3H3VH

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00575 S1 S1 RNA binding domain
H PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vH02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h3vH01
4B3RL 4NXNL 1IBMQ 4ME3A 5M3FH 1PFSA 3G71A 4P72A 4JI4L 4WJ3M 2OWOA 3CCEA 4GKJL 4IFDJ 2HIXA 4IFDI 3RLFA 3NELA 1VQ7A 4A3LG 4IFDG 1QVCA 4X66L 1BKBA 2JA8G 2H5XA 1PH5A 3A0JA 3S17H 3U50C 3EN2A 3DLLA 1EQQA 1PH6A 1C9OA 2RHQB 4DV4Q 2WP8J 2PI2A 4DR3L 3ICEA 3VDYA 4BBRH 3CMEA 1FJGL 1SROA 5J3BA 4MNOA 1GD7A 3AQQA 4BA1I 4GS3A 4A3MG 1JB7A 4AH6A 2YTVA 1EYGA 3S1NH 4HIMA 2R7FA 2VNUD 3PCOB 3KOJA 4RG1A 2KBNA 1FL0A 4IOCA 4JV5Q 4A3EG 4GN4B 1R9TH 1KHIA 2ALYB 2C35B 3FKIG 3MEFA 4GLVB 1WCMH 2N78A 1P16A 4OWXB 1G51A 3IRBA 1XPOA 2ZTEA 2N8NA 1WFQA 1WYDA 3F8TA 3ULLA 4GKKQ 1OXTA 5ELNA 4C3JH 4A76A 3KF8B 1SRUA 2D0PA 1EWIA 5JJKA 4DV4L 2JJQA 3PGZA 1N34Q 1WI5A 3CC2A 2UUCQ 3RN2A 1X55A 4R4OA 5C4XH 1YI2A 2YU9H 4IOAA 4GLXA 4BA2I 1VQHA 2JA9A 4JV5L 4IPCA 2AWOA 3M9BA 4JI6Q 4DV2Q 1VQKA 2L15A 2F4VQ 1X9NA 3AEVA 2HHHQ 1A0IA 1PH7A 3CXCA 1VQGA 1B70B 1OXVA 1X54A 5GAEC 1YITA 4JI7Q 4GKKL 4WJ4A 1V43A 2MNAA 1VCIA 4AYBG 3UE0A 1N34L 1PV4A 5FLMG 1RIPA 3G4SA 4B3MQ 2VUMH 4GN3B 4DK6C 2UUCL 3S1RH 4IPDA 1B7YB 4MZ9A 1EIFA 4HIOA 4B3SQ 3F2BA 1SE8A 2ZTDA 1TXYA 1NJIC 4YWLA 1PHJA 2IX1A 1TWFH 4BXXH 2Z6KC 1Q86C 1JJCB 3M4OH 1KRSA 1KAWA 4DV5Q 2QGQA 2VS1A 3W1BA 4JI6L 4LF5Q 4C3IH 1P8LA 4DV2L 2F4VL 1E3PA 2HHHL 1VQAA 3HKSA 1X3GA 1E22A 2ZJRA 4JI7L 4P74A 3F2DA 1GO3E 3KF6A 3K80C 2KHIA 2AMCB 3RZDH 1IBKQ 1EIYB 2RCNA 2OCEA 3K8AA 4A3BH 3HOVG 1HNZQ 2Q2HA 3UDGA 3H3VH 4BY7G 4LFCQ 4EQ5A 4B3ML 3HOYG 2E2HH 4JYAL 1SR3A 4B3SL 4BY1H 3HOUG 3S15H 3BU2A 1QZHA 1K3RA 3MXNB 3PUYA 4X62Q 4DV5L 4DV0L 1E7ZA 2Y0SG 3H0GG 4LF5L 5LMNW 3OTOQ 4DKAC 3I4MH 4AYBE 4IO9A 2Z6KA 3S24A 4LF7Q 4QQBX 2IY5B 1XNRQ 3J80c 4ALPA 5C44H 3CW2C 4P75A 5BR8Q 1IBKL 3KF6B 3PF4A 2YTXA 4JI2Q 4OWWB 2DUDA 1HNZL 2R92G 2YV5A 4TQUS 1IZ6A 4LFCL 4DAMA 3HOWH 4DR6Q 5IYBH 4DR5Q 2B3GA 1YJWA 1GVPA 3S2HH 4O0AA 4GN5A 4YWMA 5IY0A 1OTCA 4JI1Q 2CQOA 1YIJA 2QA4A 3CP0A 5IYDH 4HJ9A 3GD7A 4LW1A 5IT9c 1FVIA 4DNIA 2MQHA 5IP9H 3GO5A 4X62L 4LUVA 3GTMH 3OTOL 3CCQA 4PZ6A 3CQZH 2A19A 4X66Q 4HIKA 1SN8A 2Z0SA 3NENA 2NN6I 1HZBA 2NN6G 3K7UC 4GOPA 4LF7L 1MIUA 1XNRL 3TRZA 1VQJA 2EQSA 5BR8L 1LYLA 3WWVA 5IYCH 4HJ7A 3CC4A 4JI2L 1FJGQ 3CCLA 2CFMA 5IP7H 4A3JH 3NEMA 5C3EH 4A3FH 2BA0A 4DR6L 3L7ZC 4P73A 4DR5L 1WJJA 1X3EA 4DUYQ 1Y1VG 1KRTA 1D8LA 2Y0SE 3M4QA 1J5EQ 3I4NH 4JI1L 3HOXG 2JEBI 1L0WA 2JA7H 5FJ8G 1YNXA 3CPFA 4LNQA 1MKHA 1W2BA 1KQSA 5JJIA 1N33Q 4A93H 4DR4Q 3PSIA 4GOPB 4O2DA 1UE7A 4QL5A 3I56A 3I4OA 2V1CC 2K5NA 1NE3A 3T1YL 4RMFA 2JQOA 3A5ZB 2UXCQ 1K73C 3PIOA 3E9HA 3OYYA 1VQPA 1NY4A 3A74A 1DGSA 1YHAA 5GAHC 4GNXA 4IJLA 2UUBQ 3RZOH 3HOZH 1KL9A 4C2MH 4DUYL 2RF4A 1J5EL 1W3SA 2B63G 2UXDQ 1LM0A 4A3KG 4P71A 3RLNA 3EBEA 3H15A 3I55A 3TS0A 4A3IG 2XTIA 1KC8C 3OW2A 1VQ6A 4Y52H 4JOIA 2B29A 5M3MG 1I3QH 2VQFQ 4HJ5A 1ASZA 1BBUA 1N33L 1LTLA 2K52A 4R4CA 4DR4L 3KLWA 4DPGA 2GVAA 2R93G 2HQLA 3M4PA 2CWPA 1YEZA 4UPAA 2XGTA 3KDFA 4QJFA 2I5MX 2UXCL 1AE2A 5C0XJ 2UUBL 2ATWA 5C0XI 5C0XG 4GNXB 1QVFA 1VQ4A 3ZJYC 3TS2A 2JA5G 4L5SA 2UXBQ 1TWCH 1YJNA 1MJEA 2UXDL 4BY7H 4YY3Q 2Q2TA 1K0RA 2KCMA 4A4IA 1YBYA 1NMFA 5M5WH 4AQYQ 3CCRA 2NVXH 5IE8A 1HR0Q 2LXKA 2VQFL 2F52A 4A3GG 1CKNA 1G6PA 3D0FA 2HIVA 3F2CA 3K81C 1S72A 2ZJPA 1KD1C 3PO2G 3CAMA 1C0AA 3S1MH 1WOCA 1Y14B 1YVCA 4A3LH 4A3DG 1I6HH 1VQIA 2JA8H 4TVAB 2K4KA 4JYAQ 3KDFB 2WFWA 1Z47A 2NVTH 4K0KQ 4DV6Q 4POFA 1O7IA 2UXBL 2EXDA 4R4TA 3S14H 1PH2A 3GTJH 4NB3A 4YY3L 4A3MH 4DV0Q 4KI0A 3GTPH 1I5FA 1GKHA 1VQEA 4DV3L 1T9HA 4XIGS 4AQYL 1N8RC 1GM5A 2JA6G 4A3CG 3J7ZC 4PG3A 1QUQA 4JBJA 1SLJA 2RHSB 2WB1G 1HR0L 2K5HA 1Z9FA 4A3EH 1CKNB 3PO3G 1X65A 4FDBA 1J6QA 3FKIH 4A3IH 1TWHH 3K7AH 3AFPA 2JK8A 1RL2A 1PA6A 3ULPA 4UY8C 2JEAI 4APVA 4C3HH 3U4ZA 1Y1WG 3CCUA 4K0KL 3TREA 5M5YH 4DV6L 3CD6A 5JEAJ 1UE1A 3UDIA 2KHJA 4GOPC 1XNQQ 4A75A 4B3TQ 1X6OA 3RLOA 5JEAG 4YHHL 1K83H 1C7YA 4BBSG 1UEBA 5AJ3Q 4J15A 2BH2A 2AKWB 2VQEQ 1Q12A 1X56A 4HJAA 1HJPA 2ZTCA 4LUZA 4JBMA 2K50A 2E5LQ 3S16H 4UP9A 1QUQB 1L2FA 5IYBG 1VQ9A 2PI2E 1G291 4LF8Q 4YCVA 4EX5A 3CCJA 3PUZA 3U4VA 2F3IA 3W5OA 2EIFA 1HZ9A 3GTKH 2GN5A 5ELOA 1Q8KA 1MJCA 1IBLQ 1Q1BA 4JBKA 4OONA 1XNQL 1BVSA 2A1AA 5E7NA 5FLMH 4B3TL 2I5LX 2IT1A 2GVBA 5C4JH 5AJ3L 5H1SE 4HIDA 1D7QA 2WB1E 2VQEL 2UUAQ 2PQAA 3UE1A 4L5RC 4PZ7A 4BBRG 3G6EA 2E5LL 1NTGA 2ES2A 2NZOA 1S40A 4GNXC 2ZM6Q 4YCUA 3DM3A 4KHZA 2KCTA 4LF8L 4YCWA 4X64Q 1XJVA 1K8AC 4L5TA 2K75A 4LUOA 3BZKA 1HZCA 4PZ8A 3T1YQ 1NMGA 1CSQA 1EOVA 2K14A 5GAGC 2OQ0A 2OTLA 1E24A 3ERSX 1IBLL 1WCMG 4JOIC 1A63A 4UP7A 4KLKA 4DV7Q 3HOVH 2MFIA 1VQMA 3HOYH 2OQKA 3AYHB 1VS0A 1N32Q 4R1JA 3CCSA 1JJ2A 2UUAL 5GROA 4R4IA 3S2DH 2KENA 3HOUH 4IPGA 1BBWA 2ID0A 2PQAB 1FGUA 4JG2A 1L1OA 3E9IA 4JI8Q 4GLAC 2ZM6L 4LWCA 2CWAA 4MTNA 3H0GH 4X64L 3HKZG 1UE6A 3CF5A 3GTOH 3AFQA 1VQFA 4DUZQ 1N36Q 4JI0Q 3ER0A 3J81j 1TWGH 2JE6I 3PV0A 5LMNQ 1CSPA 1Q1EA 2AWNA 4DV7L 2R92H 4DV1Q 1K9MC 1HZAA 1X3FA 2IX0A 5HGQA 3BJUA 3W1GA 4NXMQ 3RR5A 1N32L 2OTJA 3UDFA 1VQ8A 1KIXA 5JJLA 3CC7A 3KFUA 1V1QA 2HT1A 1EFWA 2VUMG 2IHFA 1YZ6A 4JI8L 1L1OB 3U58A 2MO1A 3H3VI 3JAMc 3CPWA 3FHWA 1PH9A 2YTYA 4OXPA 4BXXG 2VL6A 3M7NA 1I50H 4DUZL 1N36L 2N3SA 4JI0L 3GTLH 4LF4Q 2D0OA 1XTDA 5LMNL 3I2ZA 2N49A 1IBML 2Q2UA 1KXLA 1XPRA 3LGJA 3PIPA 5K36G 3JAMi 3M85A 4DV1L 2VY3A 4JCVE 1QVGA 1SMXA 4NXML 1E1TA 4JC0A 2AHOB 3G48A 3PUXA 4IPHA 4DV3Q 4A3BG 1Y1VH 2QEXA 4DAYB 1CUKA 3HKZE 2R7DA 3HOXH 1XMQQ 1H95A 5FJ8H 3T1HQ 5LMUQ 3HFZB 5EAYA 1JMCA 3TQYA 5FLXc 1XPUA 4BY1G 1I94Q 3KYHC 3STBC 1Q46A 1YHBA 2VW9A 4LF6Q 4JI5Q 2NVYH 2NVQH 1VQLA 4LF4L 3S1QH 1E1OA 3STBD 3RN5A 2I5HA 1AE3A 5DLQE 4YHHQ 3I4MG 1ASYA 3TEHB 1PH4A 2MO0A 1HNWQ 5C44G 2E2JH 4OO1G 4OO1I 3L0OA 4OX9Q 3GTGH 4R4QA 1IL2A 2B63H 1XMQL 4DR1Q 3HOWG 3PUVA 4A3KH 3KJPA 3T1HL 5LMUL 3CMAA 3FP9A 2R7ZG 2WAQG 2R6GA 1OXSC 3KJOA 1I94L 1UWVA 1IXRA 1HH2P 2FXQA 4QIWE 5GQOA 4DR2Q 5M3MH 2R93H 3JC66 5IWAQ 1Q7YC 2CKZB 4LF6L 5IYDG 4JI5L 3NBHB 3A5UA 3ULJA 1LUZA 5IP9G 3CCMA 1S3OA 3PF5A 1VQOA 1YHQA 1HNWL 1CKMA 4OWTB 1VQNA 3BZCA 1A62A 1M1KC 1SFOH 2UU9Q 5IYCG 4OX9L 2JA5H 5IP7G 4A3JG 4A3FG 5C3EG 2CCZA 3SGIA 2IHEA 4DR1L 4JI3Q 1N9WA 1PYBA 1A8VA 3D31A 4X6AH 1JJGA 3CCVA 3F1ZA 1JE5A 1VQDA 2PNHA 5M3FG 4DR2L 3I4NG 4NPSA 3PUWA 2LSSA 1OXUA 1PH3A 5IWAL 4POGA 2JA7G 4A3GH 2D62A 1PH1A 1U0LA 4LFBQ 3PO2H 4IJHA 3M3YH 1L1OC 1IYJB 1EUJA 5M5XH 2E8GA 3UDXA 4A3DH 3L2PA 4A93G 2Q2IA 4YWKA 4LFAQ 2UU9L 4H02A 4KHPQ 1V9PA 4LF9Q 2LXJA 1AH9A 2WAQE 4DK3C 5GADC 4DR7Q 4UP8A 4X65Q 4JI3L 4L5QA 4QGUA 3HOZG 1Q81C 1U5KA 2JA6H 4A3CH 3EIVA 1XMOQ 3E0EA 2ZJQA 1EQRA 1YJ9A 4XTCS 2DGYA 1HNXQ 3J7A5 2E2IH 3PO3H 4B3RQ 4NXNQ 4LFBL 1JT8A 3B6YA 2R7ZH 1Q82C 1OXXK 1PYSB 1VQ5A 4JBWA 3J80i 3K0XA 1CKOA 3J81c 4HJ8A 2YYZA 1B8AA 3Q8DA 2NZHA 3I7FA 1K8GA 4JI4Q 1Y1WH 4QY7A 4GKJQ 3RNUA 1M90C 2VZAA 1UE5A 4LFAL 2A8VA 4KHPL 2PMZE 4LF9L 2I0QA 4Y7NH 3GTQH 4DR7L 4BBSH 4AIMA 4X65L 1QZGA 2BA1A 1VQBA 5C4XG 3J81i 1PH8A 1VQCA 1NBWA 4DR3Q 1TWAH 4PMWA 1XMOL 2BH8A 1PVOA 5HY6A 3GDEA 2K5VA 2ASBA 1HR0W 1HNXL
chains in the Genus database with same CATH superfamily
1WR2A 4APMA 1SYXB 1IBMQ 2JA5A 3GTGB 2K28A 1PFSA 4IRCA 4PWQA 3BABA 2DY7A 2N88A 2Z6BA 4EQPA 3KALA 4JI4L 4WJ3M 1SEIA 2HIXA 2R93B 1VQ7A 2FFKB 2GPWA 2L4NA 4X66L 3N40P 2H5XA 4CDFC 3A0JA 1PH5A 3LX0A 5K5PA 3DLLA 5LXTF 3VA7A 2DIKA 2NYZD 2A6HD 3KXYT 3NTKA 4BBRH 3NE5B 3L3OC 5EWEA 2FLNA 2YTVA 1RYRA 1SFOB 5DG8A 4HIMA 2R7FA 1U9RA 4FXKC 4DL5A 4FF4A 3BQ0A 3KOJA 4JV5Q 4A3EG 1R9TH 3OWEB 3FKIG 4GLVB 3RZDB 3D8GA 4HYKA 3J7AV 2WB1A 4HTHA 5KKNB 5J22A 4MV9A 4MV4A 2E2IA 2N8NA 4HMIA 4IURA 2Z4HA 4C3HG 1MHWC 2FMMA 3KF8B 1SRUA 3M3YB 5I2XA 1GSOA 4A3DB 4IN3A 4JW0A 3CC2A 5G3LD 1K3BC 1X55A 1HFNA 4YR3A 5DNFA 4IOAA 2R3ZA 3PZPA 3M9BA 4FVMA 5E3FA 1TWAA 4OEMB 2JA6B 2L15A 1X9NA 1PFMA 2HHHQ 4ZRZA 2R86A 5A2QW 1EEID 1OXVA 4WJ4A 3RB3A 4DK0A 3QOLA 1V43A 2MNAA 3UE0A 3IL8A 2IX3A 5KG5A 1PV4A 1JCKB 1RIPA 4B3MQ 3Q2OA 2UUCL 1SSOA 3SVMA 4YAJB 2VQEH 1EIFA 1JWUD 3MR6A 3F2BA 2ZTDA 1NJIC 1TXYA 2AQ3B 2E5LH 4IRKA 3MXNA 1Q86C 3M4OH 5D1OB 3FEWX 1S5DD 4DV5Q 2B2UC 4LF5Q 2JP1A 1JDBB 2NTTA 4DV2L 1Q8IA 4CDDC 2ZJRA 3HKSA 1X3GA 4UCTA 4ECUA 3T13A 2B2TC 2E76C 2LS01 3RZDH 5C5JA 4JV1A 2QYZA 1D5ZC 2KJXA 1SR3A 3ETJA 3I90A 1CTMA 3GV3A 1JE4A 4UCOA 3S15H 1PRTC 3I70A 3TN2A 3S17B 2YS7A 4IUUA 1G2TA 3C3LA 3MC0B 3R5XA 3T5HA 3PUYA 5EGTA 5FO7B 3H0GG 2JSOA 3OTOQ 4DXFA 3CKIB 1B44D 4ME5A 2V58A 1F77A 1UNSA 1XNRQ 4ALPA 4K5XA 3J80L 4P75A 4DF7A 4FXDA 3RV3A 2YTXA 4OWWB 1HNZL 4DR6Q 4DAMA 3RV4A 1AP0A 3WO0A 1WCMB 4QCLA 3A56A 1YNJC 4YWMA 2B2TA 2H4OA 1RK6A 3J81L 2QA4A 1S4ZA 4C3JB 3TP8A 5IT9c 4L8JA 3JRWA 5IP9H 2NWGA 4F4XA 3AU7A 4DUZH 3CCQA 4J1MA 2A19A 4X66Q 3ETHA 1MIUA 1IBMH 1CK1A 5JPNC 1D6EC 4JV0A 2EQSA 4EEQA 2KEEA 3WWVA 3CC4A 4ECRA 2EY5A 3NEMA 3VR3A 2BA0A 5EBCA 3L7ZC 2F0MA 2VB2X 1ZHSA 2SNMA 1HFGA 4C56C 1D8LA 1J5EQ 3G6JB 1Z6HA 3K5IA 1GHKA 4J9PA 2O03A 5D1PA 4LNQA 2A6HC 4HR7A 1KQSA 5KT7A 5JJIA 4FM9A 2VUMB 4PDBA 4DR4Q 5H80A 4O42A 5KFBA 1R4QB 1F2ZA 5DAUA 1PZID 3I56A 3TBIB 5G3LF 2R61A 5KT3A 1EQTA 2HQEA 3T1YL 5JUMA 1DIKA 3QG1A 1BCPF 1K73C 3E9HA 4KKTA 4KJNA 1NY4A 2UUBQ 4DUYL 2DN8A 2WKDA 1EHIA 2B63G 3M9MB 2I46A 4A3KG 1DJRD 3H15A 3I55A 4A3IG 2RDJA 3L4JA 4FYDA 3OW2A 1GUTA 3VR4A 2VUGA 5M3MG 2F0JA 4LF6H 2E2HB 3Q8QB 4R4CA 2EJGC 3URYA 3M4PA 4PQXA 4BY1B 3DHQA 3D4DA 5IGGA 2UVVA 1GUOA 1IKLA 2BDNA 4K6LA 4HMJA 3PIP3 1TVXA 2I87A 3ZJYC 4M1UB 4HSPA 2JA5G 1AN8A 1YJNA 1MJEA 2AQ4A 1KDCA 4BY7H 4QW9A 1SYFA 3HOWB 1S72A 3K81C 2K01A 2PMZA 5KFFA 2ZJPA 2AGQA 2RBMA 3PO2G 1C0AA 4IFDH 1YVCA 2YYAA 1A15A 1E2WA 4K0KQ 2WIIB 4DA2A 2RDFA 3GTMB 3A54A 3PR4A 4C5AA 2XWBB 1L0YB 3CQZB 3WO1A 3TQ1A 4JI3H 3V6KA 4EGJA 4CKEA 4NB3A 4YY3L 4A3MH 1LT5D 4KI0A 3AMUA 1B4OA 1GKHA 1ILQA 5FPOA 4KK7A 2ICEC 4RH6A 2FE3A 3J7ZC 4E4TA 1QUQA 4JBJA 4A3FB 1HR0L 2WB1G 1ICFB 2K5HA 1Z9FA 4KY6A 4MN3A 1B2TA 3PO3G 2A6EC 3M4IA 4A3IH 1A9XA 3I4NB 1GGOA 4DFAA 2R84A 3CCUA 2XN9C 4DV6L 3SK4A 3CD6A 1I3QA 1UE1A 2X6LA 5C4ZA 2RGVA 5DQHA 4A75A 1KJJA 4B3TQ 5JEAG 1QOHA 3RLOA 4YHHL 4BBSG 2F0VA 5AJ3Q 2Y0SB 4J15A 2BH2A 4NMZA 1X56A 1HJPA 4JBMA 4FF2A 3PW0A 3M4YA 1V8QA 3S16H 4IUQA 5LL6S 4MV3A 1G291 4LF8Q 4YCVA 2F3IA 5DEHA 2GN5A 4JI4H 1HPCA 1MJCA 1RDPD 2NVXA 4JBKA 1I4PA 1PFNA 1SNOA 4KJOA 4B9WA 1XNQL 3MFIA 5FLMH 4M8AA 1B3AA 4RA8A 3BVZA 2F3VA 2UUAQ 2WTFA 3T16A 2HDLA 5KFYA 1GLVA 1EIHA 2CW7A 3W3AA 4YCWA 1K8AC 4R8UB 1N56A 3BQ2A 3T1YQ 1CSQA 3GTPA 4FS2A 2OQ0A 2OTLA 5KFDA 3ERSX 4R8IA 2K1BA 4NDXA 1VQMA 3HOYH 2OQKA 1I4HA 3K59A 4O4LF 3S1MB 3I3CA 2KENA 2ID0A 3I72A 1L1OA 1RTOA 2A73B 4JI8Q 1JIHA 4GLAC 3KHRA 2J4XA 4X64L 3OSOA 3D4RA 3CF5A 1K83A 3RAXA 3I8ZA 4ETSA 5KFAA 3PVXA 1ZEQX 2FLPA 4ECYA 4F87A 3BVGA 1LTAD 4UFZA 5KYIA 2AWNA 4DV7L 2BDOA 5HGQA 3NPPA 4NXMQ 2OF1A 1N32L 3H6MA 4K8IA 2F03A 5JJLA 3CC7A 3GTKA 5F2DA 3SEBA 2HT1A 2UUCH 1NUCA 1O78A 2Z9HA 2E2DC 3L4KA 5JAVA 2YTYA 2VL6A 3M7NA 3RFCA 1X32A 1N36L 2EDGA 4JI0L 4GZYC 2R8KA 2V59A 3GTLH 1JXLA 1SYGA 4DV2H 2Q2UA 3I2ZA 1WSCA 1KXLA 2CQAA 3JAMi 4C5CA 4DV1L 3FDSA 4JCVE 3N6XA 1K8MA 4A3BG 3G48A 1H9RA 3PUXA 4IPHA 3RB6A 2R7DA 4RKLA 1I4XA 3MHBA 3T1HQ 