3H3VH

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00575 S1 S1 RNA binding domain
H PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vH02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h3vH01
1XPOA 4DR3Q 2UXBQ 3Q8DA 4IJHA 3OTOL 1Q81C 2A8VA 3CPFA 1HR0L 4JI2Q 1I6HH 4B3ML 4DUZL 4JBKA 1W2BA 1SE8A 5C44G 1D8LA 4GN5A 2IY5B 4B3TL 4POFA 3HFZB 4OONA 4LF4L 1VQBA 1OXTA 3D31A 1KC8C 1X6OA 4JI8Q 4LF8L 1XPUA 3BZCA 4L5QA 5GAHC 2VQEL 3S2HH 2EXDA 4A3IH 4YY3Q 4GLAC 1L0WA 3EN2A 3ULJA 3AFPA 1BBUA 4C3HH 2R6GA 2ZJPA 1S3OA 1WI5A 3WWVA 5C0XJ 2KCMA 5FJ8H 2QGQA 4GLVB 3RN5A 5C44H 3GTGH 4GKKQ 5C4JH 2OTLA 3GDEA 2NN6I 4A3EG 1ASZA 1JB7A 3PUVA 1XPRA 4XTCS 1YVCA 1RL2A 3GTKH 4A3MG 3OW2A 2AHOB 3PSIA 3STBC 3KDFB 4NXML 2DGYA 3I4NG 2ID0A 4JI7L 1PVOA 3UDXA 5IYCG 1JJCB 2OQKA 3J80i 1HNXQ 1VQAA 3DM3A 2MO0A 1EWIA 1C7YA 1YI2A 2BH8A 3S1NH 1MJEA 4A3LH 3CCRA 4LF6L 4LF5L 4B3RQ 1UE7A 4TVAB 4DKAC 4GNXC 1I3QH 4IPDA 4JCVE 4APVA 4IOCA 4OX9Q 5IP9G 4K0KL 4A75A 1CKNA 4A3MH 2WAQE 3S14H 2DUDA 4P74A 1AH9A 2KBNA 3K7UC 4YHHQ 3BJUA 1VQ5A 3I4NH 4OWXB 2VNUD 4DR7Q 3I4MG 5IYCH 1FJGL 3NBHB 1TWAH 2NZOA 1O7IA 1N34Q 4KHPQ 3I4OA 3KLWA 4RMFA 1X56A 1NJIC 3CCLA 1PH9A 1YHQA 3J81j 4C3IH 1WCMG 1SROA 5IT9c 2MNAA 3CXCA 4JG2A 2HHHL 5IE8A 1X65A 3RLFA 3HKZE 3M9BA 4EQ5A 3KJOA 2YTYA 5BR8Q 1VQKA 1E1OA 1SRUA 5JEAJ 1RIPA 4X64L 3UDGA 4JI5Q 3ULPA 1X3FA 2EQSA 2F52A 1PH5A 3I4MH 1Q46A 3LGJA 4JBWA 1WJJA 4C3JH 4IOAA 3HOYH 1XMQQ 2R7ZG 1QUQA 3A74A 2ZJRA 4UY8C 2LSSA 1A63A 1WCMH 3GO5A 4DV2Q 4LFAL 5IWAL 1G51A 4WJ4A 1PH1A 3G48A 4KHZA 4B3SL 1U5KA 5M3MG 4DV1L 4GNXB 2IX0A 1IBML 2CWAA 1NY4A 2R7DA 2B63G 3M4OH 3PCOB 1K3RA 1FGUA 4LUVA 1Z47A 5LMNL 4BBRG 4GKJQ 2AMCB 3M4QA 4L5TA 5AJ3L 4LF9Q 4DR6L 4QQBX 1N36L 3AEVA 2VW9A 5JJIA 1M1KC 2R7ZH 2Z6KC 4DR4L 4H02A 4X66Q 4DV4Q 1T9HA 1LUZA 4DV7L 2I5LX 5M3MH 4HIMA 4DR5Q 3RNUA 1GM5A 2B63H 4AYBE 4JYAQ 2N78A 5GADC 1I5FA 5IYDG 4DR2Q 4BBRH 4LFCL 2ES2A 1IBKL 4LF7Q 2B29A 2ZTEA 4DR3L 2WAQG 4DK3C 3JAMc 3CCVA 2YV5A 3D0FA 4BY7H 1E3PA 5GQOA 1L2FA 3RZOH 2JJQA 2K52A 1UE1A 4OWTB 1SFOH 1A8VA 4GOPC 1P8LA 2VY3A 1PA6A 1W3SA 2YTXA 3KF8B 1K83H 3KDFA 2GVAA 3ERSX 3U4VA 1NBWA 4JI8L 3HKZG 1HZBA 1NTGA 1CKMA 2KHIA 2R7FA 4O2DA 3U4ZA 3E9IA 1AE3A 4YY3L 2AKWB 5FLXc 4X65Q 4AIMA 2MQHA 1XNQQ 4LFBQ 1XMOL 2D62A 2OQ0A 2HIVA 4UPAA 3AFQA 3T1YQ 1IBLQ 2NVXH 4UP7A 4JI6L 4YCWA 4GKKL 4XIGS 1IYJB 1KIXA 1N33Q 2JK8A 2Y0SG 1A0IA 3FP9A 5FJ8G 1Y1VH 3DLLA 3I56A 1K8AC 4DR1Q 1E1TA 1VQJA 3G6EA 4HJ5A 4BXXG 4ALPA 3EBEA 4DUYQ 1HNXL 2VUMG 4YWMA 3GTOH 4A3JG 1VQFA 4R4IA 1TWCH 4PZ7A 1S72A 1QVCA 1VQNA 2UU9Q 4BBSH 3CCSA 2VL6A 4JI4Q 5JJLA 1G291 1V43A 2D0PA 1I50H 4HIDA 3U58A 3J81c 2E5LL 4MZ9A 3PIOA 3S17H 4A3CH 2WP8J 1I94L 4OX9L 3S16H 5EAYA 4A3LG 1N32Q 3CCQA 3CC4A 4GOPB 1GKHA 1V9PA 2JA9A 4GN4B 4A3FG 1XTDA 3M4PA 1PH2A 4YHHL 4QY7A 1WYDA 3I55A 4O0AA 2GVBA 4BXXH 1VQ6A 4DR7L 2K5VA 4AYBG 5M3FH 4DV0L 1N34L 2VUMH 1L1OB 4JI1L 4A3JH 1TWFH 1YHAA 2OWOA 2AWNA 5J3BA 1H95A 3GD7A 4A3BH 2ZJQA 1VQLA 1IL2A 2K5NA 1Q1EA 2D0OA 1VQCA 5C0XI 3CMEA 4L5SA 4GNXA 2BA1A 3I2ZA 3CPWA 4L5RC 1KRSA 4UP9A 1K8GA 5BR8L 5FLMH 4OO1G 1X55A 1PYBA 3AYHB 1BKBA 4YWLA 3HOZG 2UXDQ 4P73A 1HJPA 4JBJA 3KF6B 4A3FH 1XNRQ 1YEZA 4R4CA 4JI5L 5LMUL 4NPSA 3S2DH 3ULLA 4IPCA 3F2DA 4JBMA 5M5WH 2WB1E 1K73C 2BH2A 1HNWL 4B3MQ 3CQZH 3T1HQ 1VQ8A 2QA4A 3A5ZB 2PQAB 3HOYG 1PHJA 1MJCA 3UE1A 4B3TQ 2CQOA 2UUBL 4DV5Q 1OXXK 4IFDJ 2UXCL 1GVPA 1YJNA 4DV3Q 1VQ9A 3J80c 2GN5A 3HOZH 2RHQB 2VQEQ 1B8AA 1EFWA 4GKJL 4LF9L 2Q2TA 4X6AH 2PI2E 1J5EQ 1N8RC 3S24A 2UUCQ 3G71A 2JA6H 1Q86C 1Y1WH 2JA7H 3J7A5 3PO2G 4PZ6A 4LNQA 4X66L 3CCMA 4DV4L 1PYSB 3PUXA 3PUZA 1Y14B 3CP0A 5DLQE 4POGA 4MTNA 3ICEA 2H5XA 2Y0SE 3KFUA 4NXMQ 2NN6G 1JJGA 4JI7Q 1E22A 5M5XH 4A93G 4LUZA 1VQGA 3F1ZA 1E24A 1VQ4A 3U50C 1X3EA 1X54A 5C0XG 2I5HA 4A3DG 2Z6KA 3TS2A 2ATWA 3PO2H 1YIJA 2NVYH 1Q12A 2R92G 2ASBA 4QGUA 4BY7G 2R93G 5GROA 4X62Q 1Q7YC 2UUAQ 3H15A 1TWHH 3K8AA 4DPGA 4AQYL 4JI3L 4X65L 3M85A 1FJGQ 1XNQL 4A93H 4ME3A 2AWOA 1YJWA 1G6PA 3S1QH 2K5HA 3T1YL 1FVIA 1HH2P 4A3DH 2HQLA 1WFQA 3RZDH 3F8TA 3GTPH 4GOPA 2UXBL 3GTMH 3BU2A 1N33L 1U0LA 2WB1G 4JI2L 4YCVA 2R92H 2ZM6Q 5IY0A 2R93H 5HY6A 1CSPA 4DR1L 2JA5G 1YNXA 3L2PA 4DUYL 4DAMA 2PI2A 3EIVA 1CUKA 1PFSA 2OCEA 4BA1I 1Q1BA 3BZKA 1Y1VG 4BY1G 2YU9H 4JI0Q 3JC66 4DV6Q 1NMGA 1L1OC 2F4VQ 1MKHA 2VQFQ 2KHJA 3HOXH 3M7NA 4HIOA 4B3SQ 4Y52H 5JEAG 4BBSG 2OTJA 2RCNA 3KF6A 4OWWB 4LWCA 3PGZA 1UWVA 4YCUA 3S15H 2JQOA 4P71A 4A3CG 1E7ZA 1C0AA 5LMNQ 1VCIA 3MEFA 3CAMA 2JA5H 2E8GA 1IZ6A 1GD7A 3W1BA 4BY1H 4WJ3M 1EIFA 3CCEA 2V1CC 2YTVA 1B7YB 1VQEA 4A3KG 2CFMA 1UE5A 2PQAA 5M3FG 3GTJH 1QUQB 3TREA 1KHIA 2HT1A 1VQHA 3J81i 4A3BG 3MXNB 1IXRA 2K50A 2C35B 5LMNW 4B3RL 4QL5A 2UXDL 4MNOA 2MFIA 1XNRL 1Z9FA 5FLMG 4AH6A 1SMXA 2IHEA 1KAWA 5E7NA 4A3GG 3PF5A 1GO3E 3NENA 4DAYB 4GN3B 2KCTA 2JA8H 1KXLA 3CW2C 1UE6A 1SLJA 3UDIA 4A3KH 1KL9A 1K9MC 1Q8KA 4KHPL 1FL0A 3T1HL 3TEHB 1HNZQ 2LXJA 4NXNQ 2CWPA 5GAGC 4DV5L 2K4KA 2PNHA 3PUYA 3OYYA 3PV0A 3A5UA 1M90C 4PZ8A 3CCUA 2CCZA 4KI0A 4DV3L 2NVTH 4DK6C 1S40A 1HZ9A 5IP7G 2NVQH 3E9HA 1JE5A 3A0JA 1J5EL 5K36G 4A3GH 2UUCL 1XMOQ 2K14A 5HGQA 3KOJA 1K0RA 2I5MX 1C9OA 4JI6Q 4JV5Q 3PIPA 2RF4A 4FDBA 1VQ7A 3S1MH 2IT1A 2N3SA 1OXSC 4GLXA 2E2JH 1OXVA 3CD6A 3RN2A 3OTOQ 3S1RH 2F3IA 1XMQL 1VQIA 1J6QA 1HR0Q 1Y1WG 2JA6G 2JA7G 3H3VI 4DUZQ 1LTLA 4DV2L 4LUOA 1KRTA 1OXUA 4J15A 1BVSA 4IPGA 5IYBG 1PV4A 3HOUG 2YYZA 3I7FA 4R4OA 2JEBI 4IO9A 1VQMA 3H0GG 5IP7H 3RR5A 1VQPA 4LF4Q 3PUWA 4EX5A 3B6YA 4KLKA 4R1JA 1X9NA 4LF8Q 3FKIG 1NE3A 1DGSA 1EUJA 4RG1A 3CCJA 5M5YH 2JE6I 3PO3G 1MIUA 3ER0A 2E5LQ 1HR0W 1KQSA 2JEAI 1I94Q 1JJ2A 4A3EH 1UEBA 1YITA 4IFDI 4X62L 3GTLH 2Q2HA 2UUAL 1VQDA 2N49A 4HJ8A 2B3GA 4HJ7A 5IYBH 3HOUH 4BA2I 4JOIA 2E2IH 4DR5L 2E2HH 1YZ6A 4LW1A 3H0GH 4DV0Q 1OTCA 4JYAL 2CKZB 4JI1Q 1CKOA 4QJFA 4DR2L 1QVFA 3FKIH 4JOIC 1A62A 4P75A 4TQUS 1VQOA 3STBD 4LF7L 3M3YH 3PO3H 1D7QA 3CC2A 1BBWA 3TRZA 5IP9H 2ZM6L 1PH6A 2IX1A 1B70B 3UE0A 4LF5Q 4LF6Q 3GTQH 5C4XG 1XJVA 1N9WA 1P16A 4R4QA 3F2BA 5LMUQ 1SN8A 1PH7A 1YJ9A 1TXYA 2K75A 4K0KQ 1SR3A 3L7ZC 4HIKA 4UP8A 3W1GA 4JI0L 3FHWA 1Q82C 3NEMA 4DV6L 3RLNA 1HNWQ 2F4VL 4R4TA 3KJPA 3L0OA 2IHFA 2VQFL 4QIWE 2VZAA 1QZHA 3NELA 4LFBL 1X3GA 2QEXA 3AQQA 2PMZE 3F2CA 2A19A 2UUBQ 5ELOA 1EYGA 3JAMi 1IBLL 3ZJYC 2UXCQ 5C4XH 2KENA 3K81C 4NB3A 3HOXG 1TWGH 1HZAA 5C3EG 2HHHQ 2XGTA 2HIXA 3K80C 3RLOA 4JC0A 1LYLA 1R9TH 1JMCA 4IJLA 4C2MH 1EQRA 4P72A 4PMWA 3W5OA 1V1QA 3CF5A 1EOVA 1ASYA 4X64Q 2ZTDA 2RHSB 4PG3A 1CKNB 1L1OA 2MO1A 4OXPA 5GAEC 3TS0A 3E0EA 1NMFA 1HZCA 2N8NA 2FXQA 4DNIA 3J7ZC 2Z0SA 4HJAA 4IFDG 5H1SE 1PH8A 2Q2UA 2UU9L 2XTIA 4YWKA 4JI4L 3H3VH 3TQYA 2L15A 1QVGA 4LFAQ 3HKSA 5IWAQ 3VDYA 1JT8A 2VS1A 3SGIA 5C3EH 1EQQA 4DV1Q 1IBMQ 1PH3A 1N32L 3K0XA 1EIYB 3HOWG 3KYHC 2LXKA 4HJ9A 3IRBA 2A1AA 1AE2A 2ALYB 5AJ3Q 3HOVG 4DR6Q 5ELNA 4A4IA 1HNZL 4GS3A 1N36Q 3CC7A 4NXNL 1QZGA 3CMAA 1KD1C 2JA8G 3G4SA 2EIFA 1WOCA 1LM0A 1YHBA 2WFWA 1PH4A 4DR4Q 4OO1I 5IYDH 2NZHA 4DV7Q 4AQYQ 2BA0A 4JI3Q 3K7AH 1VS0A 4Y7NH 3HOWH 2I0QA 4IPHA 3UDFA 5JJKA 2ZTCA 1YBYA 2Q2IA 1CSQA 4A3IG 3PF4A 4LFCQ 4JV5L 1IBKQ 3HOVH 4A76A
chains in the Genus database with same CATH superfamily
3N52A 1XPOA 4DR3Q 1EUCB 1QNUA 3Q8DA 3H20A 1SFOB 2A8VA 3CPFA 1HR0L 1GHKA 4JI2Q 5E4WC 1SNPA 2W9CB 4JI6H 5C44G 2F0TA 1SE2A 4B3TL 3AMUA 4LF4L 4OONA 4O3PA 4KY5A 3OTOH 1HFNA 4LH6A 1DXMA 1N48A 2C2RA 4ED7A 3BZCA 3I3CA 3RIZA 5GAHC 1B2TA 2WB1B 3EN2A 4LF8H 5HURA 1D5ZC 2R6GA 1S3OA 1WI5A 3RMHA 5FJ8H 5JJZA 2XIWA 3RN5A 3GTGH 1GSHA 1XTCD 5CGKA 2OTLA 1ASZA 1JB7A 1B44D 3GTKH 3BDCA 3A7LA 3K3PA 4RZRA 1IL8A 4WBNF 5FPRA 3UDXA 1BO0A 3AU7A 3DM3A 2ASDA 2XCLA 4LSXA 4HCSA 3S17B 5IGGA 4LF6L 4LF5L 1F9PA 1UE7A 4TVAB 2DLNA 1I3QH 4FXKC 4IPDA 3PZPA 3TP8A 2CW0C 4A75A 3PW5A 5JPNC 5M3FB 2XRSD 2NU9B 2DUDA 4P74A 4A3JB 1AH9A 4YHHQ 1WCMA 5ELDA 4JV1A 3NBHB 4K0KH 2NZOA 1O7IA 2N55A 4RMFA 4OIKA 1PH9A 3CCLA 3EVQA 4C3IH 3VA7A 1WCMG 1TWGA 1FJGH 3Q8SB 1SYFA 3BA8A 1X65A 4A3FB 1L0YB 1PFBA 5BR8Q 2UXCH 2HJWA 1ENFA 4X64L 2NUAB 4JI5Q 1FKAH 1X3FA 5EPKA 3LGJA 2CH4A 4JBWA 2CW0D 4L8JA 4C3JH 2CHBD 3HOYH 2R7ZG 2NTTA 1ZKOA 2VB2X 3EFXD 2LSSA 3MHBA 1F2LA 1W96A 4LFAL 3J81W 1G51A 1DONA 4PNYA 2RCFA 3G48A 4B3SL 5KG4A 3VPCA 4DV1L 5EKIA 4GNXB 3VPDA 4DL7A 2CWAA 1NY4A 3OSPA 3M4OH 2K7VA 1Z47A 2FB9A 4RH6A 4DAYA 2JSOA 5ELBA 1AEXA 4L5TA 3MEHA 5AJ3L 1SFOA 1IBMH 2W9CA 1Y1WB 4EYHB 4QQBX 4XXEA 4R8IA 4OELB 2VW9A 5C3WA 2L0CA 1GGOA 5LMNH 4CC5A 1RYRA 2ZXRA 5KG0A 4ED3A 3E5SA 3HS0C 4FF4A 4DR6H 2NN6H 5LL6b 3QZ8A 1LUZA 1SMYC 4XYMB 1Q90A 4HIMA 1ET9A 3MTSA 4I65A 5GADC 1A6XA 4DR4H 1FNVA 4ODGA 4DV7H 2W6MA 2B29A 2ZTEA 3HB9A 4DK3C 3KAJA 1S5CD 1GSAA 1E3PA 5CR3A 3CVZA 3RZOH 3BJYA 4CJ1B 4OWTB 4J9OA 4DR3H 4UCUA 2YTXA 1AW7A 2GVAA 2B8FA 1J8IA 1VMCA 5CBAE 5IGEA 5KG3A 2UVRA 2E75C 4YY3L 1AE3A 5FLXc 4A3DB 2MQHA 3V6HA 3J7AK 3MFIA 4UCVA 1HTLD 2FP4B 4JPBW 1XMOL 3GTPB 3IG0A 1VF7A 3AFQA 4UP7A 2R92B 3GTGA 2SNMA 2DY7A 2XIGA 4XIGS 2R93B 1N33Q 3GTKA 4QCLA 5C1OA 1UUPA 2XRQD 3FP9A 5FJ8G 1IOWA 3N44B 3T4AC 2PZUA 3NBHA 4DR1Q 1E1TA 3G6EA 3GTOH 4A3JG 2EJFC 4MV4A 3HOXB 5JJLA 1AP0A 1V4YA 3PIOA 3BABA 4J9LA 4A3CH 2QDBA 4KY7A 3S16H 3RV3A 1A9XA 1V9PA 2JA5B 4U68A 4A3FG 1KJ8A 2OXPA 2E5LH 2F0QA 4I50F 4ZQ3A 2O2LD 4G7OC 1N34L 3LWUA 1SJHD 2VUMH 2O03A 4CKCA 2OWOA 1TWFH 1YHAA 2AWNA 5J3BA 3LWEA 1H95A 4YAJB 5KFUA 2EY5A 1VQLA 4YHHH 1Q1EA 1D1KA 1W6JA 2F0OA 4K8IA 3TDQA 4GNXA 1O78A 3I2ZA 3R93A 1IKLA 4K2KA 4WORA 4O3SA 5LP6F 2R85A 1KBLA 1X55A 1PYBA 1BKBA 5G3LF 5KKNB 2UXDQ 2A6EC 2VA3A 1GLVA 1V51A 5LMUL 1QILA 3WO1A 5KT6A 1SDFA 1KTKA 3NWSA 4A3KB 5BR8H 3ULLA 4IPCA 4HYKA 5CV7A 3C1EA 3KBXA 2GPSA 2OH2A 1S5DD 4RAYA 1EZ8A 5M5WH 1K73C 4CC6A 5FD6A 4JI5H 2BOSA 5I4DA 2PQAB 3HOYG 4B3TQ 2KEEA 2UUBL 4MHEA 4DV5Q 2NVQB 2PW7A 4HMJA 3D6CA 1RJPA 4DV3Q 3HOZH 3D6WA 3P7JA 4H44C 2AGQA 1EFWA 4LF9L 5KEEA 1Y8PB 3D8GA 4PMBA 1STEA 1Y8NB 1WTOA 4X6AH 2B2VC 4MN3A 1N8RC 4QIWB 2V58A 2L9HA 4LNQA 1WVLA 2JXMB 2NUCA 4JV2A 3PIO3 3PUZA 1JB3A 1Y14B 1ESFA 3CP0A 4MTNA 4S3SA 1LTRD 2NN6G 1JJGA 4KKTA 2LMCB 3OHXC 3DMUA 1VQ4A 3GIMA 5EKLA 1X54A 2I07B 2R92A 2I5HA 4A3DG 2BE5C 2EY2A 2R93A 4ZUJA 1PRTF 3PO2H 3VR6A 1XDNA 2R92G 2ASBA 2E2IB 2R93G 2B2TA 2K01A 5KFZA 1Q7YC 4XX0B 2F0MA 1BNCA 1TWHH 4AQYL 3GV8B 4JI3L 2IWHA 1TKWB 3R5FA 1S0NA 4ME3A 4PDBA 4O1NA 4DK0A 1YJWA 4RKLA 2OLSA 2W7OA 2B2WC 3S1QH 2K5HA 3T1YL 1IYVA 4IWXA 2IP4A 3QO2A 1WFQA 2OEOA 5IIFA 4EQOA 4QWBA 1Q8IA 1SNMA 2A68C 3V05A 3BU2A 5E3FA 3C46A 5EDWA 2JA5A 4X3UA 2EYFA 4XQQA 2FFKB 3HEJA 2Q8RE 2HGSA 1CSPA 2EPBA 2DY8A 2JA5G 1N33H 4DGZA 1CFMA 1CUKA 2OCEA 3MC0B 4BA1I 1Q1BA 4C1NI 1U4PA 4JI0Q 4DR1H 3J80W 4O3RA 5IGFA 5E1FA 2F0LA 2F4VQ 1MKHA 2KHJA 4F50A 4B3SQ 4O2BF 4Y52H 4TV8F 5JEAG 5L37A 2RDFA 2OTJA 1R9TB 4BWGB 4YCUA 2JQOA 4P71A 4A3CG 1A2TA 4K5WA 1C0AA 1UC8A 4ED2A 2E8GA 4R8NA 1TWFA 5L1JA 1ZHSA 4BY1H 3WO0A 4WJ3M 4A3KG 1EWCA 2CFMA 2PQAA 2YYAA 3SDZA 3TREA 3HG9A 2HT1A 3BVZA 1IYUA 2L11A 5FLXL 1AN7A 3MXNB 1C8CA 4QL5A 2FMMA 5LHY1 4TQRA 2W6QA 5HV6A 1DZ1A 5FO9B 4AH6A 3GIDA 1KAWA 4G7HC 3PF5A 5IODA 2UXDH 1Z2PX 4L6TB 5I2XA 1KXLA 1B53A 1UE6A 5BN5A 1DOKA 1UAPA 1FL0A 3QIAA 4O4IF 3J7YW 2CWPA 2XNAC 3VPBA 1XX8A 2K4KA 2CCZA 1I7NA 1EY7A 3HOWB 2WAQB 