3H3VH

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00575 S1 S1 RNA binding domain
H PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vH02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h3vH01
3KF8B 5GAGC 2PQAB 4JBJA 3G71A 4GLAC 3UDXA 5JJKA 4X65L 2WB1G 4LFCL 2ZM6L 4QQBX 3S14H 1D7QA 1FJGL 1BVSA 1N8RC 3RLOA 4HIOA 2VS1A 2ES2A 3GO5A 3I4OA 5DLQE 4DV4Q 4POFA 3CC2A 4JG2A 1NJIC 4QJFA 2JA5G 3CF5A 3J7ZC 3PIPA 2D62A 4LNQA 3CMAA 3U58A 3CCMA 1Q7YC 3S1MH 4BA2I 4DR5Q 4KLKA 1AH9A 2JEBI 3GTQH 2B63G 3PUXA 4X64L 1X65A 2KCTA 1E24A 4QL5A 3G4SA 2WAQG 5HGQA 2Z0SA 4LF8Q 1L1OC 4X6AH 2UUAQ 3F8TA 4A3DG 3FP9A 4C3JH 4GS3A 5J3BA 1PHJA 3I4NG 1MKHA 4A3GG 4GN4B 5C0XJ 1X54A 2RCNA 4BY1H 4AH6A 3DLLA 1XNQQ 3M9BA 3EN2A 3ULPA 3T1YQ 4JBKA 3M85A 4DV2Q 3Q8DA 4GKJL 1KXLA 1H95A 2KHJA 2PI2A 4BBRH 4GNXA 1VQKA 3E9HA 3J80i 4JOIC 3U4VA 4JI3Q 2HQLA 3E9IA 4LWCA 4NXNL 5IE8A 3GTJH 4IFDG 1PFSA 1HZ9A 4IJLA 4IPDA 1MIUA 4DR3Q 3PUVA 3H15A 1X3FA 2YTVA 1P16A 5FLXc 5IWAL 1OXXK 2JJQA 4DUZQ 4DV1L 4DV2L 4WJ3M 2IHEA 2QEXA 4X66L 4PG3A 3CCJA 3M4QA 2OTJA 2Z6KA 4L5SA 5IYDH 1XNQL 5M3MG 3KYHC 1YI2A 2ZTCA 2Q2UA 2YU9H 3U50C 2KCMA 1DGSA 4Y7NH 4A3KH 2Q2IA 1VQPA 3TRZA 3HOYH 5LMNW 2V1CC 2UXCQ 2CKZB 1KRTA 4DK3C 2JE6I 1AE2A 1U5KA 1HNXL 1R9TH 4DR5L 4OO1I 3S15H 5GADC 3TS2A 3PO2G 1VS0A 4GKJQ 1Q46A 1QUQA 3GTMH 3GTOH 2I5LX 3E0EA 3CCRA 1W3SA 1CKOA 2JA9A 1N34L 4A3JH 1HNXQ 2ZJRA 5LMUQ 1I5FA 3J80c 3PO2H 4GLVB 2NVXH 4IPHA 2HIVA 3ULJA 1K9MC 3PCOB 1D8LA 3IRBA 4DR2L 1FL0A 4YY3Q 1E3PA 2RHQB 4DV6L 3DM3A 2VZAA 3CCEA 1B7YB 2E2HH 2K14A 1KHIA 1PH4A 3L0OA 2CFMA 4UY8C 1VQEA 1GD7A 1HR0Q 3GTKH 4IPGA 4NXMQ 1YITA 5M5WH 4A3LH 4A93G 1EQRA 1N36L 3FHWA 4DV1Q 1QUQB 2F4VL 3BJUA 1PH6A 4LF5Q 5IYCG 4QY7A 4BXXH 4JV5Q 3CC4A 4IJHA 5IP9H 2MO0A 4JC0A 2R92G 2E5LL 1E1OA 3AQQA 3L2PA 2NVQH 4AQYL 1LUZA 2VUMH 1YVCA 4JI7L 4R1JA 2I5HA 1MJEA 4A3MG 3AFPA 4XTCS 1YZ6A 1G51A 4IPCA 4DV5Q 4HJ8A 4JI4L 2KBNA 4R4CA 5C0XI 4XIGS 4HIKA 1PVOA 1Q82C 1TWHH 1T9HA 1XPRA 3K81C 5GAEC 2UXDL 4DR2Q 1TWGH 3PSIA 4P74A 1KAWA 1E22A 4MZ9A 3HOWG 1J6QA 4LF4L 4GOPA 4LUZA 3GTPH 1VQOA 2F3IA 2JK8A 2AHOB 5IYBG 4TVAB 1I94L 2K4KA 4LUOA 3EIVA 1PH9A 4PZ7A 5AJ3L 3UE1A 4IOAA 2B29A 2CQOA 2GN5A 3CAMA 3OTOL 1IBMQ 3UDFA 4A3EG 3PO3G 3CCVA 1YJNA 4DV3Q 4K0KL 4YHHL 1PYSB 1WCMG 4GN5A 3I56A 1KQSA 3K8AA 2UXCL 1VQ4A 4GLXA 3K7UC 5JEAJ 3W5OA 3CCSA 4R4QA 1QZHA 2IY5B 3H0GG 4HJAA 1SFOH 5LMUL 4X62L 4X65Q 2NVYH 1SLJA 4DUYL 1A0IA 4LF6L 4ME3A 1S72A 3I4MH 2YTXA 4B3TQ 4OX9Q 3KDFA 5M5YH 4GNXB 4A3FG 2OWOA 1N32Q 3I7FA 4P75A 3JAMc 4JI0Q 4GKKQ 3F2DA 4AQYQ 4A93H 1WJJA 1PYBA 4HJ9A 4TQUS 4BBSG 1X3GA 4DR7L 1IBKL 4JBWA 1IBLL 1JJGA 1BBUA 3KJPA 3UDIA 4LF4Q 3F2BA 3T1HL 4JYAQ 4JV5L 1XNRQ 5GQOA 5H1SE 1PH8A 3J81i 5C0XG 1VQ5A 4JI0L 4POGA 1IZ6A 2JA6G 2OQKA 4KHPQ 1UE7A 2VY3A 1VQBA 1NTGA 3M7NA 1FGUA 2WFWA 1YNXA 1Q8KA 4YCWA 4AYBG 3KFUA 4KHPL 4OWWB 2UUCL 3UE0A 5LMNL 1EOVA 1PH1A 3TQYA 3H3VH 1Z47A 2XGTA 1J5EL 3KDFB 2NZOA 4C2MH 5C3EG 5ELNA 2OCEA 4YCVA 4NXNQ 3FKIH 4BA1I 1Y14B 5C4XH 2N3SA 4LF7Q 3RZOH 1VQ6A 1G6PA 1KRSA 4GKKL 3OYYA 3HOXH 3PF4A 1PH5A 4R4TA 1GKHA 1WI5A 2GVBA 1IYJB 4APVA 2JA7G 4JI2Q 3GDEA 2L15A 2MFIA 1CKNA 4A3BG 3K7AH 3HOYG 2ALYB 2F52A 2AMCB 2R7FA 2VW9A 2JA7H 2I5MX 1J5EQ 3I4NH 5IP9G 4UP9A 1NE3A 3CP0A 1TWFH 1UWVA 4R4OA 2MO1A 4L5QA 2GVAA 1TWAH 2A19A 1ASYA 3HOUG 3CMEA 5JEAG 2VQEQ 2E2IH 4A3MH 1K3RA 1X6OA 4UP8A 5GROA 4JI6L 2HHHQ 3G6EA 3PUZA 4YWKA 4JI7Q 3KOJA 1YHBA 4PZ6A 1WOCA 5C44G 2HT1A 2E5LQ 4DUZL 2K5NA 4DR1L 1SROA 3RLNA 2EXDA 2KHIA 1PV4A 4L5TA 1L1OB 1IBLQ 3AEVA 1EUJA 4A3IH 3CCQA 4A75A 1FJGQ 3BU2A 5BR8Q 2JA8G 4OX9L 4NPSA 5JJLA 2ZTDA 1EQQA 5HY6A 3CC7A 3PGZA 2VQEL 3S16H 1A62A 1YHQA 1EIYB 3J81c 2Q2TA 3A5UA 4P72A 3D0FA 2E2JH 2JA8H 3NENA 1EYGA 1HJPA 1VQFA 1N33L 1I50H 2IX1A 3CPFA 3T1HQ 3TS0A 4JYAL 1C0AA 2WAQE 2RHSB 3KF6A 3WWVA 1HZCA 1IBKQ 4LF5L 4DPGA 1E1TA 2K50A 1JT8A 3HKSA 1PH2A 4B3RL 2H5XA 3RN5A 3J81j 1I6HH 1CUKA 1N32L 1YJ9A 2VNUD 4B3TL 1JMCA 1VQ7A 1Z9FA 5FJ8H 1HZBA 1NBWA 1V1QA 1HR0W 4QIWE 1RL2A 1HZAA 4A3GH 2NZHA 4YY3L 3TEHB 4P71A 3OW2A 2UUAL 4OO1G 1SR3A 1XMQQ 1B8AA 4OWXB 4DV7L 1N33Q 1VQ9A 2VL6A 5FJ8G 1PH3A 4DR7Q 3RLFA 1HNWL 1UEBA 4C3HH 4BBRG 2B63H 2WB1E 2PMZE 3HOUH 4GOPB 4NB3A 4UP7A 1VQHA 1CSQA 4JI2L 2YTYA 1W2BA 5FLMG 3PO3H 1VQMA 1JE5A 1SN8A 3AYHB 3M4OH 2UU9L 2Z6KC 5IWAQ 2YYZA 3PIOA 3RN2A 3S24A 3AFQA 1QVGA 4JI5Q 2R6GA 3B6YA 3M4PA 4J15A 2CCZA 2YV5A 1XTDA 1PH7A 1V9PA 1SMXA 1K73C 4IFDI 3CCLA 4A3IG 3S1RH 3T1YL 1GM5A 2N49A 4NXML 2LXJA 1L0WA 1UE5A 1U0LA 2R7DA 2K5VA 4JI1Q 3SGIA 2R7ZH 2QGQA 4JOIA 4DUYQ 2JQOA 3EBEA 3F1ZA 5M5XH 2R93G 3PUYA 3I55A 1A63A 1YIJA 4DAMA 4DK6C 1XMQL 1TXYA 1O7IA 3A74A 3KJOA 1XMOQ 4B3MQ 1VQDA 3HFZB 5M3FH 4HIMA 1BKBA 1IL2A 1G291 2DUDA 1EFWA 2Q2HA 3TREA 3CPWA 1XJVA 2UUBQ 4A3JG 4JBMA 4JI3L 1CKMA 3I4MG 4MTNA 2N78A 3GTGH 4DR4L 4H02A 1QZGA 1AE3A 5AJ3Q 4A3EH 4JI6Q 4QGUA 2A8VA 2AKWB 1CSPA 4B3SQ 1I94Q 4IOCA 2OQ0A 2UXBL 4KHZA 4PMWA 1OXSC 4X62Q 3HOZG 1HH2P 2QA4A 1TWCH 3CQZH 4DAYB 4DNIA 3UDGA 2CWPA 2NVTH 1I3QH 3H0GH 2ZJPA 1QVCA 1WYDA 1NMFA 2ID0A 3KLWA 1VQLA 3CW2C 4X64Q 1X55A 4YHHQ 2PQAA 3HOVG 1Y1VG 1ASZA 1K8AC 3A0JA 1FVIA 3K0XA 4JI4Q 2IT1A 4HJ5A 2HIXA 1LTLA 3U4ZA 2MQHA 3M3YH 1KL9A 2MNAA 4C3IH 2OTLA 1Y1VH 3S17H 2LXKA 1XNRL 1C9OA 1JB7A 2UUBL 5C3EH 4LF9Q 3PV0A 3ZJYC 2K52A 4DV4L 3W1BA 1CKNB 1XMOL 4B3ML 3HKZG 2PI2E 1YJWA 1OXVA 2UU9Q 2VQFQ 2XTIA 5LMNQ 1XPOA 1N36Q 4YWMA 1Q86C 2HHHL 2UUCQ 5K36G 2RF4A 1K0RA 2FXQA 1VQAA 4JCVE 4DV0Q 1M1KC 1OTCA 4GNXC 2R92H 3F2CA 4DR6Q 4JI1L 1V43A 2IX0A 2Y0SG 4P73A 4X66Q 5M3MH 5IT9c 3CD6A 1YBYA 2VQFL 4LF8L 1IXRA 1OXUA 4EQ5A 1BBWA 4O2DA 4DV7Q 2I0QA 2NN6G 5C4XG 1YHAA 2JEAI 1SE8A 4HIDA 3NBHB 1VQNA 4RG1A 4JI5L 2ZTEA 1HNZL 4GN3B 3HOXG 4LFAL 1Q81C 4LW1A 1VQGA 5M3FG 1LM0A 1L1OA 4A3DH 4YWLA 1X9NA 1GVPA 1Y1WG 3HOWH 3BZKA 4A3BH 1JJCB 5IP7H 1KD1C 1HR0L 1JJ2A 3PF5A 3I2ZA 4DV6Q 4IO9A 1S40A 5E7NA 4A3FH 2BA0A 3PUWA 4K0KQ 1YEZA 1VQCA 2PNHA 1GO3E 3ICEA 2Y0SE 3KF6B 4PZ8A 1IBML 1LYLA 1NMGA 2EQSA 1RIPA 3MXNB 4DV0L 1K8GA 4EX5A 1NY4A 1SRUA 4R4IA 4DR4Q 2C35B 3BZCA 5IYDG 4IFDJ 5GAHC 4OXPA 2R93H 5IY0A 1B70B 5ELOA 1HNZQ 2NN6I 4A3KG 3HKZE 1X3EA 4DR1Q 3MEFA 4LF9L 1VQ8A 3S2HH 1N9WA 1MJCA 4BY7H 2JA5H 2JA6H 2UXDQ 1X56A 3RZDH 2ZM6Q 4LFCQ 3H3VI 2DGYA 4MNOA 3S1NH 4LFBL 1C7YA 3L7ZC 1K83H 4A76A 4LF6Q 2E8GA 2CWAA 1M90C 4FDBA 1XPUA 4BY7G 3STBC 4LFBQ 3GTLH 4DKAC 4DV5L 3S1QH 4A4IA 5BR8L 4WJ4A 3STBD 1Q12A 3K80C 3ERSX 4ALPA 4DR3L 2N8NA 5IYCH 4BXXG 1PA6A 2LSSA 4HJ7A 4KI0A 1E7ZA 4JI8L 5C4JH 4UPAA 4RMFA 4A3CH 3ULLA 3OTOQ 4B3SL 2R7ZG 5FLMH 2ASBA 5IYBH 3GD7A 2D0PA 3JC66 2D0OA 4LUVA 3RNUA 3FKIG 4LFAQ 1OXTA 4A3CG 2AWOA 1S3OA 4OONA 1HNWQ 1A8VA 2A1AA 1KC8C 1Q1BA 2K5HA 3JAMi 2IHFA 3NEMA 3S2DH 2BH8A 4YCUA 1Q1EA 4BY1G 3A5ZB 4DV3L 3VDYA 5C44H 1N34Q 2VUMG 1EIFA 4DR6L 2KENA 2UXBQ 4Y52H 1EWIA 1VQIA 2EIFA 4OWTB 1UE6A 3NELA 2ZJQA 4O0AA 2B3GA 3W1GA 3CXCA 1Y1WH 3HOZH 2WP8J 5JJIA 5IP7G 3J7A5 4B3RQ 4LF7L 1L2FA 3ER0A 3LGJA 4JI8Q 1KIXA 2ATWA 3CCUA 1P8LA 1VCIA 3D31A 1QVFA 4AYBE 1VQJA 1WCMH 4BBSH 3RR5A 4AIMA 4L5RC 2BA1A 2F4VQ 3HOVH 1UE1A 1WFQA 2K75A 2AWNA 4GOPC 2BH2A 3G48A 5EAYA 4A3LG
chains in the Genus database with same CATH superfamily
