;  1O75 A;  4NXM L;  3U9T A;  2F03 A;  1PH7 A;  1NY4 A;  1N36 L;  5KG3 A;  1OXX K;  1HR0 L;  5KFC A;  1W2B A;  1DCZ A;  4RCO A;  2YZG A;  3K5O A;  4BY7 H;  1IKM A;  4IR1 A;  2JA6 H;  5KFV A;  3CXC A;  4YP3 A;  2EVB A;  1KRS A;  4RCN A;  5KGU A;  1R9T B;  1L0W A;  4ID6 A;  2RDI A;  3ORQ A;  2VUM B;  1HNX Q;  1PRT F;  1PYS B;  5ELO A;  2MPM A;  3GTP A;  2MFI A;  2XSC A;  1S40 A;  1FNV A;  3K3P A;  1VF7 A;  1TWC H;  2I0Q A;  1BXR A;  4RWS C;  1C7Y A;  5I6W A;  1YI2 A;  4UCS A;  4KJN A;  2ZJQ A;  4Y7N B;  2W6P A;  1ZYR D;  1G91 A;  1RIP A;  4IOA A;  4IRK A;  1EQT A;  1GSA A;  3EIV A;  1K8G A;  2A68 D;  4J9K A; 
#chains in the Genus database with same CATH homology
 2WAQ E;  1WYD A;  1PH4 A;  2R92 G;  3HOZ G;  2AMC B;  2A8V A;  1HNW Q;  3D31 A;  5LMU Q;  4UP9 A;  1PA6 A;  3H3V H;  1NJI C;  3KJP A;  1IBL L;  4H02 A;  3F8T A;  5C0X J;  4JI8 L;  1CKN B;  2E2J H;  4OON A;  4DR6 L;  1PH1 A;  3L2P A;  3Q8D A;  3KF6 A;  3PSI A;  5IYD G;  3RNU A;  4P72 A;  1VQJ A;  1A8V A;  1CKO A;  1YJN A;  1QZH A;  2IT1 A;  2LXJ A;  4PG3 A;  1VQ7 A;  4KHP L;  2Z0S A;  3J7Z C;  2R7Z G;  2JEB I;  2UUB Q;  2R93 G;  1WCM G;  2HT1 A;  1CUK A;  4LF7 L;  1JE5 A;  1UWV A;  2JK8 A;  3CC7 A;  4LWC A;  1H95 A;  4WJ3 M;  1B7Y B;  1GVP A;  1Q12 A;  1HJP A;  4KHP Q;  4IFD I;  2JA5 G;  1K73 C;  4LF4 L;  4GKJ L;  1IBM L;  2JA6 G;  2GN5 A;  4IPH A;  3GTQ H;  1Q86 C;  1XPO A;  4GKK L;  1U0L A;  3G6E A;  3UDF A;  2UU9 L;  1N36 Q;  2YTY A;  1C9O A;  2OCE A;  3PUZ A;  1YHA A;  4BXX H;  4BBR G;  3TRZ A;  1BBW A;  3HOW G;  4GOP C;  2VQF L;  4MTN A;  1LYL A;  4MZ9 A;  5M3F G;  4HJ8 A;  3H3V I;  3D0F A;  4BY1 H;  1Q8K A;  2EIF A;  3PIO A;  4JI4 Q;  4R1J A;  3ULL A;  1FVI A;  4A3F G;  4GN5 A;  2PI2 A;  3M9B A;  2VQF Q;  3GDE A;  1NMG A;  4LFA L;  4JI6 L;  4R4Q A;  2K75 A;  1SMX A;  1KL9 A;  3J81 i;  4DUZ L;  3W5O A;  4DUY Q;  4A76 A;  3FKI H;  1VQH A;  4A3M H;  3I7F A;  1KQS A;  1RL2 A;  4GNX A;  1QVC A;  3F1Z A;  4ALP A;  2R93 H;  3CCM A;  4LNQ A;  1JJG A;  4X65 Q;  3CCL A;  2I5L X;  2I5M X;  3AYH B;  3F2D A;  1XMQ Q;  1Y1V H;  2WFW A;  4LFA Q;  4A3E H;  1VQL A;  4OX9 L;  1SE8 A;  2ZTD A;  2LXK A;  