3M9NB 3HFZB 4V190 5EAYA 1JMCA 3MZ5A 3T51B 4AYBB 4QUFA 5FLXc 1XPUA 3QFFA 4J0MA 1M0WA 4MV1A 3RB0A 3DEPA 2XIWA 2X69A 4RAUC 3TP5A 5C4JB 3NBHA 4IUNA 2R8IA 4HEDA 2V9WA 4LF4L 5IGBA 3STBD 4B9XA 1SCUB 1AE3A 4YHHQ 3I4MG 3R5HA 5EJWA 3C46A 3LWUA 2MO0A 1HNWQ 3Q1KA 1JWMD 3GTOA 4M7EA 5C44G 1HNZH 3LWBA 5F9LA 1IL2A 1XMQL 4DR1Q 1TWGA 3KJPA 4JUZA 4A2BA 3FP9A 2R7ZG 1OXSC 3KJOA 2R92A 1ENAA 5GQOA 1Q7YC 1ZETA 1K8OA 1CHQD 3S2DB 1VQOA 1YHQA 4KKSA 1CKMA 1E4EB 5C0XH 2UU9Q 1E0BA 3RUZA 5IYCG 2C22A 1EQVA 4OX9L 1CHPD 5NUCA 5C3EG 3MFYA 2IJ0A 2Q8RE 4FP5D 1JJGA 4X6AH 1VQDA 5M3FG 3NBIA 3PUWA 1PH3A 2I80A 5IWAL 1SJED 4IJHA 3DXJC 4X3SA 4C1NK 3UFXB 1EUJA 2E8GA 4A93G 2AQ1B 3L2PA 2J6SA 1Y69U 1BCPB 1ZKOA 1S9FA 2K33A 4H02A 5KFCA 1V9PA 3T1YH 4LF9Q 2LXJA 3EQLC 4DR7Q 2R87A 2E75C 2WV6D 5KIXA 1UC9A 1K1QA 4L5QA 4KN4C 3HOZG 1DCZA 4DUYH 1K1SA 2YRWA 5KFHA 2LY7A 1F9RA 1W96A 2KOLA 3GTGA 2R7ZH 1Y1VB 4H44C 2PW5A 1CKOA 3K0XA 3FVQA 4HJ8A 3T5LA 1B8AA 1Y1WH 2G5DA 1M90C 2A8VA 2R93A 3KTMA 3NSWA 1J9OA 2NVYB 4AIMA 2BA1A 4FXGC 2OLSA 3R2IA 5C4XG 2XCLA 3S1QB 2NU6B 3DWAA 3E3XA 4UAIA 1SYDA 5C6AA 4TUYF 2ASDA 1PVOA 3GDEA 2K5VA 1QB5D 5IYBH 5D3DA 4ECSA 4P2CB 4B3RL 1S97A 2E2JB 1SFOA 1IYVA 1E2ZA 4ME3A 3X3MA 5M3FH 3GLKA 4P72A 3K5LA 4GKJL 1RHPA 1WTXA 2PYKA 5IODA 4R9WA 4A3LG 1CA6A 2JA8G 2QEJC 3KF8A 3U50C 1PH6A 1KBLA 2RHQB 4DV4Q 1BNCA 4ABNA 1V51A 2D5DA 4DR3L 3VDYA 3CMEA 4KV6A 1FJGL 4LSAA 5EKIA 4MNOA 1GD7A 5J3BA 3KAJA 4YY3H 4ZLTF 5D3IB 1Q3LA 3PN1A 3C1EA 3S1NH 5EDWA 4F4YA 1GUNA 3T5KA 3PCOB 1HR0H 4RG1A 2R7LA 4GN4B 2ALYB 2C35B 3MEFA 3NP8A 5C3XA 2N78A 2JA6A 4OWXB 4A3GB 5LA6F 3IRBA 2ZTEA 3F8TA 1WFQA 1T3NA 1F9QA 4GKKQ 4I7ZC 4DV6H 1Y8PB 2D0PA 1EWIA 4ED1A 3PGZA 1N34Q 2C2RA 2CQYA 4R4OA 5C4XH 3QR8A 3TSSA 2BQ3A 2YU9H 4GLXA 5D1OA 4JV5L 1PTOD 2AWOA 1DXMA 2W9AA 2F0QA 4QUCA 1JORA 2PW7A 1SBBB 3GIMA 1A0IA 3CXCA 4ULLA 2F0TA 4ID6A 1B70B 1F9SA 1U4LA 2WAQB 5IGFA 1XNQH 1EY0A 4ZUIA 4OIKA 5L1KA 3K0YA 3H3VH 1RF2D 3VPDA 1SE8A 1TWFH 2Z6KC 4Y7NB 3GTQB 5CV9A 3A7AB 1M4VA 4KKUA 4EGQA 4RGOS 3GIDA 1KAWA 2VS1A 2ZJTA 2EY6A 2LMCB 4C3IH 4CDEC 1LV9A 2HHHL 4NW2A 4HN7A 3F2DA 2F0NA 1IBKQ 2KHIA 2AMCB 1AUXA 4YR0A 2ASLA 3HOVG 2DPIA 2Q2HA 1BGWA 4CHTB 1STEA 4B3ML 2ZDHA 4JYAL 1WCMA 1VKZA 3BA9A 1EL0A 2B2VC 1D5XC 4HNVA 3HOUG 3BU2A 1QZHA 4Q0YA 4X64H 4DV5L 3MWMA 1E7ZA 4LF5L 1TIID 3RBEA 5LMNW 1PRTD 4BBRB 3QO2A 4AYBE 4IO9A 2EYPA 2Z6KA 4LF7Q 1EOTA 3GIJA 2IY5B 5KG3A 1DV2A 2QDLA 1EEFD 3KF6B 4OO1H 4DV7H 1CQVA 1LO5D 2RDGA 5CBEE 2DUDA 2R92G 5EOYA 4TQUS 1R9TB 1N32H 3R3OA 4RZRA 2R7KA 2F0LA 4ZK9B 3M9OB 1OTCA 2XCAA 4JI1Q 1B6SA 1UC8A 2EJFC 1YIJA 2DWCA 1FVIA 1YNJD 2MGSA 2MQHA 5IT9L 3RTXA 4DL2A 4LUVA 1CZWA 1N36H 2VUMA 3OTOL 2B2VA 4EYIB 4JI0H 4CC6A 4HIKA 2NN6G 2NN6I 1XNRL 4F50A 3H94A 2O5IC 1LABA 1T5EA 3KLSX 5FLXE 2PO4A 4DV1H 1FJGQ 4A3JH 5LHY1 1TT2A 4DR6L 4ED3A 2F0KA 5FO9B 3J7YW 1WTHA 4TKOB 4J9KA 5KRUA 4WFN3 5T1IA 3OMCA 3HOXG 1O7YA 1II3A 1L0WA 2JA7H 2NU7B 3OUUA 3BQ1A 5JPMC 5L1LA 1QG7A 1W2BA 3V2TA 2O5JC 2E2HA 3NTIA 1I6HB 1N33Q 4Q45A 3PSIA 1D1KA 4GOPB 4UCVA 4LF4H 1JQYD 1TA8A 1H9MA 4RFBA 4QWAA 3E0JA 2HCIA 2V1CC 4C5BA 2K5NA 3M4OB 1JB3A 1U4PA 3RMHA 3NK9A 3A5ZB 2UXCQ 2R8HA 1VQPA 4DV3H 3A74A 1YHAA 5EPJA 5GAHC 5EWFA 4IJLA 1QNKA 1KL9A 4C2MH 4O3RA 1XMQH 2K5DA 4KY7A 1J5EL 1XXGA 1LM0A 1S0NA 1GUGA 3RLNA 2YZMA 3EBEA 1GUWA 2TSSA 4RZQA 1VQ6A 3AB9A 4Y52H 2W8KA 3NWSA 1ULZA 2VQFQ 3PW7A 2R93G 4QF4A 1BBUA 3C1FA 4DR4L 1QCBD 3P20A 3CRLC 3KLWA 4DPGA 2GVAA 2HQLA 4UHVA 3LWEA 4RNOA 1T94A 2RGRA 3S15B 4GC7A 1YEZA 2XGTA 5KYLA 2I5MX 2NN6H 5JVDF 1AE2A 1JWSD 1PTOC 4XYQA 2C2DA 1LTBD 3H09A 4JK1C 2UUBL 3GTMA 4OHJA 4GNXB 4CBVA 3CQZA 4OX9H 2ASJA 2UXBQ 3KK7A 1TWCH 1QILA 4MTDA 3Q6SA 1KJQA 1EU3A 2LFNA 2Q2TA 4IZOA 2M05A 1K0RA 2K7VA 4AQYQ 1YBYA 3DUZA 2QDBA 5IWAH 2LXKA 1X3PA 2F52A 5L1JA 3D0FA 4NKLA 2HIVA 3F2CA 2DY8A 2RA4A 2AGPA 1DOLA 3QOJA 1Y14B 1ZQ7A 4A3DG 1I6HH 2DZDA 1RJRA 4JYAQ 3R5FA 1Z2PX 1Z47A 2DNCA 3OIPA 3FMAA 4TV8F 2XGQA 3U9OA 4O4HF 1KLUD 4CDCC 4CC5A 4I4TF 5JQWA 2Y0SA 3EJIA 3GTJH 1PH2A 2P5ZX 2HVRA 5IIFA 1EU4A 3MXPA 3PW4A 5L37A 4ED0A 3K5NA 1JOKA 1HRJA 2JA6G 1N8RC 3FDTA 4A3CG 1SMYD 3KHGA 4XDXA 1SLJA 4A3EH 2RVLA 2M2LA 1CKNB 4FBUA 1X65A 4FDBA 1ZXTA 3FKIH 1A3VA 1TWHH 5ELDA 4QWEA 3AFPA 3E5NA 2B2YA 2JEAI 4RAZA 2KCCA 2A6ED 4C3HH 4K0KL 1VAJA 4MA0A 2KHJA 4BS9A 1RODA 3RJ0A 1I4RA 4K5VA 3NWTA 1NAPA 1UEBA 2KSWA 4UCSA 4IWYA 2AKWB 1JKJB 4DL4A 1Q12A 4CKBA 4E6IA 4LUZA 3GP7A 4XYOA 5KFIA 2HJWA 1L2FA 4B3RH 2PI2E 2FK1A 3GQCA 5HBRB 4EX5A 4R8UA 2XC9A 3U4VA 1SAPA 4DNTB 1QWYA 3G6YA 1LTRD 1Q8KA 5ELFA 3GV8B 4GKJH 1PZKD 1IBLQ 2C9OA 4OONA 5FLXW 2F0IA 4B3TL 3R2TA 2I5LX 1A6XA 2GVBA 2EYJA 3D6WA 4QB4A 4X3UA 5AJ3L 1WD0A 4MTKA 4QWDA 3GQBA 4DR3H 2ZM6Q 5J1ZA 1YNND 4KD3A 4LF8L 4L5TA 2K75A 1O75A 1ENCA 3ORRA 1SYBA 5CR3A 4BY7B 2C2EA 2HUGA 1X3QA 1GJXA 4RCNA 1WCMG 3FPUB 3H4BA 5A2QL 4EQOA 1BQQT 3GILA 1VS0A 4J9RA 4C3JG 4R1JA 2UUAL 3G8CA 4IPGA 1TY0A 2R7MA 5E4XA 4I50F 4HSVA 3E9IA 5C1OA 1C48A 3GV7B 2KHSA 2A5HA 3H0GH 1UE6A 1RJTA 2PCFB 3AFQA 3MR3A 4JV5H 4PV1C 1VF5C 4A3MB 2Q8TA 3KHLA 5DLFA 2JE6I 5LMNQ 5A35A 2PN1A 3K5MA 1Q90A 2F0OA 3CU7A 4ED7A 1K9MC 1HZAA 1X3FA 1Y8OB 4XQQA 3W1GA 5I4DA 4A3IB 3UDFA 1VQ8A 1KIXA 1KJ9A 2VUMG 2IHFA 2R6FA 4JI8L 2X0SA 2QW7A 2MO1A 3K3VA 4AYBA 3CPWA 1PH9A 4BXXG 4R8NA 4RU9A 1I50H 2N3SA 4X3KA 1ONLA 1V1OA 3SR1A 1XPRA 5KNDA 2HHHH 3S16B 1NR2A 2VY3A 1QVGA 5CA1F 4NXML 2AHOB 3ERQA 3MFHA 2QEXA 2EZVA 4B3MH 3MFGA 2LKVA 2L11A 5LMUQ 1KAAA 4EFBA 4ZYSA 4BY1G 5FLXL 3KYHC 1I94Q 1BCPC 3OSNA 4JVZA 2VW9A 4JI5Q 5CV8A 3JZIA 4DV5H 4LF5H 4OELB 5C5LA 1E1OA 1KDBA 2M9VA 2B8FA 4DAPA 5DLQE 1SMYC 4RAYA 4N8X1 1M7JA 1PH4A 1C8CA 1E4EA 4TQSA 1R4PB 2O4XA 3LNNA 1MD2D 5KNBA 1E4FT 1I6VC 1RJQA 2VB3X 2B63H 3HOWG 3OSPA 2RSNA 3PUVA 4A3KH 4J9LA 3T1HL 5KG7A 4O3PA 1T5XD 2HD3A 2SEBD 4DR2Q 5M3MH 3JC66 3HOYB 5F9NA 2CKZB 5IYDG 3VMMA 4XX0B 2KVMA 1E4GT 1GUSA 3OTOH 1DV1A 5FD6A 4WRDA 1WTQA 2W6OA 3MWEA 1XNRH 2IL8A 4G7ZC 1HNWL 1AW7A 5EKLA 2W6NA 4DL3A 3Q8RB 1MGSA 1M1KC 1WTPA 2JA5H 4F8MA 4DR6H 4RGNA 5IP7G 4A3FG 3T5JA 4DR1L 2IHEA 1N9WA 5BN4A 1PYBA 3TIGA 3D31A 1RK5A 4RHRA 4FF3A 3I4NG 1NNXA 4ED2A 1PH1A 4LFBQ 1KLGD 3PO2H 1Y1VA 3A7LA 3KLRA 1L1OC 2HDMA 2NUCA 2IMWP 4X66H 5M5XH 4L1KA 2CH4W 4J9SA 5LYJF 2AQ2B 2Q2IA 4V0BA 5I47A 4YWKA 1YNNC 2F0DA 4Q5VA 1M6VA 4LFAQ 2UU9L 4KHPQ 3SHLA 3N42B 3RBDA 1SNDA 5FO8B 2V5AA 2NVYA 3MEHA 3J7AF 4X65Q 4U7CA 3GTLB 1CQFA 4EGVA 2QK4A 4QGUA 3TP7A 1Q81C 1EWCA 3JAME 5KG1A 1J5EH 3EIVA 1XMOQ 2EYHA 2NB0A 2ZJQA 1UNNC 4ZQIA 2DGYA 1HNXQ 3J7A5 2E2IH 3PO3H 4NXNQ 5EZYF 1JT8A 3B6YA 3VPBA 1JOQA 5HURA 3G6VA 3J81c 4DR4H 3I73A 1PFBA 1K8GA 2SCUB 1SJHD 4QY7A 3TQTA 1S0OA 2PZWA 2RSOA 2K32A 3PW5A 5KFKA 4LF9L 2L55A 5JEAH 1QNUA 4DR7L 4BBSH 2J7ZA 2UUBH 1IL8A 1VQBA 1BOSA 5DQGA 1B9NA 2K03A 2PNRC 1VQCA 5C5MA 1TWAH 2BQRA 5HY6A 2ASBA 1TY2A 1EY7A 4WBNF 3MVVA 3O13A 4JPBW 4ZUJA 1I6UA 2ZXOA 4TRDA 2NU9B 4U68A 2OWOA 4IFDJ 4JV2A 2TMPA 3TZUA 1PLFA 3NELA 1QVCA 3BZDB 4I65A 1KABA 4ED8A 2XD4A 3EN2A 1EQQA 1CT1D 2WP8J 2PI2A 4FS1A 1PTOH 4DL7A 1D5MC 1SROA 2EYFA 4BA1I 3KBGA 3NQIA 4AH6A 1EYGA 2JYOA 2SDFA 2VNUD 3HS0C 2PBZA 1SNCA 2KBNA 1FL0A 1Z2NX 1O80A 3BG3A 2FJZA 1P16A 2BR0A 1OXTA 2WAQA 5ELNA 4K0KH 4A76A 4DV4L 2DLNA 2GLTA 1WH2A 3GV5B 1RTNA 3RN2A 2CH4A 3VR5A 3GTQA 1ZYRC 4BA2I 1VQHA 5KT2A 4ECQA 2RDIA 3R8BA 5COYA 4JI6Q 1HTPA 4KTAA 4G7OC 4NP5A 2R82A 4F4WA 2F4VQ 3IN5A 4O3SA 4WD3A 2F0WA 4R7RA 4IHJF 1VQGA 1X54A 2XNAC 4JI7Q 4GKKL 3U9TA 2R7ZB 1VCIA 2E74C 4AYBG 4LH6A 4B3TH 1N34L 1XX8A 4GN3B 1LACA 4DK6C 5IGDA 3S1RH 1Y1WB 1B7YB 4IQZA 4MZ9A 1S68A 4HIOA 1LT6D 4B3SQ 1U4RA 4LK1C 1PHJA 1MSGA 2IX1A 1B9MA 1DONA 2HGSA 3OHBA 2W7OA 3V6JA 1JJCB 2B39A 2P0AA 1KRSA 1HTLD 4LF8H 4O1NA 2QGQA 5ISRA 4X3TA 2VA3A 1FGBD 1E3PA 1VBGA 1VQAA 1QJOA 5CORA 4P74A 1D2BA 2PMZB 1SXTA 4XQNA 3KF6A 4A3BH 3ORQA 2PZTA 5JH7F 1EIYB 3K8AA 2OCEA 3K5OA 5M3FB 1NSNS 3V05A 1R9TA 1HHVA 4LFCQ 4EQ5A 3BVMA 1B04A 2DPJA 4H7BA 2UUAH 3JAMW 1STYA 2KEDA 1K3RA 3BYYB 1XDNA 4X62Q 1IKMA 2EJMA 4H13C 4IUTA 3I4MH 3DM1A 3PR5B 1EY6A 3QIAA 1SNMA 4QQBX 4EBDA 3HOZB 3S1NB 3N44B 4ZI7F 5C44H 1W6KA 1IBKL 5BR8Q 4ZOLF 5KFNA 2WYOA 1UAPA 4JI2Q 2CZGA 4DR5Q 1YJWA 3OOCA 1QE6A 4O0AA 4GN5A 2HVQA 2J9GA 4JI8H 2YZNA 1TKWB 4WORA 4HJ9A 3GD7A 4LW1A 4DN4M 4DNIA 3GIIA 4XYLB 4RGMA 4PZ6A 3K58A 1IHZA 5KFGA 4GOPA 3NENA 3TRZA 5C4XB 4LF7L 1BJTA 3K7UC 3HKZB 1M0TA 4J9OA 1STNA 2YU9B 3IFDA 5IYCH 3CCLA 5K36G 2J0TD 5C3EH 4NXMH 3OUZA 4P73A 4O4IF 1VMCA 2CW0D 5M5WB 1WJJA 5IYZF 1WTWA 1X3EA 1Y1VG 4U673 4LH7A 2Y0SE 4JI1L 2ZT9C 2MP1A 3A8IE 5FJ8G 4ZCKA 1GOZA 5DQIA 3CPFA 4ODGA 2FMCA 4FNFA 1MKHA 3LMLA 3ZYYX 3S9WA 4A93H 1EZ8A 4O2DA 1UE7A 4QL5A 2EOTA 1RKNA 1TWFB 3MTSA 1FD7D 5KX5F 4ED6A 1L0XB 2F0HA 1NCVA 1I7NA 1UEAB 2JQOA 2G9DA 4CJ1B 3NGDA 3PIOA 3OYYA 4QIWB 3RZOH 4C3IB 1DGSA 4GNXA 4Q0FA 3HOZH 3T56B 2RF4A 5EPLA 2UXDQ 3T1HH 1FR3A 2J6TA 4P71A 2WDTA 3HEJA 1HA6A 4JOIA 1I3QH 4K6DA 4HJ5A 1ASZA 1N33L 1LTLA 1XTCD 1XWEA 4YHHH 3QJYA 4YQWA 2YS6A 1EIGA 1HNWH 2UXCL 1C30A 5C0XJ 3WNZA 2FPGB 2F0FA 1BR9A 2FPIB 4DR1H 4G57A 2R8JA 1EYAA 3SE7A 1S10A 1EYDA 4YIJA 2KCMA 4A4IA 5M5WH 1NMFA 2NVXH 3CCRA 5IE8A 4A3GG 1G6PA 2VQFL 4EBEA 4LJZC 1CKNA 2IA6A 1KD1C 1V1PB 3J80E 2F0GA 4RUAA 4Z9CB 2Q8IB 4A3LH 5KFSA 2JA8H 4XQJA 3KDFB 2NVTH 1V4YA 3R23A 2UU9H 5KFEA 2BCOA 2W7PA 1JR0D 3EA6A 1JX4A 1O7IA 3RGXA 2UXBL 4R4TA 2L9HA 3J81E 3S14H 2K5QA 3GTPH 5EQ0A 2YZGA 1T9HA 4KY5A 4XIGS 4TSSA 4AQYL 1GM5A 3JSNA 1H9SB 4A3JB 2RHSB 3D3RA 3VR2A 1J6QA 5J39A 2W57A 4PMBA 3K7AH 2EY1A 2AUJD 2JK8A 1RL2A 4EFEA 5EPKA 1OWTA 3HGBA 4UY8C 2JA7B 4APVA 1ICWA 1GXDC 5CAEB 1RD9D 3A55A 2B2WA 5M5YH 2F3WA 3TINA 3UDIA 1HUMA 4LF9H 1LT3D 4DR7H 3HB9A 4RB3C 3OHXC 1VBHA 1K83H 1C7YA 2L1BA 2VQEQ 5DM73 3T53B 4HJAA 2ZTCA 3GIKA 1CE8A 2N55A 2K50A 4OIJA 2E5LQ 2W70A 3DWQA 1J8IA 1RJPA 3BJYA 1SNQA 1LTSD 1M8AA 3CCJA 2XIGA 5KFJA 3QZ8A 4C2MB 3W5OA 4YAKB 3GTKH 5ELOA 4ECVA 5KFQA 2VPSA 1PMRA 4LMQD 1DD2A 5ELBA 5E7NA 1JOOA 2IT1A 1S5FD 2WINB 3WDNA 1D7QA 5I9PA 3UE1A 4L5RC 4PZ7A 4BBRG 3G6EA 2V4QA 1NTGA 2ES2A 3SK5A 5C8YF 4YCUA 2FKLA 4KHZA 2KCTA 5KFPA 2I8CA 3G7LA 2CW0C 2MCTA 1O7LA 2XRSD 2UVUA 4LUOA 3N8DA 4IR9A 4PZ8A 4UDUC 2MUYA 1TWCB 2WE6A 1NMGA 2EVBA 3W2DA 5GAGC 1E24A 4KD4A 2VQDA 4RWSC 3OWFA 1IBLL 4DL6A 4KLKA 5JJZA 1KEEA 3HOVH 1KNEA 2MFIA 3V96A 5KFZA 2KUMA 4DV4H 5ELEA 3IKJA 4XXEA 3CCSA 1JJ2A 1T36A 4R4IA 5CV6A 1GHJA 3HOUH 1BBWA 2PQAB 3ONAB 3H91A 5KEEA 2VA2A 1FGUA 2L12A 2XGPA 2ZM6L 3Q22A 4MTNA 3GTOH 1JDEA 3BDLA 4DUZQ 3KAKA 3GTJB 2ZDQA 1GSAA 3MJFA 3J81j 2GPSA 4NLGA 1TWGH 2A74C 1CSPA 2IW3A 5KGUA 3NUCA 5JVH3 1D1IA 1PTOF 2R92H 4A3EB 4GKKH 2IX0A 4J9QA 4EVOA 2JEFA 3FKIB 1TWHB 2OTJA 1LLRD 1N34H 4OGQC 3KFUA 2YRXA 1V1QA 2B8GA 4KMUC 1TS4A 1YZ6A 4C3HB 2SOBA 4HCEA 3NTHA 5KFXA 3JAMc 2XSCA 2F0PA 2IWHA 3FHWA 4OXPA 1DM0B 1W6JA 5KFOA 4CJ0B 4H0LC 2D0OA 1XTDA 2V4DA 5ELCA 2N49A 5LMNL 3J80W 3DEOA 3LGJA 1N48A 3M85A 1C3OA 5CV7A 1E1TA 4YB8B 4I7AA 4JC0A 5FK9C 4TQRA 3BDOA 2B2YC 3MR2A 4DAYB 3CHBD 3HKZE 3I91A 4CKCA 3HOXH 3RAQA 1H95A 3HG9A 3J81W 4EQNA 1BF4A 1PK8A 4IAJA 3TQYA 5CGKA 4LMYA 1SE4A 3DMUA 3V6HA 2L0CA 5JVG3 1KTKA 5AFWA 2F4IA 4LF6Q 3GV6A 1LTGD 2NVQH 1EZ6A 5I9OA 3EPGA 3RN5A 1BCPD 4XYMB 2I5HA 1EY5A 3VPCA 1AEXA 3BG5A 3TEHB 3RUPA 4J8QA 