2AGOA 2W8LA 4QIWB 3W3AA 4OIJA 4R8UA 2ZM6L 3S14H 1VBHA 2SCUB 1FJGL 1BVSA 1EYCA 1EWHA 3RAQA 5D14A 5DLQE 4DV4Q 4ULLA 2L4NA 3JZIA 2W9CB 2F0PA 4IR9A 4QJFA 1CTMA 4C2MB 5KFKA 3CF5A 4HTHA 4RH6A 4IRCA 4ZUJA 4ED8A 2G5DA 2AQ2B 5DM63 4N9PA 4FXKC 3CCMA 4BA2I 4TV9F 4K5VA 4E6IA 4QB4A 5JH7F 3RB6A 1X65A 3L3OC 2PNRC 2QF7A 3W2DA 2WAQG 1BQQT 2W6MA 3Q8QB 2UUAQ 2NVYA 3K5IA 3VYRA 3RGZA 1SFOA 3G6VA 3FP9A 2EYLA 1JOKA 4A3GG 2F0HA 4DUZH 2JA5A 1FNWA 3M9BA 3OOCA 1I4PA 1PRTD 5E3FA 2C2RA 2OF1A 3Q8DA 1B1ZA 4KHPH 4BBRH 2KQ3A 1PFSA 3H6MA 1HZ9A 2DLNA 4FVMA 4DL5A 3H15A 1P16A 3PW7A 2JJQA 2EDGA 1RJRA 5HBRB 1EFID 4X66L 2YZGA 2DNCA 2EYHA 3CCJA 3M4QA 4RUCA 1H9KA 2CHBD 2Z6KA 1XNQL 5M3MG 2N88A 1LTRD 1XWEA 3GV3A 2ZJTA 1DGSA 4A3KH 2GPWA 5LMNW 2NTTA 4LF5H 4HMJA 2KVMA 1AE2A 5BN3A 3SK4A 4L6TB 5DQHA 3GIQA 4G7HC 1BGWA 3E0EA 4I55F 4J9PA 1LABA 1TA8A 1HTLD 5FOBB 1HNXQ 2UUAH 5LMUQ 3S15B 2EXZA 3J80c 4GLVB 1TAEA 4ZQ3A 1K9MC 3GTQB 3PCOB 3M3YB 3IRBA 4DR2L 1FL0A 2RHQB 3LNNA 2YS6A 2ENBA 1GD7A 1SNQA 2RKSA 5M5WH 4A3LH 5CA1F 4K6DA 2R7MA 1EOTA 1U4RA 4M1UB 5C4HA 5LMUH 1QUQB 2HQEA 2L9HA 3T4AC 5IP9H 3CC4A 4DV7H 2R92G 1QCBD 4YJ2F 1H9MA 4QMGA 4X3UA 4AQYL 2NVQH 1CQJB 1YVCA 4R1JA 3PMFA 4XTCS 4L63B 1EY5A 3JRWA 1FD7D 1H9JA 5C0XI 4XIGS 4HIKA 1PVOA 1TWHH 1EQTA 2NWGA 2Q8IB 1STBA 4HMIA 1XPRA 3JRXA 5GAEC 2DJFC 3PSIA 3GTOB 2XCLA 1E22A 5KEEA 2W9CA 2YRXA 4LF4L 3NP8A 1Y1VB 4O4IF 2F3IA 2JK8A 5IYBG 4YAKB 1KJ9A 2PQEA 3NBHA 4LUOA 4J9LA 1Z2PX 1EYZA 3KBGA 1ENCA 4F8MA 1AP0A 4MV4A 1N34H 4RKBA 4ED2A 1AW7A 3V05A 1IBMQ 1PTOC 2VA2A 3MXUA 5KT5A 2FK2A 1WCMG 5CC4A 1V1OA 4GZYC 3M4IA 3DWQA 3K7UC 5JEAJ 1EY6A 1QZHA 2R61A 2M9VA 3V4ZA 1B04A 4ID6A 4HJAA 3Q1KA 4M7EA 4X62L 2AQ4A 2NVYH 3EVQA 4RA8A 3NTHA 5CYUA 4RFBA 1TY0A 1S72A 1AEXA 4OX9Q 3E5SA 4EBCA 1F2LA 4A3FG 3U9TA 2L55A 3R5FA 4GKKQ 4LF6H 1PYBA 4HJ9A 2F03A 2CW0D 1JJGA 4RUAA 5LMNH 1F2YA 2I46A 3GIKA 3KJPA 4LF4Q 4JV5L 2XIGA 4JYAQ 1XNRQ 2O4XA 1PH8A 3J81i 3K3PA 4A3FB 3H3VC 1TU2B 1SMYC 2W57A 2MHVA 1VQBA 1YNXA 4YCWA 1ZHSA 4MIUA 2UUCL 2VA3A 1AFPA 3TQYA 2I07B 1J5EL 1RTOA 3KDFB 3J81L 4JV1A 4C2MH 3S16B 2N3SA 4LF7Q 3BYYB 1G6PA 4MAMA 1A9XA 1LTGD 2WAQB 5DAUA 1WCMA 2GVBA 2UXCH 2F0VA 4JI2Q 2FHTA 1G91A 1S68A 3GDEA 3K7AH 2ALYB 5CBAE 1NCVA 2EVBA 2AMCB 3MFIA 1CZGA 3D3RA 5LL6b 4UP9A 3FKIA 2MO1A 4L5QA 1TWAH 2A19A 2K01A 5A2QE 1ASYA 1VKZA 5JEAG 2FLPA 1K3RA 1X6OA 4LJZC 1B9MA 3HZXA 1GUNA 3VR6A 5GONF 1WOCA 4MN3A 1BO0A 5C44G 4DUZL 2K5NA 3K5OA 1CA5A 4HNUA 1NR2A 2KHIA 1PV4A 1IBLQ 4L5TA 1L1OB 2XD4A 1O7YA 4HR7A 2K32A 1TKWB 1XDNA 4A75A 3GTGB 4JV0A 2B8FA 1TWAA 2CH4A 2G9DA 3CRLC 2GPSA 3WO1A 1EQQA 4I65A 3PO3B 2JA7A 3S16H 1A62A 2Q2TA 3PW2A 3J81c 3A5UA 4N8FA 2E2JH 2X6LA 1HJPA 1N33L 2IX1A 3CPFA 3TS0A 1Y1WA 2WAQE 5CA0F 3BDLA 3KF6A 1HZCA 1STHA 1SNCA 1JT8A 1E1TA 5K36H 3MR2A 4DV6H 3SI8A 2L5TA 1IKLA 2IPKD 1SYCA 3RN5A 2ZT9C 4UCUA 3PR5B 2HCCA 4N8X1 1B50A 1YJ9A 1VQ7A 3MA2B 3EJIA 2FFKB 1NBWA 2MUYA 5D3IB 4A3GH 1RL2A 4I7AA 4JVZA 5CV8A 1JWUD 4CJ0B 4ZAIA 4FYDA 1PH3A 4K8JA 5KFSA 4CKCA 4RZQA 5KFGA 4BBRG 2NVYB 2PMZE 1VQHA 1TWGA 1CSQA 4JI2L 1W2BA 1SYDA 3PO3H 5CB4F 4UCOA 2UU9L 2Z6KC 4O2AF 2BOSA 3AFQA 1ENAA 3GP7A 3URYA 1HXYD 3OIPA 1I4HA 1JB3A 2CCZA 2YV5A 4FXDA 3RIZA 4RAYA 4IFDI 1KDBA 1SYEA 2Y0SA 4LF9H 3RV4A 3S1RH 5FKAC 1OO9B 4NXML 3I72A 5KFPA 2EY2A 3KLSA 2R7DA 2R7ZH 2QGQA 3KTMA 4PNYA 3PUYA 1A63A 1YIJA 3OSPA 1ZETA 3X3MA 3KJOA 3I4NB 3HRZC 1VQDA 3HFZB 1S5ED 1Y8PB 5KNCA 1TWCB 2VQFH 3V96A 3I4MG 4XQQA 1W6KA 1SYGA 4DR4L 4H02A 1A2UA 1EIGA 1AE3A 3SEBA 3PW4A 4V190 4H7BA 3I12A 4PMWA 4YB8B 4X62Q 5KFXA 3CQZH 2AQ3B 1Q8IA 5CV6A 4DAYB 3JSLA 3FDTA 4DR7H 1I3QH 2XWBB 1QVCA 1WYDA 3BS1A 3I70A 1RCVD 2KA7A 1VF7A 2QDBA 1KNEA 1JX4A 1ASZA 1B6RA 4JPBW 2XCAA 1HUNA 1I6HB 4PWQA 4HCEA 2MQHA 1WTOA 1PDQA 3S17B 1SYFA 2R7ZB 5KFLA 1V51A 2W6NA 2MNAA 4TUYF 4NKLA 2OTLA 2LXKA 1Z2NX 2UUBL 1E2ZA 4LF9Q 1JC7A 2K52A 5AFWA 4IWXA 5DGBA 3GTGA 5J39A 1TWAB 1VDZA 2XSCA 2VQFQ 1KDAA 1N36Q 5KG2A 1ZXTA 3TMEA 2BDNA 1OTCA 2E5LH 3GTJA 2MGSA 3N42B 4ECXA 4DR6Q 3F2CA 1M7JA 4LSAA 1MZBA 2IX0A 2PYKA 2FJ2A 2HDMA 3CD6A 4XYMB 3S9WA 2RGRA 2PZUA 4ZK9B 2FB9A 3A55A 3PW0A 2YRWA 2TMPA 3DEOA 4JI5L 2ZTEA 3HOXG 2J9GA 4LFAL 1Q81C 5EKLA 4JI4H 3NGDA 3RMHA 4H0LC 3VA7A 1GUGA 2RQXA 1WTVA 4X62H 1X9NA 1GVPA 1Y1WG 3HOWH 2K33A 3BZKA 4A3BH 2E2HB 2UVWA 1GSOA 2ALZA 1ET6A 4RWSC 5EPKA 4IO9A 1S40A 4QW9A 4A3FH 2XNAC 4LK1C 4NLGA 1UAPA 1CZWA 1FR3A 3ICEA 2Y0SE 1IBML 5KFFA 2F0LA 4KHVA 1RIPA 3N41B 4R4IA 1GUWA 4IHJF 5GAHC 2R93H 1FKAH 1B70B 4MV8A 2PO4A 2HHHH 3MR5A 5BN4A 3HOYB 2K1BA 4LF9L 3KAJA 3QOJA 4FNFA 1JDEA 4BY7H 1D5XC 2C5CA 1AN8A 4DFAA 2JA6H 2PMZA 2E2DC 3S1NH 1T36A 2FPGB 4HEDA 1JQYD 4LF6Q 5K5PA 2O5IC 2CWAA 2EJFC 4CDDC 3NXWA 3WDNA 4A4IA 5EZYF 3J7AF 3MXNA 5BR8L 4JI8H 2R7NA 2Q8RE 1B9NA 3ERSX 4DR3L 4QWCA 3TP8A 4HJ7A 4KI0A 1E7ZA 5DEHA 5C4JH 4RMFA 2EE1A 1NR4A 3HEJA 5FLMH 1E4EA 2XRQD 5KFIA 2XIWA 2D0OA 2N55A 3G7LA 3FKIG 1YNNC 1VF5C 3VR4A 2EY6A 5KFBA 4OONA 3HP3A 3N6RA 1A8VA 2VXWA 1R9TB 1UC8A 5DLGA 3C1EA 3NEMA 2BH8A 3V6JA 2K03A 3K5NA 4J9SA 4DV3L 5C44H 3P20A 1K8OA 1VMPA 2VUMG 2ZXOA 2KENA 1VQIA 5HGTA 5I4DA 2YL2A 3P7JA 1B4OA 3CXCA 4FF3A 3LP8A 4DGZA 1KLUD 4B3RQ 4UCTA 4O3OA 2YW2A 1L2FA 1B44D 4JI8Q 4EQPA 1KIXA 5KFNA 3ETHA 4XT1B 2F0QA 4ECWA 1QVFA 3HB9A 5C8YF 1WCMH 5KG1A 1KAAA 3RR5A 4AIMA 5ELFA 2BA1A 4L5RC 4ECSA 2JA6A 2QYZA 5JVH3 5F9LA 2C22A 1GYFA 2K75A 2AWNA 2BH2A 2A69C 1RF2D 2R85A 1JCKB 3N43B 4GLAC 3UDXA 3I4MB 5JJKA 1H9SB 2WB1G 4LFCL 4DR1H 3T56B 1D7QA 3LWUA 1N8RC 4JI5H 3VYUA 2VS1A 3GO5A 3I4OA 1C4QA 1H9RA 3NUCA 4JG2A 1NJIC 5CV9A 1TR5A 4RB2C 1DJRD 2JA5G 2VQEH 1O7ZA 3ERQA 3IFTA 4ME5A 5KFDA 4CJ1B 3Q22A 3N8DA 3U58A 1JIHA 2RDHA 1UNSA 2B2TA 5FLXL 1AH9A 3GTQH 4QL5A 1E24A 2HVQA 2X6GA 3G4SA 4B3MH 4M9UA 4DN4M 1XYIA 4A3DG 4GS3A 1X54A 2RCNA 3AU7A 3GTMB 2XCPA 3MR6A 2C2DA 2VQDA 4AYBA 4KV6A 4CHTB 3T1YQ 3M85A 3C2PA 4GKJL 1C30A 2KHJA 1X32A 3E9HA 3U4VA 3BJYA 4LWCA 3DEPA 3V4SA 1BR9A 4IJLA 1MIUA 4O3PA 2K5DA 4RGMA 4DV1L 4J1MA 4DV2L 4IZ8A 2J6TA 4JV5H 1IKMA 4PG3A 1EEFD 1QOHA 4JI3H 5IGBA 4L5SA 5IYDH 3T51B 1HR0H 1U9RA 1E4FT 3SK8A 3J80W 4PMBA 4DR3H 5KFQA 2R8JA 3TRZA 1LO5D 1KTKA 4CKBA 1XXGA 3HOYH 4JI2H 4EGQA 4J6HA 4DK3C 4ZI7F 4DR5L 2D2CC 3K5MA 1Q46A 3GTMH 3GTOH 2I5LX 2E75C 1IOVA 1SEIA 3CCRA 4C3JB 1RYRA 3ND9A 1N34L 4A3JH 3OTOH 2ZJRA 2NVXH 4IPHA 2RCFA 1D6EC 4YP3A 2R92A 3ULJA 1BDOA 2UUBH 1D8LA 2WINB 2NYZD 4YY3Q 4DV6L 4I7ZC 2VZAA 2WACA 2Z6BA 2J6UA 1WTQA 4J9QA 1W96A 3GTKH 4J9OA 3UI2A 3A56A 4MA0A 1EQRA 4Q5VA 4IUNA 2R87A 4XX0B 1PH6A 2JA6B 4BXXH 4JV5Q 3L4KA 3RFCA 4DR2H 1S03G 1TWHA 2R82A 2MO0A 4KKSA 3I91A 5C4ZA 2E5LL 3RJ0A 3AQQA 5BPFA 1JORA 1YNND 1ZKOA 4LAAA 4JI7L 4A3MG 1CK1A 4DV5Q 1G51A 1LTBD 1YZ6A 4JI4L 1SE2A 3T1HH 1SSOA 1I3QA 2F4VH 2TSSA 4UAIA 3M4YA 3K81C 2UXDL 4DR2Q 2K04A 1HNZH 4KD3A 5I9OA 1CA6A 3HOWG 2OXPA 3GTPH 4TVAB 1I94L 1KNAA 1PH9A 4PZ7A 2RDJA 4HAEA 1CE8A 1OWTA 5BMVF 1AN7A 3JAMW 4IOAA 1SNDA 2B29A 2CQOA 2GN5A 3OTOL 3HOWB 3NPPA 3DHQA 2RSOA 4A3EG 1YJNA 4DV3Q 3HGBA 4K0KL 2EYJA 4YHHL 4GN5A 3K8AA 3MXGA 2IY5B 1O75A 5KG3A 3H0GG 4S3SA 4DR5H 4ECYA 5LMUL 3H40A 4X65Q 2JEJA 5M3MB 4A3EB 1I50A 1TS3A 4LF6L 5EWEA 2SNMA 4ME3A 3I4MH 2YTXA 1A3TA 5M5YH 2OEOA 1K3BC 4P75A 3JAMc 4JI0Q 5E4WC 1ML0D 1WJJA 4BBSG 1X3GA 4DR7L 1X3PA 4JBWA 1IBLL 2YU9A 3HOVB 1AZPA 3GIDA 3F2BA 2B8GA 1J9OA 5GQOA 2NU9B 1CHQD 1D5MC 4FXGC 4Q8FA 4NDXA 4TQSA 1FGUA 3S1NB 1GSHA 3D4RA 3KFUA 2JA5B 3T5LA 1SXTA 1U4PA 2NB0A 2FMMA 3UE0A 1EOVA 3CRKC 3MVVA 2XGTA 2FMAA 2I8CA 5ELNA 1LLRD 4NXNQ 3FKIH 5CAEB 3RZOH 2HUGA 1I7LA 4GKKL 1PH5A 4R4TA 1WI5A 1M8AA 3S14B 1PZKD 4NP5A 1F77A 2L15A 2MFIA 1CKNA 4WORA 1Z7TA 5C6AA 1E4EB 4IFDH 5M9OA 2R92B 3K58A 4XQJA 2ICIA 2VW9A 2I5MX 3I4NH 5IP9G 4B3SH 1NE3A 3BVMA 4UCVA 4MV9A 4IN3A 4HQ6A 1STAA 1CQFA 2E2IH 3K5HA 3NTKA 3JAML 1PX2A 4JUZA 5DM73 4FBUA 4JI6L 3D6CA 2A68D 3MAQA 4CC6A 2NVTB 2AU0A 1YHBA 4PZ6A 2PPBC 2E5LQ 3RZDB 5JJZA 3E3XA 1SROA 3BABA 2A6HC 2EXDA 5NUCA 3UQ8A 2VB2X 3K57A 4O3QA 3BU2A 1EY0A 4IUPA 3KF8A 2JA8G 3RZOB 1TWFA 1PRTB 4OX9L 4B3RH 1LT5D 5HY6A 5IIFA 2BDOA 1QILA 1YHQA 1EIYB 5KT6A 1WTRA 3FVQA 5KFCA 3N40P 3D0FA 3KHGA 1EYGA 4MV7A 4JYAL 1YNJD 1LT4D 2RHSB 2MJ8A 3WWVA 1IBKQ 4LF5L 2NU8B 3H94A 4CBVA 4RB0A 2O2LD 2H5XA 1CI3M 3VYSA 1I6HH 3NE5B 2FJZA 2E74C 1JMCA 3IFDA 2R93A 4C3HG 2F3VA 4P2CB 2NU6B 3J81W 2QDLA 3WNZA 3TEHB 4RGOS 1DM0B 1IBKH 1FNUA 3VPDA 1SEBD 3RLFA 1DXMA 1I50B 1UEBA 4Q45A 3KXYT 4FS1A 2WB1E 4KKUA 4C3HB 4QWBA 4UP7A 2W9BB 1EUDB 2YTYA 4DK0A 1VMCA 5FLMG 2KCCA 1F9SA 2W7OA 2CW0C 3AYHB 2CW8A 3PIOA 1IHZA 2YYZA 2EY1A 4ABNA 2SOBA 4ODGA 1QVGA 2B2YC 1Z2OX 2B2WC 4K14A 1PFMA 2R6FA 2RSNA 1V9PA 1SMXA 3RGXA 4DXFA 3CCLA 4IAJA 5C1PA 3T1YL 1GM5A 5DG9A 4X64H 1BXRA 3BYTB 3RBEA 1U0LA 1PFBA 3NWTA 3SGIA 4KN4C 4DUYQ 2B2VA 3EBEA 3EQLC 5M5XH 2EJGC 1KLGD 3I55A 