1S40A 2EZVA 2FKLA 5A2QE 4DV5H 2R87A 3K5IA 1JE5A 4A3GH 3G6XA 4CDDC 5C6AA 1XMOQ 4DV3H 5HGQA 1K0RA 1LABA 2WKDA 1STHA 3OMCA 3PIPA 4JV5Q 2FMCA 3VA5A 2N3SA 1OXSC 2E2IA 3R5XA 2A74C 4UDUC 1XMQL 2F3IA 3SK6A 1VQIA 3H3VI 4LK1C 3L9AX 4IPGA 1PV4A 2Z1CA 2JEBI 2K04A 5IP7H 4TV9F 3JAME 4A3IB 1JWUD 4DV2H 1T5EA 5DGBA 1X9NA 1IOVA 1ZYRC 5D3IB 1EUJA 5M5YH 2V9WA 4C3HB 3ER0A 4QWDA 4A3EH 1GUTA 1J9OA 2Q2HA 1D2BA 3FDSA 2N49A 5J22A 4HJ8A 4DR5L 2NWGA 2E2HH 1M4VA 1KNAA 3H0GH 1Y69U 4ED6A 2NBFA 1PLFA 2AQ4A 4QJFA 4DR2L 2EOTA 4TQUS 4JOIC 1HA6A 2R8JA 3STBD 3M3YH 3PO3H 1D7QA 5KT2A 1ZEQX 4H0LC 1BNZA 1WR2A 1OO9B 2ZM6L 5COYA 1CQFA 4AYBB 1XJVA 1N9WA 3IKJA 1ZYRD 2WV6D 3D4WA 3JSLA 1PH7A 5LMUQ 2FPGB 1YJ9A 1TXYA 3SXHA 1EY9A 3NP8A 1TWAB 4DL3A 3W2DA 3RLNA 3V2TA 1QZHA 1AFPA 2YZNA 3NELA 2EYOA 1X3GA 3M9NB 1K0SA 1S97A 2JEJA 3PIP3 1EY0A 2UUBQ 3H3VC 4JI0H 3JAMi 2F4VH 4U673 1HZAA 1O7ZA 4LFBH 1SEBD 1TR5A 3RLOA 4B3SH 1LYLA 1JMCA 4IJLA 4C2MH 2TMPA 4PMWA 2ZDGA 3RD4A 4N8X1 1NMFA 2FXQA 2R7LA 1Q3LA 3GIJA 1SNQA 1PH8A 3Q24A 1JORA 4JI4L 4YBZB 4A2AA 5LYJF 2WIIB 1CQVA 5IWAQ 4MA5A 2VS1A 4EGQA 1YNNC 2NB0A 3PQIA 3HOWG 4L63B 4ME5A 1E4GT 1FD7D 5T14A 1SCUB 5I47A 3IRBA 3K5LA 2A1AA 3JZIA 2HDLA 3QB3A 4IHJF 1E4FT 1N36Q 3ND9A 3CMAA 1QZGA 4MIUA 3UQ8A 2I87A 5EKKA 4L1KA 2IA6A 1WOCA 4RAUC 2B63B 1H9SB 3BZDB 3OSNA 3SR1A 5JPMC 5IYDH 1DOLA 1LTBD 4IQZA 5KG1A 4AQYQ 4O3NA 4JI3Q 1CHPD 3K7AH 4BBRB 2F0JA 3R2TA 4Y7NH 3MFGA 2I0QA 4HQ6A 4HR7A 1LT4D 5EZYF 4A3IG 1CSQA 3QG1A 2AQ1B 3DWPA 1D1IA 1IBKQ 4LFCQ 3HOVH 4BY7B 2PMZA 4FNFA 4IJHA 1Q81C 1JLLB 2ICEC 4C3HG 5JAVA 3MR5A 1VBGA 1I6HH 4DUZL 4JBKA 1W2BA 4JV5H 1K83B 4TSSA 1K1SA 1B6SA 1D8LA 2YS7A 1SJED 4Q43A 5CAEB 1MHWC 4POFA 3GIPA 4F7XA 1K3BC 1VQBA 1F2MA 3MZ5A 1OXTA 3D31A 4KJOA 1EOTA 4JI8Q 1XPUA 3BQ2A 2QK4A 1M6VA 1DIKA 1L0WA 3ULJA 2HVQA 2FLPA 1JIHA 1K1QA 3AFPA 1GUNA 2KOLA 1DCZA 2VOBA 2VQEH 2M05A 2WINB 1A63A 3WWVA 4GKKQ 2KCMA 2QGQA 4GLVB 5C44H 2JYOA 5C4JH 3NGDA 2NN6I 4A3EG 1TWAA 3H0GA 3PUVA 1RL2A 3EJIA 2AHOB 4NXML 4Q44A 2K28A 3CRKC 2ZXPA 1JJCB 2OQKA 1HNXQ 3GV6A 3V4SA 2ASLA 1I50B 1YI2A 1WD0A 1MJEA 4A3LH 1IHZA 3CCRA 4JI7H 5I6YA 3RB4A 4GNXC 1HQMC 1ULZA 2Y0SB 4RCNA 4OX9Q 2VQDA 4RB3C 1R4PB 3S14H 5EPLA 1KABA 3K7UC 1VQ5A 3BJUA 4J8QA 3RUZA 4OWXB 4I7AA 4DR7Q 3GIKA 4EYIB 5FLXW 1JC7A 2DJGC 3I4OA 1X56A 5C3XA 3J81j 2M00A 1LLRD 1AZQA 4PQXA 1SROA 5IT9c 5EOYA 4OO1H 3BDLA 3CXCA 1I4XA 3R2IA 4P2CB 2HHHL 3RLFA 1FGBD 3BA9A 4C2MA 3KJOA 5CYUA 1HA5A 2YTYA 2R8GA 1SRUA 5JEAJ 5A35A 4IR9A 1RIPA 3S2DB 3NXWA 2R7KA 3PN1A 3G7LA 5C5MA 3ULPA 1KC7A 2EQSA 2BCOA 3Q22A 3IL8A 2B63A 2Q8TA 1XMQQ 4UCOA 2B2YA 3OUZA 1PZKD 1WCMH 3RBEA 5ISRA 5BPHA 4UHVA 3M4IA 2B63G 1JE4A 2R7DA 2VUGA 1X3PA 3M9MB 4LUVA 3BAAA 5IWAH 1JDBB 2JEFA 4BBRG 2RQXA 1MD2D 2AUJD 3A8KE 2JA7B 2EY1A 5KFOA 1I4RA 5FO7B 1K83A 2J0TD 4KHVA 1TA8A 2R7ZH 4Q0FA 3EPIA 4H02A 2F0UA 4X66Q 5D1PA 1GUOA 4DV4Q 4NDXA 1N36H 3ETJA 4DR5Q 1GM5A 3Q8PB 3RNUA 2JN4A 4TKOB 2N78A 3SHLA 1I5FA 2B2TC 3BVMA 5IYDG 4DR2Q 1KJJA 2EYMA 4C56C 1BBXC 3R23A 4AQYH 3V6JA 1RK6A 3ONAB 3JAMc 2YS6A 4J9MA 4J9NA 5GQOA 4LFCH 1AUVA 1JDEA 3TINA 2BQ3A 1IBKH 1SFOH 3HKZA 1PA6A 1EY5A 5I9OA 1NSNS 5FPOA 3TBIB 3U4VA 2F0DA 4A93B 3HKZG 1CKMA 3HP3A 3E9IA 4AIMA 1XNQQ 1RK5A 3RB6A 4LJZC 2F0IA 4EFBA 2D62A 2OQ0A 3OWFA 4JI8H 2LY7A 1VKZA 2NVXH 3Q1KA 4Q8FA 4YCWA 2IL8A 1XXGA 1IYJB 4HMIA 1KIXA 4KD3A 4IRDA 5CV8A 1CI3M 1ICWA 2Y0SG 1LV9A 1A0IA 5HBRB 5KFWA 1AUXA 4GKKH 1K8AC 1O7YA 4OHJA 3RBDA 4HJ5A 1JOKA 4DUYQ 3ETHA 4YWMA 1PFMA 2PO4A 4R4IA 1QVCA 1VQNA 4HAEA 1DV2A 4JI4Q 1V43A 1HNXH 4HIDA 3FPPA 3S17H 2NVXB 2XGPA 2WP8J 1I94L 3UFXB 4ZI7F 5CA0F 4A3LG 2NZ1D 4KMUC 2XGQA 4QW8A 4GN4B 5KFPA 1XTDA 5JUMA 3M4PA 1WYDA 3NTKA 4O0AA 4E6IA 4ZRZA 4OX9H 1VQ6A 5M3FH 4DV0L 1S5FD 4C5BA 5KG5A 4WRDA 5JVH3 1L1OB 4JI1L 1F9SA 4A3JH 1EYZA 4A3BH 2ZJQA 4L5SA 1VQCA 3CMEA 4DR7H 1PYWD 5L1KA 3KBGA 2C28A 4L5RC 4OO1G 3OW7A 3AYHB 4YWLA 1PTOB 4A3FH 1HJPA 4JBJA 4DNTB 5KFAA 1TY0A 3LX0A 3F2DA 1I4PA 1L2ZA 4JBMA 3RB0A 1JOOA 2BH2A 2DZDA 1HNWL 3KXYT 2PPBC 4A3BB 3T1HQ 1VQ8A 1T3NA 1UEAB 2QA4A 3RGXA 1PHJA 1MJCA 3UE1A 4DL4A 1OXXK 5KFEA 3MR6A 5BPFA 5E4XA 3M9OB 1ML0D 2RHQB 4GKJL 1B8AA 1H9RA 4RZQA 2H1EA 4NMZA 2Q2TA 1W93A 2WYOA 2KHSA 2UUCQ 2NYZD 2R7ZA 3G71A 2E2JB 1Y1WH 3J7A5 1V1OA 3CCMA 4MTKA 4J1MA 3PUXA 1MGSA 2W71A 5ELFA 4POGA 1QCBD 4XZ3B 4KK7A 5KYIA 4X66H 4NXMQ 5IT9L 4DV4H 4DR5H 4A93G 4G4KA 3F1ZA 1QNKA 4RB2C 2N88A 2RDGA 5C0XG 2EJGC 2Z6KA 2EJMA 2ATWA 5CORA 3U9TA 1X32A 3GTLB 1KAAA 3HOUB 2X0SA 1M0WA 2B39A 4R8UB 5GROA 4X62Q 3H15A 1KLUD 3K8AA 3J81E 4X65L 5KFVA 3FKIB 1LTAD 2YZMA 2AWOA 2KCNA 2EXZA 2WB1A 2NVXA 1A3TA 1VBHA 1FVIA 4A3DH 5FO8B 5DLFA 1LTTD 4J9QA 4ECTA 3F8TA 1XNQH 1QB5D 1S4ZA 3GTPH 3GTQB 2UXBL 2F4IA 2WB1G 2R92H 1A2UA 2R93H 3V4ZA 4LSAA 3SI8A 1PFNA 2FE3A 3BG3A 1V8QA 3L2PA 3TQ1A 2HDMA 4DL5A 2PI2A 3OUUA 4JI2H 5C5LA 3JC66 1H9JA 4DUYH 3HOXH 1WTHA 4F8MA 3X3MA 1CK1A 4CDEC 4JI4H 4OWWB 3CHBD 3TN2A 5DG8A 1KJIA 1E7ZA 5I9PA 3MWMA 1VCIA 1SNCA 3MEFA 4DL2A 2JA5H 1IZ6A 2W70A 3W1BA 5BMVF 2L12A 4HCEA 3CCEA 2V1CC 4YB8B 5DQIA 3A55A 2K1BA 1UE5A 5M3FG 1JCKB 1QUQB 2EYLA 1JWSD 1TT2A 3J81i 1S5ED 3A8JE 4A3BG 5JEAH 2K50A 1T94A 4B3RL 4RGNA 2ZDQA 4QW9A 2MFIA 3U9SA 5DM73 4DK1A 1XNRL 2WTFA 5D3DA 4ED1A 5H80A 1SMXA 4KV6A 3NENA 4FF2A 2EYHA 3CW2C 3WOFA 4A3KH 1KL9A 2CZGA 2G9DA 4KHPL 4ED8A 4MA0A 2M9VA 2F0WA 2LXJA 3ITPA 4NXNQ 1S10A 4JVZA 3A5UA 3PV0A 3G6VA 4PZ8A 1LACA 2IPKD 4KI0A 4ZUIA 3T1HH 4DK6C 1HZ9A 2NVQH 4RGMA 3E9HA 3IFDA 3A0JA 1J5EL 3FVQA 2MP1A 1WD1A 4BWSC 3H4BA 1SBBB 3KOJA 3GV5B 1LT6D 5J1ZA 5CBEE 1Y1WA 1HUNA 4FXGC 4RWSC 3CD6A 2UUCH 5DGAA 5EBDA 1HR0Q 1J6QA 1Y1WG 4MV6A 4RU9A 1LTLA 1O80A 5KYLA 5IYBG 3HOUG 2YYZA 3I7FA 4R4OA 1VQMA 4LF4Q 3S2HB 1S03G 4QUFA 2R8HA 4KLKA 4R1JA 3MR3A 4NXMH 5I2YA 3FKIG 1NE3A 3GTQA 4ECRA 5LXTF 2KECA 2JE6I 3DXJC 4YQWA 1HR0W 2JEAI 1I94Q 1G8ZD 1GUSA 1A3VA 1TIID 1EQVA 4FVMA 4X3TA 2UUAL 2FK3A 4MV7A 2KSWA 2XSCA 2E2IH 4JYAL 4DV0Q 1Y8OB 2CKZB 4JI1Q 4X62H 1EIGA 3HRZC 1K8MA 1QVFA 3N8DA 5KNBA 1A62A 2WE6A 3S1NB 3NUCA 4O2AF 4YJ3F 4APMA 1M0TA 4RUAA 2RGRA 5KFQA 3GTPA 1WH2A 1BBWA 2W6ZA 3TRZA 4I7ZC 5K5PA 5I6WA 1PH6A 3O13A 4LF6Q 4LF5Q 4HNVA 2J7ZA 1EEFD 1ENAA 1FNUA 4A3MB 4R4QA 1SN8A 3QJYA 3I4NB 3OPOA 3W1GA 4DV6L 4F4ZA 3VR4A 3F8NA 4HTHA 1RF2D 1HNWQ 4RNMA 3L0OA 2F0PA 2IHFA 2Z9HA 2VZAA 4F87A 5IOCA 4IALA 2K33A 2VQFL 1WTPA 2PMZE 2DWCA 3DF7A 5ELOA 2P5ZX 3JSNA 1IBLL 1S68A 2KENA 3HOXG 4FBTA 2HIXA 5LOVF 4EBCA 1R9TH 4QWCA 4P72A 1RKNA 1V1QA 1ASYA 3I4MB 4X64Q 1CKNB 3MWDA 4WD3A 2MO1A 3PMFA 5GAEC 1DM0B 4DNIA 4JV0A 3J7ZC 2Z0SA 4IFDG 5H1SE 1DYQA 4TRDA 2Q2UA 2UU9L 4YWKA 5G3LD 4LFAQ 3VDYA 1B33N 3TP6A 1EQQA 1U9RA 4DV1Q 1N32L 2O5IC 2CW8A 3K5NA 3K0XA 1EIYB 4DAPA 2LXKA 1KJ9A 2R6FA 4UCSA 2CQAA 1AE2A 1QJOA 1SAPA 5AJ3Q 3N6XA 4FM9A 5ELNA 1HNZL 5CB4F 4GS3A 2EIFA 5IT9W 5M3MB 1PH4A 4XYQA 4OO1I 3J80E 1JX4A 1PRTC 3CKIB 2OF1A 4NXNH 2E2DC 3EYYA 1GXDC 1VS0A 3HOWH 4J6HA 4G3IA 2F0GA 1B9MA 2W6PA 2P0AA 5JJKA 5KT3A 4MTEA 4QWAA 3PF4A 4QIWA 4A76A 3T5JA 2UXBQ 3OTOL 3CRLC 3OIQA 4B3ML 4C5AA 1SE8A 3ORQA 3PW4A 4LH7A 3HFZB 5FKAC 5C1PA 1SYEA 2D5DA 1HR0H 3DHQA 1RJQA 1Z6HA 2Q8IB 4B08A 1X6OA 1KC8C 4LF8L 4L5QA 2C2DA 4B3TH 1QWYA 2EXDA 5CV9A 4YY3Q 4A3IH 4LF4H 1PRTD 2VB3X 4GLAC 3I72A 3VYUA 2AGPA 2QCPX 4FP5D 1BBUA 1CM9A 4C3HH 3TZDA 1EZ6A 1RJRA 4F88A 5C0XJ 4IURA 3P75A 4ZKCB 2R3ZA 1Y1VB 3GDEA 5KFNA 4XTCS 1YVCA 5EWFA 1BCPF 4A3MG 3OW2A 1RYSA 4RHSA 5JVDF 3STBC 3I4NG 1TWCB 2ID0A 1PVOA 1DOMA 5IYCG 4A2BA 2DNCA 3J80i 2QF7A 3OIPA 2MO0A 2XWBB 4K5XA 3VYSA 4JI1H 1WSCA 3IAYA 1TY2A 3P1HA 3Q6SA 4B3RQ 3K5HA 4X3KA 4DKAC 3I70A 2F0VA 5DQHA 1EL0A 2PZTA 3T13A 4APVA 2W9AA 4BS9A 4K0KL 1GUWA 5EPJA 4LF6H 1CKNA 4IZ8A 4LF5H 5KG2A 2KBNA 2J9GA 1ICFB 1FYCA 3HBLA 1B4OA 3I4MG 1FJGL 1TWAH 4KHPQ 1N34Q 2SOBA 2MHVA 3KLWA 2L5TA 3SK5A 3UI2A 5DEHA 1Z2OX 2RVLA 2MNAA 1ESRA 4JG2A 2EYJA 5IE8A 1HTPA 1GHJA 1KNEA 4I7HA 3HKZE 3M9BA 4EQ5A 1T36A 1R9TA 3RF2A 1VQKA 2XWJB 3CU7A 5F2DA 3BYYB 1E1OA 2MUYA 4QF4A 4ED0A 4TUYF 5BN4A 3UDGA 2F0EA 4C5CA 2A73B 1Q46A 1V1PB 3CQZB 1WJJA 4IOAA 4YAKB 2FINB 5KIXA 1CQIB 4X64H 5LA6F 3A74A 2ZJRA 4UY8C 1I6UA 3MXNA 5KT7A 4WJ4A 1PH1A 3E3XA 1PTOF 4KHZA 1U5KA 5M3MG 1IBML 1MZBA 4IUQA 3PCOB 3U9OA 1BF4A 4LFAH 1CQJB 3EROA 5LMNL 4DV1H 5KFCA 4MV1A 4LF9Q 4DR6L 1HRJA 3GLKA 2PZWA 2W9BB 5KFRA 3AEVA 1G2TA 5JJIA 5KNCA 1M1KC 1E2VA 2Z6KC 3L4JA 1EZ1A 4G57A 4DR4L 4RAZA 5C8YF 2DPJA 5KFHA 3TP7A 1T9HA 4DV7L 1HHVA 2B63H 4JYAQ 5F9LA 1L0XB 3D3RA 5M5XB 2WAQA 3SK4A 3M4YA 2SDFA 2QW7A 4IN3A 4BBRH 4DN4M 2ES2A 4ZLTF 2BQUA 4YIJA 4DR3L 2QYZA 2WAQG 4HNUA 5FK9C 4WFN3 3CCVA 2NVYB 3D0FA 4BY7H 4CKEA 3TIGA 1VF5C 1L2FA 5DAUA 2JJQA 2K52A 1CT1D 2UXBH 1P8LA 3KF8B 1SYXB 1K83H 3K58A 4CBVA 1ILPA 3VR2A 5AFWA 1HZBA 3KALA 2KHIA 2R7FA 3N40P 3KHRA 4IRCA 3FRPB 1HFGA 5M9OA 2EDGA 2C2EA 3RZDB 4ECWA 4K8JA 4UPAA 2HIVA 3GTMB 1IBLQ 3T1YQ 1I6VC 4IWYA 4LAAA 2R61A 4YY3H 4KY6A 2A69C 3MFYA 2FJZA 1EY6A 4MAMA 1XMOH 1C3OA 1TU2B 4UCRA 2IBKA 3DWAA 5KFKA 3BVGA 3I56A 2RA4A 3DUZA 4BXXG 3EBEA 2YU9B 2F0NA 1TS3A 1U4LA 3JRXA 1VQFA 1I4QA 2UU9Q 4BBSH 2PW5A 4RUCA 4IZOA 1G291 2D0PA 2K5WA 1I50H 2DN8A 2TSSA 2E5LL 1EHIA 3S15B 2NU8B 1MBYA 4OIJA 5EAYA 1N32Q 3CCQA 3CC4A 4GOPB 4AYBA 2JA9A 1EY8A 3K0YA 5KFJA 2KQ3A 4EVOA 4YHHL 1V1PA 4QY7A 3EA6A 3I55A 1WTRA 2GVBA 3CQZA 3RAQA 2K5VA 2A69D 4AYBG 1G91A 1DJRD 4E4TA 4K14A 3GTJB 3A56A 3GD7A 4KJNA 3DEPA 2D0OA 3NQTA 4BBSB 2F0FA 1E4EB 1N34H 2C5CA 2BA1A 3CPWA 2I80A 1KRSA 4UP9A 4DU9A 1SXTA 2RBMA 5BR8L 3A54A 3T5LA 2J6TA 3VMMA 2AU0A 4IR1A 3KF6B 1OWTA 3H91A 4JI5L 3T56B 4XT3B 2W9BA 1MI2A 2JA8B 5KFXA 4NPSA 3S2DH 3H94A 2RKSA 2A5HA 2KCCA 2XCAA 3VYTA 2WB1E 5LMUH 4B3MQ 3A8IE 1PZID 4RKBA 4GC6A 2D9UA 2NVTB 2LKVA 4IFDJ 2I8CA 3MWYW 2FPIB 1YJNA 1U4RA 2GN5A 3J80c 2R7NA 2ALZA 2F0KA 2UUBH 2AQ3B 2PI2E 4RGTA 4J0MA 3Q8QB 1FR3A 3RFCA 3S1MB 2JA6H 1Q86C 3S1RB 4CKBA 2JA7H 4PZ6A 4LF9H 5EQ0A 3KF8A 1EFID 4KN7C 5DQGA 2L4NA 4ECQA 2WDTA 1PYSB 2XD4A 1H9SA 2A6HD 4EEQA 3D4RA 2QEJC 1EYAA 3KLSX 3KFUA 2DPIA 2W57A 1E22A 1II3A 4MV3A 3GTMA 3GQBA 2FK1A 1SEIA 1AN8A 4EQPA 5L1LA 2K5QA 5F9NA 4FS1A 2W7PA 2JA6B 1YIJA 2NU7B 3MR2A 1Q12A 1JKJB 2PN1A 3V96A 4BY7G 2CW7A 1MSGA 4B9XA 5CC4A 1JWMD 1DV1A 4K6DA 3NQIA 5KFSA 2Z4HA 4DPGA 1F9RA 3M85A 1FJGQ 5KX5F 4A93H 4KTAA 3PW0A 4EGJA 5C0XH 1E2WA 1HH2P 2HQLA 1I4GA 2Z8LA 4JI3H 3Q8RB 4GOPA 4K5VA 1N33L 1U0LA 4LMQD 1BJTA 4YCVA 1IBLH 3T1YH 3WDNA 2ZM6Q 5IY0A 1HXYD 3G6YA 4DR1L 3GIIA 4DAMA 3TSSA 1PFSA 2PCFB 5CV4A 3T53B 1BCPB 4M1UB 4EG0A 1I50A 5GONF 5C4XB 3NE5B 4HIOA 3R5HA 4TQSA 1TWGB 4BBSG 3PR4A 2LS01 2UU9H 3KF6A 1SE4A 1SNOA 4LWCA 4CDCC 2Y0SA 1UWVA 4U6PA 4U7CA 3KTMA 5LMNQ 1D5MC 3ND8A 2WACA 1ZETA 1E2ZA 4KN4C 1BR9A 1EIFA 2H4OA 5DM63 1VQEA 1C30A 3D4DA 3DWQA 5LL6X 2YZGA 2B2UA 2J6UA 3PW7A 1IXRA 5C3EB 5LMNW 2W8LA 1IW7D 1BOSA 2UXDL 1CHQD 1Z9FA 3QWNA 1ONLA 1PTOH 2IHEA 4NKLA 4DAYB 4GN3B 5CA1F 3KHLA 3K3VA 4CJ2C 3R8BA 3Q23A 1LTGD 1G6ZA 3UDIA 3KHGA 5EJWA 1K9MC 2O5JC 1Q8KA 3J7AF 3TEHB 5GAGC 4DV5L 4B3MH 3OYYA 4ULLA 1HPCA 2V59A 2L55A 1N56A 4DV3L 4FS2A 1STYA 4RNOA 4ZYSA 2RSOA 5TSSA 2K14A 5BN3A 2JA6A 3PVXA 2JA7A 2I5MX 4NW2A 1VQ7A 2E2JH 4DAVA 1OXVA 2GPWA 2FK2A 2VPQA 2G9HD 2JA6G 2JA7G 4DUZQ 1BGWA 4DV2L 2VA2A 4IAJA 1KRTA 1H9MA 4J15A 1BVSA 