4RB1A 4OL7A 1PRTF 3MA2B 4DLKA 1IBKH 1EY4A 4IWXA 3L0OA 1K28A 3GTGH 4UCRA 4U6PA 4R4QA 2RCFA 1CS0A 1Y8NB 1AFPA 1U4MA 2GA4B 1S5ED 3Q24A 5LMUL 2W9BB 4BWSC 5T1GA 1I94L 4IRDA 1HH2P 4QIWE 1A2TA 2AU0A 2R93H 1ET9A 4JI5L 3A5UA 4GC6A 4J6HA 5IP9G 5EKKA 3SK8A 3CCMA 3Q8SB 2KA7A 3FMCA 5D65A 1IYUA 4LF7H 4J9NA 1DYQA 2VXWA 1B50A 1WTVA 3H0GB 3K6OA 1F2YA 4OWTB 1ENFA 5KFMA 3BZCA 5KFWA 1SFOH 2NZ1D 3GTLA 2CCZA 4N9PA 2F1MA 4JI3Q 3R93A 4ME6A 1A8VA 2JEJA 4ZKBB 3CCVA 5CB4F 1CI3M 2PNHA 4JI1H 4DR2L 4NPSA 2FJ2A 1OXUA 1JC7A 2LSSA 4IUPA 4POGA 3QZ7A 1U0LA 1WTOA 3M3YH 3HBLA 1IYJB 4WJWA 2W9CB 4A3DH 2DJGC 5K2MA 2VR1A 2VPQA 1S5BD 4HAEA 4QMGA 2VOBA 1FJGH 1I50B 1AH9A 2WAQE 4DK3C 5GADC 3ITPA 4HNTA 4UP8A 4IZ8A 3HRZC 3MWYW 1UUPA 3MXGA 2B2UA 2JA6H 4A3CH 1YJ9A 4XTCS 2CW8A 1IW7D 4Y8VB 4LFBL 4HNUA 1TS5A 1Q82C 1OXXK 1PYSB 3UI2A 4JBWA 1VQ5A 5KFTA 5BPFA 5DLGA 1N33H 5KFLA 1SNPA 2YYZA 1AN7A 2NZHA 3I7FA 4JI4Q 3RF2A 1C4QA 4F4ZA 1LTTD 3RNUA 1CQIB 2VZAA 2A69D 4LFAL 4KHPL 4RCOA 2UXCH 1G91A 4X65L 1QZGA 2IBKA 4Q43A 2FB9A 1NBWA 4PMWA 1XMOL 1ESRA 3M7GA 4DK1A 1HR0W 4BY7G 2FK3A 1HNXL 1S0MA 1VF7A 4FU0A 1GYFA 4NXNL 4G3IA 3NHHA 4MA5A 2VQFH 3A8KE 2BOSA 2B63B 1DOKA 3G71A 4A3KB 1BBXC 2XRQD 5KFRA 3CCEA 2Z1CA 1G8ZD 5LL6b 5M3MB 4IFDI 3RLFA 4IFDG 1FNUA 4ECXA 4DU9A 1BKBA 3S17H 5HGTA 5KT5A 4KN7C 4MV7A 1C9OA 1A3TA 3OHAA 4YJ3F 4B08A 2F0SA 4QW8A 2C28A 2UXBH 1H9JA 2RKSA 3PIO3 1WD1A 3AQQA 4GS3A 4A3MG 1JB7A 2F0UA 4AQYH 4L63B 2F0EA 4IOCA 2JA5B 1EUDB 2EYLA 4ZKCB 4Q8EA 1KHIA 1WCMH 1LT4D 4HCSA 4I55F 4RNMA 1F9PA 1G51A 2EPBA 1MI2A 2H1EA 1XPOA 4JYAH 1WYDA 1CM9A 3ULLA 5CMDA 2JEIA 2R7ZA 3FRPB 3PO2B 1HUNA 4C3JH 1B6RA 2IP4A 2R8GA 3IG0A 5JJKA 2JJQA 2BE5D 5M5XB 3RIZA 3N52A 1WI5A 1Y1WA 2UUCQ 3LP8A 2NBFA 3Q23A 1YI2A 5J2TF 2JA9A 1FYCA 4IPCA 5M9OA 3GIPA 3TIIA 4MAMA 3DWPA 1TS2A 4DV2Q 5TSSA 4F7XA 1VQKA 4Q44A 1ZYRD 3AEVA 1PH7A 2WB1B 4LAAA 3PO3B 2E2IB 5LP6F 5GAEC 2K04A 4O2AF 1YITA 3S2HB 4G7HC 1WTRA 4ECZA 5CC4A 1KJIA 2FHTA 2MHVA 5FLMG 5DG9A 2EXZA 3G4SA 2VUMH 2UVWA 2FPPB 3QB3A 4IPDA 2EE1A 4YWLA 2A68D 1VMPA 4QWCA 4BXXH 1DOMA 2ZDGA 5HV6A 4BBSB 3W1BA 4JI6L 2OEOA 1B1ZA 1P8LA 1VDZA 1TWAB 2F4VL 2RQXA 1ML0D 4RHSA 5EWGA 1E22A 2X6GA 1IOWA 4JI7L 2MPMA 4EBCA 1IBLH 1GO3E 3SDZA 3K80C 5IGCA 3SE0A 2RCNA 5DGAA 1O7ZA 3UDGA 1HNZQ 1G6ZA 1ESFA 3HOYG 2E2HH 4B3SL 4BY1H 1B33N 2QF7A 3H3VC 5CV5A 3CRKC 2ZM6H 3MXNB 1STGA 4MIUA 5CYUA 4DV0L 2Y0SG 1PTOB 4DKAC 2Z4IA 3EYYA 3S24A 3H4DA 3HKZA 3V4ZA 3J80c 2W6PA 1IW7C 5JOBA 3CW2C 2WKCA 3NQTA 3SXHA 3PF4A 2J6UA 2YU9A 2C00A 1I4GA 2YV5A 3HOWH 1IZ6A 2OT2A 1STHA 4LFCL 2B3GA 1GVPA 3S2HH 1EWHA 5IY0A 2A69C 4IALA 2CQOA 3CP0A 3KLSA 5IYDH 2YL2A 4X62L 3GO5A 4UCUA 3GTMH 3TMEA 1K0SA 3E5SA 3SK6A 1TR5A 3CQZH 1SN8A 2Z0SA 1WVLA 1HZBA 1CQJB 5LMNH 4EYHB 4IR1A 1TWFA 1RYSA 1VQJA 5LL6X 5BR8L 1LYLA 4HJ7A 3P7JA 1AZPA 4JI2L 2W6ZA 2CFMA 1HQRD 3ND8A 5IP7H 4A3FH 1FNWA 4QIWA 1TQOA 5BN5A 5CA0F 4DR5L 1BNZA 2FP4B 1KNAA 4ECWA 1TS3A 4DUYQ 1KRTA 3M4QA 3VYSA 3I4NH 2JEBI 2AGOA 1YNXA 2O2LD 3VYTA 4F88A 5BN3A 1AZQA 2YCHA 3MAQA 1IOVA 2PQEA 1FNVA 3EROA 4K8JA 3S1RB 4TV9F 2CHBD 4DXGA 5BPHA 1PRTB 1F2MA 1EY9A 1MZBA 3I4OA 4PMCA 2JXMB 1NE3A 2XVSA 4RMFA 4XZ3B 2EYOA 1SYEA 5D14A 3D4WA 1EY8A 2FINB 4L6TB 3TP6A 2D9UA 2W8LA 1EYZA 1W3SA 5LMUH 3WOEA 2BQUA 5D8DA 3X3NA 4A3BB 5DG7A 3TS0A 2PPBC 2HCCA 1I94H 2XTIA 1KC8C 3K5HA 1EYCA 3HXLA 2B29A 4HR7B 2BE5C 4JI5H 2K52A 4YBZB 1V1PA 2CWPA 5KFVA 5KG2A 2QILA 3F2UA 4UPAA 3KDFA 4QJFA 1ET6A 2ATWA 5C0XI 5C0XG 1QVFA 1VQ4A 4ZAIA 3I4MB 3TS2A 4XT1B 4L5SA 4MV6A 3BA8A 4I7HA 2UXDL 2ZXRA 3D6CA 4YY3Q 5C44B 3PQIA 1A2UA 4CJ2C 1PZJD 1SE2A 4DR2H 1H9SA 3J7AK 1BO0A 3I4LA 1HR0Q 4FBTA 2Z8LA 4MHEA 3OW7A 5KT6A 2QCPX 3CAMA 3S1MH 1WOCA 4O2BF 2A68C 2JA7A 5FPRA 1VQIA 4TVAB 2K4KA 4N8FA 2WFWA 1W93A 1CFMA 4DV6Q 2FMAA 4O3NA 4POFA 4RUCA 2EXDA 3VYUA 3PW2A 1L2ZA 1BUVT 4EG0A 2ZXPA 4DV0Q 1I5FA 2K6AA 1VQEA 4DV3L 5IT9E 2UVRA 1ZHQA 4RB0A 2DNEA 4PG3A 5C3EB 3BS1A 4LFBH 3VR6A 4C2MA 1HA5A 5FD5A 3H40A 4S3SA 1PA6A 3ULPA 3G6XA 5KG6A 4Q8FA 1S03G 2WACA 3E6ZX 3U4ZA 1Y1WG 3TREA 5KG4A 4LFAH 4KHPH 2RDHA 3RD4A 5JEAJ 1XNQQ 4GOPC 3U9SA 1Z2OX 3F8NA 1X6OA 5DM63 4A93B 4X65H 5C3WA 5L1IA 5I6WA 1NR4A 1EUCB 4M9UA 1EFID 1XMOH 3Q0AA 2W6QA 3SI8A 4UP9A 1QUQB 5IYBG 1VQ9A 1KC7A 5J2UF 3RZOB 1HNXH 4NXNH 5E4WC 3I12A 2QKIC 3PUZA 3OPOA 3P1HA 4DGZA 3C2PA 1I7LA 2EIFA 1TWCA 4RNNA 1JICA 1HZ9A 1G2SA 2NTSA 5IOCA 4YR2A 1BDOA 4QWBA 1Q1BA 2ALZA 5FOBB 1SDFA 2K05A 2MJ8A 1BVSA 1I3QB 2A1AA 2NU8B 4N9TA 2XCPA 5C4JH 5H1SE 4HIDA 2WB1E 2VQEL 2W6MA 2PQAA 2K5WA 1PDQA 2E5LL 2L5TA 2NZOA 1S40A 4GNXC 1SYCA 3DM3A 4X64Q 2G9HD 1XJVA 2YW2A 3JRXA 1SE3A 1HZCA 3BZKA 1STAA 3GTJA 1EOVA 2K14A 5BMVF 3PMFA 3UQ8A 1CA5A 2HVSA 3HZXA 4JOIC 4DAVA 1A63A 2NVXB 2DJFC 1F2LA 4UP7A 4DV7Q 1KJ8A 3TZDA 5LOVF 3C0FB 4O3QA 3FKIA 3AYHB 1TWHA 1JLLB 1N32Q 3EPIA 1AUVA 5GROA 3S2DH 2PVPA 2JA8B 4JG2A 4FF1A 4RB2C 3N6RA 2NVTB 1I4QA 4LWCA 2CWAA 3HKZG 5FKAC 3NXWA 1VQFA 1N36Q 3S14B 1STBA 4JI0Q 3GIQA 3ER0A 3GTPB 5IGEA 3PV0A 3VA5A 3V4SA 1Q1EA 1GSHA 4DV1Q 3K57A 5KT4A 3KHHA 1FKAH 2EYMA 3BJUA 5C1PA 3RR5A 3K7AB 4DAYA 2R7NA 3KUPA 4EEYA 5I2YA 1EFWA 2FK2A 2ENBA 2KQ3A 3DF7A 1L1OB 3U58A 3N41B 3H3VI 5CV4A 3P75A 5M5YB 4PNYA 3JAML 2KCNA 1BXTA 5GONF 2KECA 1K83B 4DUZL 4K14A 3WOFA 4ZHQF 3Q8PB 4JI6H 4LF4Q 3FPPA 4C3IG 2F4VH 1IBML 3EVQA 3IAYA 2JEGA 1Z7TA 3PIPA 2IPKD 5K36H 4JI7H 3OIQA 1B53A 1SMXA 5CBAE 4DV3Q 2ATLA 1Y1VH 3BAAA 1CUKA 3GTKB 1XMQQ 2W71A 2B2WC 5FJ8H 4B3SH 3HP3A 1PXUA 2W9BA 3RGZA 3H20A 5IT9W 3STBC 3MR5A 1Q46A 2ICIA 4BWGB 2R85A 1CZGA 1YHBA 2NVYH 3L9AX 4DV0H 1TU2B 4K5WA 1VQLA 3S1QH 4MV8A 4LSXA 1TAEA 2OH2A 1PX2A 1RCVD 1ASYA 5EBDA 3H0GA 5L9XA 4DNRB 1XYIA 2E2JH 4OO1G 4OO1I 4OX9Q 1DZ1A 4LFCH 4XT3B 3RB4A 3CMAA 2WAQG 2R6GA 2JN4A 1UWVA 1IXRA 2FXQA 3HOVB 5IWAQ 4LF6L 4X62H 2AUKA 3NBHB 3ULJA 1LUZA 5E1FA 2PZUA 4YJ2F 3ND9A 1HXYD 3HOUB 2W9CA 3EFXD 1B3QA 1S3OA 5A2QE 2CVRA 3BYTB 3PF5A 3K3PA 4IUVA 3VYRA 1HQMC 1VQNA 5BR8H 3GTOB 1A62A 4JI2H 1I50A 2M00A 4A3JG 4ZQ3A 1A3UA 4RGTA 3SGIA 1TWGB 5JVLA 4DR5H 3MWDA 3T4AC 3F1ZA 1JE5A 3ICEA 2R92B 4A3GH 2JA7G 2D62A 1ILPA 1SEBD 4MTEA 4O3OA 3CVZA 4HQ6A 4G4KA 4A2AA 3IFTA 3MXUA 3UDXA 5T14A 4CGYB 1KDAA 5C4HA 2FLLA 3QWNA 3A8JE 1H9KA 2C5CA 3KBXA 4KHVA 4RKBA 1MSHA 4JI3L 1BXRA 3OMGA 2XWJB 2V4RA 1U5KA 5KNCA 3JSLA 3TDQA 3E0EA 1EZ1A 1EQRA 4ECTA 4B3RQ 1MBYA 1S5CD 2OXPA 5KG0A 5DGBA 2B63A 4K2LA 5KFUA 3J80i 3HOXB 3N43B 3BDCA 3Q8DA 4GKJQ 4J9MA 1UE5A 2NUAB 2EY2A 1HCZA 2PMZE 5I6YA 2I0QA 4Y7NH 3GTQH 4C1NI 2NVQB 3J81i 4YP3A 1OO9B 1PH8A 4DR3Q 4K2KA 1E2VA 2SNSA 1LTID 4ILWA 2UXDH 1PYWD 2BH8A 2I07B 4FO2A 2D2CC
chains in the Genus database with same CATH topology
4B3RL 4NXNL 1IBMQ 4ME3A 5M3FH 1PFSA 3G71A 4P72A 4JI4L 4WJ3M 2OWOA 3CCEA 4GKJL 4IFDJ 2HIXA 4IFDI 3RLFA 3NELA 1VQ7A 4A3LG 4IFDG 1QVCA 4X66L 1BKBA 2JA8G 2H5XA 1PH5A 3A0JA 3S17H 3U50C 3EN2A 3DLLA 1EQQA 1PH6A 1C9OA 2RHQB 4DV4Q 2WP8J 2PI2A 4DR3L 3ICEA 3VDYA 4BBRH 3CMEA 1FJGL 1SROA 5J3BA 4MNOA 1GD7A 3AQQA 4BA1I 4GS3A 4A3MG 1JB7A 4AH6A 2YTVA 1EYGA 3S1NH 4HIMA 2R7FA 2VNUD 3PCOB 3KOJA 4RG1A 2KBNA 1FL0A 4IOCA 4JV5Q 4A3EG 4GN4B 1R9TH 1KHIA 2ALYB 2C35B 3FKIG 3MEFA 4GLVB 1WCMH 2N78A 1P16A 4OWXB 1G51A 3IRBA 1XPOA 2ZTEA 2N8NA 1WFQA 1WYDA 3F8TA 3ULLA 4GKKQ 1OXTA 5ELNA 4C3JH 4A76A 3KF8B 1SRUA 2D0PA 1EWIA 5JJKA 4DV4L 2JJQA 3PGZA 1N34Q 1WI5A 3CC2A 2UUCQ 3RN2A 1X55A 4R4OA 5C4XH 1YI2A 2YU9H 4IOAA 4GLXA 4BA2I 1VQHA 2JA9A 4JV5L 4IPCA 2AWOA 3M9BA 4JI6Q 4DV2Q 1VQKA 2L15A 2F4VQ 1X9NA 3AEVA 2HHHQ 1A0IA 1PH7A 3CXCA 1VQGA 1B70B 1OXVA 1X54A 5GAEC 1YITA 4JI7Q 4GKKL 4WJ4A 1V43A 2MNAA 1VCIA 4AYBG 3UE0A 1N34L 1PV4A 5FLMG 1RIPA 3G4SA 4B3MQ 2VUMH 4GN3B 4DK6C 2UUCL 3S1RH 4IPDA 1B7YB 4MZ9A 1EIFA 4HIOA 4B3SQ 3F2BA 1SE8A 2ZTDA 1TXYA 1NJIC 4YWLA 1PHJA 2IX1A 1TWFH 4BXXH 2Z6KC 1Q86C 1JJCB 3M4OH 1KRSA 1KAWA 4DV5Q 2QGQA 2VS1A 3W1BA 4JI6L 4LF5Q 4C3IH 1P8LA 4DV2L 2F4VL 1E3PA 2HHHL 1VQAA 3HKSA 1X3GA 1E22A 2ZJRA 4JI7L 4P74A 3F2DA 1GO3E 3KF6A 3K80C 2KHIA 2AMCB 3RZDH 1IBKQ 1EIYB 2RCNA 2OCEA 3K8AA 4A3BH 3HOVG 1HNZQ 2Q2HA 3UDGA 3H3VH 4BY7G 4LFCQ 4EQ5A 4B3ML 3HOYG 2E2HH 4JYAL 1SR3A 4B3SL 4BY1H 3HOUG 3S15H 3BU2A 1QZHA 1K3RA 3MXNB 3PUYA 4X62Q 4DV5L 4DV0L 1E7ZA 2Y0SG 3H0GG 4LF5L 5LMNW 3OTOQ 4DKAC 3I4MH 4AYBE 4IO9A 2Z6KA 3S24A 4LF7Q 4QQBX 2IY5B 1XNRQ 3J80c 4ALPA 5C44H 3CW2C 4P75A 5BR8Q 1IBKL 3KF6B 3PF4A 2YTXA 4JI2Q 4OWWB 2DUDA 1HNZL 2R92G 2YV5A 4TQUS 1IZ6A 4LFCL 4DAMA 3HOWH 4DR6Q 5IYBH 4DR5Q 2B3GA 1YJWA 1GVPA 3S2HH 4O0AA 4GN5A 4YWMA 5IY0A 1OTCA 4JI1Q 2CQOA 1YIJA 2QA4A 3CP0A 5IYDH 4HJ9A 3GD7A 4LW1A 5IT9c 1FVIA 4DNIA 2MQHA 5IP9H 3GO5A 4X62L 4LUVA 3GTMH 3OTOL 3CCQA 4PZ6A 3CQZH 2A19A 4X66Q 4HIKA 1SN8A 2Z0SA 3NENA 2NN6I 1HZBA 2NN6G 3K7UC 4GOPA 4LF7L 1MIUA 1XNRL 3TRZA 1VQJA 2EQSA 5BR8L 1LYLA 3WWVA 5IYCH 4HJ7A 3CC4A 4JI2L 1FJGQ 3CCLA 2CFMA 5IP7H 4A3JH 3NEMA 5C3EH 4A3FH 2BA0A 4DR6L 3L7ZC 4P73A 4DR5L 1WJJA 1X3EA 4DUYQ 1Y1VG 1KRTA 1D8LA 2Y0SE 3M4QA 1J5EQ 3I4NH 4JI1L 3HOXG 2JEBI 1L0WA 2JA7H 5FJ8G 1YNXA 3CPFA 4LNQA 1MKHA 1W2BA 1KQSA 5JJIA 1N33Q 4A93H 4DR4Q 3PSIA 4GOPB 4O2DA 1UE7A 4QL5A 3I56A 3I4OA 2V1CC 2K5NA 1NE3A 3T1YL 4RMFA 2JQOA 3A5ZB 2UXCQ 1K73C 3PIOA 3E9HA 3OYYA 1VQPA 1NY4A 3A74A 1DGSA 1YHAA 5GAHC 4GNXA 4IJLA 2UUBQ 3RZOH 3HOZH 1KL9A 4C2MH 4DUYL 2RF4A 1J5EL 1W3SA 2B63G 2UXDQ 1LM0A 4A3KG 4P71A 3RLNA 3EBEA 3H15A 3I55A 3TS0A 4A3IG 2XTIA 1KC8C 3OW2A 1VQ6A 4Y52H 4JOIA 2B29A 5M3MG 1I3QH 2VQFQ 4HJ5A 1ASZA 1BBUA 1N33L 1LTLA 2K52A 4R4CA 4DR4L 3KLWA 4DPGA 2GVAA 2R93G 2HQLA 3M4PA 2CWPA 1YEZA 4UPAA 2XGTA 3KDFA 4QJFA 2I5MX 2UXCL 1AE2A 5C0XJ 2UUBL 2ATWA 5C0XI 5C0XG 4GNXB 1QVFA 1VQ4A 3ZJYC 3TS2A 2JA5G 4L5SA 2UXBQ 1TWCH 1YJNA 1MJEA 2UXDL 4BY7H 4YY3Q 2Q2TA 1K0RA 2KCMA 4A4IA 1YBYA 1NMFA 5M5WH 4AQYQ 3CCRA 2NVXH 5IE8A 1HR0Q 2LXKA 2VQFL 2F52A 4A3GG 1CKNA 1G6PA 3D0FA 2HIVA 3F2CA 3K81C 1S72A 2ZJPA 1KD1C 3PO2G 3CAMA 1C0AA 3S1MH 1WOCA 1Y14B 1YVCA 4A3LH 4A3DG 1I6HH 1VQIA 2JA8H 4TVAB 2K4KA 4JYAQ 3KDFB 2WFWA 1Z47A 2NVTH 4K0KQ 4DV6Q 4POFA 1O7IA 2UXBL 2EXDA 4R4TA 3S14H 1PH2A 3GTJH 4NB3A 4YY3L 4A3MH 4DV0Q 4KI0A 3GTPH 1I5FA 1GKHA 1VQEA 4DV3L 1T9HA 4XIGS 4AQYL 1N8RC 1GM5A 2JA6G 4A3CG 3J7ZC 4PG3A 1QUQA 4JBJA 1SLJA 2RHSB 2WB1G 1HR0L 2K5HA 1Z9FA 4A3EH 1CKNB 3PO3G 1X65A 4FDBA 1J6QA 3FKIH 4A3IH 1TWHH 3K7AH 3AFPA 2JK8A 1RL2A 1PA6A 3ULPA 4UY8C 2JEAI 4APVA 4C3HH 3U4ZA 1Y1WG 3CCUA 4K0KL 3TREA 5M5YH 4DV6L 3CD6A 5JEAJ 1UE1A 3UDIA 2KHJA 4GOPC 1XNQQ 4A75A 4B3TQ 1X6OA 3RLOA 5JEAG 4YHHL 1K83H 1C7YA 4BBSG 1UEBA 5AJ3Q 4J15A 2BH2A 2AKWB 2VQEQ 1Q12A 1X56A 4HJAA 1HJPA 2ZTCA 4LUZA 4JBMA 2K50A 2E5LQ 3S16H 4UP9A 1QUQB 1L2FA 5IYBG 1VQ9A 2PI2E 1G291 4LF8Q 4YCVA 4EX5A 3CCJA 3PUZA 3U4VA 2F3IA 3W5OA 2EIFA 1HZ9A 3GTKH 2GN5A 5ELOA 1Q8KA 1MJCA 1IBLQ 1Q1BA 4JBKA 4OONA 1XNQL 1BVSA 2A1AA 5E7NA 5FLMH 4B3TL 2I5LX 2IT1A 2GVBA 5C4JH 5AJ3L 5H1SE 4HIDA 1D7QA 2WB1E 2VQEL 2UUAQ 2PQAA 3UE1A 4L5RC 4PZ7A 4BBRG 3G6EA 2E5LL 1NTGA 2ES2A 2NZOA 1S40A 4GNXC 2ZM6Q 4YCUA 3DM3A 4KHZA 2KCTA 4LF8L 4YCWA 4X64Q 1XJVA 1K8AC 4L5TA 2K75A 4LUOA 3BZKA 1HZCA 4PZ8A 3T1YQ 1NMGA 1CSQA 1EOVA 2K14A 5GAGC 2OQ0A 2OTLA 1E24A 3ERSX 1IBLL 1WCMG 4JOIC 1A63A 4UP7A 4KLKA 4DV7Q 3HOVH 2MFIA 1VQMA 3HOYH 2OQKA 3AYHB 1VS0A 1N32Q 4R1JA 3CCSA 1JJ2A 2UUAL 5GROA 