1RJQA 5HV6A 4JV2A 2WV6D 5EPLA 3GTKA 3LWBA 4J9MA 4DAMA 2F0TA 5TSSA 1XMQL 1TXYA 4N9TA 1O7IA 3A74A 2Z8LA 4DR7Q 1EFWA 2Q2HA 3KUPA 3CQZB 3TDQA 4A3JG 4MTNA 2NVXA 5JPMC 5AJ3Q 4JI6Q 4QGUA 2A8VA 2AKWB 4B3SQ 2UXBL 3N6XA 1JR0D 5I47A 1HH2P 2ZJPA 1EZ8A 1VQLA 5M5WB 3CW2C 4ZCKA 1EZ1A 2FPPB 3P1HA 1D1IA 3PVXA 1X55A 2PQAA 3HOVG 1RHPA 3EPGA 3ND8A 1FVIA 3A8KE 3K0XA 4C1NI 2HIXA 1T5XD 2KECA 2OT2A 4NMZA 1EU4A 5C3EH 3ZJYC 4DV4L 3W1BA 1N56A 3HKZG 2PI2E 3QJYA 1YJWA 1M0WA 1TWHB 2UU9Q 3Q23A 2K05A 2XTIA 5T1IA 5K36G 5KKNB 4F4WA 1Q86C 5C4XB 5CV5A 5D1PA 4DV0Q 3PW5A 3BA8A 1RTNA 4B3TH 5L1LA 1QNUA 4C1NK 2F0UA 1HNXH 1ILQA 5M3MH 3M7NA 1RJTA 1BBWA 4DAVA 5L1IA 1W93A 5C4XG 3KBXA 4DV5H 5KFOA 1HNZL 5H80A 5DLFA 1VQGA 1V4YA 1L1OA 4QWAA 1KC7A 4I7HA 3T5HA 5IP7H 1HR0L 3H0GA 3N44B 3RAXA 3BDOA 3I2ZA 2P5ZX 1RYSA 1KJIA 5LA6F 5LP6F 3PO2B 4QUFA 4KJNA 2RDGA 3GV6A 2PNHA 1I6VC 1N48A 2E2JB 2E76C 2W7PA 3KF6B 1LYLA 4DV0L 3D6WA 1K8GA 1IW7D 4EFEA 2AUJD 1NY4A 1SRUA 3HKZA 2XC9A 1Y8OB 4EBDA 4OXPA 5IY0A 1U4MA 1V8QA 4DR1Q 2ICEC 3VR5A 2B63B 1B33N 3S2HH 4UDUC 2LY7A 2R8HA 1K1QA 3OWEB 2UXDQ 2V4RA 1X56A 3H3VI 2ZM6Q 2DGYA 2DZDA 2YZMA 4LFBL 5IWAH 3Q8RB 3L7ZC 1K83H 5K2MA 2B39A 4BY7G 3STBC 4LFBQ 2R7KA 2B2YA 1HUMA 5EOYA 2F0MA 3K59A 4WD3A 2IBKA 4FF4A 2N8NA 4BXXG 2B2UC 2LSSA 2ZM6H 2NVXB 1ICFB 4A3CH 4B3SL 3MC0B 3R8BA 1B53A 1PZJD 2R7ZG 5IYBH 4E4TA 4RHRA 4BY1B 1S5DD 3EROA 4LUVA 4LFAQ 4KN7C 1OXTA 1G2SA 2YS7A 3ONAB 3OHXC 1S3OA 4IRDA 1HNWQ 4NXNH 1KC8C 2ZDHA 5KFEA 4R9WA 2IHFA 4U7CA 3S2DH 3J81E 1Q1EA 4BY1G 2NVQB 1D5ZC 4QIWA 1I94H 3CVZA 1N34Q 1EIFA 1CM9A 5KFWA 4ED1A 1EWIA 1NUCA 4OWTB 3OHBA 1C8CA 3TN2A 1UUPA 5KFJA 4J8QA 2WP8J 5JJIA 1FNVA 1G8ZD 1T5EA 3NQIA 2X0SA 1ULZA 1M0TA 2E2IB 3TBIB 1GUTA 3R2IA 4AYBE 5JVLA 2J7ZA 4HSVA 1EY8A 3J80L 1JXLA 3QIAA 3F8NA 4O4LF 5EKIA 3KF8B 5GAGC 3G71A 3JSNA 4A3JB 2V59A 4QQBX 4BWSC 5L37A 1IW7C 1PTOH 3G8CA 3GV7B 3RLOA 3P75A 3WOEA 4H13C 3DWAA 1WD1A 4POFA 3CC2A 2VOBA 4JW0A 2M05A 2R8KA 1DONA 4ZHQF 4MHEA 1PXUA 3PIPA 1XTCD 2D62A 1KJ8A 5C44B 4ZUIA 1HCZA 1NAPA 2DY8A 5EWGA 3S1MH 4K0KH 5F2DA 3GIMA 3GTJB 4KLKA 4RGTA 2JEBI 3MWDA 2R93B 4X64L 3T1YH 3GTLA 2L1BA 5FLXW 2A74C 1XMOH 5HGQA 2AUKA 2Z0SA 3J7YW 1L1OC 2WKCA 4DU9A 4X6AH 1B3QA 4MV6A 4QF4A 4C3JH 5J3BA 3KALA 1MKHA 2EOTA 4GN4B 4BY1H 1XNQQ 4AH6A 3HKZB 4YR0A 3TP7A 2JN4A 4C3IG 3ULPA 1LACA 4MTDA 5C4JB 4C2MA 1F2MA 3JAME 1MHWC 1E2WA 4JI3Q 3J80i 4JOIC 3SE0A 1G2TA 4DL7A 4NXNL 1V1PA 4IFDG 4X66H 4DR3Q 5IWAL 1OXXK 4LFBH 2IHEA 4YJ3F 2OTJA 3DM1A 4DXGA 3C3LA 2ZTCA 4RGNA 4RAUC 1GUOA 2KCMA 1IBLH 1TIID 2Q2IA 1HRJA 3WO0A 2UXCQ 4MA5A 4LMYA 4G57A 2JE6I 4BBRB 1F2ZA 1HNXL 5KT4A 3BQ2A 4OO1I 4ZKCB 3MJFA 3TSSA 3PN1A 2ASLA 3PO2G 1VS0A 1XNQH 1QUQA 2DNEA 1U4LA 2ZXRA 3BQ1A 1QB5D 1X3QA 3QZ7A 1CKOA 2JA9A 1I5FA 2B2UA 2FLNA 5C3WA 2SDFA 5KG6A 4O3RA 2HIVA 1SDFA 1E3PA 1JWMD 3G6JB 3DM3A 4X3SA 1B7YB 4Y7NB 2E2HH 2Q8TA 4JI6H 3L0OA 3IAYA 1VQEA 2DJGC 4IPGA 2XRSD 2W71A 4A93G 1YITA 4EEQA 3QFFA 1WVLA 1Y1VA 1ESFA 1SNOA 4LF5Q 3SDZA 1RJPA 4HNTA 4BY7B 4IJHA 4JC0A 4OIKA 2RGVA 2F0SA 4QWEA 4FU0A 1R9TA 2VUMH 2I5HA 3AFPA 4HJ8A 4IPCA 4IQZA 1TS2A 1LTTD 2KBNA 4R4CA 3J80E 3QWNA 2V4QA 4CKEA 1PMRA 3CKIB 3GV5B 2LS01 1DYQA 1T9HA 3HG9A 2A5HA 1CQIB 4ZQIA 2BCOA 3E6ZX 1M6VA 1WR2A 2LMCB 4RCNA 1DIKA 1KAWA 1WH2A 1J6QA 3EA6A 4GOPA 1GHKA 1A3UA 3NTIA 4LUZA 3ORQA 2AHOB 2K4KA 3EIVA 4G7ZC 1IYVA 4KY7A 5AJ3L 1ZHQA 5KYIA 3S2HB 4UHVA 5IYZF 4X65H 3Q0AA 4LSXA 5IGEA 4F7XA 2FK1A 3UDFA 4DAPA 2M2LA 4XYLB 5FD5A 5D3DA 3I56A 1PYSB 1KQSA 1K83B 3KHLA 1SJHD 4R4QA 3A8JE 3GTOA 3R3OA 2FPIB 1SLJA 4DUYL 5COYA 3TINA 5FPOA 4RNNA 4B3TQ 4DR6H 5IGCA 2K5WA 3KDFA 4FS2A 4O4HF 4A93H 1L0XB 1PLFA 3FRPB 4TQUS 4XT3B 5CV7A 1IBKL 2FE3A 1BBUA 1PYWD 4CC5A 3UDIA 2WAQA 3T1HL 2G9HD 1RODA 1VQ5A 4IUVA 4GC7A 2IP4A 5EDWA 2OQKA 1UE7A 1NTGA 5EQ0A 3GQBA 2PBZA 1STGA 4ILWA 2F0OA 3D4DA 4OWWB 4KHPL 1PH1A 5LMNL 3H3VH 5DG7A 4G3IA 2A68C 4RNOA 1D1KA 3H4DA 3K5LA 2CH4W 2ZDQA 5KFRA 1EHIA 5C3EG 4YCVA 3OWFA 1QWYA 2DPJA 1VQ6A 1KRSA 5CV4A 3HOXH 3PF4A 1I6UA 1GKHA 2IL8A 4APVA 3HOUB 4A3IB 2JA7G 1JICA 1J8IA 1WTXA 5KFUA 4A3BG 1XX8A 4HR7B 5C3EB 4KJOA 3HOYG 2F52A 4F4ZA 3A8IE 1UC9A 4C3IB 2R7FA 5LXTF 5BN5A 5M3FB 4EFBA 3MWEA 4DV4H 4A3MB 3CP0A 1UWVA 3HOUG 3SE7A 3MXPA 2A73B 4K6LA 4EYIB 3CMEA 4A3BB 3HXLA 1SNPA 4XXEA 4HSPA 4A3MH 2HHHQ 3G6EA 3X3NA 2KEDA 4YWKA 1HNWH 3KOJA 4X3KA 5KT7A 4DK1A 4DA2A 5G3LF 5I9PA 1TY2A 3OUZA 3BG5A 4DR1L 3TIGA 1ENFA 3CU7A 1A15A 1EUJA 3AEVA 4WRDA 2DIKA 2E2IA 2C00A 5BR8Q 4XZ3B 2F0IA 2JXMB 4DV1H 4O2BF 3QO2A 3FKIB 4NPSA 3EPIA 4R8NA 3CC7A 4FO2A 2VQEL 4TSSA 2LFNA 1GXDC 1K28A 2JA8H 2HD3A 3NENA 1DZ1A 1SAPA 1B2TA 1EY7A 3MFHA 4YR2A 4GC6A 5A35A 1C0AA 1HQMC 4IWYA 1XMQH 3MTSA 2K50A 1N33H 2C28A 2AGPA 1PH2A 4B3RL 3J81j 1N32L 4DNRB 1S97A 2VNUD 2MP1A 1Z9FA 4EBEA 3I90A 5FJ8H 5DQIA 1PFNA 1HZBA 1V1QA 4YQWA 1HR0W 1NNXA 4G4KA 4PQXA 4QIWE 5KGUA 4YY3L 4A93B 1I3QB 4P71A 2Y0SB 3OW2A 2UUAL 1XMQQ 2DWCA 1B8AA 4J0MA 4OWXB 2BQUA 1N33Q 2BQRA 2VL6A 4XYQA 4C3HH 3K0YA 2B63H 4I50F 3HOUH 5KT3A 4JYAH 2D5DA 3OPOA 4F88A 3Q2OA 3TQTA 1JE5A 1SN8A 3VYTA 5IWAQ 3RN2A 4IRKA 4JI5Q 5BR8H 1R4PB 3M4PA 3B6YA 2ATLA 4OX9H 4K2KA 3KHHA 1PH7A 3RV3A 2N49A 4AQYH 4HCSA 2LXJA 4JI7H 1FYCA 5FO8B 1UE5A 4JI1Q 2J4XA 1MD2D 3FMCA 2JQOA 3F1ZA 3M7GA 1T94A 4KMUC 1TWGB 3A7AB 1FGBD 1YNJC 4DK6C 5C5JA 4TRDA 4A3DB 1TS4A 4B3MQ 5L9XA 5M3FH 4HIMA 1BKBA 2VR1A 2UUBQ 2FINB 3CPWA 2F0GA 4JBMA 1JOQA 3ZYYX 5LOVF 2J6SA 1CKMA 2W9BA 3GTGH 2RBMA 5DNFA 1QZGA 1BUVT 1A2TA 4WFN3 1HFNA 4A2BA 1CSPA 3MR3A 1I94Q 2OQ0A 5D1OB 3MWYW 3FMAA 1I4XA 3HOZG 4IR1A 4EGJA 1ONLA 3I73A 4DNIA 2GLTA 3LX0A 2ID0A 3KLWA 4ED7A 1BNZA 1Y1VG 3D4WA 4R8UB 2A6EC 5KG4A 1K8AC 3A0JA 4JI4Q 2EYPA 2FMCA 1LTLA 5KFYA 1TWCA 1TVXA 4MV1A 1II3A 4QWDA 2IMWP 1KL9A 1IOWA 3K6OA 4DNTB 3TQ1A 2K5QA 1GGOA 1XNRL 1C9OA 4A2AA 2QILA 1CKNB 4B3ML 1E0BA 2HVRA 2E2HA 5LMNQ 1XPOA 4ECZA 4YWMA 2UUCQ 1K0RA 2RF4A 1VQAA 4C3JG 1M1KC 2EPBA 4HYKA 3RB4A 1Q3LA 4JI1L 2IWHA 2IX3A 4PDBA 3BVGA 4P73A 5IT9c 3SR1A 1YBYA 2VQFL 4LF8L 2I0QA 4EQ5A 3L9AX 4DV7Q 2R7ZA 2WYOA 1SE3A 1YHAA 2F1MA 2JEAI 3TZUA 4RG1A 2F0KA 3BAAA 4RAZA 4GN3B 4LW1A 1I4GA 5M3FG 1JKJB 5HURA 5ELDA 1PRTF 2JP1A 4C5AA 3KK7A 2O5JC 5KFAA 2HCIA 2L0CA 1MI2A 2R3ZA 3PF5A 4Q44A 4JI0H 5JOBA 4FP5D 2PMZB 3H4BA 5E7NA 1S5BD 4OHJA 3Q8PB 5JEAH 1N36H 2F3WA 1YEZA 5LL6X 1QNKA 1S5CD 1D2BA 1Z6HA 5KG0A 3KLRA 3MXNB 1WTPA 4EX5A 1VBGA 4DR4Q 1Y8NB 2C35B 2RVLA 3BZCA 4IFDJ 2ZDGA 4Z9CB 5ELOA 1HNZQ 2NN6I 4EG0A 3SVMA 4A3KG 3HKZE 2P0AA 1X3EA 3NWSA 3MEFA 4YBZB 3AMUA 2ZXPA 4R8IA 1VQ8A 3IKJA 2JA5H 4LFCQ 4MNOA 4CGYB 3VA5A 1HA5A 2ASDA 2W6ZA 4DR4H 4A3GB 4Q43A 4GKKH 4FDBA 3I3CA 4XQNA 1XPUA 4OL7A 3FPUB 3GTLH 4IZOA 4CDCC 5JQWA 1O78A 2JYOA 5C0XH 2CVRA 5DG8A 3GTQA 5LYJF 4WJ4A 3OHAA 4LF4H 1F9QA 4DL6A 1Q12A 3NHHA 4ALPA 3E5NA 1PA6A 2W6QA 3BA9A 4LFCH 4JI8L 4ED0A 3R93A 4UPAA 3PR4A 4B9XA 3H91A 3OTOQ 1IYUA 2BE5D 1PZID 1A3VA 3V6HA 5KFVA 1FJGH 2F0NA 4ECVA 2ASJA 4DV3H 4ECUA 4OEMB 3MZ5A 1S9FA 4BBSB 3JC66 3PIP3 3DMUA 1PTOD 2QCPX 5LHY1 4EYHB 2K7VA 4A3CG 2AWOA 2QEJC 3O13A 2RDFA 2A1AA 3SHLA 1Q1BA 1HPCA 2K5HA 1LTID 3VR3A 4CDFC 2SEBD 5CGKA 3A5ZB 3GIPA 1EYDA 5EGTA 3OUUA 2XN9C 1WSCA 4IALA 2UXBQ 5DGAA 4KY5A 2EIFA 1UE6A 3NELA 2ZJQA 2V58A 3FDSA 2B3GA 1Y1WH 5KYLA 3GILA 5I6WA 5JVDF 3J7A5 4RU9A 4LF7L 3LGJA 5FO7B 3M9MB 3DF7A 3EYYA 4UCRA 5IGGA 2ATWA 2DY7A 1VCIA 3CCUA 3D31A 4F4YA 4BBSH 1VQJA 2F4VQ 5D8DA 3HOVH 1UE1A 2F0EA 3J7AK 3G48A 5EAYA 4A3LG 2W6PA 1MBYA 2PQAB 4JBJA 3SK5A 4Q8EA 4X65L 1EL0A 1LT6D 3S1QB 4HIOA 2NUCA 2ES2A 5J22A 3EFXD 1UEAB 4QCLA 3HOZB 2DPIA 1KBLA 4RB3C 2HDLA 3T16A 4AYBB 4B9WA 3J7ZC 1S5FD 3KAKA 3M9OB 3S1MB 5I2YA 3Q24A 4LNQA 1GJXA 3GIIA 3CMAA 1LT3D 4YR3A 4O42A 1Q7YC 4DR5Q 1DV1A 2IW3A 5EPJA 5IGFA 4ECRA 4DV2H 2B63G 3PUXA 1ICWA 3MEHA 2KCTA 2NU7B 1RDPD 1H9SA 2UXBH 4LF8Q 1AUXA 3F8TA 1HTPA 5IT9E 3I4NG 4XDXA 1PHJA 2MPMA 4OELB 4Y8VB 5C0XJ 4GKJH 2O03A 3DLLA 3OSNA 5CBEE 3EN2A 3MHBA 2L12A 4JBKA 4DV2Q 1KXLA 1H95A 2PI2A 4Q0YA 4GNXA 1VQKA 2HJWA 3BG3A 2HQLA 