4RCOA 2PBZA 1CA5A 1XMQH 1VQPA 4M9UA 3PUWA 4EX5A 1EYDA 4GZYC 3P20A 3GQCA 4B9WA 1DGSA 2OT2A 4RG1A 5C4HA 2G5DA 2F3WA 4ME6A 2F0SA 2E5LQ 5C5JA 3GTGB 3F2UA 2IX3A 1EU3A 2C00A 3GTLH 3GTKB 5JOBA 1F2YA 5KNDA 5IYBH 4HJ7A 3HOUH 4JOIA 1YZ6A 3KAKA 4QMGA 1CA6A 1CKOA 2F0HA 4XYLB 3C3LA 3E6ZX 2VPSA 4EBEA 1STBA 3AB9A 2O4XA 3FKIH 1VQOA 1RHPA 4LF7L 5DLGA 3J80L 4UCTA 1I3QB 4F4WA 4DR2H 1KJQA 5IP9H 1QE6A 5C4XG 1B70B 3UE0A 3GTQH 2R8IA 2D2CC 4QUCA 1P16A 1ZHQA 5NUCA 5T1GA 4CJ0B 2GA4B 2K75A 1SR3A 2ZM6H 2AUKA 4JI0L 3FHWA 3NEMA 3C0FB 2F4VL 1K8OA 3KJPA 4C3IB 4QIWE 3BDOA 4LFBL 2QEXA 2A19A 4ECXA 4O4HF 1EYGA 5KFDA 3J7AV 1SYCA 4ILWA 1ENCA 2HHHQ 5C3EG 2XGTA 3K80C 1EY4A 4Y8VB 3I4LA 5A2QL 2XC9A 1O7LA 3OWEB 3W5OA 3CF5A 1EOVA 2RHSB 1SE3A 4PG3A 4C3JB 3HOYB 1L1OA 4OXPA 2C22A 1H9KA 4RB0A 4HJAA 1NNXA 1UNNC 2JEGA 1FNWA 3M4OB 2V5AA 3I8ZA 2RDHA 3MXUA 1JT8A 3SGIA 4RNNA 4ETSA 1LTSD 3JAML 3EPGA 3KYHC 3TQTA 3TMEA 1ET6A 1UC9A 3BQ0A 4A4IA 4IFDH 1JICA 2AGOA 2MGSA 4F4YA 4YR2A 4ECVA 3LNNA 3QOJA 3G8CA 1PZJD 2BA0A 3QR8A 1SMYD 3N43B 4M7EA 1XWEA 2K05A 2ZTCA 3LWBA 2BQRA 3DEOA 5L9XA 2SEBD 4JV5L 4ZK9B 2X69A 2F1MA 3RZOB 1KLGD 5D65A 3KHHA 3PW2A 3HXLA 3Q0AA 4NP5A 3GV7B 4WJWA 4GN5A 1TQOA 4XDXA 2IY5B 4H7BA 1T5XD 4JW0A 3T16A 5KG7A 4HN7A 4MTDA 1S0OA 2UVVA 4DUZH 4DFAA 1W6KA 5DNFA 2VQEL 3S2HH 5KFGA 1I3QA 2VR1A 1PX2A 4I55F 1R4QB 4F4XA 2K32A 3GTLA 2C9OA 2ZJPA 2E74C 4ZAIA 4HSPA 4R8UA 4HEDA 1XPRA 4ECSA 2K03A 2ZXOA 4FF3A 3GTOB 3PSIA 1EQTA 1JR0D 3KDFB 2DGYA 3KLSA 3FKIA 4JI7L 3IFTA 1VQAA 3FEWX 4EGVA 3MA2B 1CTMA 4HNTA 5JH7F 1EWIA 3MJFA 2SNSA 1C7YA 4EBDA 4C3IG 2BH8A 3H6MA 1TS4A 3NBIA 3S1NH 3S16B 4JCVE 1U4MA 4K2LA 5DG9A 4IOCA 5IP9G 1TS5A 5JVG3 3NSWA 2M2LA 5KG6A 4A3MH 2WAQE 1B1ZA 3N6RA 2VUMB 1UNSA 2X6LA 1TWFB 2VNUD 3I4NH 4J9SA 5IYCH 1S9FA 2GLTA 4C3JG 1NJIC 1YHQA 1ZQ7A 5EWGA 4MV8A 2CVRA 2IJ0A 1VAJA 3RAXA 3WNZA 3KUPA 3NPPA 3RGZA 3MVVA 1EWHA 4FXDA 5IGDA 1CS0A 2HVSA 4G7ZC 4Q45A 2HHHH 1EU4A 1I4HA 2A6ED 5M5WB 2F52A 1PH5A 3I4MH 4DA2A 1QUQA 3K6OA 2R7MA 1EYCA 4ECZA 3GO5A 1BXTA 4DV2Q 5IWAL 2R82A 2QILA 1EEID 3L3OC 2IX0A 1NAPA 2MPMA 3HOZB 4DL6A 3OHBA 5HGTA 2B2YC 1K3RA 1FGUA 1NR2A 1WTQA 5KRUA 4FYDA 4GC7A 5CV5A 4GKJQ 2AMCB 3M4QA 4MV9A 4JK1C 1N36L 1STAA 1K28A 4XQNA 2W6NA 2I5LX 5M3MH 1AZPA 2PNRC 2DIKA 2K5DA 4AYBE 5D8DA 4O3QA 4QB4A 1A3UA 4LFCL 1IBKL 4LF7Q 3ERQA 4XYOA 3RJ0A 3SK8A 3V6KA 3FPUB 3PO2B 2YV5A 3QFFA 5D14A 3X3NA 5KFMA 2BE5D 1UE1A 1A8VA 4ZOLF 4GOPC 2VY3A 1W3SA 1WTWA 4R7RA 3GTOA 1XYIA 4ID6A 5JQWA 1TWHB 2ICIA 3KDFA 4ZHQF 3ERSX 1M8AA 3IN5A 1NBWA 3NTHA 4JI8L 3E0JA 2EE1A 1HUMA 1NTGA 4O2DA 3U4ZA 1A15A 4J9PA 3S1QB 1E0BA 2AKWB 4X65Q 2V4RA 3VR3A 4LFBQ 3FMAA 1LT5D 3SVMA 4JI6L 4GKKL 5KT5A 2ATLA 3BYTB 5IYZF 1TVXA 2ZT9C 4I4TF 2VUMA 3DM1A 2A68D 2JK8A 4IUTA 1LT3D 1Y1VH 3DLLA 1VQJA 5IT9E 4ALPA 1C4QA 1HNXL 5KFBA 4DF7A 2VUMG 1KDAA 1TWCH 3I91A 4PZ7A 1S72A 3RV4A 3T5HA 3CCSA 2VL6A 4RB1A 4OL7A 3U58A 3J81c 2B2UC 4MZ9A 5A2QW 2HVRA 4OX9L 5ELEA 2RGVA 3H4DA 1GKHA 5D1OB 3L4KA 4CGYB 4CDFC 1PH2A 1QOHA 3FMCA 4N9PA 3T51B 4BY1B 3QZ7A 4BXXH 4DR7L 1I94H 2PQEA 2W8KA 4RA8A 1TAEA 1IL2A 2K5NA 1B50A 5C0XI 3OOCA 2KEDA 2ASJA 4IUUA 4DV0H 4KKUA 3JAMW 2WKCA 4CHTB 1NUCA 1X3QA 1K8GA 5FLMH 4LMYA 3T5KA 1TS2A 3HOZG 4P73A 1B3AA 1XNRQ 1STGA 1B04A 1YEZA 4R4CA 3BQ1A 3I73A 5FOBB 4NLGA 2XCPA 1C48A 2KA7A 5KGUA 3HGBA 4XT1B 3CQZH 4O3OA 4FU0A 3SEBA 2YRXA 3A5ZB 3FDTA 2CQOA 3KK7A 2UXCL 1HNWH 5K36H 1GVPA 1VQ9A 4A3GB 4V190 2VQEQ 1YNJC 2FLNA 3HZXA 4HR7B 1Z2NX 3NK9A 1BQQT 1J5EQ 4YR0A 5K2MA 3S24A 3BS1A 2PMZB 4GKJH 3PO2G 2IMWP 2HQEA 5J2TF 4X66L 1TWHA 4DV4L 1RTNA 5KFFA 2W6OA 1GJXA 5DLQE 3ICEA 1M7JA 2FJ2A 2H5XA 2Y0SE 3NHHA 2I46A 1F77A 4JI7Q 4K6LA 5M5XH 4LUZA 1VQGA 1KDBA 4ZQIA 4UAIA 3TIIA 1E24A 2QKIC 4H13C 4PMCA 5M5YB 2YL2A 3U50C 1BCPC 1X3EA 2VXWA 1IKMA 1SNDA 3TS2A 2L1BA 4A3EB 4LF7H 1I7LA 2NVYH 1YNJD 3OHAA 3KLRA 1GOZA 4QGUA 3NWTA 5C4ZA 2E2HB 1G2SA 1RTOA 1RJTA 3H0GB 2UUAQ 4DNRB 1XNQL 3M3YB 4ABNA 3PO3B 4C1NK 1G6PA 1PDQA 4FBUA 3ZYYX 5DG7A 2RDIA 4X3SA 2UVWA 3RZDH 2HCCA 4X65H 2JP1A 2XN9C 2BDNA 4PWQA 3GTMH 2F03A 2Z4IA 5D1OA 4ECUA 4JI2L 4N8FA 5EBCA 4EQNA 2EYPA 1EIHA 1BCPD 1Y1VA 3Q2OA 5HY6A 3OSOA 1WTXA 1KDCA 1B9NA 1YNXA 4DUYL 3EIVA 1BDOA 1TWCA 3BZKA 4BY1G 1Y1VG 3R3OA 2YU9H 4DV6Q 2Z6BA 3OMGA 1NMGA 1L1OC 2EVBA 2VQFQ 3RUPA 3M7NA 4M8AA 3JRWA 1O75A 4EFEA 2RCNA 4IUVA 1MSHA 3URYA 4J9RA 3PGZA 4C2MB 3C2PA 1GYFA 2QDLA 3S15H 3C1FA 3H40A 2BR0A 3CAMA 1PTOC 4DXGA 2EY6A 3S9WA 3K57A 1GD7A 2FLLA 4HSVA 1DD2A 2YTVA 3GV3A 1B7YB 2V4QA 4V0BA 1KEEA 3GTJH 1KHIA 2FHTA 4DXFA 1VQHA 4PV1C 1BXRA 5J2UF 2J4XA 2C35B 1Z7TA 4YP3A 2HCIA 2RSNA 4MNOA 1SYGA 3NTIA 5KT4A 5KFYA 2CH4W 5FLMG 3H09A 1SSOA 5E7NA 1GUGA 1YNND 1GO3E 2B8GA 4ZCKA 4A3GG 4B3RH 2KCTA 2JA8H 1XNRH 1SLJA 2K6AA 2ENBA 3T1HL 3SE7A 1HNZQ 1PTOD 1RCVD 4Z9CB 1D6EC 1STNA 2HUGA 2PNHA 1JOQA 1QG7A 2DNEA 3PUYA 1M90C 3CCUA 3K7AB 3M7GA 2NVTH 3MWEA 4KHPH 4Y7NB 5IP7G 3GIQA 3ORRA 3J81L 4UFZA 3W3AA 2YW2A 2KJXA 5K36G 1LO5D 3N42B 2KUMA 2PYKA 3HOVB 1BUVT 2UUCL 3TZUA 1B6RA 2RDJA 1C9OA 2IW3A 2YCHA 2XVSA 1F9QA 3WOEA 4JI6Q 4KD4A 2RF4A 4FDBA 1I6HB 3S1MH 4RGOS 2IT1A 1J5EH 5KFTA 4GLXA 2A6HC 2LFNA 2E2HA 3RN2A 2E76C 3OTOQ 3S1RH 3I12A 1PRTB 3HKZB 2JEIA 1NR4A 4EEYA 4OGQC 4LUOA 5KFLA 1OXUA 4Q8EA 3I90A 4IO9A 3H0GG 3RR5A 4YR3A 2NTSA 2B2VA 3B6YA 1PXUA 3K5OA 4LF8Q 1PMRA 4RFBA 4R9WA 5J39A 3CCJA 3PO3G 1MIUA 3G6JB 2NVYA 4JUZA 1D5XC 1KQSA 4ZKBB 2MJ8A 5C44B 3SE0A 5C4JB 1UEBA 1YITA 1JJ2A 2HD3A 2AQ2B 4IFDI 3PR5B 2KVMA 3GP7A 4X62L 4J9KA 4RHRA 2NU6B 2ZJTA 1VQDA 4XQJA 2B3GA 2UVUA 3N41B 3TP5A 4O42A 4BA2I 5FLXE 4KKSA 2X6GA 4LW1A 1OTCA 4FO2A 3K59A 3LMLA 2UUAH 4P75A 1LTID 4JYAH 1RD9D 3CC2A 2DJFC 2FMAA 1B3QA 1CE8A 1CZGA 2IX1A 1HQRD 2R8KA 3S14B 3F2BA 2FPPB 5ELCA 2J6SA 4K0KQ 4Q5VA 2R86A 3L7ZC 4HIKA 4UP8A 5EGTA 4IRKA 2YU9A 2PVPA 4ECYA 1Q82C 2B2WA 5CV6A 4R4TA 4DLKA 3QOLA 2SCUB 1SYBA 3F2CA 3AQQA 5FD5A 2BDOA 4IUNA 4DV6H 3GILA 3ZJYC 2UXCQ 5C4XH 1ILQA 2YRWA 3K81C 4NB3A 2VQFH 1TWGH 1RODA 4N9TA 1VMPA 1CZWA 4JC0A 2V4DA 1EQRA 3LP8A 1GSOA 4O4LF 2ZTDA 4YJ2F 3A7AB 3TS0A 3GTJA 3E0EA 1HZCA 2N8NA 1WCMB 5T1IA 1HCZA 1S5BD 1IW7C 5LL6S 3E5NA 3MXGA 2MCTA 2XTIA 3H3VH 1E4EA 3BG5A 3TQYA 2L15A 1QVGA 1NCVA 1ZXTA 1WTVA 2R84A 3HKSA 3MAQA 1F2ZA 1SYDA 5C3EH 4FF1A 1IBMQ 1PH3A 1RDPD 1S0MA 1VDZA 3MFHA 3EQLC 3K5MA 5EWEA 1EUDB 4HJ9A 4IUPA 2ZDHA 3HOVG 2ALYB 3MXPA 2R7ZB 4DR6Q 5IGCA 1PK8A 1N32H 3RTXA 5JVLA 4Q0YA 3CC7A 4NXNL 1KD1C 2JA8G 3RB3A 3G4SA 2WFWA 1LM0A 1YHBA 5IGBA 4DR4Q 4QWEA 1HNZH 2NZHA 4DV7Q 5L1IA 4OEMB 1JXLA 2F3VA 5KFIA 4IPHA 3UDFA 3VR5A 1JQYD 1YBYA 2Q2IA 5CMDA 3VYRA 2CQYA
chains in the Genus database with same CATH topology
1XPOA 4DR3Q 2UXBQ 3Q8DA 4IJHA 3OTOL 1Q81C 2A8VA 3CPFA 1HR0L 4JI2Q 1I6HH 4B3ML 4DUZL 4JBKA 1W2BA 1SE8A 5C44G 1D8LA 4GN5A 2IY5B 4B3TL 4POFA 3HFZB 4OONA 4LF4L 1VQBA 1OXTA 3D31A 1KC8C 1X6OA 4JI8Q 4LF8L 1XPUA 3BZCA 4L5QA 5GAHC 2VQEL 3S2HH 2EXDA 4A3IH 4YY3Q 4GLAC 1L0WA 3EN2A 3ULJA 3AFPA 1BBUA 4C3HH 2R6GA 2ZJPA 1S3OA 1WI5A 3WWVA 5C0XJ 2KCMA 5FJ8H 2QGQA 4GLVB 3RN5A 5C44H 3GTGH 4GKKQ 5C4JH 2OTLA 3GDEA 2NN6I 4A3EG 1ASZA 1JB7A 3PUVA 1XPRA 4XTCS 1YVCA 1RL2A 3GTKH 4A3MG 3OW2A 2AHOB 3PSIA 3STBC 3KDFB 4NXML 2DGYA 3I4NG 2ID0A 4JI7L 1PVOA 3UDXA 5IYCG 1JJCB 2OQKA 3J80i 1HNXQ 1VQAA 3DM3A 2MO0A 1EWIA 1C7YA 1YI2A 2BH8A 3S1NH 1MJEA 4A3LH 3CCRA 4LF6L 4LF5L 4B3RQ 1UE7A 4TVAB 4DKAC 4GNXC 1I3QH 4IPDA 4JCVE 4APVA 4IOCA 4OX9Q 5IP9G 4K0KL 4A75A 1CKNA 4A3MH 2WAQE 3S14H 2DUDA 4P74A 1AH9A 2KBNA 3K7UC 4YHHQ 3BJUA 1VQ5A 3I4NH 4OWXB 2VNUD 4DR7Q 3I4MG 5IYCH 1FJGL 3NBHB 1TWAH 2NZOA 1O7IA 1N34Q 4KHPQ 3I4OA 3KLWA 4RMFA 1X56A 1NJIC 3CCLA 1PH9A 1YHQA 3J81j 4C3IH 1WCMG 1SROA 5IT9c 2MNAA 3CXCA 4JG2A 2HHHL 5IE8A 1X65A 3RLFA 3HKZE 3M9BA 4EQ5A 3KJOA 2YTYA 5BR8Q 1VQKA 1E1OA 1SRUA 5JEAJ 1RIPA 4X64L 3UDGA 4JI5Q 3ULPA 1X3FA 2EQSA 2F52A 1PH5A 3I4MH 1Q46A 3LGJA 4JBWA 1WJJA 4C3JH 4IOAA 3HOYH 1XMQQ 2R7ZG 1QUQA 3A74A 2ZJRA 4UY8C 2LSSA 1A63A 1WCMH 3GO5A 4DV2Q 4LFAL 5IWAL 1G51A 4WJ4A 1PH1A 3G48A 4KHZA 4B3SL 1U5KA 5M3MG 4DV1L 4GNXB 2IX0A 1IBML 2CWAA 1NY4A 2R7DA 2B63G 3M4OH 3PCOB 1K3RA 1FGUA 4LUVA 1Z47A 5LMNL 4BBRG 4GKJQ 2AMCB 3M4QA 4L5TA 5AJ3L 4LF9Q 4DR6L 4QQBX 1N36L 3AEVA 2VW9A 5JJIA 1M1KC 2R7ZH 2Z6KC 4DR4L 4H02A 4X66Q 4DV4Q 1T9HA 1LUZA 4DV7L 2I5LX 5M3MH 4HIMA 4DR5Q 3RNUA 1GM5A 2B63H 4AYBE 4JYAQ 2N78A 5GADC 1I5FA 5IYDG 4DR2Q 4BBRH 4LFCL 2ES2A 1IBKL 4LF7Q 2B29A 2ZTEA 4DR3L 2WAQG 4DK3C 3JAMc 3CCVA 2YV5A 3D0FA 4BY7H 1E3PA 5GQOA 1L2FA 3RZOH 2JJQA 2K52A 1UE1A 4OWTB 1SFOH 1A8VA 4GOPC 1P8LA 2VY3A 1PA6A 1W3SA 2YTXA 3KF8B 1K83H 3KDFA 2GVAA 3ERSX 3U4VA 1NBWA 4JI8L 3HKZG 1HZBA 1NTGA 1CKMA 2KHIA 2R7FA 4O2DA 3U4ZA 3E9IA 1AE3A 4YY3L 2AKWB 5FLXc 4X65Q 4AIMA 2MQHA 1XNQQ 4LFBQ 1XMOL 2D62A 2OQ0A 2HIVA 4UPAA 3AFQA 3T1YQ 1IBLQ 2NVXH 4UP7A 4JI6L 4YCWA 4GKKL 4XIGS 1IYJB 1KIXA 1N33Q 2JK8A 2Y0SG 1A0IA 3FP9A 5FJ8G 1Y1VH 3DLLA 3I56A 1K8AC 4DR1Q 1E1TA 1VQJA 3G6EA 4HJ5A 4BXXG 4ALPA 3EBEA 4DUYQ 1HNXL 2VUMG 4YWMA 3GTOH 4A3JG 1VQFA 4R4IA 1TWCH 4PZ7A 1S72A 1QVCA 1VQNA 2UU9Q 4BBSH 3CCSA 2VL6A 4JI4Q 5JJLA 1G291 1V43A 2D0PA 1I50H 4HIDA 3U58A 3J81c 2E5LL 4MZ9A 3PIOA 3S17H 4A3CH 2WP8J 1I94L 4OX9L 3S16H 5EAYA 4A3LG 1N32Q 3CCQA 3CC4A 4GOPB 1GKHA 1V9PA 2JA9A 4GN4B 4A3FG 1XTDA 3M4PA 1PH2A 4YHHL 4QY7A 1WYDA 3I55A 4O0AA 2GVBA 4BXXH 1VQ6A 4DR7L 2K5VA 4AYBG 5M3FH 4DV0L 1N34L 2VUMH 1L1OB 4JI1L 4A3JH 1TWFH 1YHAA 2OWOA 2AWNA 5J3BA 1H95A 3GD7A 4A3BH 2ZJQA 1VQLA 1IL2A 2K5NA 1Q1EA 2D0OA 1VQCA 5C0XI 3CMEA 4L5SA 4GNXA 2BA1A 3I2ZA 3CPWA 4L5RC 1KRSA 4UP9A 1K8GA 5BR8L 5FLMH 4OO1G 1X55A 1PYBA 3AYHB 1BKBA 4YWLA 3HOZG 2UXDQ 4P73A 1HJPA 4JBJA 3KF6B 4A3FH 1XNRQ 1YEZA 4R4CA 4JI5L 5LMUL 4NPSA 3S2DH 3ULLA 4IPCA 3F2DA 4JBMA 5M5WH 2WB1E 1K73C 2BH2A 1HNWL 4B3MQ 3CQZH 3T1HQ 1VQ8A 2QA4A 3A5ZB 2PQAB 3HOYG 1PHJA 1MJCA 3UE1A 4B3TQ 2CQOA 2UUBL 4DV5Q 1OXXK 4IFDJ 2UXCL 1GVPA 1YJNA 4DV3Q 1VQ9A 3J80c 2GN5A 3HOZH 2RHQB 2VQEQ 1B8AA 1EFWA 4GKJL 4LF9L 2Q2TA 4X6AH 2PI2E 1J5EQ 1N8RC 3S24A 2UUCQ 3G71A 2JA6H 1Q86C 1Y1WH 2JA7H 3J7A5 3PO2G 4PZ6A 4LNQA 4X66L 3CCMA 4DV4L 1PYSB 3PUXA 3PUZA 1Y14B 3CP0A 5DLQE 4POGA 4MTNA 3ICEA 2H5XA 2Y0SE 3KFUA 4NXMQ 2NN6G 1JJGA 4JI7Q 1E22A 5M5XH 4A93G 4LUZA 1VQGA 3F1ZA 1E24A 1VQ4A 3U50C 1X3EA 1X54A 5C0XG 2I5HA 4A3DG 2Z6KA 3TS2A 2ATWA 3PO2H 1YIJA 2NVYH 1Q12A 2R92G 2ASBA 4QGUA 4BY7G 2R93G 5GROA 4X62Q 1Q7YC 2UUAQ 3H15A 1TWHH 3K8AA 4DPGA 4AQYL 4JI3L 4X65L 3M85A 1FJGQ 1XNQL 4A93H 4ME3A 2AWOA 1YJWA 1G6PA 3S1QH 2K5HA 3T1YL 1FVIA 1HH2P 4A3DH 2HQLA 1WFQA 3RZDH 3F8TA 3GTPH 4GOPA 2UXBL 3GTMH 3BU2A 1N33L 1U0LA 2WB1G 4JI2L 4YCVA 2R92H 2ZM6Q 5IY0A 2R93H 5HY6A 1CSPA 4DR1L 2JA5G 1YNXA 3L2PA 4DUYL 4DAMA 2PI2A 3EIVA 1CUKA 1PFSA 2OCEA 4BA1I 1Q1BA 3BZKA 1Y1VG 4BY1G 2YU9H 4JI0Q 3JC66 4DV6Q 1NMGA 1L1OC 2F4VQ 1MKHA 2VQFQ 2KHJA 3HOXH 3M7NA 4HIOA 4B3SQ 4Y52H 5JEAG 4BBSG 2OTJA 2RCNA 3KF6A 4OWWB 4LWCA 3PGZA 1UWVA 4YCUA 3S15H 2JQOA 4P71A 4A3CG 1E7ZA 1C0AA 5LMNQ 1VCIA 3MEFA 3CAMA 2JA5H 2E8GA 1IZ6A 1GD7A 3W1BA 4BY1H 4WJ3M 1EIFA 3CCEA 2V1CC 2YTVA 1B7YB 1VQEA 4A3KG 2CFMA 1UE5A 2PQAA 5M3FG 3GTJH 1QUQB 3TREA 1KHIA 2HT1A 1VQHA 3J81i 4A3BG 3MXNB 1IXRA 2K50A 2C35B 5LMNW 4B3RL 4QL5A 2UXDL 4MNOA 2MFIA 1XNRL 1Z9FA 5FLMG 4AH6A 1SMXA 