4R4IA 3S2DH 2KENA 3HOUH 4IPGA 1BBWA 2ID0A 2PQAB 1FGUA 4JG2A 1L1OA 3E9IA 4JI8Q 4GLAC 2ZM6L 4LWCA 2CWAA 4MTNA 3H0GH 4X64L 3HKZG 1UE6A 3CF5A 3GTOH 3AFQA 1VQFA 4DUZQ 1N36Q 4JI0Q 3ER0A 3J81j 1TWGH 2JE6I 3PV0A 5LMNQ 1CSPA 1Q1EA 2AWNA 4DV7L 2R92H 4DV1Q 1K9MC 1HZAA 1X3FA 2IX0A 5HGQA 3BJUA 3W1GA 4NXMQ 3RR5A 1N32L 2OTJA 3UDFA 1VQ8A 1KIXA 5JJLA 3CC7A 3KFUA 1V1QA 2HT1A 1EFWA 2VUMG 2IHFA 1YZ6A 4JI8L 1L1OB 3U58A 2MO1A 3H3VI 3JAMc 3CPWA 3FHWA 1PH9A 2YTYA 4OXPA 4BXXG 2VL6A 3M7NA 1I50H 4DUZL 1N36L 2N3SA 4JI0L 3GTLH 4LF4Q 2D0OA 1XTDA 5LMNL 3I2ZA 2N49A 1IBML 2Q2UA 1KXLA 1XPRA 3LGJA 3PIPA 5K36G 3JAMi 3M85A 4DV1L 2VY3A 4JCVE 1QVGA 1SMXA 4NXML 1E1TA 4JC0A 2AHOB 3G48A 3PUXA 4IPHA 4DV3Q 4A3BG 1Y1VH 2QEXA 4DAYB 1CUKA 3HKZE 2R7DA 3HOXH 1XMQQ 1H95A 5FJ8H 3T1HQ 5LMUQ 3HFZB 5EAYA 1JMCA 3TQYA 5FLXc 1XPUA 4BY1G 1I94Q 3KYHC 3STBC 1Q46A 1YHBA 2VW9A 4LF6Q 4JI5Q 2NVYH 2NVQH 1VQLA 4LF4L 3S1QH 1E1OA 3STBD 3RN5A 2I5HA 1AE3A 5DLQE 4YHHQ 3I4MG 1ASYA 3TEHB 1PH4A 2MO0A 1HNWQ 5C44G 2E2JH 4OO1G 4OO1I 3L0OA 4OX9Q 3GTGH 4R4QA 1IL2A 2B63H 1XMQL 4DR1Q 3HOWG 3PUVA 4A3KH 3KJPA 3T1HL 5LMUL 3CMAA 3FP9A 2R7ZG 2WAQG 2R6GA 1OXSC 3KJOA 1I94L 1UWVA 1IXRA 1HH2P 2FXQA 4QIWE 5GQOA 4DR2Q 5M3MH 2R93H 3JC66 5IWAQ 1Q7YC 2CKZB 4LF6L 5IYDG 4JI5L 3NBHB 3A5UA 3ULJA 1LUZA 5IP9G 3CCMA 1S3OA 3PF5A 1VQOA 1YHQA 1HNWL 1CKMA 4OWTB 1VQNA 3BZCA 1A62A 1M1KC 1SFOH 2UU9Q 5IYCG 4OX9L 2JA5H 5IP7G 4A3JG 4A3FG 5C3EG 2CCZA 3SGIA 2IHEA 4DR1L 4JI3Q 1N9WA 1PYBA 1A8VA 3D31A 4X6AH 1JJGA 3CCVA 3F1ZA 1JE5A 1VQDA 2PNHA 5M3FG 4DR2L 3I4NG 4NPSA 3PUWA 2LSSA 1OXUA 1PH3A 5IWAL 4POGA 2JA7G 4A3GH 2D62A 1PH1A 1U0LA 4LFBQ 3PO2H 4IJHA 3M3YH 1L1OC 1IYJB 1EUJA 5M5XH 2E8GA 3UDXA 4A3DH 3L2PA 4A93G 2Q2IA 4YWKA 4LFAQ 2UU9L 4H02A 4KHPQ 1V9PA 4LF9Q 2LXJA 1AH9A 2WAQE 4DK3C 5GADC 4DR7Q 4UP8A 4X65Q 4JI3L 4L5QA 4QGUA 3HOZG 1Q81C 1U5KA 2JA6H 4A3CH 3EIVA 1XMOQ 3E0EA 2ZJQA 1EQRA 1YJ9A 4XTCS 2DGYA 1HNXQ 3J7A5 2E2IH 3PO3H 4B3RQ 4NXNQ 4LFBL 1JT8A 3B6YA 2R7ZH 1Q82C 1OXXK 1PYSB 1VQ5A 4JBWA 3J80i 3K0XA 1CKOA 3J81c 4HJ8A 2YYZA 1B8AA 3Q8DA 2NZHA 3I7FA 1K8GA 4JI4Q 1Y1WH 4QY7A 4GKJQ 3RNUA 1M90C 2VZAA 1UE5A 4LFAL 2A8VA 4KHPL 2PMZE 4LF9L 2I0QA 4Y7NH 3GTQH 4DR7L 4BBSH 4AIMA 4X65L 1QZGA 2BA1A 1VQBA 5C4XG 3J81i 1PH8A 1VQCA 1NBWA 4DR3Q 1TWAH 4PMWA 1XMOL 2BH8A 1PVOA 5HY6A 3GDEA 2K5VA 2ASBA 1HR0W 1HNXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R L;  4NXN L;  1IBM Q;  4ME3 A;  5M3F H;  1PFS A;  3G71 A;  4P72 A;  4JI4 L;  4WJ3 M;  2OWO A;  3CCE A;  4GKJ L;  4IFD J;  2HIX A;  4IFD I;  3RLF A;  3NEL A;  1VQ7 A;  4A3L G;  4IFD G;  1QVC A;  4X66 L;  1BKB A;  2JA8 G;  2H5X A;  1PH5 A;  3A0J A;  3S17 H;  3U50 C;  3EN2 A;  3DLL A;  1EQQ A;  1PH6 A;  1C9O A;  2RHQ B;  4DV4 Q;  2WP8 J;  2PI2 A;  4DR3 L;  3ICE A;  3VDY A;  4BBR H;  3CME A;  1FJG L;  1SRO A;  5J3B A;  4MNO A;  1GD7 A;  3AQQ A;  4BA1 I;  4GS3 A;  4A3M G;  1JB7 A;  4AH6 A;  2YTV A;  1EYG A;  3S1N H;  4HIM A;  2R7F A;  2VNU D;  3PCO B;  3KOJ A;  4RG1 A;  2KBN A;  1FL0 A;  4IOC A;  4JV5 Q;  4A3E G;  4GN4 B;  1R9T H;  1KHI A;  2ALY B;  2C35 B;  3FKI G;  3MEF A;  4GLV B;  1WCM H;  2N78 A;  1P16 A;  4OWX B;  1G51 A;  3IRB A;  1XPO A;  2ZTE A;  2N8N A;  1WFQ A;  1WYD A;  3F8T A;  3ULL A;  4GKK Q;  1OXT A;  5ELN A;  4C3J H;  4A76 A;  3KF8 B;  1SRU A;  2D0P A;  1EWI A;  5JJK A;  4DV4 L;  2JJQ A;  3PGZ A;  1N34 Q;  1WI5 A;  3CC2 A;  2UUC Q;  3RN2 A;  1X55 A;  4R4O A;  5C4X H;  1YI2 A;  2YU9 H;  4IOA A;  4GLX A;  4BA2 I;  1VQH A;  2JA9 A;  4JV5 L;  4IPC A;  2AWO A;  3M9B A;  4JI6 Q;  4DV2 Q;  1VQK A;  2L15 A;  2F4V Q;  1X9N A;  3AEV A;  2HHH Q;  1A0I A;  1PH7 A;  3CXC A;  1VQG A;  1B70 B;  1OXV A;  1X54 A;  5GAE C;  1YIT A;  4JI7 Q;  4GKK L;  4WJ4 A;  1V43 A;  2MNA A;  1VCI A;  4AYB G;  3UE0 A;  1N34 L;  1PV4 A;  5FLM G;  1RIP A;  3G4S A;  4B3M Q;  2VUM H;  4GN3 B;  4DK6 C;  2UUC L;  3S1R H;  4IPD A;  1B7Y B;  4MZ9 A;  1EIF A;  4HIO A;  4B3S Q;  3F2B A;  1SE8 A;  2ZTD A;  1TXY A;  1NJI C;  4YWL A;  1PHJ A;  2IX1 A;  1TWF H;  4BXX H;  2Z6K C;  1Q86 C;  1JJC B;  3M4O H;  1KRS A;  1KAW A;  4DV5 Q;  2QGQ A;  2VS1 A;  3W1B A;  4JI6 L;  4LF5 Q;  4C3I H;  1P8L A;  4DV2 L;  2F4V L;  1E3P A;  2HHH L;  1VQA A;  3HKS A;  1X3G A;  1E22 A;  2ZJR A;  4JI7 L;  4P74 A;  3F2D A;  1GO3 E;  3KF6 A;  3K80 C;  2KHI A;  2AMC B;  3RZD H;  1IBK Q;  1EIY B;  2RCN A;  2OCE A;  3K8A A;  4A3B H;  3HOV G;  1HNZ Q;  2Q2H A;  3UDG A;  3H3V H;  4BY7 G;  4LFC Q;  4EQ5 A;  4B3M L;  3HOY G;  2E2H H;  4JYA L;  1SR3 A;  4B3S L;  4BY1 H;  3HOU G;  3S15 H;  3BU2 A;  1QZH A;  1K3R A;  3MXN B;  3PUY A;  4X62 Q;  4DV5 L;  4DV0 L;  1E7Z A;  2Y0S G;  3H0G G;  4LF5 L;  5LMN W;  3OTO Q;  4DKA C;  3I4M H;  4AYB E;  4IO9 A;  2Z6K A;  3S24 A;  4LF7 Q;  4QQB X;  2IY5 B;  1XNR Q;  3J80 c;  4ALP A;  5C44 H;  3CW2 C;  4P75 A;  5BR8 Q;  1IBK L;  3KF6 B;  3PF4 A;  2YTX A;  4JI2 Q;  4OWW B;  2DUD A;  1HNZ L;  2R92 G;  2YV5 A;  4TQU S;  1IZ6 A;  4LFC L;  4DAM A;  3HOW H;  4DR6 Q;  5IYB H;  4DR5 Q;  2B3G A;  1YJW A;  1GVP A;  3S2H H;  4O0A A;  4GN5 A;  4YWM A;  5IY0 A;  1OTC A;  4JI1 Q;  2CQO A;  1YIJ A;  2QA4 A;  3CP0 A;  5IYD H;  4HJ9 A;  3GD7 A;  4LW1 A;  5IT9 c;  1FVI A;  4DNI A;  2MQH A;  5IP9 H;  3GO5 A;  4X62 L;  4LUV A;  3GTM H;  3OTO L;  3CCQ A;  4PZ6 A;  3CQZ H;  2A19 A;  4X66 Q;  4HIK A;  1SN8 A;  2Z0S A;  3NEN A;  2NN6 I;  1HZB A;  2NN6 G;  3K7U C;  4GOP A;  4LF7 L;  1MIU A;  1XNR L;  3TRZ A;  1VQJ A;  2EQS A;  5BR8 L;  1LYL A;  3WWV A;  5IYC H;  4HJ7 A;  3CC4 A;  4JI2 L;  1FJG Q;  3CCL A;  2CFM A;  5IP7 H;  4A3J H;  3NEM A;  5C3E H;  4A3F H;  2BA0 A;  4DR6 L;  3L7Z C;  4P73 A;  4DR5 L;  1WJJ A;  1X3E A;  4DUY Q;  1Y1V G;  1KRT A;  1D8L A;  2Y0S E;  3M4Q A;  1J5E Q;  3I4N H;  4JI1 L;  3HOX G;  2JEB I;  1L0W A;  2JA7 H;  5FJ8 G;  1YNX A;  3CPF A;  4LNQ A;  1MKH A;  1W2B A;  1KQS A;  5JJI A;  1N33 Q;  4A93 H;  4DR4 Q;  3PSI A;  4GOP B;  4O2D A;  1UE7 A;  4QL5 A;  3I56 A;  3I4O A;  2V1C C;  2K5N A;  1NE3 A;  3T1Y L;  4RMF A;  2JQO A;  3A5Z B;  2UXC Q;  1K73 C;  3PIO A;  3E9H A;  3OYY A;  1VQP A;  1NY4 A;  3A74 A;  1DGS A;  1YHA A;  5GAH C;  4GNX A;  4IJL A;  2UUB Q;  3RZO H;  3HOZ H;  1KL9 A;  4C2M H;  4DUY L;  2RF4 A;  1J5E L;  1W3S A;  2B63 G;  2UXD Q;  1LM0 A;  4A3K G;  4P71 A;  3RLN A;  3EBE A;  3H15 A;  3I55 A;  3TS0 A;  4A3I G;  2XTI A;  1KC8 C;  3OW2 A;  1VQ6 A;  4Y52 H;  4JOI A;  2B29 A;  5M3M G;  1I3Q H;  2VQF Q;  4HJ5 A;  1ASZ A;  1BBU A;  1N33 L;  1LTL A;  2K52 A;  4R4C A;  4DR4 L;  3KLW A;  4DPG A;  2GVA A;  2R93 G;  2HQL A;  3M4P A;  2CWP A;  1YEZ A;  4UPA A;  2XGT A;  3KDF A;  4QJF A;  2I5M X;  2UXC L;  1AE2 A;  5C0X J;  2UUB L;  2ATW A;  5C0X I;  5C0X G;  4GNX B;  1QVF A;  1VQ4 A;  3ZJY C;  3TS2 A;  2JA5 G;  4L5S A;  2UXB Q;  1TWC H;  1YJN A;  1MJE A;  2UXD L;  4BY7 H;  4YY3 Q;  2Q2T A;  1K0R A;  2KCM A;  4A4I A;  1YBY A;  1NMF A;  5M5W H;  4AQY Q;  3CCR A;  2NVX H;  5IE8 A;  1HR0 Q;  2LXK A;  2VQF L;  2F52 A;  4A3G G;  1CKN A;  1G6P A;  3D0F A;  2HIV A;  3F2C A;  3K81 C;  1S72 A;  2ZJP A;  1KD1 C;  3PO2 G;  3CAM A;  1C0A A;  3S1M H;  1WOC A;  1Y14 B;  1YVC A;  4A3L H;  4A3D G;  1I6H H;  1VQI A;  2JA8 H;  4TVA B;  2K4K A;  4JYA Q;  3KDF B;  2WFW A;  1Z47 A;  2NVT H;  4K0K Q;  4DV6 Q;  4POF A;  1O7I A;  2UXB L;  2EXD A;  4R4T A;  3S14 H;  1PH2 A;  3GTJ H;  4NB3 A;  4YY3 L;  4A3M H;  4DV0 Q;  4KI0 A;  3GTP H;  1I5F A;  1GKH A;  1VQE A;  4DV3 L;  1T9H A;  4XIG S;  4AQY L;  1N8R C;  1GM5 A;  2JA6 G;  4A3C G;  3J7Z C;  4PG3 A;  1QUQ A;  4JBJ A;  1SLJ A;  2RHS B;  2WB1 G;  1HR0 L;  2K5H A;  1Z9F A;  4A3E H;  1CKN B;  3PO3 G;  1X65 A;  4FDB A;  1J6Q A;  3FKI H;  4A3I H;  1TWH H;  3K7A H;  3AFP A;  2JK8 A;  1RL2 A;  1PA6 A;  3ULP A;  4UY8 C;  2JEA I;  4APV A;  4C3H H;  3U4Z A;  1Y1W G;  3CCU A;  4K0K L;  3TRE A;  5M5Y H;  4DV6 L;  3CD6 A;  5JEA J;  1UE1 A;  3UDI A;  2KHJ A;  4GOP C;  1XNQ Q;  4A75 A;  4B3T Q;  1X6O A;  3RLO A;  5JEA G;  4YHH L;  1K83 H;  1C7Y A;  4BBS G;  1UEB A;  5AJ3 Q;  4J15 A;  2BH2 A;  2AKW B;  2VQE Q;  1Q12 A;  1X56 A;  4HJA A;  1HJP A;  2ZTC A;  4LUZ A;  4JBM A;  2K50 A;  2E5L Q;  3S16 H;  4UP9 A;  1QUQ B;  1L2F A;  5IYB G;  1VQ9 A;  2PI2 E;  1G29 1;  4LF8 Q;  4YCV A;  4EX5 A;  3CCJ A;  3PUZ A;  3U4V A;  2F3I A;  3W5O A;  2EIF A;  1HZ9 A;  3GTK H;  2GN5 A;  5ELO A;  1Q8K A;  1MJC A;  1IBL Q;  1Q1B A;  4JBK A;  4OON A;  1XNQ L;  1BVS A;  2A1A A;  5E7N A;  5FLM H;  4B3T L;  2I5L X;  2IT1 A;  2GVB A;  5C4J H;  5AJ3 L;  5H1S E;  4HID A;  1D7Q A;  2WB1 E;  2VQE L;  2UUA Q;  2PQA A;  3UE1 A;  4L5R C;  4PZ7 A;  4BBR G;  3G6E A;  2E5L L;  1NTG A;  2ES2 A;  2NZO A;  1S40 A;  4GNX C;  2ZM6 Q;  4YCU A;  3DM3 A;  4KHZ A;  2KCT A;  4LF8 L;  4YCW A;  4X64 Q;  1XJV A;  1K8A C;  4L5T A;  2K75 A;  4LUO A;  3BZK A;  1HZC A;  4PZ8 A;  3T1Y Q;  1NMG A;  1CSQ A;  1EOV A;  2K14 A;  5GAG C;  2OQ0 A;  2OTL A;  1E24 A;  3ERS X;  1IBL L;  1WCM G;  4JOI C;  1A63 A;  4UP7 A;  4KLK A;  4DV7 Q;  3HOV H;  2MFI A;  1VQM A;  3HOY H;  2OQK A;  3AYH B;  1VS0 A;  1N32 Q;  4R1J A;  3CCS A;  1JJ2 A;  2UUA L;  5GRO A;  4R4I A;  3S2D H;  2KEN A;  3HOU H;  4IPG A;  1BBW A;  2ID0 A;  2PQA B;  1FGU A;  4JG2 A;  1L1O A;  3E9I A;  4JI8 Q;  4GLA C;  2ZM6 L;  4LWC A;  2CWA A;  4MTN A;  3H0G H;  4X64 L;  3HKZ G;  1UE6 A;  3CF5 A;  3GTO H;  3AFQ A;  1VQF A;  4DUZ Q;  1N36 Q;  4JI0 Q;  3ER0 A;  3J81 j;  1TWG H;  2JE6 I;  3PV0 A;  5LMN Q;  1CSP A;  1Q1E A;  2AWN A;  4DV7 L;  2R92 H;  4DV1 Q;  1K9M C;  1HZA A;  1X3F A;  2IX0 A;  5HGQ A;  3BJU A;  3W1G A;  4NXM Q;  3RR5 A;  1N32 L;  2OTJ A;  3UDF A;  1VQ8 A;  1KIX A;  5JJL A;  3CC7 A;  3KFU A;  1V1Q A;  2HT1 A;  1EFW A;  2VUM G;  2IHF A;  1YZ6 A;  4JI8 L;  1L1O B;  3U58 A;  2MO1 A;  3H3V I;  3JAM c;  3CPW A;  3FHW A;  1PH9 A;  2YTY A;  4OXP A;  4BXX G;  2VL6 A;  3M7N A;  1I50 H;  4DUZ L;  1N36 L;  2N3S A;  4JI0 L;  3GTL H;  4LF4 Q;  2D0O A;  1XTD A;  5LMN L;  3I2Z A;  2N49 A;  1IBM L;  2Q2U A;  1KXL A;  1XPR A;  3LGJ A;  3PIP A;  5K36 G;  3JAM i;  3M85 A;  4DV1 L;  2VY3 A;  4JCV E;  1QVG A;  1SMX A;  4NXM L;  1E1T A;  4JC0 A;  2AHO B;  3G48 A;  3PUX A;  4IPH A;  4DV3 Q;  4A3B G;  1Y1V H;  2QEX A;  4DAY B;  1CUK A;  3HKZ E;  2R7D A;  3HOX H;  1XMQ Q;  1H95 A;  5FJ8 H;  3T1H Q;  5LMU Q;  3HFZ B;  5EAY A;  1JMC A;  3TQY A;  5FLX c;  1XPU A;  4BY1 G;  1I94 Q;  3KYH C;  3STB C;  1Q46 A;  1YHB A;  2VW9 A;  4LF6 Q;  4JI5 Q;  2NVY H;  2NVQ H;  1VQL A;  4LF4 L;  3S1Q H;  1E1O A;  3STB D;  3RN5 A;  2I5H A;  1AE3 A;  5DLQ E;  4YHH Q;  3I4M G;  1ASY A;  3TEH B;  1PH4 A;  2MO0 A;  1HNW Q;  5C44 G;  2E2J H;  4OO1 G;  4OO1 I;  3L0O A;  4OX9 Q;  3GTG H;  4R4Q A;  1IL2 A;  2B63 H;  1XMQ L;  4DR1 Q;  3HOW G;  3PUV A;  4A3K H;  3KJP A;  3T1H L;  5LMU L;  3CMA A;  3FP9 A;  2R7Z G;  2WAQ G;  2R6G A;  1OXS C;  3KJO A;  1I94 L;  1UWV A;  1IXR A;  1HH2 P;  2FXQ A;  4QIW E;  5GQO A;  4DR2 Q;  5M3M H;  2R93 H;  3JC6 6;  5IWA Q;  1Q7Y C;  2CKZ B;  4LF6 L;  5IYD G;  4JI5 L;  3NBH B;  3A5U A;  3ULJ A;  1LUZ A;  5IP9 G;  3CCM A;  1S3O A;  3PF5 A;  1VQO A;  1YHQ A;  1HNW L;  1CKM A;  4OWT B;  1VQN A;  3BZC A;  1A62 A;  1M1K C;  1SFO H;  2UU9 Q;  5IYC G;  4OX9 L;  2JA5 H;  5IP7 G;  4A3J G;  4A3F G;  5C3E G;  2CCZ A;  3SGI A;  2IHE A;  4DR1 L;  4JI3 Q;  1N9W A;  1PYB A;  1A8V A;  3D31 A;  4X6A H;  1JJG A;  3CCV A;  3F1Z A;  1JE5 A;  1VQD A;  2PNH A;  5M3F G;  4DR2 L;  3I4N G;  4NPS A;  3PUW A;  2LSS A;  1OXU A;  1PH3 A;  5IWA L;  4POG A;  2JA7 G;  4A3G H;  2D62 A;  1PH1 A;  1U0L A;  4LFB Q;  3PO2 H;  4IJH A;  3M3Y H;  1L1O C;  1IYJ B;  1EUJ A;  5M5X H;  2E8G A;  3UDX A;  4A3D H;  3L2P A;  4A93 G;  2Q2I A;  4YWK A;  4LFA Q;  2UU9 L;  4H02 A;  4KHP Q;  1V9P A;  4LF9 Q;  2LXJ A;  1AH9 A;  2WAQ E;  4DK3 C;  5GAD C;  4DR7 Q;  4UP8 A;  4X65 Q;  4JI3 L;  4L5Q A;  4QGU A;  3HOZ G;  1Q81 C;  1U5K A;  2JA6 H;  4A3C H;  3EIV A;  1XMO Q;  3E0E A;  2ZJQ A;  1EQR A;  1YJ9 A;  4XTC S;  2DGY A;  1HNX Q;  3J7A 5;  2E2I H;  3PO3 H;  4B3R Q;  4NXN Q;  4LFB L;  1JT8 A;  3B6Y A;  2R7Z H;  1Q82 C;  1OXX K;  1PYS B;  1VQ5 A;  4JBW A;  3J80 i;  3K0X A;  1CKO A;  3J81 c;  4HJ8 A;  2YYZ A;  1B8A A;  3Q8D A;  2NZH A;  3I7F A;  1K8G A;  4JI4 Q;  1Y1W H;  4QY7 A;  4GKJ Q;  3RNU A;  1M90 C;  2VZA A;  1UE5 A;  4LFA L;  2A8V A;  4KHP L;  2PMZ E;  4LF9 L;  2I0Q A;  4Y7N H;  3GTQ H;  4DR7 L;  4BBS H;  4AIM A;  4X65 L;  1QZG A;  2BA1 A;  1VQB A;  5C4X G;  3J81 i;  1PH8 A;  1VQC A;  1NBW A;  4DR3 Q;  1TWA H;  4PMW A;  1XMO L;  2BH8 A;  1PVO A;  5HY6 A;  3GDE A;  2K5V A;  2ASB A;  1HR0 W;  1HNX L; 