2X69A 3E9IA 4LMQD 5IE8A 3GTJH 2NZ1D 1S4ZA 4IPDA 1SYBA 4F50A 3E0JA 1WCMB 3PUVA 1X3FA 2YTVA 5FLXc 2VB3X 4DUZQ 5KFZA 4WJ3M 2QEXA 4YY3H 5C1OA 2PCFB 1K8MA 2W8KA 1JLLB 3KYHC 1YI2A 2K28A 5JPNC 3R23A 3TP6A 2Q2UA 2YU9H 3U50C 2R86A 4Y7NH 1VQPA 4RKLA 4U68A 5KIXA 2XVSA 4LH7A 2NTSA 1SNMA 2V1CC 2V4DA 3VPCA 2CKZB 1KRTA 1BJTA 4DL2A 1U5KA 1R9TH 4FF1A 2A6HD 3S15H 5GADC 3TS2A 4RB1A 2KJXA 4M8AA 4GKJQ 3PIO3 1G6ZA 2R8IA 5KRUA 4IURA 2W6OA 1W3SA 1AZQA 3PQIA 4BWGB 1DD2A 3PO2H 4F87A 5A2QW 4O3NA 1F9PA 4J9KA 3C0FB 4RHSA 3RUPA 2XWJB 5LL6S 2DN8A 3CCEA 1ET9A 4A3KB 5J2UF 2K14A 1KHIA 1PH4A 4J9NA 4F4XA 2CFMA 4UY8C 2UU9H 1HR0Q 3GTPA 4NXMQ 4DV0H 1N36L 5KNDA 3FHWA 3TZDA 4DV1Q 1Y1WB 2J0TD 1HA6A 3BDCA 3RUZA 2F4VL 3BJUA 4L1KA 2KCNA 5IYCG 4QY7A 2WE6A 1ESRA 5BPHA 3M9NB 4IUQA 1S0NA 1E1OA 5FO9B 3C46A 3L2PA 3GIJA 1LUZA 1JE4A 4H44C 1MJEA 2F0JA 2PZWA 2VUMA 3QZ8A 2EYOA 5EBCA 3OSOA 1Q82C 2QKIC 3DXJC 5IT9L 4CDEC 4U6PA 4JK1C 1TWGH 3RB0A 3QG1A 2L11A 1DCZA 3NQTA 4P74A 1A6XA 3Q6SA 4MZ9A 3U9OA 2Z9HA 2UUCH 2WIIB 1VQOA 5I2XA 4EGVA 2C9OA 3S1RB 2OH2A 4EVOA 5F9NA 1M4VA 4ZLTF 3UE1A 2NN6H 1DOKA 3CAMA 2YU9B 2NBFA 3PO3G 4RZRA 3CCVA 5EJWA 2WB1A 3A54A 2UXCL 3SK6A 1VQ4A 1B3AA 4GLXA 1HHVA 3W5OA 3CCSA 4TQRA 2W70A 2A69D 2EJMA 3BVZA 1SFOH 5EKKA 1STYA 2UVVA 4Q0FA 1GHJA 1A0IA 1STNA 2F0FA 1Q90A 2FKLA 1EIHA 2FK3A 4EQOA 2CW7A 4GNXB 2OWOA 1N32Q 1DV2A 3I7FA 1EYAA 3A7LA 3F2DA 4AQYQ 2KEEA 1UNNC 4KK7A 2V9WA 2OLSA 2AQ1B 5H1SE 2VPSA 3GTLB 2QK4A 1KEEA 5C0XG 4JI0L 4POGA 4MV3A 1IZ6A 2GA4B 2EZVA 4KHPQ 4FM9A 2VY3A 3NBIA 1N32H 2BR0A 2WFWA 4DAYA 1Q8KA 4AYBG 3C1FA 1S0MA 2KOLA 2WDTA 4LFAH 1Z47A 4B08A 1I7NA 5CMDA 5G3LD 1RD9D 1KJQA 2NZOA 3LWEA 1BF4A 3Q8SB 2KSWA 2OCEA 3IG0A 4L8JA 1J5EH 4BA1I 1V1PB 1Y14B 5C4XH 1LTAD 3OYYA 1NSNS 1IYJB 1BBXC 4J9RA 4OO1H 1T3NA 4LH6A 2Z4IA 1MSGA 3OMCA 1GLVA 2UVRA 4ETSA 1E2VA 4LF7H 3DUZA 3I8ZA 2JA7H 1PTOF 1J5EQ 5ELEA 2HVSA 1TWFH 4R4OA 2GVAA 1B6SA 3H20A 2VQEQ 1S10A 3OW7A 2MCTA 5M5XB 4KTAA 1PRTC 5GROA 4UP8A 1C48A 5JAVA 3PUZA 2WTFA 4JI7Q 1VAJA 2H1EA 4JI1H 2KHSA 2HT1A 4NW2A 5IGDA 2FP4B 1EEID 4PV1C 2C2EA 2UXDH 5FPRA 3LMLA 3RLNA 3V6KA 2BE5C 3F2UA 3R2TA 2PN1A 4A3IH 4WBNF 3CCQA 1FJGQ 3RB3A 4FBTA 1HFGA 5JJLA 1ZEQX 2ZTDA 1GSAA 4C5CA 3PGZA 1SJED 3QOLA 2IJ0A 3T13A 2UVUA 2B2WA 4P72A 1GUSA 3PZPA 1DOMA 1VQFA 1I50H 3T1HQ 2B2TC 4ZYSA 3IN5A 1BCPC 4DPGA 3HKSA 3VMMA 2F4IA 5JUMA 1BOSA 1CUKA 2WKDA 3N52A 5J1ZA 3SXHA 2RDIA 1WTHA 4B3TL 1CFMA 5KFTA 3L4JA 3NSWA 1TWFB 2PW5A 2NUAB 1RK5A 1HZAA 5KNBA 2NZHA 4OO1G 4RNMA 2PW7A 2R84A 1SR3A 1Y69U 4I4TF 1BCPB 4MTKA 4DV7L 1JOOA 1VQ9A 1PK8A 5FJ8G 1ILPA 2JEIA 1HNWL 3WOFA 2I87A 1ZYRC 2R7LA 4GOPB 4QW8A 4NB3A 2W9AA 3HOXB 4R7RA 5C5LA 2YYAA 1VQMA 5ELBA 4K5XA 3M4OH 4ZRZA 4CJ2C 3OIQA 1CHPD 5T14A 3S24A 1SCUB 1STEA 1C3OA 1O80A 2R6GA 1SE4A 4J15A 1AUVA 4DL3A 3RF2A 1XTDA 1K73C 1RKNA 1K83A 4O1NA 4A3IG 1W6JA 1L0WA 4O3SA 2K5VA 4WJWA 1QJOA 5CR3A 1BXTA 4C56C 4JOIA 1F9RA 2R93G 4ZKBB 3RBDA 5E1FA 5FLXE 1DOLA 5DQGA 4LF8H 4C5BA 1XMOQ 2JA6G 3M4OB 1IL2A 3MWMA 1G291 2DUDA 3TREA 1XJVA 5M5YB 4JI3L 2M00A 3KLSX 2N78A 2XGPA 2IA6A 2D9UA 4A3EH 2EYMA 3HBLA 3V2TA 4IOCA 5KG5A 3MFGA 4KHZA 1OXSC 3R5HA 2EYFA 1L2ZA 2QA4A 1TWCH 3UDGA 5KFMA 2CWPA 2Z1CA 3RD4A 3H0GH 2NVTH 1NMFA 4TV8F 4UFZA 3GTKB 1JDBB 4X64Q 2R8GA 4YHHQ 2BQ3A 4APMA 4V0BA 2SNSA 5IOCA 1CS0A 5JVG3 3KHRA 4DUYH 2IT1A 4HJ5A 3M3YH 3QB3A 3T53B 3U4ZA 4DF7A 3CQZA 5L1JA 4X3TA 3GTPB 4C3IH 4KY6A 1Y1VH 3S17H 5J2TF 1IBMH 1JB7A 5EWFA 2B2VC 3K7AB 3PV0A 4OGQC 3ORRA 3FEWX 4TKOB 5C3XA 1K0SA 1XMOL 5KT2A 1KABA 4IUTA 1OXVA 1ZQ7A 4K8IA 1CQVA 1KDCA 2HHHL 3GV8B 3H0GB 2FXQA 4JCVE 1TT2A 3TIIA 3ITPA 4GNXC 2R92H 2VUMB 3BZDB 1V43A 2Y0SG 3TP5A 3OMGA 4BS9A 4X66Q 5ISRA 1IXRA 1OXUA 4O2DA 2A6ED 4IUUA 1EZ6A 2NN6G 1K1SA 1SE8A 4HIDA 3GQCA 3GTMA 2F0WA 3NBHB 1VQNA 2PZTA 2CQYA 2YZNA 5IODA 1LM0A 4A3DH 2JEFA 4NXMH 3I4LA 4YWLA 1S0OA 3RTXA 1JWSD 1JJCB 4U673 4ED3A 1KD1C 2XGQA 1SMYD 2EY5A 5E4XA 5C5MA 1JJ2A 1WTWA 3VPBA 5KG7A 4DV6Q 4KKTA 5FD6A 5IT9W 2WB1B 1BCPF 2BA0A 3PUWA 4G7OC 1RK6A 4K0KQ 1VQCA 1GO3E 2VUGA 4ED6A 4PZ8A 1SFOB 1XNRH 1LTSD 1NMGA 2HGSA 2EQSA 4KD4A 3GLKA 4RCOA 4YIJA 5IYDG 1MSHA 4DLKA 1MGSA 3IL8A 1L0YB 1EWCA 1SYXB 3ETJA 1EUCB 4YAJB 4EEYA 1R4QB 1N9WA 1MJCA 5D65A 2VPQA 4HN7A 1EU3A 3T5KA 1WD0A 3RZDH 5FK9C 2I80A 1C7YA 2JEGA 4A76A 3NK9A 2E8GA 2RA4A 1M90C 3K3VA 4DKAC 4DV5L 3S1QH 5A2QL 2CZGA 1EQVA 1PTOB 4HNVA 3STBD 1ZYRD 1BNCA 3BQ0A 3K80C 1CT1D 5IYCH 5T1GA 3R5XA 3UFXB 3T5JA 2Z4HA 1TQOA 3ULLA 1EY9A 5KX5F 3AB9A 2B63A 4ME6A 4QUCA 1HQRD 2ASBA 2KUMA 3GD7A 4UCSA 2D0PA 2AGQA 1I4QA 2JA8B 3J7AV 3RNUA 5I6YA 3HS0C 3U9SA 2QW7A 4YHHH 5L1KA 3QR8A 3FPPA 1KJJA 3JAMi 2YCHA 4K5WA 4XYOA 4YCUA 1E4GT 1O7LA 1IL8A 3VDYA 1LV9A 4ECQA 4FF2A 4ECTA 3H09A 1QE6A 4DR6L 4Y52H 4DL4A 5ELCA 5KFHA 1BCPD 3S2DB 2V5AA 3DWPA 1SBBB 2LKVA 4O0AA 2H4OA 3CHBD 4PMCA 1QG7A 5EBDA 3W1GA 3HOZH 2PVPA 1EY4A 2F0DA 5IP7G 4MTEA 3ER0A 3MFYA 4EQNA 2K6AA 1P8LA 5D1OA 3D8GA 3G6YA 2CQAA 1I4RA 1TS5A 4K2LA 3VR2A 1WFQA 4ZOLF 2FLLA 5CORA 4GOPC 2JSOA 2JA7B 3G6XA 1GOZA
chains in the Genus database with same CATH topology
3KF8B 5GAGC 2PQAB 4JBJA 3G71A 4GLAC 3UDXA 5JJKA 4X65L 2WB1G 4LFCL 2ZM6L 4QQBX 3S14H 1D7QA 1FJGL 1BVSA 1N8RC 3RLOA 4HIOA 2VS1A 2ES2A 3GO5A 3I4OA 5DLQE 4DV4Q 4POFA 3CC2A 4JG2A 1NJIC 4QJFA 2JA5G 3CF5A 3J7ZC 3PIPA 2D62A 4LNQA 3CMAA 3U58A 3CCMA 1Q7YC 3S1MH 4BA2I 4DR5Q 4KLKA 1AH9A 2JEBI 3GTQH 2B63G 3PUXA 4X64L 1X65A 2KCTA 1E24A 4QL5A 3G4SA 2WAQG 5HGQA 2Z0SA 4LF8Q 1L1OC 4X6AH 2UUAQ 3F8TA 4A3DG 3FP9A 4C3JH 4GS3A 5J3BA 1PHJA 3I4NG 1MKHA 4A3GG 4GN4B 5C0XJ 1X54A 2RCNA 4BY1H 4AH6A 3DLLA 1XNQQ 3M9BA 3EN2A 3ULPA 3T1YQ 4JBKA 3M85A 4DV2Q 3Q8DA 4GKJL 1KXLA 1H95A 2KHJA 2PI2A 4BBRH 4GNXA 1VQKA 3E9HA 3J80i 4JOIC 3U4VA 4JI3Q 2HQLA 3E9IA 4LWCA 4NXNL 5IE8A 3GTJH 4IFDG 1PFSA 1HZ9A 4IJLA 4IPDA 1MIUA 4DR3Q 3PUVA 3H15A 1X3FA 2YTVA 1P16A 5FLXc 5IWAL 1OXXK 2JJQA 4DUZQ 4DV1L 4DV2L 4WJ3M 2IHEA 2QEXA 4X66L 4PG3A 3CCJA 3M4QA 2OTJA 2Z6KA 4L5SA 5IYDH 1XNQL 5M3MG 3KYHC 1YI2A 2ZTCA 2Q2UA 2YU9H 3U50C 2KCMA 1DGSA 4Y7NH 4A3KH 2Q2IA 1VQPA 3TRZA 3HOYH 5LMNW 2V1CC 2UXCQ 2CKZB 1KRTA 4DK3C 2JE6I 1AE2A 1U5KA 1HNXL 1R9TH 4DR5L 4OO1I 3S15H 5GADC 3TS2A 3PO2G 1VS0A 4GKJQ 1Q46A 1QUQA 3GTMH 3GTOH 2I5LX 3E0EA 3CCRA 1W3SA 1CKOA 2JA9A 1N34L 4A3JH 1HNXQ 2ZJRA 5LMUQ 1I5FA 3J80c 3PO2H 4GLVB 2NVXH 4IPHA 2HIVA 3ULJA 1K9MC 3PCOB 1D8LA 3IRBA 4DR2L 1FL0A 4YY3Q 1E3PA 2RHQB 4DV6L 3DM3A 2VZAA 3CCEA 1B7YB 2E2HH 2K14A 1KHIA 1PH4A 3L0OA 2CFMA 4UY8C 1VQEA 1GD7A 1HR0Q 3GTKH 4IPGA 4NXMQ 1YITA 5M5WH 4A3LH 4A93G 1EQRA 1N36L 3FHWA 4DV1Q 1QUQB 2F4VL 3BJUA 1PH6A 4LF5Q 5IYCG 4QY7A 4BXXH 4JV5Q 3CC4A 4IJHA 5IP9H 2MO0A 4JC0A 2R92G 2E5LL 1E1OA 3AQQA 3L2PA 2NVQH 4AQYL 1LUZA 2VUMH 1YVCA 4JI7L 4R1JA 2I5HA 1MJEA 4A3MG 3AFPA 4XTCS 1YZ6A 1G51A 4IPCA 4DV5Q 4HJ8A 4JI4L 2KBNA 4R4CA 5C0XI 4XIGS 4HIKA 1PVOA 1Q82C 1TWHH 1T9HA 1XPRA 3K81C 5GAEC 2UXDL 4DR2Q 1TWGH 3PSIA 4P74A 1KAWA 1E22A 4MZ9A 3HOWG 1J6QA 4LF4L 4GOPA 4LUZA 3GTPH 1VQOA 2F3IA 2JK8A 2AHOB 5IYBG 4TVAB 1I94L 2K4KA 4LUOA 3EIVA 1PH9A 4PZ7A 5AJ3L 3UE1A 4IOAA 2B29A 2CQOA 2GN5A 3CAMA 3OTOL 1IBMQ 3UDFA 4A3EG 3PO3G 3CCVA 1YJNA 4DV3Q 4K0KL 4YHHL 1PYSB 1WCMG 4GN5A 3I56A 1KQSA 3K8AA 2UXCL 1VQ4A 4GLXA 3K7UC 5JEAJ 3W5OA 3CCSA 4R4QA 1QZHA 2IY5B 3H0GG 4HJAA 1SFOH 5LMUL 4X62L 4X65Q 2NVYH 1SLJA 4DUYL 1A0IA 4LF6L 4ME3A 1S72A 3I4MH 2YTXA 4B3TQ 4OX9Q 3KDFA 5M5YH 4GNXB 4A3FG 2OWOA 1N32Q 3I7FA 4P75A 3JAMc 4JI0Q 4GKKQ 3F2DA 4AQYQ 4A93H 1WJJA 1PYBA 4HJ9A 4TQUS 4BBSG 1X3GA 4DR7L 1IBKL 4JBWA 1IBLL 1JJGA 1BBUA 3KJPA 3UDIA 4LF4Q 3F2BA 3T1HL 4JYAQ 4JV5L 1XNRQ 5GQOA 5H1SE 1PH8A 3J81i 5C0XG 1VQ5A 4JI0L 4POGA 1IZ6A 2JA6G 2OQKA 4KHPQ 1UE7A 2VY3A 1VQBA 1NTGA 3M7NA 1FGUA 2WFWA 1YNXA 1Q8KA 4YCWA 4AYBG 3KFUA 4KHPL 4OWWB 2UUCL 3UE0A 5LMNL 1EOVA 1PH1A 3TQYA 3H3VH 1Z47A 2XGTA 1J5EL 3KDFB 2NZOA 4C2MH 5C3EG 5ELNA 2OCEA 4YCVA 4NXNQ 3FKIH 4BA1I 1Y14B 5C4XH 2N3SA 4LF7Q 3RZOH 1VQ6A 1G6PA 1KRSA 4GKKL 3OYYA 3HOXH 3PF4A 1PH5A 4R4TA 