2IHEA 1KAWA 5E7NA 4A3GG 3PF5A 1GO3E 3NENA 4DAYB 4GN3B 2KCTA 2JA8H 1KXLA 3CW2C 1UE6A 1SLJA 3UDIA 4A3KH 1KL9A 1K9MC 1Q8KA 4KHPL 1FL0A 3T1HL 3TEHB 1HNZQ 2LXJA 4NXNQ 2CWPA 5GAGC 4DV5L 2K4KA 2PNHA 3PUYA 3OYYA 3PV0A 3A5UA 1M90C 4PZ8A 3CCUA 2CCZA 4KI0A 4DV3L 2NVTH 4DK6C 1S40A 1HZ9A 5IP7G 2NVQH 3E9HA 1JE5A 3A0JA 1J5EL 5K36G 4A3GH 2UUCL 1XMOQ 2K14A 5HGQA 3KOJA 1K0RA 2I5MX 1C9OA 4JI6Q 4JV5Q 3PIPA 2RF4A 4FDBA 1VQ7A 3S1MH 2IT1A 2N3SA 1OXSC 4GLXA 2E2JH 1OXVA 3CD6A 3RN2A 3OTOQ 3S1RH 2F3IA 1XMQL 1VQIA 1J6QA 1HR0Q 1Y1WG 2JA6G 2JA7G 3H3VI 4DUZQ 1LTLA 4DV2L 4LUOA 1KRTA 1OXUA 4J15A 1BVSA 4IPGA 5IYBG 1PV4A 3HOUG 2YYZA 3I7FA 4R4OA 2JEBI 4IO9A 1VQMA 3H0GG 5IP7H 3RR5A 1VQPA 4LF4Q 3PUWA 4EX5A 3B6YA 4KLKA 4R1JA 1X9NA 4LF8Q 3FKIG 1NE3A 1DGSA 1EUJA 4RG1A 3CCJA 5M5YH 2JE6I 3PO3G 1MIUA 3ER0A 2E5LQ 1HR0W 1KQSA 2JEAI 1I94Q 1JJ2A 4A3EH 1UEBA 1YITA 4IFDI 4X62L 3GTLH 2Q2HA 2UUAL 1VQDA 2N49A 4HJ8A 2B3GA 4HJ7A 5IYBH 3HOUH 4BA2I 4JOIA 2E2IH 4DR5L 2E2HH 1YZ6A 4LW1A 3H0GH 4DV0Q 1OTCA 4JYAL 2CKZB 4JI1Q 1CKOA 4QJFA 4DR2L 1QVFA 3FKIH 4JOIC 1A62A 4P75A 4TQUS 1VQOA 3STBD 4LF7L 3M3YH 3PO3H 1D7QA 3CC2A 1BBWA 3TRZA 5IP9H 2ZM6L 1PH6A 2IX1A 1B70B 3UE0A 4LF5Q 4LF6Q 3GTQH 5C4XG 1XJVA 1N9WA 1P16A 4R4QA 3F2BA 5LMUQ 1SN8A 1PH7A 1YJ9A 1TXYA 2K75A 4K0KQ 1SR3A 3L7ZC 4HIKA 4UP8A 3W1GA 4JI0L 3FHWA 1Q82C 3NEMA 4DV6L 3RLNA 1HNWQ 2F4VL 4R4TA 3KJPA 3L0OA 2IHFA 2VQFL 4QIWE 2VZAA 1QZHA 3NELA 4LFBL 1X3GA 2QEXA 3AQQA 2PMZE 3F2CA 2A19A 2UUBQ 5ELOA 1EYGA 3JAMi 1IBLL 3ZJYC 2UXCQ 5C4XH 2KENA 3K81C 4NB3A 3HOXG 1TWGH 1HZAA 5C3EG 2HHHQ 2XGTA 2HIXA 3K80C 3RLOA 4JC0A 1LYLA 1R9TH 1JMCA 4IJLA 4C2MH 1EQRA 4P72A 4PMWA 3W5OA 1V1QA 3CF5A 1EOVA 1ASYA 4X64Q 2ZTDA 2RHSB 4PG3A 1CKNB 1L1OA 2MO1A 4OXPA 5GAEC 3TS0A 3E0EA 1NMFA 1HZCA 2N8NA 2FXQA 4DNIA 3J7ZC 2Z0SA 4HJAA 4IFDG 5H1SE 1PH8A 2Q2UA 2UU9L 2XTIA 4YWKA 4JI4L 3H3VH 3TQYA 2L15A 1QVGA 4LFAQ 3HKSA 5IWAQ 3VDYA 1JT8A 2VS1A 3SGIA 5C3EH 1EQQA 4DV1Q 1IBMQ 1PH3A 1N32L 3K0XA 1EIYB 3HOWG 3KYHC 2LXKA 4HJ9A 3IRBA 2A1AA 1AE2A 2ALYB 5AJ3Q 3HOVG 4DR6Q 5ELNA 4A4IA 1HNZL 4GS3A 1N36Q 3CC7A 4NXNL 1QZGA 3CMAA 1KD1C 2JA8G 3G4SA 2EIFA 1WOCA 1LM0A 1YHBA 2WFWA 1PH4A 4DR4Q 4OO1I 5IYDH 2NZHA 4DV7Q 4AQYQ 2BA0A 4JI3Q 3K7AH 1VS0A 4Y7NH 3HOWH 2I0QA 4IPHA 3UDFA 5JJKA 2ZTCA 1YBYA 2Q2IA 1CSQA 4A3IG 3PF4A 4LFCQ 4JV5L 1IBKQ 3HOVH 4A76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPO A;  4DR3 Q;  2UXB Q;  3Q8D A;  4IJH A;  3OTO L;  1Q81 C;  2A8V A;  3CPF A;  1HR0 L;  4JI2 Q;  1I6H H;  4B3M L;  4DUZ L;  4JBK A;  1W2B A;  1SE8 A;  5C44 G;  1D8L A;  4GN5 A;  2IY5 B;  4B3T L;  4POF A;  3HFZ B;  4OON A;  4LF4 L;  1VQB A;  1OXT A;  3D31 A;  1KC8 C;  1X6O A;  4JI8 Q;  4LF8 L;  1XPU A;  3BZC A;  4L5Q A;  5GAH C;  2VQE L;  3S2H H;  2EXD A;  4A3I H;  4YY3 Q;  4GLA C;  1L0W A;  3EN2 A;  3ULJ A;  3AFP A;  1BBU A;  4C3H H;  2R6G A;  2ZJP A;  1S3O A;  1WI5 A;  3WWV A;  5C0X J;  2KCM A;  5FJ8 H;  2QGQ A;  4GLV B;  3RN5 A;  5C44 H;  3GTG H;  4GKK Q;  5C4J H;  2OTL A;  3GDE A;  2NN6 I;  4A3E G;  1ASZ A;  1JB7 A;  3PUV A;  1XPR A;  4XTC S;  1YVC A;  1RL2 A;  3GTK H;  4A3M G;  3OW2 A;  2AHO B;  3PSI A;  3STB C;  3KDF B;  4NXM L;  2DGY A;  3I4N G;  2ID0 A;  4JI7 L;  1PVO A;  3UDX A;  5IYC G;  1JJC B;  2OQK A;  3J80 i;  1HNX Q;  1VQA A;  3DM3 A;  2MO0 A;  1EWI A;  1C7Y A;  1YI2 A;  2BH8 A;  3S1N H;  1MJE A;  4A3L H;  3CCR A;  4LF6 L;  4LF5 L;  4B3R Q;  1UE7 A;  4TVA B;  4DKA C;  4GNX C;  1I3Q H;  4IPD A;  4JCV E;  4APV A;  4IOC A;  4OX9 Q;  5IP9 G;  4K0K L;  4A75 A;  1CKN A;  4A3M H;  2WAQ E;  3S14 H;  2DUD A;  4P74 A;  1AH9 A;  2KBN A;  3K7U C;  4YHH Q;  3BJU A;  1VQ5 A;  3I4N H;  4OWX B;  2VNU D;  4DR7 Q;  3I4M G;  5IYC H;  1FJG L;  3NBH B;  1TWA H;  2NZO A;  1O7I A;  1N34 Q;  4KHP Q;  3I4O A;  3KLW A;  4RMF A;  1X56 A;  1NJI C;  3CCL A;  1PH9 A;  1YHQ A;  3J81 j;  4C3I H;  1WCM G;  1SRO A;  5IT9 c;  2MNA A;  3CXC A;  4JG2 A;  2HHH L;  5IE8 A;  1X65 A;  3RLF A;  3HKZ E;  3M9B A;  4EQ5 A;  3KJO A;  2YTY A;  5BR8 Q;  1VQK A;  1E1O A;  1SRU A;  5JEA J;  1RIP A;  4X64 L;  3UDG A;  4JI5 Q;  3ULP A;  1X3F A;  2EQS A;  2F52 A;  1PH5 A;  3I4M H;  1Q46 A;  3LGJ A;  4JBW A;  1WJJ A;  4C3J H;  4IOA A;  3HOY H;  1XMQ Q;  2R7Z G;  1QUQ A;  3A74 A;  2ZJR A;  4UY8 C;  2LSS A;  1A63 A;  1WCM H;  3GO5 A;  4DV2 Q;  4LFA L;  5IWA L;  1G51 A;  4WJ4 A;  1PH1 A;  3G48 A;  4KHZ A;  4B3S L;  1U5K A;  5M3M G;  4DV1 L;  4GNX B;  2IX0 A;  1IBM L;  2CWA A;  1NY4 A;  2R7D A;  2B63 G;  3M4O H;  3PCO B;  1K3R A;  1FGU A;  4LUV A;  1Z47 A;  5LMN L;  4BBR G;  4GKJ Q;  2AMC B;  3M4Q A;  4L5T A;  5AJ3 L;  4LF9 Q;  4DR6 L;  4QQB X;  1N36 L;  3AEV A;  2VW9 A;  5JJI A;  1M1K C;  2R7Z H;  2Z6K C;  4DR4 L;  4H02 A;  4X66 Q;  4DV4 Q;  1T9H A;  1LUZ A;  4DV7 L;  2I5L X;  5M3M H;  4HIM A;  4DR5 Q;  3RNU A;  1GM5 A;  2B63 H;  4AYB E;  4JYA Q;  2N78 A;  5GAD C;  1I5F A;  5IYD G;  4DR2 Q;  4BBR H;  4LFC L;  2ES2 A;  1IBK L;  4LF7 Q;  2B29 A;  2ZTE A;  4DR3 L;  2WAQ G;  4DK3 C;  3JAM c;  3CCV A;  2YV5 A;  3D0F A;  4BY7 H;  1E3P A;  5GQO A;  1L2F A;  3RZO H;  2JJQ A;  2K52 A;  1UE1 A;  4OWT B;  1SFO H;  1A8V A;  4GOP C;  1P8L A;  2VY3 A;  1PA6 A;  1W3S A;  2YTX A;  3KF8 B;  1K83 H;  3KDF A;  2GVA A;  3ERS X;  3U4V A;  1NBW A;  4JI8 L;  3HKZ G;  1HZB A;  1NTG A;  1CKM A;  2KHI A;  2R7F A;  4O2D A;  3U4Z A;  3E9I A;  1AE3 A;  4YY3 L;  2AKW B;  5FLX c;  4X65 Q;  4AIM A;  2MQH A;  1XNQ Q;  4LFB Q;  1XMO L;  2D62 A;  2OQ0 A;  2HIV A;  4UPA A;  3AFQ A;  3T1Y Q;  1IBL Q;  2NVX H;  4UP7 A;  4JI6 L;  4YCW A;  4GKK L;  4XIG S;  1IYJ B;  1KIX A;  1N33 Q;  2JK8 A;  2Y0S G;  1A0I A;  3FP9 A;  5FJ8 G;  1Y1V H;  3DLL A;  3I56 A;  1K8A C;  4DR1 Q;  1E1T A;  1VQJ A;  3G6E A;  4HJ5 A;  4BXX G;  4ALP A;  3EBE A;  4DUY Q;  1HNX L;  2VUM G;  4YWM A;  3GTO H;  4A3J G;  1VQF A;  4R4I A;  1TWC H;  4PZ7 A;  1S72 A;  1QVC A;  1VQN A;  2UU9 Q;  4BBS H;  3CCS A;  2VL6 A;  4JI4 Q;  5JJL A;  1G29 1;  1V43 A;  2D0P A;  1I50 H;  4HID A;  3U58 A;  3J81 c;  2E5L L;  4MZ9 A;  3PIO A;  3S17 H;  4A3C H;  2WP8 J;  1I94 L;  4OX9 L;  3S16 H;  5EAY A;  4A3L G;  1N32 Q;  3CCQ A;  3CC4 A;  4GOP B;  1GKH A;  1V9P A;  2JA9 A;  4GN4 B;  4A3F G;  1XTD A;  3M4P A;  1PH2 A;  4YHH L;  4QY7 A;  1WYD A;  3I55 A;  4O0A A;  2GVB A;  4BXX H;  1VQ6 A;  4DR7 L;  2K5V A;  4AYB G;  5M3F H;  4DV0 L;  1N34 L;  2VUM H;  1L1O B;  4JI1 L;  4A3J H;  1TWF H;  1YHA A;  2OWO A;  2AWN A;  5J3B A;  1H95 A;  3GD7 A;  4A3B H;  2ZJQ A;  1VQL A;  1IL2 A;  2K5N A;  1Q1E A;  2D0O A;  1VQC A;  5C0X I;  3CME A;  4L5S A;  4GNX A;  2BA1 A;  3I2Z A;  3CPW A;  4L5R C;  1KRS A;  4UP9 A;  1K8G A;  5BR8 L;  5FLM H;  4OO1 G;  1X55 A;  1PYB A;  3AYH B;  1BKB A;  4YWL A;  3HOZ G;  2UXD Q;  4P73 A;  1HJP A;  4JBJ A;  3KF6 B;  4A3F H;  1XNR Q;  1YEZ A;  4R4C A;  4JI5 L;  5LMU L;  4NPS A;  3S2D H;  3ULL A;  4IPC A;  3F2D A;  4JBM A;  5M5W H;  2WB1 E;  1K73 C;  2BH2 A;  1HNW L;  4B3M Q;  3CQZ H;  3T1H Q;  1VQ8 A;  2QA4 A;  3A5Z B;  2PQA B;  3HOY G;  1PHJ A;  1MJC A;  3UE1 A;  4B3T Q;  2CQO A;  2UUB L;  4DV5 Q;  1OXX K;  4IFD J;  2UXC L;  1GVP A;  1YJN A;  4DV3 Q;  1VQ9 A;  3J80 c;  2GN5 A;  3HOZ H;  2RHQ B;  2VQE Q;  1B8A A;  1EFW A;  4GKJ L;  4LF9 L;  2Q2T A;  4X6A H;  2PI2 E;  1J5E Q;  1N8R C;  3S24 A;  2UUC Q;  3G71 A;  2JA6 H;  1Q86 C;  1Y1W H;  2JA7 H;  3J7A 5;  3PO2 G;  4PZ6 A;  4LNQ A;  4X66 L;  3CCM A;  4DV4 L;  1PYS B;  3PUX A;  3PUZ A;  1Y14 B;  3CP0 A;  5DLQ E;  4POG A;  4MTN A;  3ICE A;  2H5X A;  2Y0S E;  3KFU A;  4NXM Q;  2NN6 G;  1JJG A;  4JI7 Q;  1E22 A;  5M5X H;  4A93 G;  4LUZ A;  1VQG A;  3F1Z A;  1E24 A;  1VQ4 A;  3U50 C;  1X3E A;  1X54 A;  5C0X G;  2I5H A;  4A3D G;  2Z6K A;  3TS2 A;  2ATW A;  3PO2 H;  1YIJ A;  2NVY H;  1Q12 A;  2R92 G;  2ASB A;  4QGU A;  4BY7 G;  2R93 G;  5GRO A;  4X62 Q;  1Q7Y C;  2UUA Q;  3H15 A;  1TWH H;  3K8A A;  4DPG A;  4AQY L;  4JI3 L;  4X65 L;  3M85 A;  1FJG Q;  1XNQ L;  4A93 H;  4ME3 A;  2AWO A;  1YJW A;  1G6P A;  3S1Q H;  2K5H A;  3T1Y L;  1FVI A;  1HH2 P;  4A3D H;  2HQL A;  1WFQ A;  3RZD H;  3F8T A;  3GTP H;  4GOP A;  2UXB L;  3GTM H;  3BU2 A;  1N33 L;  1U0L A;  2WB1 G;  4JI2 L;  4YCV A;  2R92 H;  2ZM6 Q;  5IY0 A;  2R93 H;  5HY6 A;  1CSP A;  4DR1 L;  2JA5 G;  1YNX A;  3L2P A;  4DUY L;  4DAM A;  2PI2 A;  3EIV A;  1CUK A;  1PFS A;  2OCE A;  4BA1 I;  1Q1B A;  3BZK A;  1Y1V G;  4BY1 G;  2YU9 H;  4JI0 Q;  3JC6 6;  4DV6 Q;  1NMG A;  1L1O C;  2F4V Q;  1MKH A;  2VQF Q;  2KHJ A;  3HOX H;  3M7N A;  4HIO A;  4B3S Q;  4Y52 H;  5JEA G;  4BBS G;  2OTJ A;  2RCN A;  3KF6 A;  4OWW B;  4LWC A;  3PGZ A;  1UWV A;  4YCU A;  3S15 H;  2JQO A;  4P71 A;  4A3C G;  1E7Z A;  1C0A A;  5LMN Q;  1VCI A;  3MEF A;  3CAM A;  2JA5 H;  2E8G A;  1IZ6 A;  1GD7 A;  3W1B A;  4BY1 H;  4WJ3 M;  1EIF A;  3CCE A;  2V1C C;  2YTV A;  1B7Y B;  1VQE A;  4A3K G;  2CFM A;  1UE5 A;  2PQA A;  5M3F G;  3GTJ H;  1QUQ B;  3TRE A;  1KHI A;  2HT1 A;  1VQH A;  3J81 i;  4A3B G;  3MXN B;  1IXR A;  2K50 A;  2C35 B;  5LMN W;  4B3R L;  4QL5 A;  2UXD L;  4MNO A;  2MFI A;  1XNR L;  1Z9F A;  5FLM G;  4AH6 A;  1SMX A;  2IHE A;  1KAW A;  5E7N A;  4A3G G;  3PF5 A;  1GO3 E;  3NEN A;  4DAY B;  4GN3 B;  2KCT A;  2JA8 H;  1KXL A;  3CW2 C;  1UE6 A;  1SLJ A;  3UDI A;  4A3K H;  1KL9 A;  1K9M C;  1Q8K A;  4KHP L;  1FL0 A;  3T1H L;  3TEH B;  1HNZ Q;  2LXJ A;  4NXN Q;  2CWP A;  5GAG C;  4DV5 L;  2K4K A;  2PNH A;  3PUY A;  3OYY A;  3PV0 A;  3A5U A;  1M90 C;  4PZ8 A;  3CCU A;  2CCZ A;  4KI0 A;  4DV3 L;  2NVT H;  4DK6 C;  1S40 A;  1HZ9 A;  5IP7 G;  2NVQ H;  3E9H A;  1JE5 A;  3A0J A;  1J5E L;  5K36 G;  4A3G H;  2UUC L;  1XMO Q;  2K14 A;  5HGQ A;  3KOJ A;  1K0R A;  2I5M X;  1C9O A;  4JI6 Q;  4JV5 Q;  3PIP A;  2RF4 A;  4FDB A;  1VQ7 A;  3S1M H;  2IT1 A;  2N3S A;  1OXS C;  4GLX A;  2E2J H;  1OXV A;  3CD6 A;  3RN2 A;  3OTO Q;  3S1R H;  2F3I A;  1XMQ L;  1VQI A;  1J6Q A;  1HR0 Q;  1Y1W G;  2JA6 G;  2JA7 G;  3H3V I;  4DUZ Q;  1LTL A;  4DV2 L;  4LUO A;  1KRT A;  1OXU A;  4J15 A;  1BVS A;  4IPG A;  5IYB G;  1PV4 A;  3HOU G;  2YYZ A;  3I7F A;  4R4O A;  2JEB I;  4IO9 A;  1VQM A;  3H0G G;  5IP7 H;  3RR5 A;  1VQP A;  4LF4 Q;  3PUW A;  4EX5 A;  3B6Y A;  4KLK A;  4R1J A;  1X9N A;  4LF8 Q;  3FKI G;  1NE3 A;  1DGS A;  1EUJ A;  4RG1 A;  3CCJ A;  5M5Y H;  2JE6 I;  3PO3 G;  1MIU A;  3ER0 A;  2E5L Q;  1HR0 W;  1KQS A;  2JEA I;  1I94 Q;  1JJ2 A;  4A3E H;  1UEB A;  1YIT A;  4IFD I;  4X62 L;  3GTL H;  2Q2H A;  2UUA L;  1VQD A;  2N49 A;  4HJ8 A;  2B3G A;  4HJ7 A;  5IYB H;  3HOU H;  4BA2 I;  4JOI A;  2E2I H;  4DR5 L;  2E2H H;  1YZ6 A;  4LW1 A;  3H0G H;  4DV0 Q;  1OTC A;  4JYA L;  2CKZ B;  4JI1 Q;  1CKO A;  4QJF A;  4DR2 L;  1QVF A;  3FKI H;  4JOI C;  1A62 A;  4P75 A;  4TQU S;  1VQO A;  3STB D;  4LF7 L;  3M3Y H;  3PO3 H;  1D7Q A;  3CC2 A;  1BBW A;  3TRZ A;  5IP9 H;  2ZM6 L;  1PH6 A;  2IX1 A;  1B70 B;  3UE0 A;  4LF5 Q;  4LF6 Q;  3GTQ H;  5C4X G;  1XJV A;  1N9W A;  1P16 A;  4R4Q A;  3F2B A;  5LMU Q;  1SN8 A;  1PH7 A;  1YJ9 A;  1TXY A;  2K75 A;  4K0K Q;  1SR3 A;  3L7Z C;  4HIK A;  4UP8 A;  3W1G A;  4JI0 L;  3FHW A;  1Q82 C;  3NEM A;  4DV6 L;  3RLN A;  1HNW Q;  2F4V L;  4R4T A;  3KJP A;  3L0O A;  2IHF A;  2VQF L;  4QIW E;  2VZA A;  1QZH A;  3NEL A;  4LFB L;  1X3G A;  2QEX A;  3AQQ A;  2PMZ E;  3F2C A;  2A19 A;  2UUB Q;  5ELO A;  1EYG A;  3JAM i;  1IBL L;  3ZJY C;  2UXC Q;  5C4X H;  2KEN A;  3K81 C;  4NB3 A;  3HOX G;  1TWG H;  1HZA A;  5C3E G;  2HHH Q;  2XGT A;  2HIX A;  3K80 C;  3RLO A;  4JC0 A;  1LYL A;  1R9T H;  1JMC A;  4IJL A;  4C2M H;  1EQR A;  4P72 A;  4PMW A;  3W5O A;  1V1Q A;  3CF5 A;  1EOV A;  1ASY A;  4X64 Q;  2ZTD A;  2RHS B;  4PG3 A;  1CKN B;  1L1O A;  2MO1 A;  4OXP A;  5GAE C;  3TS0 A;  3E0E A;  1NMF A;  1HZC A;  2N8N A;  2FXQ A;  4DNI A;  3J7Z C;  2Z0S A;  4HJA A;  4IFD G;  5H1S E;  1PH8 A;  2Q2U A;  2UU9 L;  2XTI A;  4YWK A;  4JI4 L;  3H3V H;  3TQY A;  2L15 A;  1QVG A;  4LFA Q;  3HKS A;  5IWA Q;  3VDY A;  1JT8 A;  2VS1 A;  3SGI A;  5C3E H;  1EQQ A;  4DV1 Q;  1IBM Q;  1PH3 A;  1N32 L;  3K0X A;  1EIY B;  3HOW G;  3KYH C;  2LXK A;  4HJ9 A;  3IRB A;  2A1A A;  1AE2 A;  2ALY B;  5AJ3 Q;  3HOV G;  4DR6 Q;  5ELN A;  4A4I A;  1HNZ L;  4GS3 A;  1N36 Q;  3CC7 A;  4NXN L;  1QZG A;  3CMA A;  1KD1 C;  2JA8 G;  3G4S A;  2EIF A;  1WOC A;  1LM0 A;  1YHB A;  2WFW A;  1PH4 A;  4DR4 Q;  4OO1 I;  5IYD H;  2NZH A;  4DV7 Q;  4AQY Q;  2BA0 A;  4JI3 Q;  3K7A H;  1VS0 A;  4Y7N H;  3HOW H;  2I0Q A;  4IPH A;  3UDF A;  5JJK A;  2ZTC A;  1YBY A;  2Q2I A;  1CSQ A;  4A3I G;  3PF4 A;  4LFC Q;  4JV5 L;  1IBK Q;  3HOV H;  4A76 A; 