#chains in the Genus database with same CATH topology
 1WR2 A;  4APM A;  1SYX B;  1IBM Q;  2JA5 A;  3GTG B;  2K28 A;  1PFS A;  4IRC A;  4PWQ A;  3BAB A;  2DY7 A;  2N88 A;  2Z6B A;  4EQP A;  3KAL A;  4JI4 L;  4WJ3 M;  1SEI A;  2HIX A;  2R93 B;  1VQ7 A;  2FFK B;  2GPW A;  2L4N A;  4X66 L;  3N40 P;  2H5X A;  4CDF C;  3A0J A;  1PH5 A;  3LX0 A;  5K5P A;  3DLL A;  5LXT F;  3VA7 A;  2DIK A;  2NYZ D;  2A6H D;  3KXY T;  3NTK A;  4BBR H;  3NE5 B;  3L3O C;  5EWE A;  2FLN A;  2YTV A;  1RYR A;  1SFO B;  5DG8 A;  4HIM A;  2R7F A;  1U9R A;  4FXK C;  4DL5 A;  4FF4 A;  3BQ0 A;  3KOJ A;  4JV5 Q;  4A3E G;  1R9T H;  3OWE B;  3FKI G;  4GLV B;  3RZD B;  3D8G A;  4HYK A;  3J7A V;  2WB1 A;  4HTH A;  5KKN B;  5J22 A;  4MV9 A;  4MV4 A;  2E2I A;  2N8N A;  4HMI A;  4IUR A;  2Z4H A;  4C3H G;  1MHW C;  2FMM A;  3KF8 B;  1SRU A;  3M3Y B;  5I2X A;  1GSO A;  4A3D B;  4IN3 A;  4JW0 A;  3CC2 A;  5G3L D;  1K3B C;  1X55 A;  1HFN A;  4YR3 A;  5DNF A;  4IOA A;  2R3Z A;  3PZP A;  3M9B A;  4FVM A;  5E3F A;  1TWA A;  4OEM B;  2JA6 B;  2L15 A;  1X9N A;  1PFM A;  2HHH Q;  4ZRZ A;  2R86 A;  5A2Q W;  1EEI D;  1OXV A;  4WJ4 A;  3RB3 A;  4DK0 A;  3QOL A;  1V43 A;  2MNA A;  3UE0 A;  3IL8 A;  2IX3 A;  5KG5 A;  1PV4 A;  1JCK B;  1RIP A;  4B3M Q;  3Q2O A;  2UUC L;  1SSO A;  3SVM A;  4YAJ B;  2VQE H;  1EIF A;  1JWU D;  3MR6 A;  3F2B A;  2ZTD A;  1NJI C;  1TXY A;  2AQ3 B;  2E5L H;  4IRK A;  3MXN A;  1Q86 C;  3M4O H;  5D1O B;  3FEW X;  1S5D D;  4DV5 Q;  2B2U C;  4LF5 Q;  2JP1 A;  1JDB B;  2NTT A;  4DV2 L;  1Q8I A;  4CDD C;  2ZJR A;  3HKS A;  1X3G A;  4UCT A;  4ECU A;  3T13 A;  2B2T C;  2E76 C;  2LS0 1;  3RZD H;  5C5J A;  4JV1 A;  2QYZ A;  1D5Z C;  2KJX A;  1SR3 A;  3ETJ A;  3I90 A;  1CTM A;  3GV3 A;  1JE4 A;  4UCO A;  3S15 H;  1PRT C;  3I70 A;  3TN2 A;  3S17 B;  2YS7 A;  4IUU A;  1G2T A;  3C3L A;  3MC0 B;  3R5X A;  3T5H A;  3PUY A;  5EGT A;  5FO7 B;  3H0G G;  2JSO A;  3OTO Q;  4DXF A;  3CKI B;  1B44 D;  4ME5 A;  2V58 A;  1F77 A;  1UNS A;  1XNR Q;  4ALP A;  4K5X A;  3J80 L;  4P75 A;  4DF7 A;  4FXD A;  3RV3 A;  2YTX A;  4OWW B;  1HNZ L;  4DR6 Q;  4DAM A;  3RV4 A;  1AP0 A;  3WO0 A;  1WCM B;  4QCL A;  3A56 A;  1YNJ C;  4YWM A;  2B2T A;  2H4O A;  1RK6 A;  3J81 L;  2QA4 A;  1S4Z A;  4C3J B;  3TP8 A;  5IT9 c;  4L8J A;  3JRW A;  5IP9 H;  2NWG A;  4F4X A;  3AU7 A;  4DUZ H;  3CCQ A;  4J1M A;  2A19 A;  4X66 Q;  3ETH A;  1MIU A;  1IBM H;  1CK1 A;  5JPN C;  1D6E C;  4JV0 A;  2EQS A;  4EEQ A;  2KEE A;  3WWV A;  3CC4 A;  4ECR A;  2EY5 A;  3NEM A;  3VR3 A;  2BA0 A;  5EBC A;  3L7Z C;  2F0M A;  2VB2 X;  1ZHS A;  2SNM A;  1HFG A;  4C56 C;  1D8L A;  1J5E Q;  3G6J B;  1Z6H A;  3K5I A;  1GHK A;  4J9P A;  2O03 A;  5D1P A;  4LNQ A;  2A6H C;  4HR7 A;  1KQS A;  5KT7 A;  5JJI A;  4FM9 A;  2VUM B;  4PDB A;  4DR4 Q;  5H80 A;  4O42 A;  5KFB A;  1R4Q B;  1F2Z A;  5DAU A;  1PZI D;  3I56 A;  3TBI B;  5G3L F;  2R61 A;  5KT3 A;  1EQT A;  2HQE A;  3T1Y L;  5JUM A;  1DIK A;  3QG1 A;  1BCP F;  1K73 C;  3E9H A;  4KKT A;  4KJN A;  1NY4 A;  2UUB Q;  4DUY L;  2DN8 A;  2WKD A;  1EHI A;  2B63 G;  3M9M B;  2I46 A;  4A3K G;  1DJR D;  3H15 A;  3I55 A;  4A3I G;  2RDJ A;  3L4J A;  4FYD A;  3OW2 A;  1GUT A;  3VR4 A;  2VUG A;  5M3M G;  2F0J A;  4LF6 H;  2E2H B;  3Q8Q B;  4R4C A;  2EJG C;  3URY A;  3M4P A;  4PQX A;  4BY1 B;  3DHQ A;  3D4D A;  5IGG A;  2UVV A;  1GUO A;  1IKL A;  2BDN A;  4K6L A;  4HMJ A;  3PIP 3;  1TVX A;  2I87 A;  3ZJY C;  4M1U B;  4HSP A;  2JA5 G;  1AN8 A;  1YJN A;  1MJE A;  2AQ4 A;  1KDC A;  4BY7 H;  4QW9 A;  1SYF A;  3HOW B;  1S72 A;  3K81 C;  2K01 A;  2PMZ A;  5KFF A;  2ZJP A;  2AGQ A;  2RBM A;  3PO2 G;  1C0A A;  4IFD H;  1YVC A;  2YYA A;  1A15 A;  1E2W A;  4K0K Q;  2WII B;  4DA2 A;  2RDF A;  3GTM B;  3A54 A;  3PR4 A;  4C5A A;  2XWB B;  1L0Y B;  3CQZ B;  3WO1 A;  3TQ1 A;  4JI3 H;  3V6K A;  4EGJ A;  4CKE A;  4NB3 A;  4YY3 L;  4A3M H;  1LT5 D;  4KI0 A;  3AMU A;  1B4O A;  1GKH A;  1ILQ A;  5FPO A;  4KK7 A;  2ICE C;  4RH6 A;  2FE3 A;  3J7Z C;  4E4T A;  1QUQ A;  4JBJ A;  4A3F B;  1HR0 L;  2WB1 G;  1ICF B;  2K5H A;  1Z9F A;  4KY6 A;  4MN3 A;  1B2T A;  3PO3 G;  2A6E C;  3M4I A;  4A3I H;  1A9X A;  3I4N B;  1GGO A;  4DFA A;  2R84 A;  3CCU A;  2XN9 C;  4DV6 L;  3SK4 A;  3CD6 A;  1I3Q A;  1UE1 A;  2X6L A;  5C4Z A;  2RGV A;  5DQH A;  4A75 A;  1KJJ A;  4B3T Q;  5JEA G;  1QOH A;  3RLO A;  4YHH L;  4BBS G;  2F0V A;  5AJ3 Q;  2Y0S B;  4J15 A;  2BH2 A;  4NMZ A;  1X56 A;  1HJP A;  4JBM A;  4FF2 A;  3PW0 A;  3M4Y A;  1V8Q A;  3S16 H;  4IUQ A;  5LL6 S;  4MV3 A;  1G29 1;  4LF8 Q;  4YCV A;  2F3I A;  5DEH A;  2GN5 A;  4JI4 H;  1HPC A;  1MJC A;  1RDP D;  2NVX A;  4JBK A;  1I4P A;  1PFN A;  1SNO A;  4KJO A;  4B9W A;  1XNQ L;  3MFI A;  5FLM H;  4M8A A;  1B3A A;  4RA8 A;  3BVZ A;  2F3V A;  2UUA Q;  2WTF A;  3T16 A;  2HDL A;  5KFY A;  1GLV A;  1EIH A;  2CW7 A;  3W3A A;  4YCW A;  1K8A C;  4R8U B;  1N56 A;  3BQ2 A;  3T1Y Q;  1CSQ A;  3GTP A;  4FS2 A;  2OQ0 A;  2OTL A;  5KFD A;  3ERS X;  4R8I A;  2K1B A;  4NDX A;  1VQM A;  3HOY H;  2OQK A;  1I4H A;  3K59 A;  4O4L F;  3S1M B;  3I3C A;  2KEN A;  2ID0 A;  3I72 A;  1L1O A;  1RTO A;  2A73 B;  4JI8 Q;  1JIH A;  4GLA C;  3KHR A;  2J4X A;  4X64 L;  3OSO A;  3D4R A;  3CF5 A;  1K83 A;  3RAX A;  3I8Z A;  4ETS A;  5KFA A;  3PVX A;  1ZEQ X;  2FLP A;  4ECY A;  4F87 A;  3BVG A;  1LTA D;  4UFZ A;  5KYI A;  2AWN A;  4DV7 L;  2BDO A;  5HGQ A;  3NPP A;  4NXM Q;  2OF1 A;  1N32 L;  3H6M A;  4K8I A;  2F03 A;  5JJL A;  3CC7 A;  3GTK A;  5F2D A;  3SEB A;  2HT1 A;  2UUC H;  1NUC A;  1O78 A;  2Z9H A;  2E2D C;  3L4K A;  5JAV A;  2YTY A;  2VL6 A;  3M7N A;  3RFC A;  1X32 A;  1N36 L;  2EDG A;  4JI0 L;  4GZY C;  2R8K A;  2V59 A;  3GTL H;  1JXL A;  1SYG A;  4DV2 H;  2Q2U A;  3I2Z A;  1WSC A;  1KXL A;  2CQA A;  3JAM i;  4C5C A;  4DV1 L;  3FDS A;  4JCV E;  3N6X A;  1K8M A;  4A3B G;  3G48 A;  1H9R A;  3PUX A;  4IPH A;  3RB6 A;  2R7D A;  4RKL A;  1I4X A;  3MHB A;  3T1H Q;  3M9N B;  3HFZ B;  4V19 0;  5EAY A;  1JMC A;  3MZ5 A;  3T51 B;  4AYB B;  4QUF A;  5FLX c;  1XPU A;  3QFF A;  4J0M A;  1M0W A;  4MV1 A;  3RB0 A;  3DEP A;  2XIW A;  2X69 A;  4RAU C;  3TP5 A;  5C4J B;  3NBH A;  4IUN A;  2R8I A;  4HED A;  2V9W A;  4LF4 L;  5IGB A;  3STB D;  4B9X A;  1SCU B;  1AE3 A;  4YHH Q;  3I4M G;  3R5H A;  5EJW A;  3C46 A;  3LWU A;  2MO0 A;  1HNW Q;  3Q1K A;  1JWM D;  3GTO A;  4M7E A;  5C44 G;  1HNZ H;  3LWB A;  5F9L A;  1IL2 A;  1XMQ L;  4DR1 Q;  1TWG A;  3KJP A;  4JUZ A;  4A2B A;  3FP9 A;  2R7Z G;  1OXS C;  3KJO A;  2R92 A;  1ENA A;  5GQO A;  1Q7Y C;  1ZET A;  1K8O A;  1CHQ D;  3S2D B;  1VQO A;  1YHQ A;  4KKS A;  1CKM A;  1E4E B;  5C0X H;  2UU9 Q;  1E0B A;  3RUZ A;  5IYC G;  2C22 A;  1EQV A;  4OX9 L;  1CHP D;  5NUC A;  5C3E G;  3MFY A;  2IJ0 A;  2Q8R E;  4FP5 D;  1JJG A;  4X6A H;  1VQD A;  5M3F G;  3NBI A;  3PUW A;  1PH3 A;  2I80 A;  5IWA L;  1SJE D;  4IJH A;  3DXJ C;  4X3S A;  4C1N K;  3UFX B;  1EUJ A;  2E8G A;  4A93 G;  2AQ1 B;  3L2P A;  2J6S A;  1Y69 U;  1BCP B;  1ZKO A;  1S9F A;  2K33 A;  4H02 A;  5KFC A;  1V9P A;  3T1Y H;  4LF9 Q;  2LXJ A;  3EQL C;  4DR7 Q;  2R87 A;  2E75 C;  2WV6 D;  5KIX A;  1UC9 A;  1K1Q A;  4L5Q A;  4KN4 C;  3HOZ G;  1DCZ A;  4DUY H;  1K1S A;  2YRW A;  5KFH A;  2LY7 A;  1F9R A;  1W96 A;  2KOL A;  3GTG A;  2R7Z H;  1Y1V B;  4H44 C;  2PW5 A;  1CKO A;  3K0X A;  3FVQ A;  4HJ8 A;  3T5L A;  1B8A A;  1Y1W H;  2G5D A;  1M90 C;  2A8V A;  2R93 A;  3KTM A;  3NSW A;  1J9O A;  2NVY B;  4AIM A;  2BA1 A;  4FXG C;  2OLS A;  3R2I A;  5C4X G;  2XCL A;  3S1Q B;  2NU6 B;  3DWA A;  3E3X A;  4UAI A;  1SYD A;  5C6A A;  4TUY F;  2ASD A;  1PVO A;  3GDE A;  2K5V A;  1QB5 D;  5IYB H;  5D3D A;  4ECS A;  4P2C B;  4B3R L;  1S97 A;  2E2J B;  1SFO A;  1IYV A;  1E2Z A;  4ME3 A;  3X3M A;  5M3F H;  3GLK A;  4P72 A;  3K5L A;  4GKJ L;  1RHP A;  1WTX A;  2PYK A;  5IOD A;  4R9W A;  4A3L G;  1CA6 A;  2JA8 G;  2QEJ C;  3KF8 A;  3U50 C;  1PH6 A;  1KBL A;  2RHQ B;  4DV4 Q;  1BNC A;  4ABN A;  1V51 A;  2D5D A;  4DR3 L;  3VDY A;  3CME A;  4KV6 A;  1FJG L;  4LSA A;  5EKI A;  4MNO A;  1GD7 A;  5J3B A;  3KAJ A;  4YY3 H;  4ZLT F;  5D3I B;  1Q3L A;  3PN1 A;  3C1E A;  3S1N H;  5EDW A;  4F4Y A;  1GUN A;  3T5K A;  3PCO B;  1HR0 H;  4RG1 A;  2R7L A;  4GN4 B;  2ALY B;  2C35 B;  3MEF A;  3NP8 A;  5C3X A;  2N78 A;  2JA6 A;  4OWX B;  4A3G B;  5LA6 F;  3IRB A;  2ZTE A;  3F8T A;  1WFQ A;  1T3N A;  1F9Q A;  4GKK Q;  4I7Z C;  4DV6 H;  1Y8P B;  2D0P A;  1EWI A;  4ED1 A;  3PGZ A;  1N34 Q;  2C2R A;  2CQY A;  4R4O A;  5C4X H;  3QR8 A;  3TSS A;  2BQ3 A;  2YU9 H;  4GLX A;  5D1O A;  4JV5 L;  1PTO D;  2AWO A;  1DXM A;  2W9A A;  2F0Q A;  4QUC A;  1JOR A;  2PW7 A;  1SBB B;  3GIM A;  1A0I A;  3CXC A;  4ULL A;  2F0T A;  4ID6 A;  1B70 B;  1F9S A;  1U4L A;  2WAQ B;  5IGF A;  1XNQ H;  1EY0 A;  4ZUI A;  4OIK A;  5L1K A;  3K0Y A;  3H3V H;  1RF2 D;  3VPD A;  1SE8 A;  1TWF H;  2Z6K C;  4Y7N B;  3GTQ B;  5CV9 A;  3A7A B;  1M4V A;  4KKU A;  4EGQ A;  4RGO S;  3GID A;  1KAW A;  2VS1 A;  2ZJT A;  2EY6 A;  2LMC B;  4C3I H;  4CDE C;  1LV9 A;  2HHH L;  4NW2 A;  4HN7 A;  3F2D A;  2F0N A;  1IBK Q;  2KHI A;  2AMC B;  1AUX A;  4YR0 A;  2ASL A;  3HOV G;  2DPI A;  2Q2H A;  1BGW A;  4CHT B;  1STE A;  4B3M L;  2ZDH A;  4JYA L;  1WCM A;  1VKZ A;  3BA9 A;  1EL0 A;  2B2V C;  1D5X C;  4HNV A;  3HOU G;  3BU2 A;  1QZH A;  4Q0Y A;  4X64 H;  4DV5 L;  3MWM A;  1E7Z A;  4LF5 L;  1TII D;  3RBE A;  5LMN W;  1PRT D;  4BBR B;  3QO2 A;  4AYB