2E2H H;  1L1O C;  2OQ0 A;  4JBM A;  4TVA B;  1VQE A;  3RR5 A;  4HIO A;  4POF A;  2RHQ B;  1S72 A;  1LUZ A;  3AQQ A;  4KI0 A;  1VQI A;  1K8A C;  2VNU D;  1N32 L;  3ULJ A;  3CCQ A;  1C0A A;  1E1T A;  3CP0 A;  4DV7 Q;  1NTG A;  3HKZ E;  2YYZ A;  5JJI A;  2N49 A;  2E5L L;  4DUY L;  5C4X H;  2EXD A;  4B3R Q;  1E7Z A;  3KDF A;  1ASY A;  4DKA C;  4GOP A;  1HZA A;  2VS1 A;  3I4N H;  4A3I H;  1HNZ Q;  3H15 A;  4LF8 L;  1QVF A;  3CC4 A;  2NVY H;  4XIG S;  4DV6 Q;  3S1R H;  1KXL A;  3UE0 A;  3F2C A;  1VQA A;  5IE8 A;  3A5U A;  2JA8 G;  3M4P A;  3B6Y A;  2KBN A;  2VQE L;  4AIM A;  1G29 1;  1Q1B A;  3CCJ A;  2WB1 G;  3T1H Q;  1IXR A;  1EWI A;  3DLL A;  1HNZ L;  1VQK A;  3S14 H;  1X3G A;  3S1N H;  1WOC A;  2CWP A;  4L5Q A;  5DLQ E;  4DR3 Q;  5GQO A;  4YWL A;  5GAG C;  4B3S Q;  2UUC L;  4DV1 L;  2UXC L;  1HR0 W;  1UE6 A;  1Q82 C;  3CW2 C;  4GNX C;  4LF7 Q;  3I4M G;  2E2I H;  3K7U C;  2ZJR A;  3I2Z A;  4QIW E;  5LMN Q;  2UXD Q;  1Q7Y C;  4KHZ A;  4HIK A;  3H0G G;  1IBM Q;  1Z47 A;  1XNR L;  2JA7 H;  4LF4 Q;  1XMQ L;  1VQD A;  1X55 A;  4RMF A;  1PH9 A;  3ZJY C;  1NMF A;  3TEH B;  4JV5 Q;  1QUQ A;  2K14 A;  3PO2 G;  1CKM A;  3HKS A;  4DV1 Q;  2IHF A;  2JJQ A;  4JC0 A;  4AQY L;  4A3E G;  4IPD A;  1I94 L;  4JI0 L;  4OXP A;  4B3M Q;  3JAM i;  2ZJP A;  3KFU A;  3J80 i;  4DR3 L;  3CCS A;  2QGQ A;  3RZO H;  4B3S L;  1TWG H;  2CKZ B;  3M85 A;  1XJV A;  4A3L H;  4A3J G;  3HOX H;  3F2B A;  3OW2 A;  4PZ8 A;  4FDB A;  3HOV G;  2QEX A;  4TQU S;  4JI4 L;  3S15 H;  4O0A A;  1Y1W H;  5JEA G;  2UUA Q;  2QA4 A;  1SLJ A;  1Y1V G;  1WFQ A;  3I56 A;  3UDG A;  2A19 A;  4BA2 I;  4R4C A;  2MNA A;  4LF8 Q;  4R4O A;  1YNX A;  4DR7 L;  4A3G H;  3S1Q H;  2OTL A;  3CMA A;  2E8G A;  1PH2 A;  1WJJ A;  2NVT H;  5GRO A;  4A3K G;  3J81 c;  3STB D;  3GTL H;  3M3Y H;  2B3G A;  4DR5 L;  1CSQ A;  2KCT A;  3K8A A;  3PIP A;  2A1A A;  3UDX A;  3RLF A;  2JA9 A;  2PMZ E;  3T1Y Q;  3K80 C;  4P75 A;  4APV A;  3PUV A;  1PV4 A;  2UXD L;  1G6P A;  4YY3 Q;  1JJC B;  1KD1 C;  4JI3 Q;  3GTK H;  5GAE C;  2D62 A;  4DV5 Q;  4JI7 L;  1VQN A;  4GOP B;  3G4S A;  3UDI A;  1VS0 A;  3ULP A;  2K52 A;  3KDF B;  3KLW A;  3U4Z