#chains in the Genus database with same CATH topology
 3N52 A;  1XPO A;  4DR3 Q;  1EUC B;  1QNU A;  3Q8D A;  3H20 A;  1SFO B;  2A8V A;  3CPF A;  1HR0 L;  1GHK A;  4JI2 Q;  5E4W C;  1SNP A;  2W9C B;  4JI6 H;  5C44 G;  2F0T A;  1SE2 A;  4B3T L;  3AMU A;  4LF4 L;  4OON A;  4O3P A;  4KY5 A;  3OTO H;  1HFN A;  4LH6 A;  1DXM A;  1N48 A;  2C2R A;  4ED7 A;  3BZC A;  3I3C A;  3RIZ A;  5GAH C;  1B2T A;  2WB1 B;  3EN2 A;  4LF8 H;  5HUR A;  1D5Z C;  2R6G A;  1S3O A;  1WI5 A;  3RMH A;  5FJ8 H;  5JJZ A;  2XIW A;  3RN5 A;  3GTG H;  1GSH A;  1XTC D;  5CGK A;  2OTL A;  1ASZ A;  1JB7 A;  1B44 D;  3GTK H;  3BDC A;  3A7L A;  3K3P A;  4RZR A;  1IL8 A;  4WBN F;  5FPR A;  3UDX A;  1BO0 A;  3AU7 A;  3DM3 A;  2ASD A;  2XCL A;  4LSX A;  4HCS A;  3S17 B;  5IGG A;  4LF6 L;  4LF5 L;  1F9P A;  1UE7 A;  4TVA B;  2DLN A;  1I3Q H;  4FXK C;  4IPD A;  3PZP A;  3TP8 A;  2CW0 C;  4A75 A;  3PW5 A;  5JPN C;  5M3F B;  2XRS D;  2NU9 B;  2DUD A;  4P74 A;  4A3J B;  1AH9 A;  4YHH Q;  1WCM A;  5ELD A;  4JV1 A;  3NBH B;  4K0K H;  2NZO A;  1O7I A;  2N55 A;  4RMF A;  4OIK A;  1PH9 A;  3CCL A;  3EVQ A;  4C3I H;  3VA7 A;  1WCM G;  1TWG A;  1FJG H;  3Q8S B;  1SYF A;  3BA8 A;  1X65 A;  4A3F B;  1L0Y B;  1PFB A;  5BR8 Q;  2UXC H;  2HJW A;  1ENF A;  4X64 L;  2NUA B;  4JI5 Q;  1FKA H;  1X3F A;  5EPK A;  3LGJ A;  2CH4 A;  4JBW A;  2CW0 D;  4L8J A;  4C3J H;  2CHB D;  3HOY H;  2R7Z G;  2NTT A;  1ZKO A;  2VB2 X;  3EFX D;  2LSS A;  3MHB A;  1F2L A;  1W96 A;  4LFA L;  3J81 W;  1G51 A;  1DON A;  4PNY A;  2RCF A;  3G48 A;  4B3S L;  5KG4 A;  3VPC A;  4DV1 L;  5EKI A;  4GNX B;  3VPD A;  4DL7 A;  2CWA A;  1NY4 A;  3OSP A;  3M4O H;  2K7V A;  1Z47 A;  2FB9 A;  4RH6 A;  4DAY A;  2JSO A;  5ELB A;  1AEX A;  4L5T A;  3MEH A;  5AJ3 L;  1SFO A;  1IBM H;  2W9C A;  1Y1W B;  4EYH B;  4QQB X;  4XXE A;  4R8I A;  4OEL B;  2VW9 A;  5C3W A;  2L0C A;  1GGO A;  5LMN H;  4CC5 A;  1RYR A;  2ZXR A;  5KG0 A;  4ED3 A;  3E5S A;  3HS0 C;  4FF4 A;  4DR6 H;  2NN6 H;  5LL6 b;  3QZ8 A;  1LUZ A;  1SMY C;  4XYM B;  1Q90 A;  4HIM A;  1ET9 A;  3MTS A;  4I65 A;  5GAD C;  1A6X A;  4DR4 H;  1FNV A;  4ODG A;  4DV7 H;  2W6M A;  2B29 A;  2ZTE A;  3HB9 A;  4DK3 C;  3KAJ A;  1S5C D;  1GSA A;  1E3P A;  5CR3 A;  3CVZ A;  3RZO H;  3BJY A;  4CJ1 B;  4OWT B;  4J9O A;  4DR3 H;  4UCU A;  2YTX A;  1AW7 A;  2GVA A;  2B8F A;  1J8I A;  1VMC A;  5CBA E;  5IGE A;  5KG3 A;  2UVR A;  2E75 C;  4YY3 L;  1AE3 A;  5FLX c;  4A3D B;  2MQH A;  3V6H A;  3J7A K;  3MFI A;  4UCV A;  1HTL D;  2FP4 B;  4JPB W;  1XMO L;  3GTP B;  3IG0 A;  1VF7 A;  3AFQ A;  4UP7 A;  2R92 B;  3GTG A;  2SNM A;  2DY7 A;  2XIG A;  4XIG S;  2R93 B;  1N33 Q;  3GTK A;  4QCL A;  5C1O A;  1UUP A;  2XRQ D;  3FP9 A;  5FJ8 G;  1IOW A;  3N44 B;  3T4A C;  2PZU A;  3NBH A;  4DR1 Q;  1E1T A;  3G6E A;  3GTO H;  4A3J G;  2EJF C;  4MV4 A;  3HOX B;  5JJL A;  1AP0 A;  1V4Y A;  3PIO A;  3BAB A;  4J9L A;  4A3C H;  2QDB A;  4KY7 A;  3S16 H;  3RV3 A;  1A9X A;  1V9P A;  2JA5 B;  4U68 A;  4A3F G;  1KJ8 A;  2OXP A;  2E5L H;  2F0Q A;  4I50 F;  4ZQ3 A;  2O2L D;  4G7O C;  1N34 L;  3LWU A;  1SJH D;  2VUM H;  2O03 A;  4CKC A;  2OWO A;  1TWF H;  1YHA A;  2AWN A;  5J3B A;  3LWE A;  1H95 A;  4YAJ B;  5KFU A;  2EY5 A;  1VQL A;  4YHH H;  1Q1E A;  1D1K A;  1W6J A;  2F0O A;  4K8I A;  3TDQ A;  4GNX A;  1O78 A;  3I2Z A;  3R93 A;  1IKL A;  4K2K A;  4WOR A;  4O3S A;  5LP6 F;  2R85 A;  1KBL A;  1X55 A;  1PYB A;  1BKB A;  5G3L F;  5KKN B;  2UXD Q;  2A6E C;  2VA3 A;  1GLV A;  1V51 A;  5LMU L;  1QIL A;  3WO1 A;  5KT6 A;  1SDF A;  1KTK A;  3NWS A;  4A3K B;  5BR8 H;  3ULL A;  4IPC A;  4HYK A;  5CV7 A;  3C1E A;  3KBX A;  2GPS A;  2OH2 A;  1S5D D;  4RAY A;  1EZ8 A;  5M5W H;  1K73 C;  4CC6 A;  5FD6 A;  4JI5 H;  2BOS A;  5I4D A;  2PQA B;  3HOY G;  4B3T Q;  2KEE A;  2UUB L;  4MHE A;  4DV5 Q;  2NVQ B;  2PW7 A;  4HMJ A;  3D6C A;  1RJP A;  4DV3 Q;  3HOZ H;  3D6W A;  3P7J A;  4H44 C;  2AGQ A;  1EFW A;  4LF9 L;  5KEE A;  1Y8P B;  3D8G A;  4PMB A;  1STE A;  1Y8N B;  1WTO A;  4X6A H;  2B2V C;  4MN3 A;  1N8R C;  4QIW B;  2V58 A;  2L9H A;  4LNQ A;  1WVL A;  2JXM B;  2NUC A;  4JV2 A;  3PIO 3;  3PUZ A;  1JB3 A;  1Y14 B;  1ESF A;  3CP0 A;  4MTN A;  4S3S A;  1LTR D;  2NN6 G;  1JJG A;  4KKT A;  2LMC B;  3OHX C;  3DMU A;  1VQ4 A;  3GIM A;  5EKL A;  1X54 A;  2I07 B;  2R92 A;  2I5H A;  4A3D G;  2BE5 C;  2EY2 A;  2R93 A;  4ZUJ A;  1PRT F;  3PO2 H;  3VR6 A;  1XDN A;  2R92 G;  2ASB A;  2E2I B;  2R93 G;  2B2T A;  2K01 A;  5KFZ A;  1Q7Y C;  4XX0 B;  2F0M A;  1BNC A;  1TWH H;  4AQY L;  3GV8 B;  4JI3 L;  2IWH A;  1TKW B;  3R5F A;  1S0N A;  4ME3 A;  4PDB A;  4O1N A;  4DK0 A;  1YJW A;  4RKL A;  2OLS A;  2W7O A;  2B2W C;  3S1Q H;  2K5H A;  3T1Y L;  1IYV A;  4IWX A;  2IP4 A;  3QO2 A;  1WFQ A;  2OEO A;  5IIF A;  4EQO A;  4QWB A;  1Q8I A;  1SNM A;  2A68 C;  3V05 A;  3BU2 A;  5E3F A;  3C46 A;  5EDW A;  2JA5 A;  4X3U A;  2EYF A;  4XQQ A;  2FFK B;  3HEJ A;  2Q8R E;  2HGS A;  1CSP A;  2EPB A;  2DY8 A;  2JA5 G;  1N33 H;  4DGZ A;  1CFM A;  1CUK A;  2OCE A;  3MC0 B;  4BA1 I;  1Q1B A;  4C1N I;  1U4P A;  4JI0 Q;  4DR1 H;  3J80 W;  4O3R A;  5IGF A;  5E1F A;  2F0L A;  2F4V Q;  1MKH A;  2KHJ A;  4F50 A;  4B3S Q;  4O2B F;  4Y52 H;  4TV8 F;  5JEA G;  5L37 A;  2RDF A;  2OTJ A;  1R9T B;  4BWG B;  4YCU A;  2JQO A;  4P71 A;  4A3C G;  1A2T A;  4K5W A;  1C0A A;  1UC8 A;  4ED2 A;  2E8G A;  4R8N A;  1TWF A;  5L1J A;  1ZHS A;  4BY1 H;  3WO0 A;  4WJ3 M;  4A3K G;  1EWC A;  2CFM A;  2PQA A;  2YYA A;  3SDZ A;  3TRE A;  3HG9 A;  2HT1 A;  3BVZ A;  1IYU A;  2L11 A;  5FLX L;  1AN7 A;  3MXN B;  1C8C A;  4QL5 A;  2FMM A;  5LHY 1;  4TQR A;  2W6Q A;  5HV6 A;  1DZ1 A;  5FO9 B;  4AH6 A;  3GID A;  1KAW A;  4G7H C;  3PF5 A;  5IOD A;  2UXD H;  1Z2P X;  4L6T B;  5I2X A;  1KXL A;  1B53 A;  1UE6 A;  5BN5 A;  1DOK A;  1UAP A;  1FL0 A;  3QIA A;  4O4I F;  3J7Y W;  2CWP A;  2XNA C;  3VPB A;  1XX8 A;  2K4K A;  2CCZ A;  1I7N A;  1EY7 A;  3HOW B;  2WAQ B;  1S40 A;  2EZV A;  2FKL A;  5A2Q E;  4DV5 H;  2R87 A;  3K5I A;  1JE5 A;  4A3G H;  3G6X A;  4CDD C;  5C6A A;  1XMO Q;  4DV3 H;  5HGQ A;  1K0R A;  1LAB A;  2WKD A;  1STH A;  3OMC A;  3PIP A;  4JV5 Q;  2FMC A;  3VA5 A;  2N3S A;  1OXS C;  2E2I A;  3R5X A;  2A74 C;  4UDU C;  1XMQ L;  2F3I A;  3SK6 A;  1VQI A;  3H3V I;  4LK1 C;  3L9A X;  4IPG A;  1PV4 A;  2Z1C A;  2JEB I;  2K04 A;  5IP7 H;  4TV9 F;  3JAM E;  4A3I B;  1JWU D;  4DV2 H;  1T5E A;  5DGB A;  1X9N A;  1IOV A;  1ZYR C;  5D3I B;  1EUJ A;  5M5Y H;  2V9W A;  4C3H B;  3ER0 A;  4QWD A;  4A3E H;  1GUT A;  1J9O A;  2Q2H A;  1D2B A;  3FDS A;  2N49 A;  5J22 A;  4HJ8 A;  4DR5 L;  2NWG A;  2E2H H;  1M4V A;  1KNA A;  3H0G H;  1Y69 U;  4ED6 A;  2NBF A;  1PLF A;  2AQ4 A;  4QJF A;  4DR2 L;  2EOT A;  4TQU S;  4JOI C;  1HA6 A;  2R8J A;  3STB D;  3M3Y H;  3PO3 H;  1D7Q A;  5KT2 A;  1ZEQ X;  4H0L C;  1BNZ A;  1WR2 A;  1OO9 B;  2ZM6 L;  5COY A;  1CQF A;  4AYB B;  1XJV A;  1N9W A;  3IKJ A;  1ZYR D;  2WV6 D;  3D4W A;  3JSL A;  1PH7 A;  5LMU Q;  2FPG B;  1YJ9 A;  1TXY A;  3SXH A;  1EY9 A;  3NP8 A;  1TWA B;  4DL3 A;  3W2D A;  3RLN A;  3V2T A;  1QZH A;  1AFP A;  2YZN A;  3NEL A;  2EYO A;  1X3G A;  3M9N B;  1K0S A;  1S97 A;  2JEJ A;  3PIP 3;  1EY0 A;  2UUB Q;  3H3V C;  4JI0 H;  3JAM i;  2F4V H;  4U67 3;  1HZA A;  1O7Z A;  4LFB H;  1SEB D;  1TR5 A;  3RLO A;  4B3S H;  1LYL A;  1JMC A;  4IJL A;  4C2M H;  2TMP A;  4PMW A;  2ZDG A;  3RD4 A;  4N8X 1;  1NMF A;  2FXQ A;  2R7L A;  1Q3L A;  3GIJ A;  1SNQ A;  1PH8 A;  3Q24 A;  1JOR A;  4JI4 L;  4YBZ B;  4A2A A;  5LYJ F;  2WII B;  1CQV A;  5IWA Q;  4MA5 A;  2VS1 A;  4EGQ A;  1YNN C;  2NB0 A;  3PQI A;  3HOW G;  4L63 B;  4ME5 A;  1E4G T;  1FD7 D;  5T14 A;  1SCU B;  5I47 A;  3IRB A;  3K5L A;  2A1A A;  3JZI A;  2HDL A;  3QB3 A;  4IHJ F;  1E4F T;  1N36 Q;  3ND9 A;  3CMA A;  1QZG A;  4MIU A;  3UQ8 A;  2I87 A;  5EKK A;  4L1K A;  2IA6 A;  1WOC A;  4RAU C;  2B63 B;  1H9S B;  3BZD B;  3OSN A;  3SR1 A;  5JPM C;  5IYD H;  1DOL A;  1LTB D;  4IQZ A;  5KG1 A;  4AQY Q;  4O3N A;  4JI3 Q;  1CHP D;  3K7A H;  4BBR B;  2F0J A;  3R2T A;  4Y7N H;  3MFG A;  2I0Q A;  4HQ6 A;  4HR7 A;  1LT4 D;  5EZY F;  4A3I G;  1CSQ A;  3QG1 A;  2AQ1 B;  3DWP A;  1D1I A;  1IBK Q;  4LFC Q;  3HOV H;  4BY7 B;  2PMZ A;  4FNF A;  4IJH A;  1Q81 C;  1JLL B;  2ICE C;  4C3H G;  5JAV A;  3MR5 A;  1VBG A;  1I6H H;  4DUZ L;  4JBK A;  1W2B A;  4JV5 H;  1K83 B;  4TSS A;  1K1S A;  1B6S A;  1D8L A;  2YS7 A;  1SJE D;  4Q43 A;  5CAE B;  1MHW C;  4POF A;  3GIP A;  4F7X A;  1K3B C;  1VQB A;  1F2M A;  3MZ5 A;  1OXT A;  3D31 A;  4KJO A;  1EOT A;  4JI8 Q;  1XPU A;  3BQ2 A;  2QK4 A;  1M6V A;  1DIK A;  1L0W A;  3ULJ A;  2HVQ A;  2FLP A;  1JIH A;  1K1Q A;  3AFP A;  1GUN A;  2KOL A;  1DCZ A;  2VOB A;  2VQE H;  2M05 A;  2WIN B;  1A63 A;  3WWV A;  4GKK Q;  2KCM A;  2QGQ A;  4GLV B;  5C44 H;  2JYO A;  5C4J H;  3NGD A;  2NN6 I;  4A3E G;  1TWA A;  3H0G A;  3PUV A;  1RL2 A;  3EJI A;  2AHO B;  4NXM L;  4Q44 A;  2K28 A;  3CRK C;  2ZXP A;  1JJC B;  2OQK A;  1HNX Q;  3GV6 A;  3V4S A;  2ASL A;  1I50 B;  1YI2 A;  1WD0 A;  1MJE A;  4A3L H;  1IHZ A;  3CCR A;  4JI7 H;  5I6Y A;  3RB4 A;  4GNX C;  1HQM C;  1ULZ A;  2Y0S B;  4RCN A;  4OX9 Q;  2VQD A;  4RB3 C;  1R4P B;  3S14 H;  5EPL A;  1KAB A;  3K7U C;  1VQ5 A;  3BJU A;  4J8Q A;  3RUZ A;  4OWX B;  4I7A A;  4DR7 Q;  3GIK A;  4EYI B;  5FLX W;  1JC7 A;  2DJG C;  3I4O A;  1X56 A;  5C3X A;  3J81 j;  2M00 A;  1LLR D;  1AZQ A;  4PQX A;  1SRO A;  5IT9 