1GKHA 1WI5A 2GVBA 1IYJB 4APVA 2JA7G 4JI2Q 3GDEA 2L15A 2MFIA 1CKNA 4A3BG 3K7AH 3HOYG 2ALYB 2F52A 2AMCB 2R7FA 2VW9A 2JA7H 2I5MX 1J5EQ 3I4NH 5IP9G 4UP9A 1NE3A 3CP0A 1TWFH 1UWVA 4R4OA 2MO1A 4L5QA 2GVAA 1TWAH 2A19A 1ASYA 3HOUG 3CMEA 5JEAG 2VQEQ 2E2IH 4A3MH 1K3RA 1X6OA 4UP8A 5GROA 4JI6L 2HHHQ 3G6EA 3PUZA 4YWKA 4JI7Q 3KOJA 1YHBA 4PZ6A 1WOCA 5C44G 2HT1A 2E5LQ 4DUZL 2K5NA 4DR1L 1SROA 3RLNA 2EXDA 2KHIA 1PV4A 4L5TA 1L1OB 1IBLQ 3AEVA 1EUJA 4A3IH 3CCQA 4A75A 1FJGQ 3BU2A 5BR8Q 2JA8G 4OX9L 4NPSA 5JJLA 2ZTDA 1EQQA 5HY6A 3CC7A 3PGZA 2VQEL 3S16H 1A62A 1YHQA 1EIYB 3J81c 2Q2TA 3A5UA 4P72A 3D0FA 2E2JH 2JA8H 3NENA 1EYGA 1HJPA 1VQFA 1N33L 1I50H 2IX1A 3CPFA 3T1HQ 3TS0A 4JYAL 1C0AA 2WAQE 2RHSB 3KF6A 3WWVA 1HZCA 1IBKQ 4LF5L 4DPGA 1E1TA 2K50A 1JT8A 3HKSA 1PH2A 4B3RL 2H5XA 3RN5A 3J81j 1I6HH 1CUKA 1N32L 1YJ9A 2VNUD 4B3TL 1JMCA 1VQ7A 1Z9FA 5FJ8H 1HZBA 1NBWA 1V1QA 1HR0W 4QIWE 1RL2A 1HZAA 4A3GH 2NZHA 4YY3L 3TEHB 4P71A 3OW2A 2UUAL 4OO1G 1SR3A 1XMQQ 1B8AA 4OWXB 4DV7L 1N33Q 1VQ9A 2VL6A 5FJ8G 1PH3A 4DR7Q 3RLFA 1HNWL 1UEBA 4C3HH 4BBRG 2B63H 2WB1E 2PMZE 3HOUH 4GOPB 4NB3A 4UP7A 1VQHA 1CSQA 4JI2L 2YTYA 1W2BA 5FLMG 3PO3H 1VQMA 1JE5A 1SN8A 3AYHB 3M4OH 2UU9L 2Z6KC 5IWAQ 2YYZA 3PIOA 3RN2A 3S24A 3AFQA 1QVGA 4JI5Q 2R6GA 3B6YA 3M4PA 4J15A 2CCZA 2YV5A 1XTDA 1PH7A 1V9PA 1SMXA 1K73C 4IFDI 3CCLA 4A3IG 3S1RH 3T1YL 1GM5A 2N49A 4NXML 2LXJA 1L0WA 1UE5A 1U0LA 2R7DA 2K5VA 4JI1Q 3SGIA 2R7ZH 2QGQA 4JOIA 4DUYQ 2JQOA 3EBEA 3F1ZA 5M5XH 2R93G 3PUYA 3I55A 1A63A 1YIJA 4DAMA 4DK6C 1XMQL 1TXYA 1O7IA 3A74A 3KJOA 1XMOQ 4B3MQ 1VQDA 3HFZB 5M3FH 4HIMA 1BKBA 1IL2A 1G291 2DUDA 1EFWA 2Q2HA 3TREA 3CPWA 1XJVA 2UUBQ 4A3JG 4JBMA 4JI3L 1CKMA 3I4MG 4MTNA 2N78A 3GTGH 4DR4L 4H02A 1QZGA 1AE3A 5AJ3Q 4A3EH 4JI6Q 4QGUA 2A8VA 2AKWB 1CSPA 4B3SQ 1I94Q 4IOCA 2OQ0A 2UXBL 4KHZA 4PMWA 1OXSC 4X62Q 3HOZG 1HH2P 2QA4A 1TWCH 3CQZH 4DAYB 4DNIA 3UDGA 2CWPA 2NVTH 1I3QH 3H0GH 2ZJPA 1QVCA 1WYDA 1NMFA 2ID0A 3KLWA 1VQLA 3CW2C 4X64Q 1X55A 4YHHQ 2PQAA 3HOVG 1Y1VG 1ASZA 1K8AC 3A0JA 1FVIA 3K0XA 4JI4Q 2IT1A 4HJ5A 2HIXA 1LTLA 3U4ZA 2MQHA 3M3YH 1KL9A 2MNAA 4C3IH 2OTLA 1Y1VH 3S17H 2LXKA 1XNRL 1C9OA 1JB7A 2UUBL 5C3EH 4LF9Q 3PV0A 3ZJYC 2K52A 4DV4L 3W1BA 1CKNB 1XMOL 4B3ML 3HKZG 2PI2E 1YJWA 1OXVA 2UU9Q 2VQFQ 2XTIA 5LMNQ 1XPOA 1N36Q 4YWMA 1Q86C 2HHHL 2UUCQ 5K36G 2RF4A 1K0RA 2FXQA 1VQAA 4JCVE 4DV0Q 1M1KC 1OTCA 4GNXC 2R92H 3F2CA 4DR6Q 4JI1L 1V43A 2IX0A 2Y0SG 4P73A 4X66Q 5M3MH 5IT9c 3CD6A 1YBYA 2VQFL 4LF8L 1IXRA 1OXUA 4EQ5A 1BBWA 4O2DA 4DV7Q 2I0QA 2NN6G 5C4XG 1YHAA 2JEAI 1SE8A 4HIDA 3NBHB 1VQNA 4RG1A 4JI5L 2ZTEA 1HNZL 4GN3B 3HOXG 4LFAL 1Q81C 4LW1A 1VQGA 5M3FG 1LM0A 1L1OA 4A3DH 4YWLA 1X9NA 1GVPA 1Y1WG 3HOWH 3BZKA 4A3BH 1JJCB 5IP7H 1KD1C 1HR0L 1JJ2A 3PF5A 3I2ZA 4DV6Q 4IO9A 1S40A 5E7NA 4A3FH 2BA0A 3PUWA 4K0KQ 1YEZA 1VQCA 2PNHA 1GO3E 3ICEA 2Y0SE 3KF6B 4PZ8A 1IBML 1LYLA 1NMGA 2EQSA 1RIPA 3MXNB 4DV0L 1K8GA 4EX5A 1NY4A 1SRUA 4R4IA 4DR4Q 2C35B 3BZCA 5IYDG 4IFDJ 5GAHC 4OXPA 2R93H 5IY0A 1B70B 5ELOA 1HNZQ 2NN6I 4A3KG 3HKZE 1X3EA 4DR1Q 3MEFA 4LF9L 1VQ8A 3S2HH 1N9WA 1MJCA 4BY7H 2JA5H 2JA6H 2UXDQ 1X56A 3RZDH 2ZM6Q 4LFCQ 3H3VI 2DGYA 4MNOA 3S1NH 4LFBL 1C7YA 3L7ZC 1K83H 4A76A 4LF6Q 2E8GA 2CWAA 1M90C 4FDBA 1XPUA 4BY7G 3STBC 4LFBQ 3GTLH 4DKAC 4DV5L 3S1QH 4A4IA 5BR8L 4WJ4A 3STBD 1Q12A 3K80C 3ERSX 4ALPA 4DR3L 2N8NA 5IYCH 4BXXG 1PA6A 2LSSA 4HJ7A 4KI0A 1E7ZA 4JI8L 5C4JH 4UPAA 4RMFA 4A3CH 3ULLA 3OTOQ 4B3SL 2R7ZG 5FLMH 2ASBA 5IYBH 3GD7A 2D0PA 3JC66 2D0OA 4LUVA 3RNUA 3FKIG 4LFAQ 1OXTA 4A3CG 2AWOA 1S3OA 4OONA 1HNWQ 1A8VA 2A1AA 1KC8C 1Q1BA 2K5HA 3JAMi 2IHFA 3NEMA 3S2DH 2BH8A 4YCUA 1Q1EA 4BY1G 3A5ZB 4DV3L 3VDYA 5C44H 1N34Q 2VUMG 1EIFA 4DR6L 2KENA 2UXBQ 4Y52H 1EWIA 1VQIA 2EIFA 4OWTB 1UE6A 3NELA 2ZJQA 4O0AA 2B3GA 3W1GA 3CXCA 1Y1WH 3HOZH 2WP8J 5JJIA 5IP7G 3J7A5 4B3RQ 4LF7L 1L2FA 3ER0A 3LGJA 4JI8Q 1KIXA 2ATWA 3CCUA 1P8LA 1VCIA 3D31A 1QVFA 4AYBE 1VQJA 1WCMH 4BBSH 3RR5A 4AIMA 4L5RC 2BA1A 2F4VQ 3HOVH 1UE1A 1WFQA 2K75A 2AWNA 4GOPC 2BH2A 3G48A 5EAYA 4A3LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF8 B;  5GAG C;  2PQA B;  4JBJ A;  3G71 A;  4GLA C;  3UDX A;  5JJK A;  4X65 L;  2WB1 G;  4LFC L;  2ZM6 L;  4QQB X;  3S14 H;  1D7Q A;  1FJG L;  1BVS A;  1N8R C;  3RLO A;  4HIO A;  2VS1 A;  2ES2 A;  3GO5 A;  3I4O A;  5DLQ E;  4DV4 Q;  4POF A;  3CC2 A;  4JG2 A;  1NJI C;  4QJF A;  2JA5 G;  3CF5 A;  3J7Z C;  3PIP A;  2D62 A;  4LNQ A;  3CMA A;  3U58 A;  3CCM A;  1Q7Y C;  3S1M H;  4BA2 I;  4DR5 Q;  4KLK A;  1AH9 A;  2JEB I;  3GTQ H;  2B63 G;  3PUX A;  4X64 L;  1X65 A;  2KCT A;  1E24 A;  4QL5 A;  3G4S A;  2WAQ G;  5HGQ A;  2Z0S A;  4LF8 Q;  1L1O C;  4X6A H;  2UUA Q;  3F8T A;  4A3D G;  3FP9 A;  4C3J H;  4GS3 A;  5J3B A;  1PHJ A;  3I4N G;  1MKH A;  4A3G G;  4GN4 B;  5C0X J;  1X54 A;  2RCN A;  4BY1 H;  4AH6 A;  3DLL A;  1XNQ Q;  3M9B A;  3EN2 A;  3ULP A;  3T1Y Q;  4JBK A;  3M85 A;  4DV2 Q;  3Q8D A;  4GKJ L;  1KXL A;  1H95 A;  2KHJ A;  2PI2 A;  4BBR H;  4GNX A;  1VQK A;  3E9H A;  3J80 i;  4JOI C;  3U4V A;  4JI3 Q;  2HQL A;  3E9I A;  4LWC A;  4NXN L;  5IE8 A;  3GTJ H;  4IFD G;  1PFS A;  1HZ9 A;  4IJL A;  4IPD A;  1MIU A;  4DR3 Q;  3PUV A;  3H15 A;  1X3F A;  2YTV A;  1P16 A;  5FLX c;  5IWA L;  1OXX K;  2JJQ A;  4DUZ Q;  4DV1 L;  4DV2 L;  4WJ3 M;  2IHE A;  2QEX A;  4X66 L;  4PG3 A;  3CCJ A;  3M4Q A;  2OTJ A;  2Z6K A;  4L5S A;  5IYD H;  1XNQ L;  5M3M G;  3KYH C;  1YI2 A;  2ZTC A;  2Q2U A;  2YU9 H;  3U50 C;  2KCM A;  1DGS A;  4Y7N H;  4A3K H;  2Q2I A;  1VQP A;  3TRZ A;  3HOY H;  5LMN W;  2V1C C;  2UXC Q;  2CKZ B;  1KRT A;  4DK3 C;  2JE6 I;  1AE2 A;  1U5K A;  1HNX L;  1R9T H;  4DR5 L;  4OO1 I;  3S15 H;  5GAD C;  3TS2 A;  3PO2 G;  1VS0 A;  4GKJ Q;  1Q46 A;  1QUQ A;  3GTM H;  3GTO H;  2I5L X;  3E0E A;  3CCR A;  1W3S A;  1CKO A;  2JA9 A;  1N34 L;  4A3J H;  1HNX Q;  2ZJR A;  5LMU Q;  1I5F A;  3J80 c;  3PO2 H;  4GLV B;  2NVX H;  4IPH A;  2HIV A;  3ULJ A;  1K9M C;  3PCO B;  1D8L A;  3IRB A;  4DR2 L;  1FL0 A;  4YY3 Q;  1E3P A;  2RHQ B;  4DV6 L;  3DM3 A;  2VZA A;  3CCE A;  1B7Y B;  2E2H H;  2K14 A;  1KHI A;  1PH4 A;  3L0O A;  2CFM A;  4UY8 C;  1VQE A;  1GD7 A;  1HR0 Q;  3GTK H;  4IPG A;  4NXM Q;  1YIT A;  5M5W H;  4A3L H;  4A93 G;  1EQR A;  1N36 L;  3FHW A;  4DV1 Q;  1QUQ B;  2F4V L;  3BJU A;  1PH6 A;  4LF5 Q;  5IYC G;  4QY7 A;  4BXX H;  4JV5 Q;  3CC4 A;  4IJH A;  5IP9 H;  2MO0 A;  4JC0 A;  2R92 G;  2E5L L;  1E1O A;  3AQQ A;  3L2P A;  2NVQ H;  4AQY L;  1LUZ A;  2VUM H;  1YVC A;  4JI7 L;  4R1J A;  2I5H A;  1MJE A;  4A3M G;  3AFP A;  4XTC S;  1YZ6 A;  1G51 A;  4IPC A;  4DV5 Q;  4HJ8 A;  4JI4 L;  2KBN A;  4R4C A;  5C0X I;  4XIG S;  4HIK A;  1PVO A;  1Q82 C;  1TWH H;  1T9H A;  1XPR A;  3K81 C;  5GAE C;  2UXD L;  4DR2 Q;  1TWG H;  3PSI A;  4P74 A;  1KAW A;  1E22 A;  4MZ9 A;  3HOW G;  1J6Q A;  4LF4 L;  4GOP A;  4LUZ A;  3GTP H;  1VQO A;  2F3I A;  2JK8 A;  2AHO B;  5IYB G;  4TVA B;  1I94 L;  2K4K A;  4LUO A;  3EIV A;  1PH9 A;  4PZ7 A;  5AJ3 L;  3UE1 A;  4IOA A;  2B29 A;  2CQO A;  2GN5 A;  3CAM A;  3OTO L;  1IBM Q;  3UDF A;  4A3E G;  3PO3 G;  3CCV A;  1YJN A;  4DV3 Q;  4K0K L;  4YHH L;  1PYS B;  1WCM G;  4GN5 A;  3I56 A;  1KQS A;  3K8A A;  2UXC L;  1VQ4 A;  4GLX A;  3K7U C;  5JEA J;  3W5O A;  3CCS A;  4R4Q A;  1QZH A;  2IY5 B;  3H0G G;  4HJA A;  1SFO H;  5LMU L;  4X62 L;  4X65 Q;  2NVY H;  1SLJ A;  4DUY L;  1A0I A;  4LF6 L;  4ME3 A;  1S72 A;  3I4M H;  2YTX A;  4B3T Q;  4OX9 Q;  3KDF A;  5M5Y H;  4GNX B;  4A3F G;  2OWO A;  1N32 Q;  3I7F A;  4P75 A;  3JAM c;  4JI0 Q;  4GKK Q;  3F2D A;  4AQY Q;  4A93 H;  1WJJ A;  1PYB A;  4HJ9 A;  4TQU S;  4BBS G;  1X3G A;  4DR7 L;  1IBK L;  4JBW A;  1IBL L;  1JJG A;  1BBU A;  3KJP A;  3UDI A;  4LF4 Q;  3F2B A;  3T1H L;  4JYA Q;  4JV5 L;  1XNR Q;  5GQO A;  5H1S E;  1PH8 A;  3J81 i;  5C0X G;  1VQ5 A;  4JI0 L;  4POG A;  1IZ6 A;  2JA6 G;  2OQK A;  4KHP Q;  1UE7 A;  2VY3 A;  1VQB A;  1NTG A;  3M7N