A;  5JJK A;  4EQ5 A;  1K0R A;  4DAM A;  3GTJ H;  2Z6K A;  2JEA I;  3HOW H;  3PO3 H;  1HNX L;  3PV0 A;  5EAY A;  3L7Z C;  4JI3 L;  1XTD A;  1EOV A;  5H1S E;  2N3S A;  2L15 A;  1WCM H;  1QVG A;  1HZB A;  1P8L A;  1TWF H;  4J15 A;  5IWA Q;  4PMW A;  4DV0 L;  1Y1W G;  2H5X A;  4X64 Q;  3RN2 A;  1PFS A;  1VQ4 A;  2JA5 H;  4DV6 L;  2JQO A;  4ME3 A;  2PI2 E;  1BKB A;  2JA7 G;  1AE3 A;  3MXN B;  1J5E L;  1FGU A;  3ERS X;  4UPA A;  1KIX A;  1AE2 A;  1CSP A;  4P71 A;  2F3I A;  4PZ7 A;  5JEA J;  3TQY A;  5BR8 Q;  1IBK L;  5HY6 A;  4JI2 Q;  1Q81 C;  4POG A;  4DR4 L;  4A93 H;  5IP7 H;  4HJ9 A;  1N33 Q;  1T9H A;  2WB1 E;  3A74 A;  3TRE A;  3JC6 6;  2HHH Q;  4YCW A;  2CWA A;  1K9M C;  4LF5 Q;  3S16 H;  4MNO A;  4A4I A;  4RG1 A;  1GKH A;  3TS0 A;  4JI2 L;  4DR4 Q;  4A3D G;  5FJ8 G;  2UU9 Q;  5K36 G;  1GO3 E;  2YTV A;  4JV5 L;  1Y14 B;  3PF4 A;  1VQ9 A;  1PH6 A;  1XNR Q;  2MQH A;  4QJF A;  1N8R C;  1I6H H;  3RZD H;  5IYD H;  3M4Q A;  2AHO B;  4X66 L;  2F4V L;  3HOU H;  1A0I A;  1DGS A;  5C0X I;  2Q2T A;  1OXT A;  3A0J A;  2PNH A;  1VQB A;  2LSS A;  4YY3 L;  1VQO A;  4R4I A;  4O2D A;  4LUO A;  2R6G A;  2CQO A;  1TWH H;  4C2M H;  4DV5 L;  3M4O H;  3TS2 A;  2Z6K C;  2AKW B;  2OWO A;  4GNX B;  4DK3 C;  2F4V Q;  3I4O A;  1N34 Q;  1AH9 A;  1OXS C;  2FXQ A;  1V9P A;  2YU9 H;  2ZM6 Q;  1YVC A;  2R7D A;  3CCU A;  4L5R C;  2ES2 A;  1B70 B;  2UUA L;  2WP8 J;  1HH2 P;  4DV4 L;  1IYJ B;  4C3J H;  3NEN A;  3STB C;  1YZ6 A;  1E24 A;  3CQZ H;  1VQ6 A;  1XMO L;  4A75 A;  2IHE A;  5IYB H;  4UP7 A;  1B8A A;  1GD7 A;  3PO3 G;  4A3B G;  1IBK Q;  3L0O A;  1K3R A;  1X3E A;  3AFP A;  5IP7 G;  4DV3 L;  4AH6 A;  2JA8 H;  1EIF A;  1W3S A;  4GLX A;  2ZTE A;  1M90 C;  4NB3 A;  3HKZ G;  4JYA L;  2EQS A;  5GAH C;  4IJH A;  5FJ8 H;  1G51 A;  4GLA C;  3I4M H;  2K5N A;  4C3I H;  5AJ3 Q;  3IRB A;  1XMO Q;  1I94 Q;  4JI5 L;  5GAD C;  1L1O B;  4AYB E;  4LW1 A;  1HZC A;  2K5H A;  5IYB G;  2Q2U A;  4B3M L;  2NZO A;  3GTP H;  4X66 Q;  1VQM A;  1M1K C;  3NBH B;  4A3D H;  2CCZ A;  4LF6 L;  4JI7 Q;  3CAM A;  2VUM G;  4L5T A;  3PCO B;  1SRU A;  4DAY B;  2GVA A;  4B3T L;  1X9N A;  1X6O A;  2IX0 A;  1FJG Q;  1UE5 