c;  5EOY A;  4OO1 H;  3BDL A;  3CXC A;  1I4X A;  3R2I A;  4P2C B;  2HHH L;  3RLF A;  1FGB D;  3BA9 A;  4C2M A;  3KJO A;  5CYU A;  1HA5 A;  2YTY A;  2R8G A;  1SRU A;  5JEA J;  5A35 A;  4IR9 A;  1RIP A;  3S2D B;  3NXW A;  2R7K A;  3PN1 A;  3G7L A;  5C5M A;  3ULP A;  1KC7 A;  2EQS A;  2BCO A;  3Q22 A;  3IL8 A;  2B63 A;  2Q8T A;  1XMQ Q;  4UCO A;  2B2Y A;  3OUZ A;  1PZK D;  1WCM H;  3RBE A;  5ISR A;  5BPH A;  4UHV A;  3M4I A;  2B63 G;  1JE4 A;  2R7D A;  2VUG A;  1X3P A;  3M9M B;  4LUV A;  3BAA A;  5IWA H;  1JDB B;  2JEF A;  4BBR G;  2RQX A;  1MD2 D;  2AUJ D;  3A8K E;  2JA7 B;  2EY1 A;  5KFO A;  1I4R A;  5FO7 B;  1K83 A;  2J0T D;  4KHV A;  1TA8 A;  2R7Z H;  4Q0F A;  3EPI A;  4H02 A;  2F0U A;  4X66 Q;  5D1P A;  1GUO A;  4DV4 Q;  4NDX A;  1N36 H;  3ETJ A;  4DR5 Q;  1GM5 A;  3Q8P B;  3RNU A;  2JN4 A;  4TKO B;  2N78 A;  3SHL A;  1I5F A;  2B2T C;  3BVM A;  5IYD G;  4DR2 Q;  1KJJ A;  2EYM A;  4C56 C;  1BBX C;  3R23 A;  4AQY H;  3V6J A;  1RK6 A;  3ONA B;  3JAM c;  2YS6 A;  4J9M A;  4J9N A;  5GQO A;  4LFC H;  1AUV A;  1JDE A;  3TIN A;  2BQ3 A;  1IBK H;  1SFO H;  3HKZ A;  1PA6 A;  1EY5 A;  5I9O A;  1NSN S;  5FPO A;  3TBI B;  3U4V A;  2F0D A;  4A93 B;  3HKZ G;  1CKM A;  3HP3 A;  3E9I A;  4AIM A;  1XNQ Q;  1RK5 A;  3RB6 A;  4LJZ C;  2F0I A;  4EFB A;  2D62 A;  2OQ0 A;  3OWF A;  4JI8 H;  2LY7 A;  1VKZ A;  2NVX H;  3Q1K A;  4Q8F A;  4YCW A;  2IL8 A;  1XXG A;  1IYJ B;  4HMI A;  1KIX A;  4KD3 A;  4IRD A;  5CV8 A;  1CI3 M;  1ICW A;  2Y0S G;  1LV9 A;  1A0I A;  5HBR B;  5KFW A;  1AUX A;  4GKK H;  1K8A C;  1O7Y A;  4OHJ A;  3RBD A;  4HJ5 A;  1JOK A;  4DUY Q;  3ETH A;  4YWM A;  1PFM A;  2PO4 A;  4R4I A;  1QVC A;  1VQN A;  4HAE A;  1DV2 A;  4JI4 Q;  1V43 A;  1HNX H;  4HID A;  3FPP A;  3S17 H;  2NVX B;  2XGP A;  2WP8 J;  1I94 L;  3UFX B;  4ZI7 F;  5CA0 F;  4A3L G;  2NZ1 D;  4KMU C;  2XGQ A;  4QW8 A;  4GN4 B;  5KFP A;  1XTD A;  5JUM A;  3M4P A;  1WYD A;  3NTK A;  4O0A A;  4E6I A;  4ZRZ A;  4OX9 H;  1VQ6 A;  5M3F H;  4DV0 L;  1S5F D;  4C5B A;  5KG5 A;  4WRD A;  5JVH 3;  1L1O B;  4JI1 L;  1F9S A;  4A3J H;  1EYZ A;  4A3B H;  2ZJQ A;  4L5S A;  1VQC A;  3CME A;  4DR7 H;  1PYW D;  5L1K A;  3KBG A;  2C28 A;  4L5R C;  4OO1 G;  3OW7 A;  3AYH B;  4YWL A;  1PTO B;  4A3F H;  1HJP A;  4JBJ A;  4DNT B;  5KFA A;  1TY0 A;  3LX0 A;  3F2D A;  1I4P A;  1L2Z A;  4JBM A;  3RB0 A;  1JOO A;  2BH2 A;  2DZD A;  1HNW L;  3KXY T;  2PPB C;  4A3B B;  3T1H Q;  1VQ8 A;  1T3N A;  1UEA B;  2QA4 A;  3RGX A;  1PHJ A;  1MJC A;  3UE1 A;  4DL4 A;  1OXX K;  5KFE A;  3MR6 A;  5BPF A;  5E4X A;  3M9O B;  1ML0 D;  2RHQ B;  4GKJ L;  1B8A A;  1H9R A;  4RZQ A;  2H1E A;  4NMZ A;  2Q2T A;  1W93 A;  2WYO A;  2KHS A;  2UUC Q;  2NYZ D;  2R7Z A;  3G71 A;  2E2J B;  1Y1W H;  3J7A 5;  1V1O A;  3CCM A;  4MTK A;  4J1M A;  3PUX A;  1MGS A;  2W71 A;  5ELF A;  4POG A;  1QCB D;  4XZ3 B;  4KK7 A;  5KYI A;  4X66 H;  4NXM Q;  5IT9 L;  4DV4 H;  4DR5 H;  4A93 G;  4G4K A;  3F1Z A;  1QNK A;  4RB2 C;  2N88 A;  2RDG A;  5C0X G;  2EJG C;  2Z6K A;  2EJM A;  2ATW A;  5COR A;  3U9T A;  1X32 A;  3GTL B;  1KAA A;  3HOU B;  2X0S A;  1M0W A;  2B39 A;  4R8U B;  5GRO A;  4X62 Q;  3H15 A;  1KLU D;  3K8A A;  3J81 E;  4X65 L;  5KFV A;  3FKI B;  1LTA D;  2YZM A;  2AWO A;  2KCN A;  2EXZ A;  2WB1 A;  2NVX A;  1A3T A;  1VBH A;  1FVI A;  4A3D H;  5FO8 B;  5DLF A;  1LTT D;  4J9Q A;  4ECT A;  3F8T A;  1XNQ H;  1QB5 D;  1S4Z A;  3GTP H;  3GTQ B;  2UXB L;  2F4I A;  2WB1 G;  2R92 H;  1A2U A;  2R93 H;  3V4Z A;  4LSA A;  3SI8 A;  1PFN A;  2FE3 A;  3BG3 A;  1V8Q A;  3L2P A;  3TQ1 A;  2HDM A;  4DL5 A;  2PI2 A;  3OUU A;  4JI2 H;  5C5L A;  3JC6 6;  1H9J A;  4DUY H;  3HOX H;  1WTH A;  4F8M A;  3X3M A;  1CK1 A;  4CDE C;  4JI4 H;  4OWW B;  3CHB D;  3TN2 A;  5DG8 A;  1KJI A;  1E7Z A;  5I9P A;  3MWM A;  1VCI A;  1SNC A;  3MEF A;  4DL2 A;  2JA5 H;  1IZ6 A;  2W70 A;  3W1B A;  5BMV F;  2L12 A;  4HCE A;  3CCE A;  2V1C C;  4YB8 B;  5DQI A;  3A55 A;  2K1B A;  1UE5 A;  5M3F G;  1JCK B;  1QUQ B;  2EYL A;  1JWS D;  1TT2 A;  3J81 i;  1S5E D;  3A8J E;  4A3B G;  5JEA H;  2K50 A;  1T94 A;  4B3R L;  4RGN A;  2ZDQ A;  4QW9 A;  2MFI A;  3U9S A;  5DM7 3;  4DK1 A;  1XNR L;  2WTF A;  5D3D A;  4ED1 A;  5H80 A;  1SMX A;  4KV6 A;  3NEN A;  4FF2 A;  2EYH A;  3CW2 C;  3WOF A;  4A3K H;  1KL9 A;  2CZG A;  2G9D A;  4KHP L;  4ED8 A;  4MA0 A;  2M9V A;  2F0W A;  2LXJ A;  3ITP A;  4NXN Q;  1S10 A;  4JVZ A;  3A5U A;  3PV0 A;  3G6V A;  4PZ8 A;  1LAC A;  2IPK D;  4KI0 A;  4ZUI A;  3T1H H;  4DK6 C;  1HZ9 A;  2NVQ H;  4RGM A;  3E9H A;  3IFD A;  3A0J A;  1J5E L;  3FVQ A;  2MP1 A;  1WD1 A;  4BWS C;  3H4B A;  1SBB B;  3KOJ A;  3GV5 B;  1LT6 D;  5J1Z A;  5CBE E;  1Y1W A;  1HUN A;  4FXG C;  4RWS C;  3CD6 A;  2UUC H;  5DGA A;  5EBD A;  1HR0 Q;  1J6Q A;  1Y1W G;  4MV6 A;  4RU9 A;  1LTL A;  1O80 A;  5KYL A;  5IYB G;  3HOU G;  2YYZ A;  3I7F A;  4R4O A;  1VQM A;  4LF4 Q;  3S2H B;  1S03 G;  4QUF A;  2R8H A;  4KLK A;  4R1J A;  3MR3 A;  4NXM H;  5I2Y A;  3FKI G;  1NE3 A;  3GTQ A;  4ECR A;  5LXT F;  2KEC A;  2JE6 I;  3DXJ C;  4YQW A;  1HR0 W;  2JEA I;  1I94 Q;  1G8Z D;  1GUS A;  1A3V A;  1TII D;  1EQV A;  4FVM A;  4X3T A;  2UUA L;  2FK3 A;  4MV7 A;  2KSW A;  2XSC A;  2E2I H;  4JYA L;  4DV0 Q;  1Y8O B;  2CKZ B;  4JI1 Q;  4X62 H;  1EIG A;  3HRZ C;  1K8M A;  1QVF A;  3N8D A;  5KNB A;  1A62 A;  2WE6 A;  3S1N B;  3NUC A;  4O2A F;  4YJ3 F;  4APM A;  1M0T A;  4RUA A;  2RGR A;  5KFQ A;  3GTP A;  1WH2 A;  1BBW A;  2W6Z A;  3TRZ A;  4I7Z C;  5K5P A;  5I6W A;  1PH6 A;  3O13 A;  4LF6 Q;  4LF5 Q;  4HNV A;  2J7Z A;  1EEF D;  1ENA A;  1FNU A;  4A3M B;  4R4Q A;  1SN8 A;  3QJY A;  3I4N B;  3OPO A;  3W1G A;  4DV6 L;  4F4Z A;  3VR4 A;  3F8N A;  4HTH A;  1RF2 D;  1HNW Q;  4RNM A;  3L0O A;  2F0P A;  2IHF A;  2Z9H A;  2VZA A;  4F87 A;  5IOC A;  4IAL A;  2K33 A;  2VQF L;  1WTP A;  2PMZ E;  2DWC A;  3DF7 A;  5ELO A;  2P5Z X;  3JSN A;  1IBL L;  1S68 A;  2KEN A;  3HOX G;  4FBT A;  2HIX A;  5LOV F;  4EBC A;  1R9T H;  4QWC A;  4P72 A;  1RKN A;  1V1Q A;  1ASY A;  3I4M B;  4X64 Q;  1CKN B;  3MWD A;  4WD3 A;  2MO1 A;  3PMF A;  5GAE C;  1DM0 B;  4DNI A;  4JV0 A;  3J7Z C;  2Z0S A;  4IFD G;  5H1S E;  1DYQ A;  4TRD A;  2Q2U A;  2UU9 L;  4YWK A;  5G3L D;  4LFA Q;  3VDY A;  1B33 N;  3TP6 A;  1EQQ A;  1U9R A;  4DV1 Q;  1N32 L;  2O5I C;  2CW8 A;  3K5N A;  3K0X A;  1EIY B;  4DAP A;  2LXK A;  1KJ9 A;  2R6F A;  4UCS A;  2CQA A;  1AE2 A;  1QJO A;  1SAP A;  5AJ3 Q;  3N6X A;  4FM9 A;  5ELN A;  1HNZ L;  5CB4 F;  4GS3 A;  2EIF A;  5IT9 W;  5M3M B;  1PH4 A;  4XYQ A;  4OO1 I;  3J80 E;  1JX4 A;  1PRT C;  3CKI B;  2OF1 A;  4NXN H;  2E2D C;  3EYY A;  1GXD C;  1VS0 A;  3HOW H;  4J6H A;  4G3I A;  2F0G A;  1B9M A;  2W6P A;  2P0A A;  5JJK A;  5KT3 A;  4MTE A;  4QWA A;  3PF4 A;  4QIW A;  4A76 A;  3T5J A;  2UXB Q;  3OTO L;  3CRL C;  3OIQ A;  4B3M L;  4C5A A;  1SE8 A;  3ORQ A;  3PW4 A;  4LH7 A;  3HFZ B;  5FKA C;  5C1P A;  1SYE A;  2D5D A;  1HR0 H;  3DHQ A;  1RJQ A;  1Z6H A;  2Q8I B;  4B08 A;  1X6O A;  1KC8 C;  4LF8 L;  4L5Q A;  2C2D A;  4B3T H;  1QWY A;  2EXD A;  5CV9 A;  4YY3 Q;  4A3I H;  4LF4 H;  1PRT D;  2VB3 X;  4GLA C;  3I72 A;  3VYU A;  2AGP A;  2QCP X;  4FP5 D;  1BBU A;  1CM9 A;  4C3H H;  3TZD A;  1EZ6 A;  1RJR A;  4F88 A;  5C0X J;  4IUR A;  3P75 A;  4ZKC B;  2R3Z A;  1Y1V B;  3GDE A;  5KFN A;  4XTC S;  1YVC A;  5EWF A;  1BCP F;  4A3M G;  3OW2 A;  1RYS A;  4RHS A;  5JVD F;  3STB C;  3I4N G;  1TWC B;  2ID0 A;  1PVO A;  1DOM A;  5IYC G;  4A2B A;  2DNC A;  3J80 i;  2QF7 A;  3OIP A;  2MO0 A;  2XWB B;  4K5X A;  3VYS A;  4JI1 H;  1WSC A;  3IAY A;  1TY2 A;  3P1H A;  3Q6S A;  4B3R Q;  3K5H A;  4X3K A;  4DKA C;  3I70 A;  2F0V A;  5DQH A;  1EL0 A;  2PZT A;  3T13 A;  4APV A;  2W9A A;  4BS9 A;  4K0K L;  1GUW A;  5EPJ A;  4LF6 H;  1CKN A;  4IZ8 A;  4LF5 H;  5KG2 A;  2KBN A;  2J9G A;  1ICF B;  1FYC A;  3HBL A;  1B4O A;  3I4M G;  1FJG L;  1TWA H;  4KHP Q;  1N34 Q;  2SOB A;  2MHV A;  3KLW A;  2L5T A;  3SK5 A;  3UI2 A;  5DEH A;  1Z2O X;  2RVL A;  2MNA A;  1ESR A;  4JG2 A;  2EYJ A;  5IE8 A;  1HTP A;  1GHJ A;  1KNE A;  4I7H A;  3HKZ E;  3M9B A;  4EQ5 A;  1T36 A;  1R9T A;  3RF2 A;  1VQK A;  2XWJ B;  3CU7 A;  5F2D A;  3BYY B;  1E1O A;  2MUY A;  4QF4 A;  4ED0 A;  4TUY F;  5BN4 A;  3UDG A;  2F0E A;  4C5C A;  2A73 B;  1Q46 A;  1V1P B;  3CQZ B;  1WJJ A;  4IOA A;  4YAK B;  2FIN B;  5KIX A;  1CQI B;  4X64 H;  5LA6 F;  3A74 A;  2ZJR A;  4UY8 C;  1I6U A;  3MXN A;  5KT7 A;  4WJ4 A;  1PH1 A;  3E3X A;  1PTO F;  4KHZ A;  1U5K A;  5M3M G;  1IBM L;  1MZB A;  4IUQ A;  3PCO B;  3U9O A;  1BF4 A;  4LFA H;  1CQJ B;  3ERO A;  5LMN L;  4DV1 H;  5KFC A;  4MV1 A;  4LF9 Q;  4DR6 L;  1HRJ A;  3GLK A;  2PZW A;  2W9B B;  5KFR A;  3AEV A;  1G2T A;  5JJI A;  5KNC A;  1M1K C;  1E2V A;  2Z6K C;  3L4J A;  1EZ1 A;  4G57 A;  4DR4 L;  4RAZ A;  5C8Y F;  2DPJ A;  5KFH A;  3TP7 A;  1T9H A;  4DV7 L;  1HHV A;  2B63 H;  4JYA Q;  5F9L A;  1L0X B;  3D3R A;  5M5X B;  2WAQ A;  3SK4 A;  3M4Y A;  2SDF A;  2QW7 A;  4IN3 A;  4BBR H;  4DN4 M;  2ES2 A;  4ZLT F;  2BQU A;  4YIJ A;  4DR3 L;  2QYZ A;  2WAQ G;  4HNU A;  5FK9 C;  4WFN 3;  3CCV A;  2NVY B;  3D0F A;  4BY7 H;  4CKE A;  3TIG A;  1VF5 C;  1L2F A;  5DAU A;  2JJQ A;  2K52 A;  1CT1 D;  2UXB H;  1P8L A;  3KF8 B;  1SYX B;  1K83 H;  3K58 A;  4CBV A;  1ILP A;  3VR2 A;  5AFW A;  1HZB A;  3KAL A;  2KHI A;  2R7F A;  3N40 P;  3KHR A;  4IRC A;  3FRP B;  1HFG A;  5M9O A;  2EDG A;  2C2E A;  3RZD B;  4ECW A;  4K8J A;  4UPA A;  2HIV A;  3GTM B;  1IBL Q;  3T1Y Q;  1I6V C;  4IWY A;  4LAA A;  2R61 A;  4YY3 H;  4KY6 A;  2A69 C;  3MFY A;  2FJZ A;  1EY6 A;  4MAM A;  1XMO H;  1C3O A;  1TU2 B;  4UCR A;  2IBK A;  3DWA A;  5KFK A;  3BVG A;  3I56 A;  2RA4 A;  3DUZ A;  4BXX G;  3EBE A;  2YU9 B;  2F0N A;  1TS3 A;  1U4L A;  3JRX A;  1VQF A;  1I4Q A;  2UU9 Q;  4BBS H;  2PW5 A;  4RUC A;  4IZO A;  1G29 1;  2D0P A;  2K5W A;  1I50 H;  2DN8 A;  2TSS A;  2E5L L;  1EHI A;  3S15 B;  2NU8 B;  1MBY A;  4OIJ A;  5EAY A;  1N32 Q;  3CCQ A;  3CC4 A;  4GOP B;  4AYB A;  2JA9 A;  1EY8 A;  3K0Y A;  5KFJ A;  2KQ3 A;  4EVO A;  4YHH L;  1V1P A;  4QY7 A;  3EA6 A;  3I55 A;  1WTR A;  2GVB A;  3CQZ A;  3RAQ A;  2K5V A;  2A69 D;  4AYB G;  1G91 A;  1DJR D;  4E4T A;  4K14 A;  3GTJ B;  3A56 A;  3GD7 A;  4KJN A;  3DEP A;  2D0O A;  3NQT A;  4BBS B;  2F0F A;  1E4E B;  1N34 H;  2C5C A;  2BA1 A;  3CPW A;  2I80 A;  1KRS A;  4UP9 A;  4DU9 A;  1SXT A;  2RBM A;  5BR8 L;  3A54 A;  3T5L A;  2J6T A;  3VMM A;  2AU0 A;  4IR1 A;  3KF6 B;  1OWT A;  3H91 A;  4JI5 L;  3T56 B;  4XT3 B;  2W9B A;  1MI2 A;  2JA8 B;  5KFX A;  4NPS A;  3S2D H;  3H94 A;  2RKS A;  2A5H A;  2KCC A;  2XCA A;  3VYT A;  2WB1 E;  5LMU H;  4B3M Q;  3A8I E;  1PZI D;  4RKB A;  4GC6 A;  2D9U A;  2NVT B;  2LKV A;  4IFD J;  2I8C A;  3MWY W;  2FPI B;  1YJN A;  1U4R A;  2GN5 A;  3J80 c;  2R7N A;  2ALZ A;  2F0K A;  2UUB H;  2AQ3 B;  2PI2 E;  4RGT A;  4J0M A;  3Q8Q B;  1FR3 A;  3RFC A;  3S1M B;  2JA6 H;  1Q86 C;  3S1R B;  4CKB A;  2JA7 H;  4PZ6 