A;  1FGU A;  2WFW A;  1YNX A;  1Q8K A;  4YCW A;  4AYB G;  3KFU A;  4KHP L;  4OWW B;  2UUC L;  3UE0 A;  5LMN L;  1EOV A;  1PH1 A;  3TQY A;  3H3V H;  1Z47 A;  2XGT A;  1J5E L;  3KDF B;  2NZO A;  4C2M H;  5C3E G;  5ELN A;  2OCE A;  4YCV A;  4NXN Q;  3FKI H;  4BA1 I;  1Y14 B;  5C4X H;  2N3S A;  4LF7 Q;  3RZO H;  1VQ6 A;  1G6P A;  1KRS A;  4GKK L;  3OYY A;  3HOX H;  3PF4 A;  1PH5 A;  4R4T A;  1GKH A;  1WI5 A;  2GVB A;  1IYJ B;  4APV A;  2JA7 G;  4JI2 Q;  3GDE A;  2L15 A;  2MFI A;  1CKN A;  4A3B G;  3K7A H;  3HOY G;  2ALY B;  2F52 A;  2AMC B;  2R7F A;  2VW9 A;  2JA7 H;  2I5M X;  1J5E Q;  3I4N H;  5IP9 G;  4UP9 A;  1NE3 A;  3CP0 A;  1TWF H;  1UWV A;  4R4O A;  2MO1 A;  4L5Q A;  2GVA A;  1TWA H;  2A19 A;  1ASY A;  3HOU G;  3CME A;  5JEA G;  2VQE Q;  2E2I H;  4A3M H;  1K3R A;  1X6O A;  4UP8 A;  5GRO A;  4JI6 L;  2HHH Q;  3G6E A;  3PUZ A;  4YWK A;  4JI7 Q;  3KOJ A;  1YHB A;  4PZ6 A;  1WOC A;  5C44 G;  2HT1 A;  2E5L Q;  4DUZ L;  2K5N A;  4DR1 L;  1SRO A;  3RLN A;  2EXD A;  2KHI A;  1PV4 A;  4L5T A;  1L1O B;  1IBL Q;  3AEV A;  1EUJ A;  4A3I H;  3CCQ A;  4A75 A;  1FJG Q;  3BU2 A;  5BR8 Q;  2JA8 G;  4OX9 L;  4NPS A;  5JJL A;  2ZTD A;  1EQQ A;  5HY6 A;  3CC7 A;  3PGZ A;  2VQE L;  3S16 H;  1A62 A;  1YHQ A;  1EIY B;  3J81 c;  2Q2T A;  3A5U A;  4P72 A;  3D0F A;  2E2J H;  2JA8 H;  3NEN A;  1EYG A;  1HJP A;  1VQF A;  1N33 L;  1I50 H;  2IX1 A;  3CPF A;  3T1H Q;  3TS0 A;  4JYA L;  1C0A A;  2WAQ E;  2RHS B;  3KF6 A;  3WWV A;  1HZC A;  1IBK Q;  4LF5 L;  4DPG A;  1E1T A;  2K50 A;  1JT8 A;  3HKS A;  1PH2 A;  4B3R L;  2H5X A;  3RN5 A;  3J81 j;  1I6H H;  1CUK A;  1N32 L;  1YJ9 A;  2VNU D;  4B3T L;  1JMC A;  1VQ7 A;  1Z9F A;  5FJ8 H;  1HZB A;  1NBW A;  1V1Q A;  1HR0 W;  4QIW E;  1RL2 A;  1HZA A;  4A3G H;  2NZH A;  4YY3 L;  3TEH B;  4P71 A;  3OW2 A;  2UUA L;  4OO1 G;  1SR3 A;  1XMQ Q;  1B8A A;  4OWX B;  4DV7 L;  1N33 Q;  1VQ9 A;  2VL6 A;  5FJ8 G;  1PH3 A;  4DR7 Q;  3RLF A;  1HNW L;  1UEB A;  4C3H H;  4BBR G;  2B63 H;  2WB1 E;  2PMZ E;  3HOU H;  4GOP B;  4NB3 A;  4UP7 A;  1VQH A;  1CSQ A;  4JI2 L;  2YTY A;  1W2B A;  5FLM G;  3PO3 H;  1VQM A;  1JE5 A;  1SN8 A;  3AYH B;  3M4O H;  2UU9 L;  2Z6K C;  5IWA Q;  2YYZ A;  3PIO A;  3RN2 A;  3S24 A;  3AFQ A;  1QVG A;  4JI5 Q;  2R6G A;  3B6Y A;  3M4P A;  4J15 A;  2CCZ A;  2YV5 A;  1XTD A;  1PH7 A;  1V9P A;  1SMX A;  1K73 C;  4IFD I;  3CCL A;  4A3I G;  3S1R H;  3T1Y L;  1GM5 A;  2N49 A;  4NXM L;  2LXJ A;  1L0W A;  1UE5 A;  1U0L A;  2R7D A;  2K5V A;  4JI1 Q;  3SGI A;  2R7Z H;  2QGQ A;  4JOI A;  4DUY Q;  2JQO A;  3EBE A;  3F1Z A;  5M5X H;  2R93 G;  3PUY A;  3I55 A;  1A63 A;  1YIJ A;  4DAM A;  4DK6 C;  1XMQ L;  1TXY A;  1O7I A;  3A74 A;  3KJO A;  1XMO Q;  4B3M Q;  1VQD A;  3HFZ B;  5M3F H;  4HIM A;  1BKB A;  1IL2 A;  1G29 1;  2DUD A;  1EFW A;  2Q2H A;  3TRE A;  3CPW A;  1XJV A;  2UUB Q;  4A3J G;  4JBM A;  4JI3 L;  1CKM A;  3I4M G;  4MTN A;  2N78 A;  3GTG H;  4DR4 L;  4H02 A;  1QZG A;  1AE3 A;  5AJ3 Q;  4A3E H;  4JI6 Q;  4QGU A;  2A8V A;  2AKW B;  1CSP A;  4B3S Q;  1I94 Q;  4IOC A;  2OQ0 A;  2UXB L;  4KHZ A;  4PMW A;  1OXS C;  4X62 Q;  3HOZ G;  1HH2 P;  2QA4 A;  1TWC H;  3CQZ H;  4DAY B;  4DNI A;  3UDG A;  2CWP A;  2NVT H;  1I3Q H;  3H0G H;  2ZJP A;  1QVC A;  1WYD A;  1NMF A;  2ID0 A;  3KLW A;  1VQL A;  3CW2 C;  4X64 Q;  1X55 A;  4YHH Q;  2PQA A;  3HOV G;  1Y1V G;  1ASZ A;  1K8A C;  3A0J A;  1FVI A;  3K0X A;  4JI4 Q;  2IT1 A;  4HJ5 A;  2HIX A;  1LTL A;  3U4Z A;  2MQH A;  3M3Y H;  1KL9 A;  2MNA A;  4C3I H;  2OTL A;  1Y1V H;  3S17 H;  2LXK A;  1XNR L;  1C9O A;  1JB7 A;  2UUB L;  5C3E H;  4LF9 Q;  3PV0 A;  3ZJY C;  2K52 A;  4DV4 L;  3W1B A;  1CKN B;  1XMO L;  4B3M L;  3HKZ G;  2PI2 E;  1YJW A;  1OXV A;  2UU9 Q;  2VQF Q;  2XTI A;  5LMN Q;  1XPO A;  1N36 Q;  4YWM A;  1Q86 C;  2HHH L;  2UUC Q;  5K36 G;  2RF4 A;  1K0R A;  2FXQ A;  1VQA A;  4JCV E;  4DV0 Q;  1M1K C;  1OTC A;  4GNX C;  2R92 H;  3F2C A;  4DR6 Q;  4JI1 L;  1V43 A;  2IX0 A;  2Y0S G;  4P73 A;  4X66 Q;  5M3M H;  5IT9 c;  3CD6 A;  1YBY A;  2VQF L;  4LF8 L;  1IXR A;  1OXU A;  4EQ5 A;  1BBW A;  4O2D A;  4DV7 Q;  2I0Q A;  2NN6 G;  5C4X G;  1YHA A;  2JEA I;  1SE8 A;  4HID A;  3NBH B;  1VQN A;  4RG1 A;  4JI5 L;  2ZTE A;  1HNZ L;  4GN3 B;  3HOX G;  4LFA L;  1Q81 C;  4LW1 A;  1VQG A;  5M3F G;  1LM0 A;  1L1O A;  4A3D H;  4YWL A;  1X9N A;  1GVP A;  1Y1W G;  3HOW H;  3BZK A;  4A3B H;  1JJC B;  5IP7 H;  1KD1 C;  1HR0 L;  1JJ2 A;  3PF5 A;  3I2Z A;  4DV6 Q;  4IO9 A;  1S40 A;  5E7N A;  4A3F H;  2BA0 A;  3PUW A;  4K0K Q;  1YEZ A;  1VQC A;  2PNH A;  1GO3 E;  3ICE A;  2Y0S E;  3KF6 B;  4PZ8 A;  1IBM L;  1LYL A;  1NMG A;  2EQS A;  1RIP A;  3MXN B;  4DV0 L;  1K8G A;  4EX5 A;  1NY4 A;  1SRU A;  4R4I A;  4DR4 Q;  2C35 B;  3BZC A;  5IYD G;  4IFD J;  5GAH C;  4OXP A;  2R93 H;  5IY0 A;  1B70 B;  5ELO A;  1HNZ Q;  2NN6 I;  4A3K G;  3HKZ E;  1X3E A;  4DR1 Q;  3MEF A;  4LF9 L;  1VQ8 A;  3S2H H;  1N9W A;  1MJC A;  4BY7 H;  2JA5 H;  2JA6 H;  2UXD Q;  1X56 A;  3RZD H;  2ZM6 Q;  4LFC Q;  3H3V I;  2DGY A;  4MNO A;  3S1N H;  4LFB L;  1C7Y A;  3L7Z C;  1K83 H;  4A76 A;  4LF6 Q;  2E8G A;  2CWA A;  1M90 C;  4FDB A;  1XPU A;  4BY7 G;  3STB C;  4LFB Q;  3GTL H;  4DKA C;  4DV5 L;  3S1Q H;  4A4I A;  5BR8 L;  4WJ4 A;  3STB D;  1Q12 A;  3K80 C;  3ERS X;  4ALP A;  4DR3 L;  2N8N A;  5IYC H;  4BXX G;  1PA6 A;  2LSS A;  4HJ7 A;  4KI0 A;  1E7Z A;  4JI8 L;  5C4J H;  4UPA A;  4RMF A;  4A3C H;  3ULL A;  3OTO Q;  4B3S L;  2R7Z G;  5FLM H;  2ASB A;  5IYB H;  3GD7 A;  2D0P A;  3JC6 6;  2D0O A;  4LUV A;  3RNU A;  3FKI G;  4LFA Q;  1OXT A;  4A3C G;  2AWO A;  1S3O A;  4OON A;  1HNW Q;  1A8V A;  2A1A A;  1KC8 C;  1Q1B A;  2K5H A;  3JAM i;  2IHF A;  3NEM A;  3S2D H;  2BH8 A;  4YCU A;  1Q1E A;  4BY1 G;  3A5Z B;  4DV3 L;  3VDY A;  5C44 H;  1N34 Q;  2VUM G;  1EIF A;  4DR6 L;  2KEN A;  2UXB Q;  4Y52 H;  1EWI A;  1VQI A;  2EIF A;  4OWT B;  1UE6 A;  3NEL A;  2ZJQ A;  4O0A A;  2B3G A;  3W1G A;  3CXC A;  1Y1W H;  3HOZ H;  2WP8 J;  5JJI A;  5IP7 G;  3J7A 5;  4B3R Q;  4LF7 L;  1L2F A;  3ER0 A;  3LGJ A;  4JI8 Q;  1KIX A;  2ATW A;  3CCU A;  1P8L A;  1VCI A;  3D31 A;  1QVF A;  4AYB E;  1VQJ A;  1WCM H;  4BBS H;  3RR5 A;  4AIM A;  4L5R C;  2BA1 A;  2F4V Q;  3HOV H;  1UE1 A;  1WFQ A;  2K75 A;  2AWN A;  4GOP C;  2BH2 A;  3G48 A;  5EAY A;  4A3L G; 
#chains in the Genus database with same CATH topology
 2AGO A;  2W8L A;  4QIW B;  3W3A A;  4OIJ A;  4R8U A;  2ZM6 L;  3S14 H;  1VBH A;  2SCU B;  1FJG L;  1BVS A;  1EYC A;  1EWH A;  3RAQ A;  5D14 A;  5DLQ E;  4DV4 Q;  4ULL A;  2L4N A;  3JZI A;  2W9C B;  2F0P A;  4IR9 A;  4QJF A;  1CTM A;  4C2M B;  5KFK A;  3CF5 A;  4HTH A;  4RH6 A;  4IRC A;  4ZUJ A;  4ED8 A;  2G5D A;  2AQ2 B;  5DM6 3;  4N9P A;  4FXK C;  3CCM A;  4BA2 I;  4TV9 F;  4K5V A;  4E6I A;  4QB4 A;  5JH7 F;  3RB6 A;  1X65 A;  3L3O C;  2PNR C;  2QF7 A;  3W2D A;  2WAQ G;  1BQQ T;  2W6M A;  3Q8Q B;  2UUA Q;  2NVY A;  3K5I A;  3VYR A;  3RGZ A;  1SFO A;  3G6V A;  3FP9 A;  2EYL A;  1JOK A;  4A3G G;  2F0H A;  4DUZ H;  2JA5 A;  1FNW A;  3M9B A;  3OOC A;  1I4P A;  1PRT D;  5E3F A;  2C2R A;  2OF1 A;  3Q8D A;  1B1Z A;  4KHP H;  4BBR H;  2KQ3 A;  1PFS A;  3H6M A;  1HZ9 A;  2DLN A;  4FVM A;  4DL5 A;  3H15 A;  1P16 A;  3PW7 A;  2JJQ A;  2EDG A;  1RJR A;  5HBR B;  1EFI D;  4X66 L;  2YZG A;  2DNC A;  2EYH A;  3CCJ A;  3M4Q A;  4RUC A;  1H9K A;  2CHB D;  2Z6K A;  1XNQ L;  5M3M G;  2N88 A;  1LTR D;  1XWE A;  3GV3 A;  2ZJT A;  1DGS A;  4A3K H;  2GPW A;  5LMN W;  2NTT A;  4LF5 H;  4HMJ A;  2KVM A;  1AE2 A;  5BN3 A;  3SK4 A;  4L6T B;  5DQH A;  3GIQ A;  4G7H C;  1BGW A;  3E0E A;  4I55 F;  4J9P A;  1LAB A;  1TA8 A;  1HTL D;  5FOB B;  1HNX Q;  2UUA H;  5LMU Q;  3S15 B;  2EXZ A;  3J80 c;  4GLV B;  1TAE A;  4ZQ3 A;  1K9M C;  3GTQ B;  3PCO B;  3M3Y B;  3IRB A;  4DR2 L;  1FL0 A;  