E;  4IO9 A;  2EYP A;  2Z6K A;  4LF7 Q;  1EOT A;  3GIJ A;  2IY5 B;  5KG3 A;  1DV2 A;  2QDL A;  1EEF D;  3KF6 B;  4OO1 H;  4DV7 H;  1CQV A;  1LO5 D;  2RDG A;  5CBE E;  2DUD A;  2R92 G;  5EOY A;  4TQU S;  1R9T B;  1N32 H;  3R3O A;  4RZR A;  2R7K A;  2F0L A;  4ZK9 B;  3M9O B;  1OTC A;  2XCA A;  4JI1 Q;  1B6S A;  1UC8 A;  2EJF C;  1YIJ A;  2DWC A;  1FVI A;  1YNJ D;  2MGS A;  2MQH A;  5IT9 L;  3RTX A;  4DL2 A;  4LUV A;  1CZW A;  1N36 H;  2VUM A;  3OTO L;  2B2V A;  4EYI B;  4JI0 H;  4CC6 A;  4HIK A;  2NN6 G;  2NN6 I;  1XNR L;  4F50 A;  3H94 A;  2O5I C;  1LAB A;  1T5E A;  3KLS X;  5FLX E;  2PO4 A;  4DV1 H;  1FJG Q;  4A3J H;  5LHY 1;  1TT2 A;  4DR6 L;  4ED3 A;  2F0K A;  5FO9 B;  3J7Y W;  1WTH A;  4TKO B;  4J9K A;  5KRU A;  4WFN 3;  5T1I A;  3OMC A;  3HOX G;  1O7Y A;  1II3 A;  1L0W A;  2JA7 H;  2NU7 B;  3OUU A;  3BQ1 A;  5JPM C;  5L1L A;  1QG7 A;  1W2B A;  3V2T A;  2O5J C;  2E2H A;  3NTI A;  1I6H B;  1N33 Q;  4Q45 A;  3PSI A;  1D1K A;  4GOP B;  4UCV A;  4LF4 H;  1JQY D;  1TA8 A;  1H9M A;  4RFB A;  4QWA A;  3E0J A;  2HCI A;  2V1C C;  4C5B A;  2K5N A;  3M4O B;  1JB3 A;  1U4P A;  3RMH A;  3NK9 A;  3A5Z B;  2UXC Q;  2R8H A;  1VQP A;  4DV3 H;  3A74 A;  1YHA A;  5EPJ A;  5GAH C;  5EWF A;  4IJL A;  1QNK A;  1KL9 A;  4C2M H;  4O3R A;  1XMQ H;  2K5D A;  4KY7 A;  1J5E L;  1XXG A;  1LM0 A;  1S0N A;  1GUG A;  3RLN A;  2YZM A;  3EBE A;  1GUW A;  2TSS A;  4RZQ A;  1VQ6 A;  3AB9 A;  4Y52 H;  2W8K A;  3NWS A;  1ULZ A;  2VQF Q;  3PW7 A;  2R93 G;  4QF4 A;  1BBU A;  3C1F A;  4DR4 L;  1QCB D;  3P20 A;  3CRL C;  3KLW A;  4DPG A;  2GVA A;  2HQL A;  4UHV A;  3LWE A;  4RNO A;  1T94 A;  2RGR A;  3S15 B;  4GC7 A;  1YEZ A;  2XGT A;  5KYL A;  2I5M X;  2NN6 H;  5JVD F;  1AE2 A;  1JWS D;  1PTO C;  4XYQ A;  2C2D A;  1LTB D;  3H09 A;  4JK1 C;  2UUB L;  3GTM A;  4OHJ A;  4GNX B;  4CBV A;  3CQZ A;  4OX9 H;  2ASJ A;  2UXB Q;  3KK7 A;  1TWC H;  1QIL A;  4MTD A;  3Q6S A;  1KJQ A;  1EU3 A;  2LFN A;  2Q2T A;  4IZO A;  2M05 A;  1K0R A;  2K7V A;  4AQY Q;  1YBY A;  3DUZ A;  2QDB A;  5IWA H;  2LXK A;  1X3P A;  2F52 A;  5L1J A;  3D0F A;  4NKL A;  2HIV A;  3F2C A;  2DY8 A;  2RA4 A;  2AGP A;  1DOL A;  3QOJ A;  1Y14 B;  1ZQ7 A;  4A3D G;  1I6H H;  2DZD A;  1RJR A;  4JYA Q;  3R5F A;  1Z2P X;  1Z47 A;  2DNC A;  3OIP A;  3FMA A;  4TV8 F;  2XGQ A;  3U9O A;  4O4H F;  1KLU D;  4CDC C;  4CC5 A;  4I4T F;  5JQW A;  2Y0S A;  3EJI A;  3GTJ H;  1PH2 A;  2P5Z X;  2HVR A;  5IIF A;  1EU4 A;  3MXP A;  3PW4 A;  5L37 A;  4ED0 A;  3K5N A;  1JOK A;  1HRJ A;  2JA6 G;  1N8R C;  3FDT A;  4A3C G;  1SMY D;  3KHG A;  4XDX A;  1SLJ A;  4A3E H;  2RVL A;  2M2L A;  1CKN B;  4FBU A;  1X65 A;  4FDB A;  1ZXT A;  3FKI H;  1A3V A;  1TWH H;  5ELD A;  4QWE A;  3AFP A;  3E5N A;  2B2Y A;  2JEA I;  4RAZ A;  2KCC A;  2A6E D;  4C3H H;  4K0K L;  1VAJ A;  4MA0 A;  2KHJ A;  4BS9 A;  1ROD A;  3RJ0 A;  1I4R A;  4K5V A;  3NWT A;  1NAP A;  1UEB A;  2KSW A;  4UCS A;  4IWY A;  2AKW B;  1JKJ B;  4DL4 A;  1Q12 A;  4CKB A;  4E6I A;  4LUZ A;  3GP7 A;  4XYO A;  5KFI A;  2HJW A;  1L2F A;  4B3R H;  2PI2 E;  2FK1 A;  3GQC A;  5HBR B;  4EX5 A;  4R8U A;  2XC9 A;  3U4V A;  1SAP A;  4DNT B;  1QWY A;  3G6Y A;  1LTR D;  1Q8K A;  5ELF A;  3GV8 B;  4GKJ H;  1PZK D;  1IBL Q;  2C9O A;  4OON A;  5FLX W;  2F0I A;  4B3T L;  3R2T A;  2I5L X;  1A6X A;  2GVB A;  2EYJ A;  3D6W A;  4QB4 A;  4X3U A;  5AJ3 L;  1WD0 A;  4MTK A;  4QWD A;  3GQB A;  4DR3 H;  2ZM6 Q;  5J1Z A;  1YNN D;  4KD3 A;  4LF8 L;  4L5T A;  2K75 A;  1O75 A;  1ENC A;  3ORR A;  1SYB A;  5CR3 A;  4BY7 B;  2C2E A;  2HUG A;  1X3Q A;  1GJX A;  4RCN A;  1WCM G;  3FPU B;  3H4B A;  5A2Q L;  4EQO A;  1BQQ T;  3GIL A;  1VS0 A;  4J9R A;  4C3J G;  4R1J A;  2UUA L;  3G8C A;  4IPG A;  1TY0 A;  2R7M A;  5E4X A;  4I50 F;  4HSV A;  3E9I A;  5C1O A;  1C48 A;  3GV7 B;  2KHS A;  2A5H A;  3H0G H;  1UE6 A;  1RJT A;  2PCF B;  3AFQ A;  3MR3 A;  4JV5 H;  4PV1 C;  1VF5 C;  4A3M B;  2Q8T A;  3KHL A;  5DLF A;  2JE6 I;  5LMN Q;  5A35 A;  2PN1 A;  3K5M A;  1Q90 A;  2F0O A;  3CU7 A;  4ED7 A;  1K9M C;  1HZA A;  1X3F A;  1Y8O B;  4XQQ A;  3W1G A;  5I4D A;  4A3I B;  3UDF A;  1VQ8 A;  1KIX A;  1KJ9 A;  2VUM G;  2IHF A;  2R6F A;  4JI8 L;  2X0S A;  2QW7 A;  2MO1 A;  3K3V A;  4AYB A;  3CPW A;  1PH9 A;  4BXX G;  4R8N A;  4RU9 A;  1I50 H;  2N3S A;  4X3K A;  1ONL A;  1V1O A;  3SR1 A;  1XPR A;  5KND A;  2HHH H;  3S16 B;  1NR2 A;  2VY3 A;  1QVG A;  5CA1 F;  4NXM L;  2AHO B;  3ERQ A;  3MFH A;  2QEX A;  2EZV A;  4B3M H;  3MFG A;  2LKV A;  2L11 A;  5LMU Q;  1KAA A;  4EFB A;  4ZYS A;  4BY1 G;  5FLX L;  3KYH C;  1I94 Q;  1BCP C;  3OSN A;  4JVZ A;  2VW9 A;  4JI5 Q;  5CV8 A;  3JZI A;  4DV5 H;  4LF5 H;  4OEL B;  5C5L A;  1E1O A;  1KDB A;  2M9V A;  2B8F A;  4DAP A;  5DLQ E;  1SMY C;  4RAY A;  4N8X 1;  1M7J A;  1PH4 A;  1C8C A;  1E4E A;  4TQS A;  1R4P B;  2O4X A;  3LNN A;  1MD2 D;  5KNB A;  1E4F T;  1I6V C;  1RJQ A;  2VB3 X;  2B63 H;  3HOW G;  3OSP A;  2RSN A;  3PUV A;  4A3K H;  4J9L A;  3T1H L;  5KG7 A;  4O3P A;  1T5X D;  2HD3 A;  2SEB D;  4DR2 Q;  5M3M H;  3JC6 6;  3HOY B;  5F9N A;  2CKZ B;  5IYD G;  3VMM A;  4XX0 B;  2KVM A;  1E4G T;  1GUS A;  3OTO H;  1DV1 A;  5FD6 A;  4WRD A;  1WTQ A;  2W6O A;  3MWE A;  1XNR H;  2IL8 A;  4G7Z C;  1HNW L;  1AW7 A;  5EKL A;  2W6N A;  4DL3 A;  3Q8R B;  1MGS A;  1M1K C;  1WTP A;  2JA5 H;  4F8M A;  4DR6 H;  4RGN A;  5IP7 G;  4A3F G;  3T5J A;  4DR1 L;  2IHE A;  1N9W A;  5BN4 A;  1PYB A;  3TIG A;  3D31 A;  1RK5 A;  4RHR A;  4FF3 A;  3I4N G;  1NNX A;  4ED2 A;  1PH1 A;  4LFB Q;  1KLG D;  3PO2 H;  1Y1V A;  3A7L A;  3KLR A;  1L1O C;  2HDM A;  2NUC A;  2IMW P;  4X66 H;  5M5X H;  4L1K A;  2CH4 W;  4J9S A;  5LYJ F;  2AQ2 B;  2Q2I A;  4V0B A;  5I47 A;  4YWK A;  1YNN C;  2F0D A;  4Q5V A;  1M6V A;  4LFA Q;  2UU9 L;  4KHP Q;  3SHL A;  3N42 B;  3RBD A;  1SND A;  5FO8 B;  2V5A A;  2NVY A;  3MEH A;  3J7A F;  4X65 Q;  4U7C A;  3GTL B;  1CQF A;  4EGV A;  2QK4 A;  4QGU A;  3TP7 A;  1Q81 C;  1EWC A;  3JAM E;  5KG1 A;  1J5E H;  3EIV A;  1XMO Q;  2EYH A;  2NB0 A;  2ZJQ A;  1UNN C;  4ZQI A;  2DGY A;  1HNX Q;  3J7A 5;  2E2I H;  3PO3 H;  4NXN Q;  5EZY F;  1JT8 A;  3B6Y A;  3VPB A;  1JOQ A;  5HUR A;  3G6V A;  3J81 c;  4DR4 H;  3I73 A;  1PFB A;  1K8G A;  2SCU B;  1SJH D;  4QY7 A;  3TQT A;  1S0O A;  2PZW A;  2RSO A;  2K32 A;  3PW5 A;  5KFK A;  4LF9 L;  2L55 A;  5JEA H;  1QNU A;  4DR7 L;  4BBS H;  2J7Z A;  2UUB H;  1IL8 A;  1VQB A;  1BOS A;  5DQG A;  1B9N A;  2K03 A;  2PNR C;  1VQC A;  5C5M A;  1TWA H;  2BQR A;  5HY6 A;  2ASB A;  1TY2 A;  1EY7 A;  4WBN F;  3MVV A;  3O13 A;  4JPB W;  4ZUJ A;  1I6U A;  2ZXO A;  4TRD A;  2NU9 B;  4U68 A;  2OWO A;  4IFD J;  4JV2 A;  2TMP A;  3TZU A;  1PLF A;  3NEL A;  1QVC A;  3BZD B;  4I65 A;  1KAB A;  4ED8 A;  2XD4 A;  3EN2 A;  1EQQ A;  1CT1 D;  2WP8 J;  2PI2 A;  4FS1 A;  1PTO H;  4DL7 A;  1D5M C;  1SRO A;  2EYF A;  4BA1 I;  3KBG A;  3NQI A;  4AH6 A;  1EYG A;  2JYO A;  2SDF A;  2VNU D;  3HS0 C;  2PBZ A;  1SNC A;  2KBN A;  1FL0 A;  1Z2N X;  1O80 A;  3BG3 A;  2FJZ A;  1P16 A;  2BR0 A;  1OXT A;  2WAQ A;  5ELN A;  4K0K H;  4A76 A;  4DV4 L;  2DLN A;  2GLT A;  1WH2 A;  3GV5 B;  1RTN A;  3RN2 A;  2CH4 A;  3VR5 A;  3GTQ A;  1ZYR C;  4BA2 I;  1VQH A;  5KT2 A;  4ECQ A;  2RDI A;  3R8B A;  5COY A;  4JI6 Q;  1HTP A;  4KTA A;  4G7O C;  4NP5 A;  2R82 A;  4F4W A;  2F4V Q;  3IN5 A;  4O3S A;  4WD3 A;  2F0W A;  4R7R A;  4IHJ F;  1VQG A;  1X54 A;  2XNA C;  4JI7 Q;  4GKK L;  3U9T A;  2R7Z B;  1VCI A;  2E74 C;  4AYB G;  4LH6 A;  4B3T H;  1N34 L;  1XX8 A;  4GN3 B;  1LAC A;  4DK6 C;  5IGD A;  3S1R H;  1Y1W B;  1B7Y B;  4IQZ A;  4MZ9 A;  1S68 A;  4HIO A;  1LT6 D;  4B3S Q;  1U4R A;  4LK1 C;  1PHJ A;  1MSG A;  2IX1 A;  1B9M A;  1DON A;  2HGS A;  3OHB A;  2W7O A;  3V6J A;  1JJC B;  2B39 A;  2P0A A;  1KRS A;  1HTL D;  4LF8 H;  4O1N A;  2QGQ A;  5ISR A;  4X3T A;  2VA3 A;  1FGB D;  1E3P A;  1VBG A;  1VQA A;  1QJO A;  5COR A;  4P74 A;  1D2B A;  2PMZ B;  1SXT A;  4XQN A;  3KF6 A;  4A3B H;  3ORQ A;  2PZT A;  5JH7 F;  1EIY B;  3K8A A;  2OCE A;  3K5O A;  5M3F B;  1NSN S;  3V05 A;  1R9T A;  1HHV A;  4LFC Q;  4EQ5 A;  3BVM A;  1B04 A;  2DPJ A;  4H7B A;  2UUA H;  3JAM W;  1STY A;  2KED A;  1K3R A;  3BYY B;  1XDN A;  4X62 Q;  1IKM A;  2EJM A;  4H13 C;  4IUT A;  3I4M H;  3DM1 A;  3PR5 B;  1EY6 A;  3QIA A;  1SNM A;  4QQB X;  4EBD A;  3HOZ B;  3S1N B;  3N44 B;  4ZI7 F;  5C44 H;  1W6K A;  1IBK L;  5BR8 Q;  4ZOL F;  5KFN A;  2WYO A;  1UAP A;  4JI2 Q;  2CZG A;  4DR5 Q;  1YJW A;  3OOC A;  1QE6 A;  4O0A A;  4GN5 A;  2HVQ A;  2J9G A;  4JI8 H;  2YZN A;  1TKW B;  4WOR A;  4HJ9 A;  3GD7 A;  4LW1 A;  4DN4 M;  4DNI A;  3GII A;  4XYL B;  4RGM A;  4PZ6 A;  3K58 A;  1IHZ A;  5KFG A;  4GOP A;  3NEN A;  3TRZ A;  5C4X B;  4LF7 L;  1BJT A;  3K7U C;  3HKZ B;  1M0T A;  4J9O A;  1STN A;  2YU9 B;  3IFD A;  5IYC H;  3CCL A;  5K36 G;  2J0T D;  5C3E H;  4NXM H;  3OUZ A;  4P73 A;  4O4I F;  1VMC A;  2CW0 D;  5M5W B;  1WJJ A;  5IYZ F;  1WTW A;  1X3E A;  1Y1V G;  4U67 3;  4LH7 A;  2Y0S E;  4JI1 L;  2ZT9 C;  2MP1 A;  3A8I E;  5FJ8 G;  4ZCK A;  1GOZ A;  5DQI A;  3CPF A;  4ODG A;  2FMC A;  4FNF A;  1MKH A;  3LML A;  3ZYY X;  3S9W A;  4A93 H;  1EZ8 A;  4O2D A;  1UE7 A;  4QL5 A;  2EOT A;  1RKN A;  1TWF B;  3MTS A;  1FD7 D;  5KX5 F;  4ED6 A;  1L0X B;  2F0H A;  1NCV A;  1I7N A;  1UEA B;  2JQO A;  2G9D A;  4CJ1 B;  3NGD A;  3PIO A;  3OYY A;  4QIW B;  3RZO H;  4C3I B;  1DGS A;  4GNX A;  4Q0F A;  3HOZ H;  3T56 B;  2RF4 A;  5EPL A;  2UXD Q;  3T1H H;  1FR3 A;  2J6T A;  4P71 A;  2WDT A;  3HEJ A;  1HA6 A;  4JOI A;  1I3Q H;  4K6D A;  4HJ5 A;  1ASZ A;  1N33 L;  1LTL A;  1XTC D;  1XWE A;  4YHH H;  3QJY A;  4YQW A;  2YS6 A;  1EIG A;  1HNW H;  2UXC L;  1C30 A;  5C0X J;  3WNZ A;  2FPG B;  2F0F A;  1BR9 A;  2FPI B;  4DR1 H;  4G57 A;  2R8J A;  1EYA A;  3SE7 A;  1S10 A;  1EYD A;  4YIJ A;  2KCM A;  4A4I A;  5M5W H;  1NMF A;  2NVX H;  3CCR A;  5IE8 A;  4A3G G;  1G6P A;  2VQF L;  4EBE A;  4LJZ C;  1CKN A;  2IA6 A;  1KD1 C;  1V1P B;  3J80 E;  2F0G A;  4RUA A;  4Z9C B;  2Q8I B;  4A3L H;  5KFS A;  2JA8 H;  4XQJ A;  3KDF B;  2NVT H;  1V4Y A;  3R23 A;  2UU9 H;  5KFE A;  2BCO A;  2W7P A;  1JR0 D;  3EA6 A;  1JX4 A;  1O7I A;  3RGX A;  2UXB L;  4R4T A;  2L9H A;  3J81 E;  3S14 H;  2K5Q A;  3GTP H;  5EQ0 A;  2YZG A;  1T9H A;  4KY5 A;  4XIG S;  4TSS A;  4AQY L;  1GM5 A;  3JSN A;  1H9S B;  4A3J B;  2RHS B;  3D3R A;  3VR2 A;  1J6Q A;  5J39 A;  2W57 A;  4PMB A;  3K7A H;  2EY1 A;  2AUJ D;  2JK8 A;  1RL2 A;  4EFE A;  5EPK A;  1OWT A;  3HGB A;  4UY8 C;  2JA7 B;  4APV A;  1ICW A;  1GXD C;  5CAE B;  1RD9 D;  3A55 A;  2B2W A;  5M5Y H;  2F3W A;  3TIN A;  3UDI A;  1HUM A;  4LF9 H;  1LT3 D;  4DR7 H;  3HB9 A;  4RB3 C;  3OHX C;  1VBH A;  1K83 H;  1C7Y A;  2L1B A;  2VQE Q;  5DM7 3;  3T53 B;  4HJA A;  2ZTC A;  3GIK A;  1CE8 A;  2N55 A;  2K50 A;  4OIJ A;  2E5L Q;  2W70 A;  3DWQ A;  1J8I A;  1RJP A;  3BJY A;  1SNQ A;  1LTS D;  1M8A A;  3CCJ A;  2XIG A;  5KFJ A;  3QZ8 A;  4C2M B;  3W5O A;  4YAK