A;  4LF9 H;  5EQ0 A;  3KF8 A;  1EFI D;  4KN7 C;  5DQG A;  2L4N A;  4ECQ A;  2WDT A;  1PYS B;  2XD4 A;  1H9S A;  2A6H D;  4EEQ A;  3D4R A;  2QEJ C;  1EYA A;  3KLS X;  3KFU A;  2DPI A;  2W57 A;  1E22 A;  1II3 A;  4MV3 A;  3GTM A;  3GQB A;  2FK1 A;  1SEI A;  1AN8 A;  4EQP A;  5L1L A;  2K5Q A;  5F9N A;  4FS1 A;  2W7P A;  2JA6 B;  1YIJ A;  2NU7 B;  3MR2 A;  1Q12 A;  1JKJ B;  2PN1 A;  3V96 A;  4BY7 G;  2CW7 A;  1MSG A;  4B9X A;  5CC4 A;  1JWM D;  1DV1 A;  4K6D A;  3NQI A;  5KFS A;  2Z4H A;  4DPG A;  1F9R A;  3M85 A;  1FJG Q;  5KX5 F;  4A93 H;  4KTA A;  3PW0 A;  4EGJ A;  5C0X H;  1E2W A;  1HH2 P;  2HQL A;  1I4G A;  2Z8L A;  4JI3 H;  3Q8R B;  4GOP A;  4K5V A;  1N33 L;  1U0L A;  4LMQ D;  1BJT A;  4YCV A;  1IBL H;  3T1Y H;  3WDN A;  2ZM6 Q;  5IY0 A;  1HXY D;  3G6Y A;  4DR1 L;  3GII A;  4DAM A;  3TSS A;  1PFS A;  2PCF B;  5CV4 A;  3T53 B;  1BCP B;  4M1U B;  4EG0 A;  1I50 A;  5GON F;  5C4X B;  3NE5 B;  4HIO A;  3R5H A;  4TQS A;  1TWG B;  4BBS G;  3PR4 A;  2LS0 1;  2UU9 H;  3KF6 A;  1SE4 A;  1SNO A;  4LWC A;  4CDC C;  2Y0S A;  1UWV A;  4U6P A;  4U7C A;  3KTM A;  5LMN Q;  1D5M C;  3ND8 A;  2WAC A;  1ZET A;  1E2Z A;  4KN4 C;  1BR9 A;  1EIF A;  2H4O A;  5DM6 3;  1VQE A;  1C30 A;  3D4D A;  3DWQ A;  5LL6 X;  2YZG A;  2B2U A;  2J6U A;  3PW7 A;  1IXR A;  5C3E B;  5LMN W;  2W8L A;  1IW7 D;  1BOS A;  2UXD L;  1CHQ D;  1Z9F A;  3QWN A;  1ONL A;  1PTO H;  2IHE A;  4NKL A;  4DAY B;  4GN3 B;  5CA1 F;  3KHL A;  3K3V A;  4CJ2 C;  3R8B A;  3Q23 A;  1LTG D;  1G6Z A;  3UDI A;  3KHG A;  5EJW A;  1K9M C;  2O5J C;  1Q8K A;  3J7A F;  3TEH B;  5GAG C;  4DV5 L;  4B3M H;  3OYY A;  4ULL A;  1HPC A;  2V59 A;  2L55 A;  1N56 A;  4DV3 L;  4FS2 A;  1STY A;  4RNO A;  4ZYS A;  2RSO A;  5TSS A;  2K14 A;  5BN3 A;  2JA6 A;  3PVX A;  2JA7 A;  2I5M X;  4NW2 A;  1VQ7 A;  2E2J H;  4DAV A;  1OXV A;  2GPW A;  2FK2 A;  2VPQ A;  2G9H D;  2JA6 G;  2JA7 G;  4DUZ Q;  1BGW A;  4DV2 L;  2VA2 A;  4IAJ A;  1KRT A;  1H9M A;  4J15 A;  1BVS A;  4RCO A;  2PBZ A;  1CA5 A;  1XMQ H;  1VQP A;  4M9U A;  3PUW A;  4EX5 A;  1EYD A;  4GZY C;  3P20 A;  3GQC A;  4B9W A;  1DGS A;  2OT2 A;  4RG1 A;  5C4H A;  2G5D A;  2F3W A;  4ME6 A;  2F0S A;  2E5L Q;  5C5J A;  3GTG B;  3F2U A;  2IX3 A;  1EU3 A;  2C00 A;  3GTL H;  3GTK B;  5JOB A;  1F2Y A;  5KND A;  5IYB H;  4HJ7 A;  3HOU H;  4JOI A;  1YZ6 A;  3KAK A;  4QMG A;  1CA6 A;  1CKO A;  2F0H A;  4XYL B;  3C3L A;  3E6Z X;  2VPS A;  4EBE A;  1STB A;  3AB9 A;  2O4X A;  3FKI H;  1VQO A;  1RHP A;  4LF7 L;  5DLG A;  3J80 L;  4UCT A;  1I3Q B;  4F4W A;  4DR2 H;  1KJQ A;  5IP9 H;  1QE6 A;  5C4X G;  1B70 B;  3UE0 A;  3GTQ H;  2R8I A;  2D2C C;  4QUC A;  1P16 A;  1ZHQ A;  5NUC A;  5T1G A;  4CJ0 B;  2GA4 B;  2K75 A;  1SR3 A;  2ZM6 H;  2AUK A;  4JI0 L;  3FHW A;  3NEM A;  3C0F B;  2F4V L;  1K8O A;  3KJP A;  4C3I B;  4QIW E;  3BDO A;  4LFB L;  2QEX A;  2A19 A;  4ECX A;  4O4H F;  1EYG A;  5KFD A;  3J7A V;  1SYC A;  4ILW A;  1ENC A;  2HHH Q;  5C3E G;  2XGT A;  3K80 C;  1EY4 A;  4Y8V B;  3I4L A;  5A2Q L;  2XC9 A;  1O7L A;  3OWE B;  3W5O A;  3CF5 A;  1EOV A;  2RHS B;  1SE3 A;  4PG3 A;  4C3J B;  3HOY B;  1L1O A;  4OXP A;  2C22 A;  1H9K A;  4RB0 A;  4HJA A;  1NNX A;  1UNN C;  2JEG A;  1FNW A;  3M4O B;  2V5A A;  3I8Z A;  2RDH A;  3MXU A;  1JT8 A;  3SGI A;  4RNN A;  4ETS A;  1LTS D;  3JAM L;  3EPG A;  3KYH C;  3TQT A;  3TME A;  1ET6 A;  1UC9 A;  3BQ0 A;  4A4I A;  4IFD H;  1JIC A;  2AGO A;  2MGS A;  4F4Y A;  4YR2 A;  4ECV A;  3LNN A;  3QOJ A;  3G8C A;  1PZJ D;  2BA0 A;  3QR8 A;  1SMY D;  3N43 B;  4M7E A;  1XWE A;  2K05 A;  2ZTC A;  3LWB A;  2BQR A;  3DEO A;  5L9X A;  2SEB D;  4JV5 L;  4ZK9 B;  2X69 A;  2F1M A;  3RZO B;  1KLG D;  5D65 A;  3KHH A;  3PW2 A;  3HXL A;  3Q0A A;  4NP5 A;  3GV7 B;  4WJW A;  4GN5 A;  1TQO A;  4XDX A;  2IY5 B;  4H7B A;  1T5X D;  4JW0 A;  3T16 A;  5KG7 A;  4HN7 A;  4MTD A;  1S0O A;  2UVV A;  4DUZ H;  4DFA A;  1W6K A;  5DNF A;  2VQE L;  3S2H H;  5KFG A;  1I3Q A;  2VR1 A;  1PX2 A;  4I55 F;  1R4Q B;  4F4X A;  2K32 A;  3GTL A;  2C9O A;  2ZJP A;  2E74 C;  4ZAI A;  4HSP A;  4R8U A;  4HED A;  1XPR A;  4ECS A;  2K03 A;  2ZXO A;  4FF3 A;  3GTO B;  3PSI A;  1EQT A;  1JR0 D;  3KDF B;  2DGY A;  3KLS A;  3FKI A;  4JI7 L;  3IFT A;  1VQA A;  3FEW X;  4EGV A;  3MA2 B;  1CTM A;  4HNT A;  5JH7 F;  1EWI A;  3MJF A;  2SNS A;  1C7Y A;  4EBD A;  4C3I G;  2BH8 A;  3H6M A;  1TS4 A;  3NBI A;  3S1N H;  3S16 B;  4JCV E;  1U4M A;  4K2L A;  5DG9 A;  4IOC A;  5IP9 G;  1TS5 A;  5JVG 3;  3NSW A;  2M2L A;  5KG6 A;  4A3M H;  2WAQ E;  1B1Z A;  3N6R A;  2VUM B;  1UNS A;  2X6L A;  1TWF B;  2VNU D;  3I4N H;  4J9S A;  5IYC H;  1S9F A;  2GLT A;  4C3J G;  1NJI C;  1YHQ A;  1ZQ7 A;  5EWG A;  4MV8 A;  2CVR A;  2IJ0 A;  1VAJ A;  3RAX A;  3WNZ A;  3KUP A;  3NPP A;  3RGZ A;  3MVV A;  1EWH A;  4FXD A;  5IGD A;  1CS0 A;  2HVS A;  4G7Z C;  4Q45 A;  2HHH H;  1EU4 A;  1I4H A;  2A6E D;  5M5W B;  2F52 A;  1PH5 A;  3I4M H;  4DA2 A;  1QUQ A;  3K6O A;  2R7M A;  1EYC A;  4ECZ A;  3GO5 A;  1BXT A;  4DV2 Q;  5IWA L;  2R82 A;  2QIL A;  1EEI D;  3L3O C;  2IX0 A;  1NAP A;  2MPM A;  3HOZ B;  4DL6 A;  3OHB A;  5HGT A;  2B2Y C;  1K3R A;  1FGU A;  1NR2 A;  1WTQ A;  5KRU A;  4FYD A;  4GC7 A;  5CV5 A;  4GKJ Q;  2AMC B;  3M4Q A;  4MV9 A;  4JK1 C;  1N36 L;  1STA A;  1K28 A;  4XQN A;  2W6N A;  2I5L X;  5M3M H;  1AZP A;  2PNR C;  2DIK A;  2K5D A;  4AYB E;  5D8D A;  4O3Q A;  4QB4 A;  1A3U A;  4LFC L;  1IBK L;  4LF7 Q;  3ERQ A;  4XYO A;  3RJ0 A;  3SK8 A;  3V6K A;  3FPU B;  3PO2 B;  2YV5 A;  3QFF A;  5D14 A;  3X3N A;  5KFM A;  2BE5 D;  1UE1 A;  1A8V A;  4ZOL F;  4GOP C;  2VY3 A;  1W3S A;  1WTW A;  4R7R A;  3GTO A;  1XYI A;  4ID6 A;  5JQW A;  1TWH B;  2ICI A;  3KDF A;  4ZHQ F;  3ERS X;  1M8A A;  3IN5 A;  1NBW A;  3NTH A;  4JI8 L;  3E0J A;  2EE1 A;  1HUM A;  1NTG A;  4O2D A;  3U4Z A;  1A15 A;  4J9P A;  3S1Q B;  1E0B A;  2AKW B;  4X65 Q;  2V4R A;  3VR3 A;  4LFB Q;  3FMA A;  1LT5 D;  3SVM A;  4JI6 L;  4GKK L;  5KT5 A;  2ATL A;  3BYT B;  5IYZ F;  1TVX A;  2ZT9 C;  4I4T F;  2VUM A;  3DM1 A;  2A68 D;  2JK8 A;  4IUT A;  1LT3 D;  1Y1V H;  3DLL A;  1VQJ A;  5IT9 E;  4ALP A;  1C4Q A;  1HNX L;  5KFB A;  4DF7 A;  2VUM G;  1KDA A;  1TWC H;  3I91 A;  4PZ7 A;  1S72 A;  3RV4 A;  3T5H A;  3CCS A;  2VL6 A;  4RB1 A;  4OL7 A;  3U58 A;  3J81 c;  2B2U C;  4MZ9 A;  5A2Q W;  2HVR A;  4OX9 L;  5ELE A;  2RGV A;  3H4D A;  1GKH A;  5D1O B;  3L4K A;  4CGY B;  4CDF C;  1PH2 A;  1QOH A;  3FMC A;  4N9P A;  3T51 B;  4BY1 B;  3QZ7 A;  4BXX H;  4DR7 L;  1I94 H;  2PQE A;  2W8K A;  4RA8 A;  1TAE A;  1IL2 A;  2K5N A;  1B50 A;  5C0X I;  3OOC A;  2KED A;  2ASJ A;  4IUU A;  4DV0 H;  4KKU A;  3JAM W;  2WKC A;  4CHT B;  1NUC A;  1X3Q A;  1K8G A;  5FLM H;  4LMY A;  3T5K A;  1TS2 A;  3HOZ G;  4P73 A;  1B3A A;  1XNR Q;  1STG A;  1B04 A;  1YEZ A;  4R4C A;  3BQ1 A;  3I73 A;  5FOB B;  4NLG A;  2XCP A;  1C48 A;  2KA7 A;  5KGU A;  3HGB A;  4XT1 B;  3CQZ H;  4O3O A;  4FU0 A;  3SEB A;  2YRX A;  3A5Z B;  3FDT A;  2CQO A;  3KK7 A;  2UXC L;  1HNW H;  5K36 H;  1GVP A;  1VQ9 A;  4A3G B;  4V19 0;  2VQE Q;  1YNJ C;  2FLN A;  3HZX A;  4HR7 B;  1Z2N X;  3NK9 A;  1BQQ T;  1J5E Q;  4YR0 A;  5K2M A;  3S24 A;  3BS1 A;  2PMZ B;  4GKJ H;  3PO2 G;  2IMW P;  2HQE A;  5J2T F;  4X66 L;  1TWH A;  4DV4 L;  1RTN A;  5KFF A;  2W6O A;  1GJX A;  5DLQ E;  3ICE A;  1M7J A;  2FJ2 A;  2H5X A;  2Y0S E;  3NHH A;  2I46 A;  1F77 A;  4JI7 Q;  4K6L A;  5M5X H;  4LUZ A;  1VQG A;  1KDB A;  4ZQI A;  4UAI A;  3TII A;  1E24 A;  2QKI C;  4H13 C;  4PMC A;  5M5Y B;  2YL2 A;  3U50 C;  1BCP C;  1X3E A;  2VXW A;  1IKM A;  1SND A;  3TS2 A;  2L1B A;  4A3E B;  4LF7 H;  1I7L A;  2NVY H;  1YNJ D;  3OHA A;  3KLR A;  1GOZ A;  4QGU A;  3NWT A;  5C4Z A;  2E2H B;  1G2S A;  1RTO A;  1RJT A;  3H0G B;  2UUA Q;  4DNR B;  1XNQ L;  3M3Y B;  4ABN A;  3PO3 B;  4C1N K;  1G6P A;  1PDQ A;  4FBU A;  3ZYY X;  5DG7 A;  2RDI A;  4X3S A;  2UVW A;  3RZD H;  2HCC A;  4X65 H;  2JP1 A;  2XN9 C;  2BDN A;  4PWQ A;  3GTM H;  2F03 A;  2Z4I A;  5D1O A;  4ECU A;  4JI2 L;  4N8F A;  5EBC A;  4EQN A;  2EYP A;  1EIH A;  1BCP D;  1Y1V A;  3Q2O A;  5HY6 A;  3OSO A;  1WTX A;  1KDC A;  1B9N A;  1YNX A;  4DUY L;  3EIV A;  1BDO A;  1TWC A;  3BZK A;  4BY1 G;  1Y1V G;  3R3O A;  2YU9 H;  4DV6 Q;  2Z6B A;  3OMG A;  1NMG A;  1L1O C;  2EVB A;  2VQF Q;  3RUP A;  3M7N A;  4M8A A;  3JRW A;  1O75 A;  4EFE A;  2RCN A;  4IUV A;  1MSH A;  3URY A;  4J9R A;  3PGZ A;  4C2M B;  3C2P A;  1GYF A;  2QDL A;  3S15 H;  3C1F A;  3H40 A;  2BR0 A;  3CAM A;  1PTO C;  4DXG A;  2EY6 A;  3S9W A;  3K57 A;  1GD7 A;  2FLL A;  4HSV A;  1DD2 A;  2YTV A;  3GV3 A;  1B7Y B;  2V4Q A;  4V0B A;  1KEE A;  3GTJ H;  1KHI A;  2FHT A;  4DXF A;  1VQH A;  4PV1 C;  1BXR A;  5J2U F;  2J4X A;  2C35 B;  1Z7T A;  4YP3 A;  2HCI A;  2RSN A;  4MNO A;  1SYG A;  3NTI A;  5KT4 A;  5KFY A;  2CH4 W;  5FLM G;  3H09 A;  1SSO A;  5E7N A;  1GUG A;  1YNN D;  1GO3 E;  2B8G A;  4ZCK A;  4A3G G;  4B3R H;  2KCT A;  2JA8 H;  1XNR H;  1SLJ A;  2K6A A;  2ENB A;  3T1H L;  3SE7 A;  1HNZ Q;  1PTO D;  1RCV D;  4Z9C B;  1D6E C;  1STN A;  2HUG A;  2PNH A;  1JOQ A;  1QG7 A;  2DNE A;  3PUY A;  1M90 C;  3CCU A;  3K7A B;  3M7G A;  2NVT H;  3MWE A;  4KHP H;  4Y7N B;  5IP7 G;  3GIQ A;  3ORR A;  3J81 L;  4UFZ A;  3W3A A;  2YW2 A;  2KJX A;  5K36 G;  1LO5 D;  3N42 B;  2KUM A;  2PYK A;  3HOV B;  1BUV T;  2UUC L;  3TZU A;  1B6R A;  2RDJ A;  1C9O A;  2IW3 A;  2YCH A;  2XVS A;  1F9Q A;  3WOE A;  4JI6 Q;  4KD4 A;  2RF4 A;  4FDB A;  1I6H B;  3S1M H;  4RGO S;  2IT1 A;  1J5E H;  5KFT A;  4GLX A;  2A6H C;  2LFN A;  2E2H A;  3RN2 A;  2E76 C;  3OTO Q;  3S1R H;  3I12 A;  1PRT B;  3HKZ B;  2JEI A;  1NR4 A;  4EEY A;  4OGQ C;  4LUO A;  5KFL A;  1OXU A;  4Q8E A;  3I90 A;  4IO9 A;  3H0G G;  3RR5 A;  4YR3 A;  2NTS A;  2B2V A;  3B6Y A;  1PXU A;  3K5O A;  4LF8 Q;  1PMR A;  4RFB A;  4R9W A;  5J39 A;  3CCJ A;  3PO3 G;  1MIU A;  3G6J B;  2NVY A;  4JUZ A;  1D5X C;  1KQS A;  4ZKB B;  2MJ8 A;  5C44 B;  3SE0 A;  5C4J B;  1UEB A;  1YIT A;  1JJ2 A;  2HD3 A;  2AQ2 B;  4IFD I;  3PR5 B;  2KVM A;  3GP7 A;  4X62 L;  4J9K A;  4RHR A;  2NU6 B;  2ZJT A;  1VQD A;  4XQJ A;  2B3G A;  2UVU A;  3N41 B;  3TP5 A;  4O42 A;  4BA2 I;  5FLX E;  4KKS A;  2X6G A;  4LW1 A;  1OTC A;  4FO2 A;  3K59 A;  3LML A;  2UUA H;  4P75 A;  1LTI D;  4JYA H;  1RD9 D;  3CC2 A;  2DJF C;  2FMA A;  1B3Q A;  1CE8 A;  1CZG A;  2IX1 A;  1HQR D;  2R8K A;  3S14 B;  3F2B A;  2FPP B;  5ELC A;  2J6S A;  4K0K Q;  4Q5V A;  2R86 A;  3L7Z C;  4HIK A;  4UP8 A;  5EGT A;  4IRK A;  2YU9 A;  2PVP A;  4ECY A;  1Q82 C;  2B2W A;  5CV6 A;  4R4T A;  4DLK A;  3QOL A;  2SCU B;  1SYB A;  3F2C A;  3AQQ A;  5FD5 A;  2BDO A;  4IUN A;  4DV6 H;  3GIL A;  3ZJY C;  2UXC Q;  5C4X H;  1ILQ A;  2YRW A;  3K81 C;  4NB3 A;  2VQF H;  1TWG H;  1ROD A;  4N9T A;  1VMP A;  1CZW A;  4JC0 A;  2V4D A;  1EQR A;  3LP8 A;  1GSO A;  4O4L F;  2ZTD A;  4YJ2 F;  3A7A B;  3TS0 A;  3GTJ A;  3E0E A;  1HZC A;  2N8N A;  1WCM B;  5T1I A;  1HCZ A;  1S5B D;  1IW7 C;  5LL6 S;  3E5N A;  3MXG A;  2MCT A;  2XTI A;  3H3V H;  1E4E A;  3BG5 A;  3TQY A;  2L15 A;  1QVG A;  1NCV A;  1ZXT A;  1WTV A;  2R84 A;  3HKS A;  3MAQ A;  1F2Z A;  1SYD A;  5C3E H;  4FF1 A;  1IBM Q;  1PH3 A;  1RDP D;  1S0M A;  1VDZ A;  3MFH A;  3EQL C;  3K5M A;  5EWE A;  1EUD B;  4HJ9 A;  4IUP A;  2ZDH A;  3HOV G;  2ALY B;  3MXP A;  2R7Z B;  4DR6 Q;  5IGC A;  1PK8 A;  1N32 H;  3RTX A;  5JVL A;  4Q0Y A;  3CC7 A;  4NXN L;  1KD1 C;  2JA8 G;  3RB3 A;  3G4S A;  2WFW A;  1LM0 A;  1YHB A;  5IGB A;  4DR4 Q;  4QWE A;  1HNZ H;  2NZH A;  4DV7 Q;  5L1I A;  4OEM B;  1JXL A;  2F3V A;  5KFI A;  4IPH A;  3UDF A;  3VR5 A;  1JQY D;  1YBY A;  2Q2I A;  5CMD A;  3VYR A;  2CQY A; 