2RHQ B;  3LNN A;  2YS6 A;  2ENB A;  1GD7 A;  1SNQ A;  2RKS A;  5M5W H;  4A3L H;  5CA1 F;  4K6D A;  2R7M A;  1EOT A;  1U4R A;  4M1U B;  5C4H A;  5LMU H;  1QUQ B;  2HQE A;  2L9H A;  3T4A C;  5IP9 H;  3CC4 A;  4DV7 H;  2R92 G;  1QCB D;  4YJ2 F;  1H9M A;  4QMG A;  4X3U A;  4AQY L;  2NVQ H;  1CQJ B;  1YVC A;  4R1J A;  3PMF A;  4XTC S;  4L63 B;  1EY5 A;  3JRW A;  1FD7 D;  1H9J A;  5C0X I;  4XIG S;  4HIK A;  1PVO A;  1TWH H;  1EQT A;  2NWG A;  2Q8I B;  1STB A;  4HMI A;  1XPR A;  3JRX A;  5GAE C;  2DJF C;  3PSI A;  3GTO B;  2XCL A;  1E22 A;  5KEE A;  2W9C A;  2YRX A;  4LF4 L;  3NP8 A;  1Y1V B;  4O4I F;  2F3I A;  2JK8 A;  5IYB G;  4YAK B;  1KJ9 A;  2PQE A;  3NBH A;  4LUO A;  4J9L A;  1Z2P X;  1EYZ A;  3KBG A;  1ENC A;  4F8M A;  1AP0 A;  4MV4 A;  1N34 H;  4RKB A;  4ED2 A;  1AW7 A;  3V05 A;  1IBM Q;  1PTO C;  2VA2 A;  3MXU A;  5KT5 A;  2FK2 A;  1WCM G;  5CC4 A;  1V1O A;  4GZY C;  3M4I A;  3DWQ A;  3K7U C;  5JEA J;  1EY6 A;  1QZH A;  2R61 A;  2M9V A;  3V4Z A;  1B04 A;  4ID6 A;  4HJA A;  3Q1K A;  4M7E A;  4X62 L;  2AQ4 A;  2NVY H;  3EVQ A;  4RA8 A;  3NTH A;  5CYU A;  4RFB A;  1TY0 A;  1S72 A;  1AEX A;  4OX9 Q;  3E5S A;  4EBC A;  1F2L A;  4A3F G;  3U9T A;  2L55 A;  3R5F A;  4GKK Q;  4LF6 H;  1PYB A;  4HJ9 A;  2F03 A;  2CW0 D;  1JJG A;  4RUA A;  5LMN H;  1F2Y A;  2I46 A;  3GIK A;  3KJP A;  4LF4 Q;  4JV5 L;  2XIG A;  4JYA Q;  1XNR Q;  2O4X A;  1PH8 A;  3J81 i;  3K3P A;  4A3F B;  3H3V C;  1TU2 B;  1SMY C;  2W57 A;  2MHV A;  1VQB A;  1YNX A;  4YCW A;  1ZHS A;  4MIU A;  2UUC L;  2VA3 A;  1AFP A;  3TQY A;  2I07 B;  1J5E L;  1RTO A;  3KDF B;  3J81 L;  4JV1 A;  4C2M H;  3S16 B;  2N3S A;  4LF7 Q;  3BYY B;  1G6P A;  4MAM A;  1A9X A;  1LTG D;  2WAQ B;  5DAU A;  1WCM A;  2GVB A;  2UXC H;  2F0V A;  4JI2 Q;  2FHT A;  1G91 A;  1S68 A;  3GDE A;  3K7A H;  2ALY B;  5CBA E;  1NCV A;  2EVB A;  2AMC B;  3MFI A;  1CZG A;  3D3R A;  5LL6 b;  4UP9 A;  3FKI A;  2MO1 A;  4L5Q A;  1TWA H;  2A19 A;  2K01 A;  5A2Q E;  1ASY A;  1VKZ A;  5JEA G;  2FLP A;  1K3R A;  1X6O A;  4LJZ C;  1B9M A;  3HZX A;  1GUN A;  3VR6 A;  5GON F;  1WOC A;  4MN3 A;  1BO0 A;  5C44 G;  4DUZ L;  2K5N A;  3K5O A;  1CA5 A;  4HNU A;  1NR2 A;  2KHI A;  1PV4 A;  1IBL Q;  4L5T A;  1L1O B;  2XD4 A;  1O7Y A;  4HR7 A;  2K32 A;  1TKW B;  1XDN A;  4A75 A;  3GTG B;  4JV0 A;  2B8F A;  1TWA A;  2CH4 A;  2G9D A;  3CRL C;  2GPS A;  3WO1 A;  1EQQ A;  4I65 A;  3PO3 B;  2JA7 A;  3S16 H;  1A62 A;  2Q2T A;  3PW2 A;  3J81 c;  3A5U A;  4N8F A;  2E2J H;  2X6L A;  1HJP A;  1N33 L;  2IX1 A;  3CPF A;  3TS0 A;  1Y1W A;  2WAQ E;  5CA0 F;  3BDL A;  3KF6 A;  1HZC A;  1STH A;  1SNC A;  1JT8 A;  1E1T A;  5K36 H;  3MR2 A;  4DV6 H;  3SI8 A;  2L5T A;  1IKL A;  2IPK D;  1SYC A;  3RN5 A;  2ZT9 C;  4UCU A;  3PR5 B;  2HCC A;  4N8X 1;  1B50 A;  1YJ9 A;  1VQ7 A;  3MA2 B;  3EJI A;  2FFK B;  1NBW A;  2MUY A;  5D3I B;  4A3G H;  1RL2 A;  4I7A A;  4JVZ A;  5CV8 A;  1JWU D;  4CJ0 B;  4ZAI A;  4FYD A;  1PH3 A;  4K8J A;  5KFS A;  4CKC A;  4RZQ A;  5KFG A;  4BBR G;  2NVY B;  2PMZ E;  1VQH A;  1TWG A;  1CSQ A;  4JI2 L;  1W2B A;  1SYD A;  3PO3 H;  5CB4 F;  4UCO A;  2UU9 L;  2Z6K C;  4O2A F;  2BOS A;  3AFQ A;  1ENA A;  3GP7 A;  3URY A;  1HXY D;  3OIP A;  1I4H A;  1JB3 A;  2CCZ A;  2YV5 A;  4FXD A;  3RIZ A;  4RAY A;  4IFD I;  1KDB A;  1SYE A;  2Y0S A;  4LF9 H;  3RV4 A;  3S1R H;  5FKA C;  1OO9 B;  4NXM L;  3I72 A;  5KFP A;  2EY2 A;  3KLS A;  2R7D A;  2R7Z H;  2QGQ A;  3KTM A;  4PNY A;  3PUY A;  1A63 A;  1YIJ A;  3OSP A;  1ZET A;  3X3M A;  3KJO A;  3I4N B;  3HRZ C;  1VQD A;  3HFZ B;  1S5E D;  1Y8P B;  5KNC A;  1TWC B;  2VQF H;  3V96 A;  3I4M G;  4XQQ A;  1W6K A;  1SYG A;  4DR4 L;  4H02 A;  1A2U A;  1EIG A;  1AE3 A;  3SEB A;  3PW4 A;  4V19 0;  4H7B A;  3I12 A;  4PMW A;  4YB8 B;  4X62 Q;  5KFX A;  3CQZ H;  2AQ3 B;  1Q8I A;  5CV6 A;  4DAY B;  3JSL A;  3FDT A;  4DR7 H;  1I3Q H;  2XWB B;  1QVC A;  1WYD A;  3BS1 A;  3I70 A;  1RCV D;  2KA7 A;  1VF7 A;  2QDB A;  1KNE A;  1JX4 A;  1ASZ A;  1B6R A;  4JPB W;  2XCA A;  1HUN A;  1I6H B;  4PWQ A;  4HCE A;  2MQH A;  1WTO A;  1PDQ A;  3S17 B;  1SYF A;  2R7Z B;  5KFL A;  1V51 A;  2W6N A;  2MNA A;  4TUY F;  4NKL A;  2OTL A;  2LXK A;  1Z2N X;  2UUB L;  1E2Z A;  4LF9 Q;  1JC7 A;  2K52 A;  5AFW A;  4IWX A;  5DGB A;  3GTG A;  5J39 A;  1TWA B;  1VDZ A;  2XSC A;  2VQF Q;  1KDA A;  1N36 Q;  5KG2 A;  1ZXT A;  3TME A;  2BDN A;  1OTC A;  2E5L H;  3GTJ A;  2MGS A;  3N42 B;  4ECX A;  4DR6 Q;  3F2C A;  1M7J A;  4LSA A;  1MZB A;  2IX0 A;  2PYK A;  2FJ2 A;  2HDM A;  3CD6 A;  4XYM B;  3S9W A;  2RGR A;  2PZU A;  4ZK9 B;  2FB9 A;  3A55 A;  3PW0 A;  2YRW A;  2TMP A;  3DEO A;  4JI5 L;  2ZTE A;  3HOX G;  2J9G A;  4LFA L;  1Q81 C;  5EKL A;  4JI4 H;  3NGD A;  3RMH A;  4H0L C;  3VA7 A;  1GUG A;  2RQX A;  1WTV A;  4X62 H;  1X9N A;  1GVP A;  1Y1W G;  3HOW H;  2K33 A;  3BZK A;  4A3B H;  2E2H B;  2UVW A;  1GSO A;  2ALZ A;  1ET6 A;  4RWS C;  5EPK A;  4IO9 A;  1S40 A;  4QW9 A;  4A3F H;  2XNA C;  4LK1 C;  4NLG A;  1UAP A;  1CZW A;  1FR3 A;  3ICE A;  2Y0S E;  1IBM L;  5KFF A;  2F0L A;  4KHV A;  1RIP A;  3N41 B;  4R4I A;  1GUW A;  4IHJ F;  5GAH C;  2R93 H;  1FKA H;  1B70 B;  4MV8 A;  2PO4 A;  2HHH H;  3MR5 A;  5BN4 A;  3HOY B;  2K1B A;  4LF9 L;  3KAJ A;  3QOJ A;  4FNF A;  1JDE A;  4BY7 H;  1D5X C;  2C5C A;  1AN8 A;  4DFA A;  2JA6 H;  2PMZ A;  2E2D C;  3S1N H;  1T36 A;  2FPG B;  4HED A;  1JQY D;  4LF6 Q;  5K5P A;  2O5I C;  2CWA A;  2EJF C;  4CDD C;  3NXW A;  3WDN A;  4A4I A;  5EZY F;  3J7A F;  3MXN A;  5BR8 L;  4JI8 H;  2R7N A;  2Q8R E;  1B9N A;  3ERS X;  4DR3 L;  4QWC A;  3TP8 A;  4HJ7 A;  4KI0 A;  1E7Z A;  5DEH A;  5C4J H;  4RMF A;  2EE1 A;  1NR4 A;  3HEJ A;  5FLM H;  1E4E A;  2XRQ D;  5KFI A;  2XIW A;  2D0O A;  2N55 A;  3G7L A;  3FKI G;  1YNN C;  1VF5 C;  3VR4 A;  2EY6 A;  5KFB A;  4OON A;  3HP3 A;  3N6R A;  1A8V A;  2VXW A;  1R9T B;  1UC8 A;  5DLG A;  3C1E A;  3NEM A;  2BH8 A;  3V6J A;  2K03 A;  3K5N A;  4J9S A;  4DV3 L;  5C44 H;  3P20 A;  1K8O A;  1VMP A;  2VUM G;  2ZXO A;  2KEN A;  1VQI A;  5HGT A;  5I4D A;  2YL2 A;  3P7J A;  1B4O A;  3CXC A;  4FF3 A;  3LP8 A;  4DGZ A;  1KLU D;  4B3R Q;  4UCT A;  4O3O A;  2YW2 A;  1L2F A;  1B44 D;  4JI8 Q;  4EQP A;  1KIX A;  5KFN A;  3ETH A;  4XT1 B;  2F0Q A;  4ECW A;  1QVF A;  3HB9 A;  5C8Y F;  1WCM H;  5KG1 A;  1KAA A;  3RR5 A;  4AIM A;  5ELF A;  2BA1 A;  4L5R C;  4ECS A;  2JA6 A;  2QYZ A;  5JVH 3;  5F9L A;  2C22 A;  1GYF A;  2K75 A;  2AWN A;  2BH2 A;  2A69 C;  1RF2 D;  2R85 A;  1JCK B;  3N43 B;  4GLA C;  3UDX A;  3I4M B;  5JJK A;  1H9S B;  2WB1 G;  4LFC L;  4DR1 H;  3T56 B;  1D7Q A;  3LWU A;  1N8R C;  4JI5 H;  3VYU A;  2VS1 A;  3GO5 A;  3I4O A;  1C4Q A;  1H9R A;  3NUC A;  4JG2 A;  1NJI C;  5CV9 A;  1TR5 A;  4RB2 C;  1DJR D;  2JA5 G;  2VQE H;  1O7Z A;  3ERQ A;  3IFT A;  4ME5 A;  5KFD A;  4CJ1 B;  3Q22 A;  3N8D A;  3U58 A;  1JIH A;  2RDH A;  1UNS A;  2B2T A;  5FLX L;  1AH9 A;  3GTQ H;  4QL5 A;  1E24 A;  2HVQ A;  2X6G A;  3G4S A;  4B3M H;  4M9U A;  4DN4 M;  1XYI A;  4A3D G;  4GS3 A;  1X54 A;  2RCN A;  3AU7 A;  3GTM B;  2XCP A;  3MR6 A;  2C2D A;  2VQD A;  4AYB A;  4KV6 A;  4CHT B;  3T1Y Q;  3M85 A;  3C2P A;  4GKJ L;  1C30 A;  2KHJ A;  1X32 A;  3E9H A;  3U4V A;  3BJY A;  4LWC A;  3DEP A;  3V4S A;  1BR9 A;  4IJL A;  1MIU A;  4O3P A;  2K5D A;  4RGM A;  4DV1 L;  4J1M A;  4DV2 L;  4IZ8 A;  2J6T A;  4JV5 H;  1IKM A;  4PG3 A;  1EEF D;  1QOH A;  4JI3 H;  5IGB A;  4L5S A;  5IYD H;  3T51 B;  1HR0 H;  1U9R A;  1E4F T;  3SK8 A;  3J80 W;  4PMB A;  4DR3 H;  5KFQ A;  2R8J A;  3TRZ A;  1LO5 D;  1KTK A;  4CKB A;  1XXG A;  3HOY H;  4JI2 H;  4EGQ A;  4J6H A;  4DK3 C;  4ZI7 F;  4DR5 L;  2D2C C;  3K5M A;  1Q46 A;  3GTM H;  3GTO H;  2I5L X;  2E75 C;  1IOV A;  1SEI A;  3CCR A;  4C3J B;  1RYR A;  3ND9 A;  1N34 L;  4A3J H;  3OTO H;  2ZJR A;  2NVX