B;  3GTK H;  5ELO A;  4ECV A;  5KFQ A;  2VPS A;  1PMR A;  4LMQ D;  1DD2 A;  5ELB A;  5E7N A;  1JOO A;  2IT1 A;  1S5F D;  2WIN B;  3WDN A;  1D7Q A;  5I9P A;  3UE1 A;  4L5R C;  4PZ7 A;  4BBR G;  3G6E A;  2V4Q A;  1NTG A;  2ES2 A;  3SK5 A;  5C8Y F;  4YCU A;  2FKL A;  4KHZ A;  2KCT A;  5KFP A;  2I8C A;  3G7L A;  2CW0 C;  2MCT A;  1O7L A;  2XRS D;  2UVU A;  4LUO A;  3N8D A;  4IR9 A;  4PZ8 A;  4UDU C;  2MUY A;  1TWC B;  2WE6 A;  1NMG A;  2EVB A;  3W2D A;  5GAG C;  1E24 A;  4KD4 A;  2VQD A;  4RWS C;  3OWF A;  1IBL L;  4DL6 A;  4KLK A;  5JJZ A;  1KEE A;  3HOV H;  1KNE A;  2MFI A;  3V96 A;  5KFZ A;  2KUM A;  4DV4 H;  5ELE A;  3IKJ A;  4XXE A;  3CCS A;  1JJ2 A;  1T36 A;  4R4I A;  5CV6 A;  1GHJ A;  3HOU H;  1BBW A;  2PQA B;  3ONA B;  3H91 A;  5KEE A;  2VA2 A;  1FGU A;  2L12 A;  2XGP A;  2ZM6 L;  3Q22 A;  4MTN A;  3GTO H;  1JDE A;  3BDL A;  4DUZ Q;  3KAK A;  3GTJ B;  2ZDQ A;  1GSA A;  3MJF A;  3J81 j;  2GPS A;  4NLG A;  1TWG H;  2A74 C;  1CSP A;  2IW3 A;  5KGU A;  3NUC A;  5JVH 3;  1D1I A;  1PTO F;  2R92 H;  4A3E B;  4GKK H;  2IX0 A;  4J9Q A;  4EVO A;  2JEF A;  3FKI B;  1TWH B;  2OTJ A;  1LLR D;  1N34 H;  4OGQ C;  3KFU A;  2YRX A;  1V1Q A;  2B8G A;  4KMU C;  1TS4 A;  1YZ6 A;  4C3H B;  2SOB A;  4HCE A;  3NTH A;  5KFX A;  3JAM c;  2XSC A;  2F0P A;  2IWH A;  3FHW A;  4OXP A;  1DM0 B;  1W6J A;  5KFO A;  4CJ0 B;  4H0L C;  2D0O A;  1XTD A;  2V4D A;  5ELC A;  2N49 A;  5LMN L;  3J80 W;  3DEO A;  3LGJ A;  1N48 A;  3M85 A;  1C3O A;  5CV7 A;  1E1T A;  4YB8 B;  4I7A A;  4JC0 A;  5FK9 C;  4TQR A;  3BDO A;  2B2Y C;  3MR2 A;  4DAY B;  3CHB D;  3HKZ E;  3I91 A;  4CKC A;  3HOX H;  3RAQ A;  1H95 A;  3HG9 A;  3J81 W;  4EQN A;  1BF4 A;  1PK8 A;  4IAJ A;  3TQY A;  5CGK A;  4LMY A;  1SE4 A;  3DMU A;  3V6H A;  2L0C A;  5JVG 3;  1KTK A;  5AFW A;  2F4I A;  4LF6 Q;  3GV6 A;  1LTG D;  2NVQ H;  1EZ6 A;  5I9O A;  3EPG A;  3RN5 A;  1BCP D;  4XYM B;  2I5H A;  1EY5 A;  3VPC A;  1AEX A;  3BG5 A;  3TEH B;  3RUP A;  4J8Q A;  4RB1 A;  4OL7 A;  1PRT F;  3MA2 B;  4DLK A;  1IBK H;  1EY4 A;  4IWX A;  3L0O A;  1K28 A;  3GTG H;  4UCR A;  4U6P A;  4R4Q A;  2RCF A;  1CS0 A;  1Y8N B;  1AFP A;  1U4M A;  2GA4 B;  1S5E D;  3Q24 A;  5LMU L;  2W9B B;  4BWS C;  5T1G A;  1I94 L;  4IRD A;  1HH2 P;  4QIW E;  1A2T A;  2AU0 A;  2R93 H;  1ET9 A;  4JI5 L;  3A5U A;  4GC6 A;  4J6H A;  5IP9 G;  5EKK A;  3SK8 A;  3CCM A;  3Q8S B;  2KA7 A;  3FMC A;  5D65 A;  1IYU A;  4LF7 H;  4J9N A;  1DYQ A;  2VXW A;  1B50 A;  1WTV A;  3H0G B;  3K6O A;  1F2Y A;  4OWT B;  1ENF A;  5KFM A;  3BZC A;  5KFW A;  1SFO H;  2NZ1 D;  3GTL A;  2CCZ A;  4N9P A;  2F1M A;  4JI3 Q;  3R93 A;  4ME6 A;  1A8V A;  2JEJ A;  4ZKB B;  3CCV A;  5CB4 F;  1CI3 M;  2PNH A;  4JI1 H;  4DR2 L;  4NPS A;  2FJ2 A;  1OXU A;  1JC7 A;  2LSS A;  4IUP A;  4POG A;  3QZ7 A;  1U0L A;  1WTO A;  3M3Y H;  3HBL A;  1IYJ B;  4WJW A;  2W9C B;  4A3D H;  2DJG C;  5K2M A;  2VR1 A;  2VPQ A;  1S5B D;  4HAE A;  4QMG A;  2VOB A;  1FJG H;  1I50 B;  1AH9 A;  2WAQ E;  4DK3 C;  5GAD C;  3ITP A;  4HNT A;  4UP8 A;  4IZ8 A;  3HRZ C;  3MWY W;  1UUP A;  3MXG A;  2B2U A;  2JA6 H;  4A3C H;  1YJ9 A;  4XTC S;  2CW8 A;  1IW7 D;  4Y8V B;  4LFB L;  4HNU A;  1TS5 A;  1Q82 C;  1OXX K;  1PYS B;  3UI2 A;  4JBW A;  1VQ5 A;  5KFT A;  5BPF A;  5DLG A;  1N33 H;  5KFL A;  1SNP A;  2YYZ A;  1AN7 A;  2NZH A;  3I7F A;  4JI4 Q;  3RF2 A;  1C4Q A;  4F4Z A;  1LTT D;  3RNU A;  1CQI B;  2VZA A;  2A69 D;  4LFA L;  4KHP L;  4RCO A;  2UXC H;  1G91 A;  4X65 L;  1QZG A;  2IBK A;  4Q43 A;  2FB9 A;  1NBW A;  4PMW A;  1XMO L;  1ESR A;  3M7G A;  4DK1 A;  1HR0 W;  4BY7 G;  2FK3 A;  1HNX L;  1S0M A;  1VF7 A;  4FU0 A;  1GYF A;  4NXN L;  4G3I A;  3NHH A;  4MA5 A;  2VQF H;  3A8K E;  2BOS A;  2B63 B;  1DOK A;  3G71 A;  4A3K B;  1BBX C;  2XRQ D;  5KFR A;  3CCE A;  2Z1C A;  1G8Z D;  5LL6 b;  5M3M B;  4IFD I;  3RLF A;  4IFD G;  1FNU A;  4ECX A;  4DU9 A;  1BKB A;  3S17 H;  5HGT A;  5KT5 A;  4KN7 C;  4MV7 A;  1C9O A;  1A3T A;  3OHA A;  4YJ3 F;  4B08 A;  2F0S A;  4QW8 A;  2C28 A;  2UXB H;  1H9J A;  2RKS A;  3PIO 3;  1WD1 A;  3AQQ A;  4GS3 A;  4A3M G;  1JB7 A;  2F0U A;  4AQY H;  4L63 B;  2F0E A;  4IOC A;  2JA5 B;  1EUD B;  2EYL A;  4ZKC B;  4Q8E A;  1KHI A;  1WCM H;  1LT4 D;  4HCS A;  4I55 F;  4RNM A;  1F9P A;  1G51 A;  2EPB A;  1MI2 A;  2H1E A;  1XPO A;  4JYA H;  1WYD A;  1CM9 A;  3ULL A;  5CMD A;  2JEI A;  2R7Z A;  3FRP B;  3PO2 B;  1HUN A;  4C3J H;  1B6R A;  2IP4 A;  2R8G A;  3IG0 A;  5JJK A;  2JJQ A;  2BE5 D;  5M5X B;  3RIZ A;  3N52 A;  1WI5 A;  1Y1W A;  2UUC Q;  3LP8 A;  2NBF A;  3Q23 A;  1YI2 A;  5J2T F;  2JA9 A;  1FYC A;  4IPC A;  5M9O A;  3GIP A;  3TII A;  4MAM A;  3DWP A;  1TS2 A;  4DV2 Q;  5TSS A;  4F7X A;  1VQK A;  4Q44 A;  1ZYR D;  3AEV A;  1PH7 A;  2WB1 B;  4LAA A;  3PO3 B;  2E2I B;  5LP6 F;  5GAE C;  2K04 A;  4O2A F;  1YIT A;  3S2H B;  4G7H C;  1WTR A;  4ECZ A;  5CC4 A;  1KJI A;  2FHT A;  2MHV A;  5FLM G;  5DG9 A;  2EXZ A;  3G4S A;  2VUM H;  2UVW A;  2FPP B;  3QB3 A;  4IPD A;  2EE1 A;  4YWL A;  2A68 D;  1VMP A;  4QWC A;  4BXX H;  1DOM A;  2ZDG A;  5HV6 A;  4BBS B;  3W1B A;  4JI6 L;  2OEO A;  1B1Z A;  1P8L A;  1VDZ A;  1TWA B;  2F4V L;  2RQX A;  1ML0 D;  4RHS A;  5EWG A;  1E22 A;  2X6G A;  1IOW A;  4JI7 L;  2MPM A;  4EBC A;  1IBL H;  1GO3 E;  3SDZ A;  3K80 C;  5IGC A;  3SE0 A;  2RCN A;  5DGA A;  1O7Z A;  3UDG A;  1HNZ Q;  1G6Z A;  1ESF A;  3HOY G;  2E2H H;  4B3S L;  4BY1 H;  1B33 N;  2QF7 A;  3H3V C;  5CV5 A;  3CRK C;  2ZM6 H;  3MXN B;  1STG A;  4MIU A;  5CYU A;  4DV0 L;  2Y0S G;  1PTO B;  4DKA C;  2Z4I A;  3EYY A;  3S24 A;  3H4D A;  3HKZ A;  3V4Z A;  3J80 c;  2W6P A;  1IW7 C;  5JOB A;  3CW2 C;  2WKC A;  3NQT A;  3SXH A;  3PF4 A;  2J6U A;  2YU9 A;  2C00 A;  1I4G A;  2YV5 A;  3HOW H;  1IZ6 A;  2OT2 A;  1STH A;  4LFC L;  2B3G A;  1GVP A;  3S2H H;  1EWH A;  5IY0 A;  2A69 C;  4IAL A;  2CQO A;  3CP0 A;  3KLS A;  5IYD H;  2YL2 A;  4X62 L;  3GO5 A;  4UCU A;  3GTM H;  3TME A;  1K0S A;  3E5S A;  3SK6 A;  1TR5 A;  3CQZ H;  1SN8 A;  2Z0S A;  1WVL A;  1HZB A;  1CQJ B;  5LMN H;  4EYH B;  4IR1 A;  1TWF A;  1RYS A;  1VQJ A;  5LL6 X;  5BR8 L;  1LYL A;  4HJ7 A;  3P7J A;  1AZP A;  4JI2 L;  2W6Z A;  2CFM A;  1HQR D;  3ND8 A;  5IP7 H;  4A3F H;  1FNW A;  4QIW A;  1TQO A;  5BN5 A;  5CA0 F;  4DR5 L;  1BNZ A;  2FP4 B;  1KNA A;  4ECW A;  1TS3 A;  4DUY Q;  1KRT A;  3M4Q A;  3VYS A;  3I4N H;  2JEB I;  2AGO A;  1YNX A;  2O2L D;  3VYT A;  4F88 A;  5BN3 A;  1AZQ A;  2YCH A;  3MAQ A;  1IOV A;  2PQE A;  1FNV A;  3ERO A;  4K8J A;  3S1R B;  4TV9 F;  2CHB D;  4DXG A;  5BPH A;  1PRT B;  1F2M A;  1EY9 A;  1MZB A;  3I4O A;  4PMC A;  2JXM B;  1NE3 A;  2XVS A;  4RMF A;  4XZ3 B;  2EYO A;  1SYE A;  5D14 A;  3D4W A;  1EY8 A;  2FIN B;  4L6T B;  3TP6 A;  2D9U A;  2W8L A;  1EYZ A;  1W3S A;  5LMU H;  3WOE A;  2BQU A;  5D8D A;  3X3N A;  4A3B B;  5DG7 A;  3TS0 A;  2PPB C;  2HCC A;  1I94 H;  2XTI A;  1KC8 C;  3K5H A;  1EYC A;  3HXL A;  2B29 A;  4HR7 B;  2BE5 C;  4JI5 H;  2K52 A;  4YBZ B;  1V1P A;  2CWP A;  5KFV A;  5KG2 A;  2QIL A;  3F2U A;  4UPA A;  3KDF A;  4QJF A;  1ET6 A;  2ATW A;  5C0X I;  5C0X G;  1QVF A;  1VQ4 A;  4ZAI A;  3I4M B;  3TS2 A;  4XT1 B;  4L5S A;  4MV6 A;  3BA8 A;  4I7H A;  2UXD L;  2ZXR A;  3D6C A;  4YY3 Q;  5C44 B;  3PQI A;  1A2U A;  4CJ2 C;  1PZJ D;  1SE2 A;  4DR2 H;  1H9S A;  3J7A K;  1BO0 A;  3I4L A;  1HR0 Q;  4FBT A;  2Z8L A;  4MHE A;  3OW7 A;  5KT6 A;  2QCP X;  3CAM A;  3S1M H;  1WOC A;  4O2B F;  2A68 C;  2JA7 A;  5FPR A;  1VQI A;  4TVA B;  2K4K A;  4N8F A;  2WFW A;  1W93 A;  1CFM A;  4DV6 Q;  2FMA A;  4O3N A;  4POF A;  4RUC A;  2EXD A;  3VYU A;  3PW2 A;  1L2Z A;  1BUV T;  4EG0 A;  2ZXP A;  4DV0 Q;  1I5F A;  2K6A A;  1VQE A;  4DV3 L;  5IT9 E;  2UVR A;  1ZHQ A;  4RB0 A;  2DNE A;  4PG3 A;  5C3E B;  3BS1 A;  4LFB H;  3VR6 A;  4C2M A;  1HA5 A;  5FD5 A;  3H40 A;  4S3S A;  1PA6 A;  3ULP A;  3G6X A;  5KG6 A;  4Q8F A;  1S03 G;  2WAC A;  3E6Z X;  3U4Z A;  1Y1W G;  3TRE A;  5KG4 A;  4LFA H;  4KHP H;  2RDH A;  3RD4 A;  5JEA J;  1XNQ Q;  4GOP C;  3U9S A;  1Z2O X;  3F8N A;  1X6O A;  5DM6 3;  4A93 B;  4X65 H;  5C3W A;  5L1I A;  5I6W A;  1NR4 A;  1EUC B;  4M9U A;  1EFI D;  1XMO H;  3Q0A A;  2W6Q A;  3SI8 A;  4UP9 A;  1QUQ B;  5IYB G;  1VQ9 A;  1KC7 A;  5J2U F;  3RZO B;  1HNX H;  4NXN H;  5E4W C;  3I12 A;  2QKI C;  3PUZ A;  3OPO A;  3P1H A;  4DGZ A;  3C2P A;  1I7L A;  2EIF A;  1TWC A;  4RNN A;  1JIC A;  1HZ9 A;  1G2S A;  2NTS A;  5IOC A;  4YR2 A;  1BDO A;  4QWB A;  1Q1B A;  2ALZ A;  5FOB B;  1SDF A;  2K05 A;  2MJ8 A;  1BVS A;  1I3Q B;  2A1A A;  2NU8 B;  4N9T A;  2XCP A;  5C4J H;  5H1S E;  4HID A;  2WB1 E;  2VQE L;  2W6M A;  2PQA A;  2K5W A;  1PDQ A;  2E5L L;  2L5T A;  2NZO A;  1S40 A;  4GNX C;  1SYC A;  3DM3 A;  4X64 Q;  2G9H D;  1XJV A;  2YW2 A;  3JRX A;  1SE3 A;  1HZC A;  3BZK A;  1STA A;  3GTJ A;  1EOV A;  2K14 A;  5BMV F;  3PMF A;  3UQ8 A;  1CA5 A;  2HVS A;  3HZX A;  4JOI C;  4DAV A;  1A63 A;  2NVX B;  2DJF C;  1F2L A;  4UP7 A;  4DV7 Q;  1KJ8 A;  3TZD A;  5LOV F;  3C0F B;  4O3Q A;  3FKI A;  3AYH B;  1TWH A;  1JLL B;  1N32 Q;  3EPI A;  1AUV A;  5GRO A;  3S2D H;  2PVP A;  2JA8 B;  4JG2 A;  4FF1 A;  4RB2 C;  3N6R A;  2NVT B;  1I4Q A;  4LWC A;  2CWA A;  3HKZ G;  5FKA C;  3NXW A;  1VQF A;  1N36 Q;  3S14 B;  1STB A;  4JI0 Q;  3GIQ A;  3ER0 A;  3GTP B;  5IGE A;  3PV0 A;  3VA5 A;  3V4S A;  1Q1E A;  1GSH A;  4DV1 Q;  3K57 A;  5KT4 A;  3KHH A;  1FKA H;  2EYM A;  3BJU A;  5C1P A;  3RR5 A;  3K7A B;  4DAY A;  2R7N A;  3KUP A;  4EEY A;  5I2Y A;  1EFW A;  2FK2 A;  2ENB A;  2KQ3 A;  3DF7 A;  1L1O B;  3U58 A;  3N41 B;  3H3V I;  5CV4 A;  3P75 A;  5M5Y B;  4PNY A;  3JAM L;  2KCN A;  1BXT A;  5GON F;  2KEC A;  1K83 B;  4DUZ L;  4K14 A;  3WOF A;  4ZHQ F;  3Q8P B;  4JI6 H;  4LF4 Q;  3FPP A;  4C3I G;  2F4V H;  1IBM L;  3EVQ A;  3IAY A;  2JEG A;  1Z7T A;  3PIP A;  2IPK D;  5K36 H;  4JI7 H;  3OIQ A;  1B53 A;  1SMX A;  5CBA E;  4DV3 Q;  2ATL A;  1Y1V H;  3BAA A;  1CUK A;  3GTK B;  1XMQ Q;  2W71 A;  2B2W C;  5FJ8 H;  4B3S H;  3HP3 A;  1PXU A;  2W9B A;  3RGZ A;  3H20 A;  5IT9 W;  3STB C;  3MR5 A;  1Q46 A;  2ICI A;  4BWG B;  2R85 A;  1CZG A;  1YHB A;  2NVY H;  3L9A X;  4DV0 H;  1TU2 B;  4K5W A;  1VQL A;  3S1Q H;  4MV8 A;  4LSX A;  1TAE A;  2OH2 A;  1PX2 A;  1RCV D;  1ASY A;  5EBD A;  3H0G A;  5L9X A;  4DNR B;  1XYI A;  2E2J H;  4OO1 G;  4OO1 I;  4OX9 Q;  1DZ1 A;  4LFC H;  4XT3 B;  3RB4 A;  3CMA A;  2WAQ G;  2R6G A;  2JN4 A;  1UWV A;  1IXR A;  2FXQ A;  3HOV B;  5IWA Q;  4LF6 L;  4X62 H;  2AUK A;  3NBH B;  3ULJ A;  1LUZ A;  5E1F A;  2PZU A;  4YJ2 F;  3ND9 A;  1HXY D;  3HOU B;  2W9C A;  3EFX D;  1B3Q A;  1S3O A;  5A2Q E;  2CVR A;  3BYT B;  3PF5 A;  3K3P A;  4IUV A;  3VYR A;  1HQM C;  1VQN A;  5BR8 H;  3GTO B;  1A62 A;  4JI2 H;  1I50 A;  2M00 A;  4A3J G;  4ZQ3 A;  1A3U A;  4RGT A;  3SGI A;  1TWG B;  5JVL A;  4DR5 H;  3MWD A;  3T4A C;  3F1Z A;  1JE5 A;  3ICE A;  2R92 B;  4A3G H;  2JA7 G;  2D62 A;  1ILP A;  1SEB D;  4MTE A;  4O3O A;  3CVZ A;  4HQ6 A;  4G4K A;  4A2A A;  3IFT A;  3MXU A;  3UDX A;  5T14 A;  4CGY B;  1KDA A;  5C4H A;  2FLL A;  3QWN A;  3A8J E;  1H9K A;  2C5C A;  3KBX A;  4KHV A;  4RKB A;  1MSH A;  4JI3 L;  1BXR A;  3OMG A;  2XWJ B;  2V4R A;  1U5K A;  5KNC A;  3JSL A;  3TDQ A;  3E0E A;  1EZ1 A;  1EQR A;  4ECT A;  4B3R Q;  1MBY A;  1S5C D;  2OXP A;  5KG0 A;  5DGB A;  2B63 A;  4K2L A;  5KFU A;  3J80 i;  3HOX B;  3N43 B;  3BDC A;  3Q8D A;  4GKJ Q;  4J9M A;  1UE5 A;  2NUA B;  2EY2 A;  1HCZ A;  2PMZ E;  5I6Y A;  2I0Q A;  4Y7N H;  3GTQ H;  4C1N I;  2NVQ B;  3J81 i;  4YP3 A;  1OO9 B;  1PH8 A;  4DR3 Q;  4K2K A;  1E2V A;  2SNS A;  1LTI D;  4ILW A;  2UXD H;  1PYW D;  2BH8 A;  2I07 B;  4FO2 A;  2D2C C; 