A;  2ID0 A;  3HFZ B;  1OTC A;  1VQ5 A;  4OX9 Q;  2UUC Q;  4DR6 Q;  5IP9 H;  1PVO A;  4BBR H;  4BA1 I;  4A3J H;  2NZH A;  3HOY H;  1QUQ B;  3RLN A;  3CCV A;  1I5F A;  3KF6 B;  3KF8 B;  4DR7 Q;  1V1Q A;  4DPG A;  4P74 A;  4YCV A;  1PH3 A;  2HHH L;  2BA1 A;  5IY0 A;  3J7A 5;  1YHQ A;  1XPR A;  2XTI A;  3GO5 A;  2B29 A;  2PQA A;  1J6Q A;  4JI1 Q;  4IOC A;  4LF9 Q;  4A3C H;  1E1O A;  2K5V A;  3HOV H;  5C0X G;  4LFC L;  1XPU A;  1X56 A;  2B63 H;  4B3R L;  1NE3 A;  4DR1 Q;  4R4T A;  4DNI A;  4A3I G;  2E5L Q;  2XGT A;  4HIM A;  4GKJ Q;  3S17 H;  2R7F A;  4HJ5 A;  3PF5 A;  3GTM H;  3W1G A;  3SGI A;  1Z9F A;  1WI5 A;  1KC8 C;  3KYH C;  2NVX H;  3DM3 A;  1EQQ A;  2IY5 B;  1JJ2 A;  1MJC A;  2YTX A;  3KJO A;  4C3H H;  4A93 G;  1LTL A;  4JBK A;  4A3F H;  4Y7N H;  2OQK A;  3W1B A;  3UE1 A;  2IX1 A;  2UXB L;  4X64 L;  2DUD A;  1EIY B;  4GKK Q;  1VQ8 A;  4UP8 A;  4NXN L;  5FLM G;  2Q2I A;  2HQL A;  3E0E A;  5IWA L;  5IYC H;  1TWA H;  1X65 A;  3K0X A;  1UE7 A;  1GM5 A;  2Q2H A;  4HJ7 A;  1LM0 A;  2UXC Q;  2F52 A;  5J3B A;  1JB7 A;  3BZK A;  2NVQ H;  2R92 H;  3HOZ H;  5C4J H;  3GTG H;  2VL6 A;  1YIT A;  2N78 A;  3PO2 H;  1P16 A;  1N33 L;  4BBS G;  2UUB L;  3OTO Q;  4AYB G;  2WAQ G;  3BU2 A;  3EBE A;  2VZA A;  1O7I A;  1JMC A;  1A63 A;  3KOJ A;  2KEN A;  4Y52 H;  2GVB A;  1YBY A;  2I5H A;  4JYA Q;  2V1C C;  3CC2 A;  2VUM H;  3J80 c;  4K0K L;  4A3C G;  3LGJ A;  4DV3 Q;  4JI1 L;  3I55 A;  1KHI A;  3PGZ A;  1PYB A;  2NN6 G;  3I4N G;  2RCN A;  3NEM A;  4NXM Q;  3OTO L;  2BH2 A;  1VCI A;  4QQB X;  4BBS H;  1MIU A;  5C44 G;  2RF4 A;  4GN4 B;  3AFQ A;  2R7Z H;  2B63 G;  1N32 Q;  4YHH Q;  4JI5 Q;  4A3G G;  3FP9 A;  1QZG A;  1D7Q A;  1FJG L;  4GN3 B;  4EX5 A;  2ZM6 L;  1SR3 A;  3T1Y L;  4LF6 Q;  2DGY A;  1L1O A;  4OWT B;  3E9I A;  3J81 j;  4B3T Q;  5FLM H;  3NEL A;  2RHS B;  5ELN A;  4YHH L;  1I3Q H;  3FHW A;  1Q1E A;  2Y0S E;  4LF9 L;  2VY3 A;  3HOU G;  1YJW A;  1E22 A;  1MJE A;  4OO1 I;  1N9W A;  5M3M H;  4DUZ Q;  1NBW A;  5C3E H;  1K83 H;  2VQE Q;  2OTJ A;  2ZTC A;  4JBJ A;  2KHJ A;  1YHB A;  1YEZ A;  3ICE A;  1V43 A;  4DR1 L;  3T1H L;  3A5Z B;  4GS3 A;  4IFD J;  2C35 B;  