#chains in the Genus database with same CATH homology
 1XPO A;  4DR3 Q;  2UXB Q;  3Q8D A;  4IJH A;  3OTO L;  1Q81 C;  2A8V A;  3CPF A;  1HR0 L;  4JI2 Q;  1I6H H;  4B3M L;  4DUZ L;  4JBK A;  1W2B A;  1SE8 A;  5C44 G;  1D8L A;  4GN5 A;  2IY5 B;  4B3T L;  4POF A;  3HFZ B;  4OON A;  4LF4 L;  1VQB A;  1OXT A;  3D31 A;  1KC8 C;  1X6O A;  4JI8 Q;  4LF8 L;  1XPU A;  3BZC A;  4L5Q A;  5GAH C;  2VQE L;  3S2H H;  2EXD A;  4A3I H;  4YY3 Q;  4GLA C;  1L0W A;  3EN2 A;  3ULJ A;  3AFP A;  1BBU A;  4C3H H;  2R6G A;  2ZJP A;  1S3O A;  1WI5 A;  3WWV A;  5C0X J;  2KCM A;  5FJ8 H;  2QGQ A;  4GLV B;  3RN5 A;  5C44 H;  3GTG H;  4GKK Q;  5C4J H;  2OTL A;  3GDE A;  2NN6 I;  4A3E G;  1ASZ A;  1JB7 A;  3PUV A;  1XPR A;  4XTC S;  1YVC A;  1RL2 A;  3GTK H;  4A3M G;  3OW2 A;  2AHO B;  3PSI A;  3STB C;  3KDF B;  4NXM L;  2DGY A;  3I4N G;  2ID0 A;  4JI7 L;  1PVO A;  3UDX A;  5IYC G;  1JJC B;  2OQK A;  3J80 i;  1HNX Q;  1VQA A;  3DM3 A;  2MO0 A;  1EWI A;  1C7Y A;  1YI2 A;  2BH8 A;  3S1N H;  1MJE A;  4A3L H;  3CCR A;  4LF6 L;  4LF5 L;  4B3R Q;  1UE7 A;  4TVA B;  4DKA C;  4GNX C;  1I3Q H;  4IPD A;  4JCV E;  4APV A;  4IOC A;  4OX9 Q;  5IP9 G;  4K0K L;  4A75 A;  1CKN A;  4A3M H;  2WAQ E;  3S14 H;  2DUD A;  4P74 A;  1AH9 A;  2KBN A;  3K7U C;  4YHH Q;  3BJU A;  1VQ5 A;  3I4N H;  4OWX B;  2VNU D;  4DR7 Q;  3I4M G;  5IYC H;  1FJG L;  3NBH B;  1TWA H;  2NZO A;  1O7I A;  1N34 Q;  4KHP Q;  3I4O A;  3KLW A;  4RMF A;  1X56 A;  1NJI C;  3CCL A;  1PH9 A;  1YHQ A;  3J81 j;  4C3I H;  1WCM G;  1SRO A;  5IT9 c;  2MNA A;  3CXC A;  4JG2 A;  2HHH L;  5IE8 A;  1X65 A;  3RLF A;  3HKZ E;  3M9B A;  4EQ5 A;  3KJO A;  2YTY A;  5BR8 Q;  1VQK A;  1E1O A;  1SRU A;  5JEA J;  1RIP A;  4X64 L;  3UDG A;  4JI5 Q;  3ULP A;  1X3F A;  2EQS A;  2F52 A;  1PH5 A;  3I4M H;  1Q46 A;  3LGJ A;  4JBW A;  1WJJ A;  4C3J H;  4IOA A;  3HOY H;  1XMQ Q;  2R7Z G;  1QUQ A;  3A74 A;  2ZJR A;  4UY8 C;  2LSS A;  1A63 A;  1WCM H;  3GO5 A;  4DV2 Q;  4LFA L;  5IWA L;  1G51 A;  4WJ4 A;  1PH1 A;  3G48 A;  4KHZ A;  4B3S L;  1U5K A;  5M3M G;  4DV1 L;  4GNX B;  2IX0 A;  1IBM L;  2CWA A;  1NY4 A;  2R7D A;  2B63 G;  3M4O H;  3PCO B;  1K3R A;  1FGU A;  4LUV A;  1Z47 A;  5LMN L;  4BBR G;  4GKJ Q;  2AMC B;  3M4Q A;  4L5T A;  5AJ3 L;  4LF9 Q;  4DR6 L;  4QQB X;  1N36 L;  3AEV A;  2VW9 A;  5JJI A;  1M1K C;  2R7Z H;  2Z6K C;  4DR4 L;  4H02 A;  4X66 Q;  4DV4 Q;  1T9H A;  1LUZ A;  4DV7 L;  2I5L X;  5M3M H;  4HIM A;  4DR5 Q;  3RNU A;  1GM5 A;  2B63 H;  4AYB E;  4JYA Q;  2N78 A;  5GAD C;  1I5F A;  5IYD G;  4DR2 Q;  4BBR H;  4LFC L;  2ES2 A;  1IBK L;  4LF7 Q;  2B29 A;  2ZTE A;  4DR3 L;  2WAQ G;  4DK3 C;  3JAM c;  3CCV A;  2YV5 A;  3D0F A;  4BY7 H;  1E3P A;  5GQO A;  1L2F A;  3RZO H;  2JJQ A;  2K52 A;  1UE1 A;  4OWT B;  1SFO H;  1A8V A;  4GOP C;  1P8L A;  2VY3 A;  1PA6 A;  1W3S A;  2YTX A;  3KF8 B;  1K83 H;  3KDF A;  2GVA A;  3ERS X;  3U4V A;  1NBW A;  4JI8 L;  3HKZ G;  1HZB A;  1NTG A;  1CKM A;  2KHI A;  2R7F A;  4O2D A;  3U4Z A;  3E9I A;  1AE3 A;  4YY3 L;  2AKW B;  5FLX c;  4X65 Q;  4AIM A;  2MQH A;  1XNQ Q;  4LFB Q;  1XMO L;  2D62 A;  2OQ0 A;  2HIV A;  4UPA A;  3AFQ A;  3T1Y Q;  1IBL Q;  2NVX H;  4UP7 A;  4JI6 L;  4YCW A;  4GKK L;  4XIG S;  1IYJ B;  1KIX A;  1N33 Q;  2JK8 A;  2Y0S G;  1A0I A;  3FP9 A;  5FJ8 G;  1Y1V H;  3DLL A;  3I56 A;  1K8A C;  4DR1 Q;  1E1T A;  1VQJ A;  3G6E A;  4HJ5 A;  4BXX G;  4ALP A;  3EBE A;  4DUY Q;  1HNX L;  2VUM G;  4YWM A;  3GTO H;  4A3J G;  1VQF A;  4R4I A;  1TWC H;  4PZ7 A;  1S72 A;  1QVC A;  1VQN A;  2UU9 Q;  4BBS H;  3CCS A;  2VL6 A;  4JI4 Q;  5JJL A;  1G29 1;  1V43 A;  2D0P A;  1I50 H;  4HID A;  3U58 A;  3J81 c;  2E5L L;  4MZ9 A;  3PIO A;  3S17 H;  4A3C H;  2WP8 J;  1I94 L;  4OX9 L;  3S16 H;  5EAY A;  4A3L G;  1N32 Q;  3CCQ A;  3CC4 A;  4GOP B;  1GKH A;  1V9P A;  2JA9 A;  4GN4 B;  4A3F G;  1XTD A;  3M4P A;  1PH2 A;  4YHH L;  4QY7 A;  1WYD A;  3I55 A;  4O0A A;  2GVB A;  4BXX H;  1VQ6 A;  4DR7 L;  2K5V A;  4AYB G;  5M3F H;  4DV0 L;  1N34 L;  2VUM H;  1L1O B;  4JI1 L;  4A3J H;  1TWF H;  1YHA A;  2OWO A;  2AWN A;  5J3B A;  1H95 A;  3GD7 A;  4A3B H;  2ZJQ A;  1VQL A;  1IL2 A;  2K5N A;  1Q1E A;  2D0O A;  1VQC A;  5C0X I;  3CME A;  4L5S A;  4GNX A;  2BA1 A;  3I2Z A;  3CPW A;  4L5R C;  1KRS A;  4UP9 A;  1K8G A;  5BR8 L;  5FLM H;  4OO1 G;  1X55 A;  1PYB A;  3AYH B;  1BKB A;  4YWL A;  3HOZ G;  2UXD Q;  4P73 A;  1HJP A;  4JBJ A;  3KF6 B;  4A3F H;  1XNR Q;  1YEZ A;  4R4C A;  4JI5 L;  5LMU L;  4NPS A;  3S2D H;  3ULL A;  4IPC A;  3F2D A;  4JBM A;  5M5W H;  2WB1 E;  1K73 C;  2BH2 A;  1HNW L;  4B3M Q;  3CQZ H;  3T1H Q;  1VQ8 A;  2QA4 A;  3A5Z B;  2PQA B;  3HOY G;  1PHJ A;  1MJC A;  3UE1 A;  4B3T Q;  2CQO A;  2UUB L;  4DV5 Q;  1OXX K;  4IFD J;  2UXC L;  1GVP A;  1YJN A;  4DV3 Q;  1VQ9 A;  3J80 c;  2GN5 A;  3HOZ H;  2RHQ B;  2VQE Q;  1B8A A;  1EFW A;  4GKJ L;  4LF9 L;  2Q2T A;  4X6A H;  2PI2 E;  1J5E Q;  1N8R C;  3S24 A;  2UUC Q;  3G71 A;  2JA6 H;  1Q86 C;  1Y1W H;  2JA7 H;  3J7A 5;  3PO2 G;  4PZ6 A;  4LNQ A;  4X66 L;  3CCM A;  4DV4 L;  1PYS B;  3PUX A;  3PUZ A;  1Y14 B;  3CP0 A;  5DLQ E;  4POG A;  4MTN A;  3ICE A;  2H5X A;  2Y0S E;  3KFU A;  4NXM Q;  2NN6 G;  1JJG A;  4JI7 Q;  1E22 A;  5M5X H;  4A93 G;  4LUZ A;  1VQG A;  3F1Z A;  1E24 A;  1VQ4 A;  3U50 C;  1X3E A;  1X54 A;  5C0X G;  2I5H A;  4A3D G;  2Z6K A;  3TS2 A;  2ATW A;  3PO2 H;  1YIJ A;  2NVY H;  1Q12 A;  2R92 G;  2ASB A;  4QGU A;  4BY7 G;  2R93 G;  5GRO A;  4X62 Q;  1Q7Y C;  2UUA Q;  3H15 A;  1TWH H;  3K8A A;  4DPG A;  4AQY L;  4JI3 L;  4X65 L;  3M85 A;  1FJG Q;  1XNQ L;  4A93 H;  4ME3 A;  2AWO A;  1YJW A;  1G6P A;  3S1Q H;  2K5H A;  3T1Y L;  1FVI A;  1HH2 P;  4A3D H;  2HQL A;  1WFQ A;  3RZD H;  3F8T A;  3GTP H;  4GOP A;  2UXB L;  3GTM H;  3BU2 A;  1N33 L;  1U0L A;  2WB1 G;  4JI2 L;  4YCV A;  2R92 H;  2ZM6 Q;  5IY0 A;  2R93 H;  5HY6 A;  1CSP A;  4DR1 L;  2JA5 G;  1YNX A;  3L2P A;  4DUY L;  4DAM A;  2PI2 A;  3EIV A;  1CUK A;  1PFS A;  2OCE A;  4BA1 I;  1Q1B A;  3BZK A;  1Y1V G;  4BY1 G;  2YU9 H;  4JI0 Q;  3JC6 6;  4DV6 Q;  1NMG A;  1L1O C;  2F4V Q;  1MKH A;  2VQF Q;  2KHJ A;  3HOX H;  3M7N A;  4HIO A;  4B3S Q;  4Y52 H;  5JEA G;  4BBS G;  2OTJ A;  2RCN A;  3KF6 A;  4OWW B;  4LWC A;  3PGZ A;  1UWV A;  4YCU A;  3S15 H;  2JQO A;  4P71 A;  4A3C G;  1E7Z A;  1C0A A;  5LMN Q;  1VCI A;  3MEF A;  3CAM A;  2JA5 H;  2E8G A;  1IZ6 A;  1GD7 A;  3W1B A;  4BY1 H;  4WJ3 M;  1EIF A;  3CCE A;  2V1C C;  2YTV A;  1B7Y B;  1VQE A;  4A3K G;  2CFM A;  1UE5 A;  2PQA A;  5M3F G;  3GTJ H;  1QUQ B;  3TRE A;  1KHI A;  2HT1 A;  1VQH A;  3J81 i;  4A3B G;  3MXN B;  1IXR A;  2K50 A;  2C35 B;  5LMN W;  4B3R L;  4QL5 A;  2UXD L;  4MNO A;  2MFI A;  1XNR L;  1Z9F A;  5FLM G;  4AH6 A;  1SMX A;  2IHE A;  1KAW A;  5E7N A;  4A3G G;  3PF5 A;  1GO3 E;  3NEN A;  4DAY B;  4GN3 B;  2KCT A;  2JA8 H;  1KXL A;  3CW2 C;  1UE6 A;  1SLJ A;  3UDI A;  4A3K H;  1KL9 A;  1K9M C;  1Q8K A;  4KHP L;  1FL0 A;  3T1H L;  3TEH B;  1HNZ Q;  2LXJ A;  4NXN Q;  2CWP A;  5GAG C;  4DV5 L;  2K4K A;  2PNH A;  3PUY A;  3OYY A;  3PV0 A;  3A5U A;  1M90 C;  4PZ8 A;  3CCU A;  2CCZ A;  4KI0 A;  4DV3 L;  2NVT H;  4DK6 C;  1S40 A;  1HZ9 A;  5IP7 G;  2NVQ H;  3E9H A;  1JE5 A;  3A0J A;  1J5E L;  5K36 G;  4A3G H;  2UUC L;  1XMO Q;  2K14 A;  5HGQ A;  3KOJ A;  1K0R A;  2I5M X;  1C9O A;  4JI6 Q;  4JV5 Q;  3PIP A;  2RF4 A;  4FDB A;  1VQ7 A;  3S1M H;  2IT1 A;  2N3S A;  1OXS C;  4GLX A;  2E2J H;  1OXV A;  3CD6 A;  3RN2 A;  3OTO Q;  3S1R H;  2F3I A;  1XMQ L;  1VQI A;  1J6Q A;  1HR0 Q;  1Y1W G;  2JA6 G;  2JA7 G;  3H3V I;  4DUZ Q;  1LTL A;  4DV2 L;  4LUO A;  1KRT A;  1OXU A;  4J15 A;  1BVS A;  4IPG A;  5IYB G;  1PV4 A;  3HOU G;  2YYZ A;  3I7F A;  4R4O A;  2JEB I;  4IO9 A;  1VQM A;  3H0G G;  5IP7 H;  3RR5 A;  1VQP A;  4LF4 Q;  3PUW A;  4EX5 A;  3B6Y A;  4KLK A;  4R1J A;  1X9N A;  4LF8 Q;  3FKI G;  1NE3 A;  1DGS A;  1EUJ A;  4RG1 A;  3CCJ A;  5M5Y H;  2JE6 I;  3PO3 G;  1MIU A;  3ER0 A;  2E5L Q;  1HR0 W;  1KQS A;  2JEA I;  1I94 Q;  1JJ2 A;  4A3E H;  1UEB A;  1YIT A;  4IFD I;  4X62 L;  3GTL H;  2Q2H A;  2UUA L;  1VQD A;  2N49 A;  4HJ8 A;  2B3G A;  4HJ7 A;  5IYB H;  3HOU H;  4BA2 I;  4JOI A;  2E2I H;  4DR5 L;  2E2H H;  1YZ6 A;  4LW1 A;  3H0G H;  4DV0 Q;  1OTC A;  4JYA L;  2CKZ B;  4JI1 Q;  1CKO A;  4QJF A;  4DR2 L;  1QVF A;  3FKI H;  4JOI C;  1A62 A;  4P75 A;  4TQU S;  1VQO A;  3STB D;  4LF7 L;  3M3Y H;  3PO3 H;  1D7Q A;  3CC2 A;  1BBW A;  3TRZ A;  5IP9 H;  2ZM6 L;  1PH6 A;  2IX1 A;  1B70 B;  3UE0 A;  4LF5 Q;  4LF6 Q;  3GTQ H;  5C4X G;  1XJV A;  1N9W A;  1P16 A;  4R4Q A;  3F2B A;  5LMU Q;  1SN8 A;  1PH7 A;  1YJ9 A;  1TXY A;  2K75 A;  4K0K Q;  1SR3 A;  3L7Z C;  4HIK A;  4UP8 A;  3W1G A;  4JI0 L;  3FHW A;  1Q82 C;  3NEM A;  4DV6 L;  3RLN A;  1HNW Q;  2F4V L;  4R4T A;  3KJP A;  3L0O A;  2IHF A;  2VQF L;  4QIW E;  2VZA A;  1QZH A;  3NEL A;  4LFB L;  1X3G A;  2QEX A;  3AQQ A;  2PMZ E;  3F2C A;  2A19 A;  2UUB Q;  5ELO A;  1EYG A;  3JAM i;  1IBL L;  3ZJY C;  2UXC Q;  5C4X H;  2KEN A;  3K81 C;  4NB3 A;  3HOX G;  1TWG H;  1HZA A;  5C3E G;  2HHH Q;  2XGT A;  2HIX A;  3K80 C;  3RLO A;  4JC0 A;  1LYL A;  1R9T H;  1JMC A;  4IJL A;  4C2M H;  1EQR A;  4P72 A;  4PMW A;  3W5O A;  1V1Q A;  3CF5 A;  1EOV A;  1ASY A;  4X64 Q;  2ZTD A;  2RHS B;  4PG3 A;  1CKN B;  1L1O A;  2MO1 A;  4OXP A;  5GAE C;  3TS0 A;  3E0E A;  1NMF A;  1HZC A;  2N8N A;  2FXQ A;  4DNI A;  3J7Z C;  2Z0S A;  4HJA A;  4IFD G;  5H1S E;  1PH8 A;  2Q2U A;  2UU9 L;  2XTI A;  4YWK A;  4JI4 L;  3H3V H;  3TQY A;  2L15 A;  1QVG A;  4LFA Q;  3HKS A;  5IWA Q;  3VDY A;  1JT8 A;  2VS1 A;  3SGI A;  5C3E H;  1EQQ A;  4DV1 Q;  1IBM Q;  1PH3 A;  1N32 L;  3K0X A;  1EIY B;  3HOW G;  3KYH C;  2LXK A;  4HJ9 A;  3IRB A;  2A1A A;  1AE2 A;  2ALY B;  5AJ3 Q;  3HOV G;  4DR6 Q;  5ELN A;  4A4I A;  1HNZ L;  4GS3 A;  1N36 Q;  3CC7 A;  4NXN L;  1QZG A;  3CMA A;  1KD1 C;  2JA8 G;  3G4S A;  2EIF A;  1WOC A;  1LM0 A;  1YHB A;  2WFW A;  1PH4 A;  4DR4 Q;  4OO1 I;  5IYD H;  2NZH A;  4DV7 Q;  4AQY Q;  2BA0 A;  4JI3 Q;  3K7A H;  1VS0 A;  4Y7N H;  3HOW H;  2I0Q A;  4IPH A;  3UDF A;  5JJK A;  2ZTC A;  1YBY A;  2Q2I A;  1CSQ A;  4A3I G;  3PF4 A;  4LFC Q;  4JV5 L;  1IBK Q;  3HOV H;  4A76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...