#chains in the Genus database with same CATH homology
 4B3R L;  4NXN L;  1IBM Q;  4ME3 A;  5M3F H;  1PFS A;  3G71 A;  4P72 A;  4JI4 L;  4WJ3 M;  2OWO A;  3CCE A;  4GKJ L;  4IFD J;  2HIX A;  4IFD I;  3RLF A;  3NEL A;  1VQ7 A;  4A3L G;  4IFD G;  1QVC A;  4X66 L;  1BKB A;  2JA8 G;  2H5X A;  1PH5 A;  3A0J A;  3S17 H;  3U50 C;  3EN2 A;  3DLL A;  1EQQ A;  1PH6 A;  1C9O A;  2RHQ B;  4DV4 Q;  2WP8 J;  2PI2 A;  4DR3 L;  3ICE A;  3VDY A;  4BBR H;  3CME A;  1FJG L;  1SRO A;  5J3B A;  4MNO A;  1GD7 A;  3AQQ A;  4BA1 I;  4GS3 A;  4A3M G;  1JB7 A;  4AH6 A;  2YTV A;  1EYG A;  3S1N H;  4HIM A;  2R7F A;  2VNU D;  3PCO B;  3KOJ A;  4RG1 A;  2KBN A;  1FL0 A;  4IOC A;  4JV5 Q;  4A3E G;  4GN4 B;  1R9T H;  1KHI A;  2ALY B;  2C35 B;  3FKI G;  3MEF A;  4GLV B;  1WCM H;  2N78 A;  1P16 A;  4OWX B;  1G51 A;  3IRB A;  1XPO A;  2ZTE A;  2N8N A;  1WFQ A;  1WYD A;  3F8T A;  3ULL A;  4GKK Q;  1OXT A;  5ELN A;  4C3J H;  4A76 A;  3KF8 B;  1SRU A;  2D0P A;  1EWI A;  5JJK A;  4DV4 L;  2JJQ A;  3PGZ A;  1N34 Q;  1WI5 A;  3CC2 A;  2UUC Q;  3RN2 A;  1X55 A;  4R4O A;  5C4X H;  1YI2 A;  2YU9 H;  4IOA A;  4GLX A;  4BA2 I;  1VQH A;  2JA9 A;  4JV5 L;  4IPC A;  2AWO A;  3M9B A;  4JI6 Q;  4DV2 Q;  1VQK A;  2L15 A;  2F4V Q;  1X9N A;  3AEV A;  2HHH Q;  1A0I A;  1PH7 A;  3CXC A;  1VQG A;  1B70 B;  1OXV A;  1X54 A;  5GAE C;  1YIT A;  4JI7 Q;  4GKK L;  4WJ4 A;  1V43 A;  2MNA A;  1VCI A;  4AYB G;  3UE0 A;  1N34 L;  1PV4 A;  5FLM G;  1RIP A;  3G4S A;  4B3M Q;  2VUM H;  4GN3 B;  4DK6 C;  2UUC L;  3S1R H;  4IPD A;  1B7Y B;  4MZ9 A;  1EIF A;  4HIO A;  4B3S Q;  3F2B A;  1SE8 A;  2ZTD A;  1TXY A;  1NJI C;  4YWL A;  1PHJ A;  2IX1 A;  1TWF H;  4BXX H;  2Z6K C;  1Q86 C;  1JJC B;  3M4O H;  1KRS A;  1KAW A;  4DV5 Q;  2QGQ A;  2VS1 A;  3W1B A;  4JI6 L;  4LF5 Q;  4C3I H;  1P8L A;  4DV2 L;  2F4V L;  1E3P A;  2HHH L;  1VQA A;  3HKS A;  1X3G A;  1E22 A;  2ZJR A;  4JI7 L;  4P74 A;  3F2D A;  1GO3 E;  3KF6 A;  3K80 C;  2KHI A;  2AMC B;  3RZD H;  1IBK Q;  1EIY B;  2RCN A;  2OCE A;  3K8A A;  4A3B H;  3HOV G;  1HNZ Q;  2Q2H A;  3UDG A;  3H3V H;  4BY7 G;  4LFC Q;  4EQ5 A;  4B3M L;  3HOY G;  2E2H H;  4JYA L;  1SR3 A;  4B3S L;  4BY1 H;  3HOU G;  3S15 H;  3BU2 A;  1QZH A;  1K3R A;  3MXN B;  3PUY A;  4X62 Q;  4DV5 L;  4DV0 L;  1E7Z A;  2Y0S G;  3H0G G;  4LF5 L;  5LMN W;  3OTO Q;  4DKA C;  3I4M H;  4AYB E;  4IO9 A;  2Z6K A;  3S24 A;  4LF7 Q;  4QQB X;  2IY5 B;  1XNR Q;  3J80 c;  4ALP A;  5C44 H;  3CW2 C;  4P75 A;  5BR8 Q;  1IBK L;  3KF6 B;  3PF4 A;  2YTX A;  4JI2 Q;  4OWW B;  2DUD A;  1HNZ L;  2R92 G;  2YV5 A;  4TQU S;  1IZ6 A;  4LFC L;  4DAM A;  3HOW H;  4DR6 Q;  5IYB H;  4DR5 Q;  2B3G A;  1YJW A;  1GVP A;  3S2H H;  4O0A A;  4GN5 A;  4YWM A;  5IY0 A;  1OTC A;  4JI1 Q;  2CQO A;  1YIJ A;  2QA4 A;  3CP0 A;  5IYD H;  4HJ9 A;  3GD7 A;  4LW1 A;  5IT9 c;  1FVI A;  4DNI A;  2MQH A;  5IP9 H;  3GO5 A;  4X62 L;  4LUV A;  3GTM H;  3OTO L;  3CCQ A;  4PZ6 A;  3CQZ H;  2A19 A;  4X66 Q;  4HIK A;  1SN8 A;  2Z0S A;  3NEN A;  2NN6 I;  1HZB A;  2NN6 G;  3K7U C;  4GOP A;  4LF7 L;  1MIU A;  1XNR L;  3TRZ A;  1VQJ A;  2EQS A;  5BR8 L;  1LYL A;  3WWV A;  5IYC H;  4HJ7 A;  3CC4 A;  4JI2 L;  1FJG Q;  3CCL A;  2CFM A;  5IP7 H;  4A3J H;  3NEM A;  5C3E H;  4A3F H;  2BA0 A;  4DR6 L;  3L7Z C;  4P73 A;  4DR5 L;  1WJJ A;  1X3E A;  4DUY Q;  1Y1V G;  1KRT A;  1D8L A;  2Y0S E;  3M4Q A;  1J5E Q;  3I4N H;  4JI1 L;  3HOX G;  2JEB I;  1L0W A;  2JA7 H;  5FJ8 G;  1YNX A;  3CPF A;  4LNQ A;  1MKH A;  1W2B A;  1KQS A;  5JJI A;  1N33 Q;  4A93 H;  4DR4 Q;  3PSI A;  4GOP B;  4O2D A;  1UE7 A;  4QL5 A;  3I56 A;  3I4O A;  2V1C C;  2K5N A;  1NE3 A;  3T1Y L;  4RMF A;  2JQO A;  3A5Z B;  2UXC Q;  1K73 C;  3PIO A;  3E9H A;  3OYY A;  1VQP A;  1NY4 A;  3A74 A;  1DGS A;  1YHA A;  5GAH C;  4GNX A;  4IJL A;  2UUB Q;  3RZO H;  3HOZ H;  1KL9 A;  4C2M H;  4DUY L;  2RF4 A;  1J5E L;  1W3S A;  2B63 G;  2UXD Q;  1LM0 A;  4A3K G;  4P71 A;  3RLN A;  3EBE A;  3H15 A;  3I55 A;  3TS0 A;  4A3I G;  2XTI A;  1KC8 C;  3OW2 A;  1VQ6 A;  4Y52 H;  4JOI A;  2B29 A;  5M3M G;  1I3Q H;  2VQF Q;  4HJ5 A;  1ASZ A;  1BBU A;  1N33 L;  1LTL A;  2K52 A;  4R4C A;  4DR4 L;  3KLW A;  4DPG A;  2GVA A;  2R93 G;  2HQL A;  3M4P A;  2CWP A;  1YEZ A;  4UPA A;  2XGT A;  3KDF A;  4QJF A;  2I5M X;  2UXC L;  1AE2 A;  5C0X J;  2UUB L;  2ATW A;  5C0X I;  5C0X G;  4GNX B;  1QVF A;  1VQ4 A;  3ZJY C;  3TS2 A;  2JA5 G;  4L5S A;  2UXB Q;  1TWC H;  1YJN A;  1MJE A;  2UXD L;  4BY7 H;  4YY3 Q;  2Q2T A;  1K0R A;  2KCM A;  4A4I A;  1YBY A;  1NMF A;  5M5W H;  4AQY Q;  3CCR A;  2NVX H;  5IE8 A;  1HR0 Q;  2LXK A;  2VQF L;  2F52 A;  4A3G G;  1CKN A;  1G6P A;  3D0F A;  2HIV A;  3F2C A;  3K81 C;  1S72 A;  2ZJP A;  1KD1 C;  3PO2 G;  3CAM A;  1C0A A;  3S1M H;  1WOC A;  1Y14 B;  1YVC A;  4A3L H;  4A3D G;  1I6H H;  1VQI A;  2JA8 H;  4TVA B;  2K4K A;  4JYA Q;  3KDF B;  2WFW A;  1Z47 A;  2NVT H;  4K0K Q;  4DV6 Q;  4POF A;  1O7I A;  2UXB L;  2EXD A;  4R4T A;  3S14 H;  1PH2 A;  3GTJ H;  4NB3 A;  4YY3 L;  4A3M H;  4DV0 Q;  4KI0 A;  3GTP H;  1I5F A;  1GKH A;  1VQE A;  4DV3 L;  1T9H A;  4XIG S;  4AQY L;  1N8R C;  1GM5 A;  2JA6 G;  4A3C G;  3J7Z C;  4PG3 A;  1QUQ A;  4JBJ A;  1SLJ A;  2RHS B;  2WB1 G;  1HR0 L;  2K5H A;  1Z9F A;  4A3E H;  1CKN B;  3PO3 G;  1X65 A;  4FDB A;  1J6Q A;  3FKI H;  4A3I H;  1TWH H;  3K7A H;  3AFP A;  2JK8 A;  1RL2 A;  1PA6 A;  3ULP A;  4UY8 C;  2JEA I;  4APV A;  4C3H H;  3U4Z A;  1Y1W G;  3CCU A;  4K0K L;  3TRE A;  5M5Y H;  4DV6 L;  3CD6 A;  5JEA J;  1UE1 A;  3UDI A;  2KHJ A;  4GOP C;  1XNQ Q;  4A75 A;  4B3T Q;  1X6O A;  3RLO A;  5JEA G;  4YHH L;  1K83 H;  1C7Y A;  4BBS G;  1UEB A;  5AJ3 Q;  4J15 A;  2BH2 A;  2AKW B;  2VQE Q;  1Q12 A;  1X56 A;  4HJA A;  1HJP A;  2ZTC A;  4LUZ A;  4JBM A;  2K50 A;  2E5L Q;  3S16 H;  4UP9 A;  1QUQ B;  1L2F A;  5IYB G;  1VQ9 A;  2PI2 E;  1G29 1;  4LF8 Q;  4YCV A;  4EX5 A;  3CCJ A;  3PUZ A;  3U4V A;  2F3I A;  3W5O A;  2EIF A;  1HZ9 A;  3GTK H;  2GN5 A;  5ELO A;  1Q8K A;  1MJC A;  1IBL Q;  1Q1B A;  4JBK A;  4OON A;  1XNQ L;  1BVS A;  2A1A A;  5E7N A;  5FLM H;  4B3T L;  2I5L X;  2IT1 A;  2GVB A;  5C4J H;  5AJ3 L;  5H1S E;  4HID A;  1D7Q A;  2WB1 E;  2VQE L;  2UUA Q;  2PQA A;  3UE1 A;  4L5R C;  4PZ7 A;  4BBR G;  3G6E A;  2E5L L;  1NTG A;  2ES2 A;  2NZO A;  1S40 A;  4GNX C;  2ZM6 Q;  4YCU A;  3DM3 A;  4KHZ A;  2KCT A;  4LF8 L;  4YCW A;  4X64 Q;  1XJV A;  1K8A C;  4L5T A;  2K75 A;  4LUO A;  3BZK A;  1HZC A;  4PZ8 A;  3T1Y Q;  1NMG A;  1CSQ A;  1EOV A;  2K14 A;  5GAG C;  2OQ0 A;  2OTL A;  1E24 A;  3ERS X;  1IBL L;  1WCM G;  4JOI C;  1A63 A;  4UP7 A;  4KLK A;  4DV7 Q;  3HOV H;  2MFI A;  1VQM A;  3HOY H;  2OQK A;  3AYH B;  1VS0 A;  1N32 Q;  4R1J A;  3CCS A;  1JJ2 A;  2UUA L;  5GRO A;  4R4I A;  3S2D H;  2KEN A;  3HOU H;  4IPG A;  1BBW A;  2ID0 A;  2PQA B;  1FGU A;  4JG2 A;  1L1O A;  3E9I A;  4JI8 Q;  4GLA C;  2ZM6 L;  4LWC A;  2CWA A;  4MTN A;  3H0G H;  4X64 L;  3HKZ G;  1UE6 A;  3CF5 A;  3GTO H;  3AFQ A;  1VQF A;  4DUZ Q;  1N36 Q;  4JI0 Q;  3ER0 A;  3J81 j;  1TWG H;  2JE6 I;  3PV0 A;  5LMN Q;  1CSP A;  1Q1E A;  2AWN A;  4DV7 L;  2R92 H;  4DV1 Q;  1K9M C;  1HZA A;  1X3F A;  2IX0 A;  5HGQ A;  3BJU A;  3W1G A;  4NXM Q;  3RR5 A;  1N32 L;  2OTJ A;  3UDF A;  1VQ8 A;  1KIX A;  5JJL A;  3CC7 A;  3KFU A;  1V1Q A;  2HT1 A;  1EFW A;  2VUM G;  2IHF A;  1YZ6 A;  4JI8 L;  1L1O B;  3U58 A;  2MO1 A;  3H3V I;  3JAM c;  3CPW A;  3FHW A;  1PH9 A;  2YTY A;  4OXP A;  4BXX G;  2VL6 A;  3M7N A;  1I50 H;  4DUZ L;  1N36 L;  2N3S A;  4JI0 L;  3GTL H;  4LF4 Q;  2D0O A;  1XTD A;  5LMN L;  3I2Z A;  2N49 A;  1IBM L;  2Q2U A;  1KXL A;  1XPR A;  3LGJ A;  3PIP A;  5K36 G;  3JAM i;  3M85 A;  4DV1 L;  2VY3 A;  4JCV E;  1QVG A;  1SMX A;  4NXM L;  1E1T A;  4JC0 A;  2AHO B;  3G48 A;  3PUX A;  4IPH A;  4DV3 Q;  4A3B G;  1Y1V H;  2QEX A;  4DAY B;  1CUK A;  3HKZ E;  2R7D A;  3HOX H;  1XMQ Q;  1H95 A;  5FJ8 H;  3T1H Q;  5LMU Q;  3HFZ B;  5EAY A;  1JMC A;  3TQY A;  5FLX c;  1XPU A;  4BY1 G;  1I94 Q;  3KYH C;  3STB C;  1Q46 A;  1YHB A;  2VW9 A;  4LF6 Q;  4JI5 Q;  2NVY H;  2NVQ H;  1VQL A;  4LF4 L;  3S1Q H;  1E1O A;  3STB D;  3RN5 A;  2I5H A;  1AE3 A;  5DLQ E;  4YHH Q;  3I4M G;  1ASY A;  3TEH B;  1PH4 A;  2MO0 A;  1HNW Q;  5C44 G;  2E2J H;  4OO1 G;  4OO1 I;  3L0O A;  4OX9 Q;  3GTG H;  4R4Q A;  1IL2 A;  2B63 H;  1XMQ L;  4DR1 Q;  3HOW G;  3PUV A;  4A3K H;  3KJP A;  3T1H L;  5LMU L;  3CMA A;  3FP9 A;  2R7Z G;  2WAQ G;  2R6G A;  1OXS C;  3KJO A;  1I94 L;  1UWV A;  1IXR A;  1HH2 P;  2FXQ A;  4QIW E;  5GQO A;  4DR2 Q;  5M3M H;  2R93 H;  3JC6 6;  5IWA Q;  1Q7Y C;  2CKZ B;  4LF6 L;  5IYD G;  4JI5 L;  3NBH B;  3A5U A;  3ULJ A;  1LUZ A;  5IP9 G;  3CCM A;  1S3O A;  3PF5 A;  1VQO A;  1YHQ A;  1HNW L;  1CKM A;  4OWT B;  1VQN A;  3BZC A;  1A62 A;  1M1K C;  1SFO H;  2UU9 Q;  5IYC G;  4OX9 L;  2JA5 H;  5IP7 G;  4A3J G;  4A3F G;  5C3E G;  2CCZ A;  3SGI A;  2IHE A;  4DR1 L;  4JI3 Q;  1N9W A;  1PYB A;  1A8V A;  3D31 A;  4X6A H;  1JJG A;  3CCV A;  3F1Z A;  1JE5 A;  1VQD A;  2PNH A;  5M3F G;  4DR2 L;  3I4N G;  4NPS A;  3PUW A;  2LSS A;  1OXU A;  1PH3 A;  5IWA L;  4POG A;  2JA7 G;  4A3G H;  2D62 A;  1PH1 A;  1U0L A;  4LFB Q;  3PO2 H;  4IJH A;  3M3Y H;  1L1O C;  1IYJ B;  1EUJ A;  5M5X H;  2E8G A;  3UDX A;  4A3D H;  3L2P A;  4A93 G;  2Q2I A;  4YWK A;  4LFA Q;  2UU9 L;  4H02 A;  4KHP Q;  1V9P A;  4LF9 Q;  2LXJ A;  1AH9 A;  2WAQ E;  4DK3 C;  5GAD C;  4DR7 Q;  4UP8 A;  4X65 Q;  4JI3 L;  4L5Q A;  4QGU A;  3HOZ G;  1Q81 C;  1U5K A;  2JA6 H;  4A3C H;  3EIV A;  1XMO Q;  3E0E A;  2ZJQ A;  1EQR A;  1YJ9 A;  4XTC S;  2DGY A;  1HNX Q;  3J7A 5;  2E2I H;  3PO3 H;  4B3R Q;  4NXN Q;  4LFB L;  1JT8 A;  3B6Y A;  2R7Z H;  1Q82 C;  1OXX K;  1PYS B;  1VQ5 A;  4JBW A;  3J80 i;  3K0X A;  1CKO A;  3J81 c;  4HJ8 A;  2YYZ A;  1B8A A;  3Q8D A;  2NZH A;  3I7F A;  1K8G A;  4JI4 Q;  1Y1W H;  4QY7 A;  4GKJ Q;  3RNU A;  1M90 C;  2VZA A;  1UE5 A;  4LFA L;  2A8V A;  4KHP L;  2PMZ E;  4LF9 L;  2I0Q A;  4Y7N H;  3GTQ H;  4DR7 L;  4BBS H;  4AIM A;  4X65 L;  1QZG A;  2BA1 A;  1VQB A;  5C4X G;  3J81 i;  1PH8 A;  1VQC A;  1NBW A;  4DR3 Q;  1TWA H;  4PMW A;  1XMO L;  2BH8 A;  1PVO A;  5HY6 A;  3GDE A;  2K5V A;  2ASB A;  1HR0 W;  1HNX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...