1U5K A;  1J5E Q;  2YV5 A;  4LFC Q;  3JAM c;  1IBL Q;  1IL2 A;  4DV2 L;  4P73 A;  4HJA A;  1TXY A;  1HR0 Q;  3HOX G;  1HNW L;  4XTC S;  1N34 L;  2K50 A;  5LMN W;  5LMU L;  3BZC A;  4DV7 L;  3CD6 A;  3BJU A;  4DV2 Q;  1BBU A;  3CCE A;  3WWV A;  2KCM A;  3K81 C;  4LUV A;  5FLX c;  4LFB Q;  4AQY Q;  5BR8 L;  2D0O A;  5E7N A;  1KRT A;  4QGU A;  4DV4 Q;  1SFO H;  4DR2 L;  1SRO A;  3U4V A;  2K4K A;  4NXN Q;  3ER0 A;  1S3O A;  3PUY A;  3G71 A;  1VQC A;  1CKN A;  2VW9 A;  2HIV A;  3PUW A;  4QY7 A;  5JJL A;  2UXB Q;  2BA0 A;  4A3L G;  4IPG A;  1FL0 A;  1KAW A;  1X54 A;  4KLK A;  4DR2 Q;  1YIJ A;  1ASZ A;  3M7N A;  1HZ9 A;  1OXU A;  1UE1 A;  3RN5 A;  4LFB L;  4JCV E;  4UY8 C;  1EUJ A;  4JI6 Q;  4LUZ A;  5M3M G;  4IJL A;  4X65 L;  5C44 H;  5C4X G;  3OYY A;  1IZ6 A;  3PUX A;  2ATW A;  1MKH A;  1EQR A;  1PH5 A;  5IP9 G;  2NN6 I;  4WJ4 A;  4K0K Q;  4JOI A;  2AWN A;  4DK6 C;  5LMN L;  3VDY A;  5M5Y H;  1X3F A;  3G48 A;  1BVS A;  1I50 H;  3CPF A;  5HGQ A;  4X62 L;  1L2F A;  4YWK A;  4IO9 A;  4DR5 Q;  5C3E G;  3RLO A;  1PH8 A;  3GD7 A;  4IFD G;  3S1M H;  4A3K H;  4IPC A;  1VQG A;  1VQP A;  2HIX A;  2BH8 A;  4JI8 Q;  4NXM L;  1PH7 A;  4L5S A;  1NY4 A;  3HOY G;  1N36 L;  1E3P A;  1OXX K;  1HR0 L;  4OWX B;  4HID A;  5IT9 c;  1W2B A;  4OWW B;  4BY7 G;  4X62 Q;  2MO0 A;  3U50 C;  4JI0 Q;  2JE6 I;  1EFW A;  3S24 A;  3H0G H;  4BY7 H;  1XNQ L;  2JA6 H;  2D0P A;  2Y0S G;  1D8L A;  2N8N A;  3CXC A;  1SN8 A;  1KRS A;  3EN2 A;  4DV0 Q;  1A62 A;  1UEB A;  2PQA B;  1L0W A;  3CPW A;  4OO1 G;  1YJ9 A;  3GTO H;  1HNX Q;  1JT8 A;  3S2D H;  4A3B H;  5M3F H;  1PYS B;  5ELO A;  5M5X H;  1OXV A;  2MFI A;  4NPS A;  4YWM A;  5M5W H;  1S40 A;  4QL5 A;  4BXX G;  3CCR A;  3S2H H;  4PZ6 A;  1TWC H;  2I0Q A;  2ASB A;  4X6A H;  2AWO A;  3CF5 A;  2KHI A;  1C7Y A;  2CFM A;  2ALY B;  1YI2 A;  1XNQ Q;  5AJ3 L;  4YCU A;  2ZJQ A;  4JG2 A;  3E9H A;  3MEF A;  1RIP A;  4IOA A;  4JOI C;  1Q46 A;  1R9T H;  5IYC G;  1EYG A;  3U58 A;  3EIV A;  3K7A H;  1VQF A;  1K8G A;  3AEV A;  4JBW A;  3FKI G;  4BY1 G;  2MO1 A;  3CME A;  4A3M G;  4GLV B;  4LF5 L;  1PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...