H;  4IPH A;  2RCF A;  1D6E C;  4YP3 A;  2R92 A;  3ULJ A;  1BDO A;  2UUB H;  1D8L A;  2WIN B;  2NYZ D;  4YY3 Q;  4DV6 L;  4I7Z C;  2VZA A;  2WAC A;  2Z6B A;  2J6U A;  1WTQ A;  4J9Q A;  1W96 A;  3GTK H;  4J9O A;  3UI2 A;  3A56 A;  4MA0 A;  1EQR A;  4Q5V A;  4IUN A;  2R87 A;  4XX0 B;  1PH6 A;  2JA6 B;  4BXX H;  4JV5 Q;  3L4K A;  3RFC A;  4DR2 H;  1S03 G;  1TWH A;  2R82 A;  2MO0 A;  4KKS A;  3I91 A;  5C4Z A;  2E5L L;  3RJ0 A;  3AQQ A;  5BPF A;  1JOR A;  1YNN D;  1ZKO A;  4LAA A;  4JI7 L;  4A3M G;  1CK1 A;  4DV5 Q;  1G51 A;  1LTB D;  1YZ6 A;  4JI4 L;  1SE2 A;  3T1H H;  1SSO A;  1I3Q A;  2F4V H;  2TSS A;  4UAI A;  3M4Y A;  3K81 C;  2UXD L;  4DR2 Q;  2K04 A;  1HNZ H;  4KD3 A;  5I9O A;  1CA6 A;  3HOW G;  2OXP A;  3GTP H;  4TVA B;  1I94 L;  1KNA A;  1PH9 A;  4PZ7 A;  2RDJ A;  4HAE A;  1CE8 A;  1OWT A;  5BMV F;  1AN7 A;  3JAM W;  4IOA A;  1SND A;  2B29 A;  2CQO A;  2GN5 A;  3OTO L;  3HOW B;  3NPP A;  3DHQ A;  2RSO A;  4A3E G;  1YJN A;  4DV3 Q;  3HGB A;  4K0K L;  2EYJ A;  4YHH L;  4GN5 A;  3K8A A;  3MXG A;  2IY5 B;  1O75 A;  5KG3 A;  3H0G G;  4S3S A;  4DR5 H;  4ECY A;  5LMU L;  3H40 A;  4X65 Q;  2JEJ A;  5M3M B;  4A3E B;  1I50 A;  1TS3 A;  4LF6 L;  5EWE A;  2SNM A;  4ME3 A;  3I4M H;  2YTX A;  1A3T A;  5M5Y H;  2OEO A;  1K3B C;  4P75 A;  3JAM c;  4JI0 Q;  5E4W C;  1ML0 D;  1WJJ A;  4BBS G;  1X3G A;  4DR7 L;  1X3P A;  4JBW A;  1IBL L;  2YU9 A;  3HOV B;  1AZP A;  3GID A;  3F2B A;  2B8G A;  1J9O A;  5GQO A;  2NU9 B;  1CHQ D;  1D5M C;  4FXG C;  4Q8F A;  4NDX A;  4TQS A;  1FGU A;  3S1N B;  1GSH A;  3D4R A;  3KFU A;  2JA5 B;  3T5L A;  1SXT A;  1U4P A;  2NB0 A;  2FMM A;  3UE0 A;  1EOV A;  3CRK C;  3MVV A;  2XGT A;  2FMA A;  2I8C A;  5ELN A;  1LLR D;  4NXN Q;  3FKI H;  5CAE B;  3RZO H;  2HUG A;  1I7L A;  4GKK L;  1PH5 A;  4R4T A;  1WI5 A;  1M8A A;  3S14 B;  1PZK D;  4NP5 A;  1F77 A;  2L15 A;  2MFI A;  1CKN A;  4WOR A;  1Z7T A;  5C6A A;  1E4E B;  4IFD H;  5M9O A;  2R92 B;  3K58 A;  4XQJ A;  2ICI A;  2VW9 A;  2I5M X;  3I4N H;  5IP9 G;  4B3S H;  1NE3 A;  3BVM A;  4UCV A;  4MV9 A;  4IN3 A;  4HQ6 A;  1STA A;  1CQF A;  2E2I H;  3K5H A;  3NTK A;  3JAM L;  1PX2 A;  4JUZ A;  5DM7 3;  4FBU A;  4JI6 L;  3D6C A;  2A68 D;  3MAQ A;  4CC6 A;  2NVT B;  2AU0 A;  1YHB A;  4PZ6 A;  2PPB C;  2E5L Q;  3RZD B;  5JJZ A;  3E3X A;  1SRO A;  3BAB A;  2A6H C;  2EXD A;  5NUC A;  3UQ8 A;  2VB2 X;  3K57 A;  4O3Q A;  3BU2 A;  1EY0 A;  4IUP A;  3KF8 A;  2JA8 G;  3RZO B;  1TWF A;  1PRT B;  4OX9 L;  4B3R H;  1LT5 D;  5HY6 A;  5IIF A;  2BDO A;  1QIL A;  1YHQ A;  1EIY B;  5KT6 A;  1WTR A;  3FVQ A;  5KFC A;  3N40 P;  3D0F A;  3KHG A;  1EYG A;  4MV7 A;  4JYA L;  1YNJ D;  1LT4 D;  2RHS B;  2MJ8 A;  3WWV A;  1IBK Q;  4LF5 L;  2NU8 B;  3H94 A;  4CBV A;  4RB0 A;  2O2L D;  2H5X A;  1CI3 M;  3VYS A;  1I6H H;  3NE5 B;  2FJZ A;  2E74 C;  1JMC A;  3IFD A;  2R93 A;  4C3H G;  2F3V A;  4P2C B;  2NU6 B;  3J81 W;  2QDL A;  3WNZ A;  3TEH B;  4RGO S;  1DM0 B;  1IBK H;  1FNU A;  3VPD A;  1SEB D;  3RLF A;  1DXM A;  1I50 B;  1UEB A;  4Q45 A;  3KXY T;  4FS1 A;  2WB1 E;  4KKU A;  4C3H B;  4QWB A;  4UP7 A;  2W9B B;  1EUD B;  2YTY A;  4DK0 A;  1VMC A;  5FLM G;  2KCC A;  1F9S A;  2W7O A;  2CW0 C;  3AYH B;  2CW8 A;  3PIO A;  1IHZ A;  2YYZ A;  2EY1 A;  4ABN A;  2SOB A;  4ODG A;  1QVG A;  2B2Y C;  1Z2O X;  2B2W C;  4K14 A;  1PFM A;  2R6F A;  2RSN A;  1V9P A;  1SMX A;  3RGX A;  4DXF A;  3CCL A;  4IAJ A;  5C1P A;  3T1Y L;  1GM5 A;  5DG9 A;  4X64 H;  1BXR A;  3BYT B;  3RBE A;  1U0L A;  1PFB A;  3NWT A;  3SGI A;  4KN4 C;  4DUY Q;  2B2V A;  3EBE A;  3EQL C;  5M5X H;  2EJG C;  1KLG D;  3I55 A;  1RJQ A;  5HV6 A;  4JV2 A;  2WV6 D;  5EPL A;  3GTK A;  3LWB A;  4J9M A;  4DAM A;  2F0T A;  5TSS A;  1XMQ L;  1TXY A;  4N9T A;  1O7I A;  3A74 A;  2Z8L A;  4DR7 Q;  1EFW A;  2Q2H A;  3KUP A;  3CQZ B;  3TDQ A;  4A3J G;  4MTN A;  2NVX A;  5JPM C;  5AJ3 Q;  4JI6 Q;  4QGU A;  2A8V A;  2AKW B;  4B3S Q;  2UXB L;  3N6X A;  1JR0 D;  5I47 A;  1HH2 P;  2ZJP A;  1EZ8 A;  1VQL A;  5M5W B;  3CW2 C;  4ZCK A;  1EZ1 A;  2FPP B;  3P1H A;  1D1I A;  3PVX A;  1X55 A;  2PQA A;  3HOV G;  1RHP A;  3EPG A;  3ND8 A;  1FVI A;  3A8K E;  3K0X A;  4C1N I;  2HIX A;  1T5X D;  2KEC A;  2OT2 A;  4NMZ A;  1EU4 A;  5C3E H;  3ZJY C;  4DV4 L;  3W1B A;  1N56 A;  3HKZ G;  2PI2 E;  3QJY A;  1YJW A;  1M0W A;  1TWH B;  2UU9 Q;  3Q23 A;  2K05 A;  2XTI A;  5T1I A;  5K36 G;  5KKN B;  4F4W A;  1Q86 C;  5C4X B;  5CV5 A;  5D1P A;  4DV0 Q;  3PW5 A;  3BA8 A;  1RTN A;  4B3T H;  5L1L A;  1QNU A;  4C1N K;  2F0U A;  1HNX H;  1ILQ A;  5M3M H;  3M7N A;  1RJT A;  1BBW A;  4DAV A;  5L1I A;  1W93 A;  5C4X G;  3KBX A;  4DV5 H;  5KFO A;  1HNZ L;  5H80 A;  5DLF A;  1VQG A;  1V4Y A;  1L1O A;  4QWA A;  1KC7 A;  4I7H A;  3T5H A;  5IP7 H;  1HR0 L;  3H0G A;  3N44 B;  3RAX A;  3BDO A;  3I2Z A;  2P5Z X;  1RYS A;  1KJI A;  5LA6 F;  5LP6 F;  3PO2 B;  4QUF A;  4KJN A;  2RDG A;  3GV6 A;  2PNH A;  1I6V C;  1N48 A;  2E2J B;  2E76 C;  2W7P A;  3KF6 B;  1LYL A;  4DV0 L;  3D6W A;  1K8G A;  1IW7 D;  4EFE A;  2AUJ D;  1NY4 A;  1SRU A;  3HKZ A;  2XC9 A;  1Y8O B;  4EBD A;  4OXP A;  5IY0 A;  1U4M A;  1V8Q A;  4DR1 Q;  2ICE C;  3VR5 A;  2B63 B;  1B33 N;  3S2H H;  4UDU C;  2LY7 A;  2R8H A;  1K1Q A;  3OWE B;  2UXD Q;  2V4R A;  1X56 A;  3H3V I;  2ZM6 Q;  2DGY A;  2DZD A;  2YZM A;  4LFB L;  5IWA H;  3Q8R B;  3L7Z C;  1K83 H;  5K2M A;  2B39 A;  4BY7 G;  3STB C;  4LFB Q;  2R7K A;  2B2Y A;  1HUM A;  5EOY A;  2F0M A;  3K59 A;  4WD3 A;  2IBK A;  4FF4 A;  2N8N A;  4BXX G;  2B2U C;  2LSS A;  2ZM6 H;  2NVX B;  1ICF B;  4A3C H;  4B3S L;  3MC0 B;  3R8B A;  1B53 A;  1PZJ D;  2R7Z G;  5IYB H;  4E4T A;  4RHR A;  4BY1 B;  1S5D D;  3ERO A;  4LUV A;  4LFA Q;  4KN7 C;  1OXT A;  1G2S A;  2YS7 A;  3ONA B;  3OHX C;  1S3O A;  4IRD A;  1HNW Q;  4NXN H;  1KC8 C;  2ZDH A;  5KFE A;  4R9W A;  2IHF A;  4U7C A;  3S2D H;  3J81 E;  1Q1E A;  4BY1 G;  2NVQ B;  1D5Z C;  4QIW A;  1I94 H;  3CVZ A;  1N34 Q;  1EIF A;  1CM9 A;  5KFW A;  4ED1 A;  1EWI A;  1NUC A;  4OWT B;  3OHB A;  1C8C A;  3TN2 A;  1UUP A;  5KFJ A;  4J8Q A;  2WP8 J;  5JJI A;  1FNV A;  1G8Z D;  1T5E A;  3NQI A;  2X0S A;  1ULZ A;  1M0T A;  2E2I B;  3TBI B;  1GUT A;  3R2I A;  4AYB E;  5JVL A;  2J7Z A;  4HSV A;  1EY8 A;  3J80 L;  1JXL A;  3QIA A;  3F8N A;  4O4L F;  5EKI A;  3KF8 B;  5GAG C;  3G71 A;  3JSN A;  4A3J B;  2V59 A;  4QQB X;  4BWS C;  5L37 A;  1IW7 C;  1PTO H;  3G8C A;  3GV7 B;  3RLO A;  3P75 A;  3WOE A;  4H13 C;  3DWA A;  1WD1 A;  4POF A;  3CC2 A;  2VOB A;  4JW0 A;  2M05 A;  2R8K A;  1DON A;  4ZHQ F;  4MHE A;  1PXU A;  3PIP A;  1XTC D;  2D62 A;  1KJ8 A;  5C44 B;  4ZUI A;  1HCZ A;  1NAP A;  2DY8 A;  5EWG A;  3S1M H;  4K0K H;  5F2D A;  3GIM A;  3GTJ B;  4KLK A;  4RGT A;  2JEB I;  3MWD A;  2R93 B;  4X64 L;  3T1Y H;  3GTL A;  2L1B A;  5FLX W;  2A74 C;  1XMO H;  5HGQ A;  2AUK A;  2Z0S A;  3J7Y W;  1L1O C;  2WKC A;  4DU9 A;  4X6A H;  1B3Q A;  4MV6 A;  4QF4 A;  4C3J H;  5J3B A;  3KAL A;  1MKH A;  2EOT A;  4GN4 B;  4BY1 H;  1XNQ Q;  4AH6 A;  3HKZ B;  4YR0 A;  3TP7 A;  2JN4 A;  4C3I G;  3ULP A;  1LAC A;  4MTD A;  5C4J B;  4C2M A;  1F2M A;  3JAM E;  1MHW C;  1E2W A;  4JI3 Q;  3J80 i;  4JOI C;  3SE0 A;  1G2T A;  4DL7 A;  4NXN L;  1V1P A;  4IFD G;  4X66 H;  4DR3 Q;  5IWA L;  1OXX K;  4LFB H;  2IHE A;  4YJ3 F;  2OTJ A;  3DM1 A;  4DXG A;  3C3L A;  2ZTC A;  4RGN A;  4RAU C;  1GUO A;  2KCM A;  1IBL H;  1TII D;  2Q2I A;  1HRJ A;  3WO0 A;  2UXC Q;  4MA5 A;  4LMY A;  4G57 A;  2JE6 I;  4BBR B;  1F2Z A;  1HNX L;  5KT4 A;  3BQ2 A;  4OO1 I;  4ZKC B;  3MJF A;  3TSS A;  3PN1 A;  2ASL A;  3PO2 G;  1VS0 A;  1XNQ H;  1QUQ A;  2DNE A;  1U4L A;  2ZXR A;  3BQ1 A;  1QB5 D;  1X3Q A;  3QZ7 A;  1CKO A;  2JA9 A;  1I5F A;  2B2U A;  2FLN A;  5C3W A;  2SDF A;  5KG6 A;  4O3R A;  2HIV A;  1SDF A;  1E3P A;  1JWM D;  3G6J B;  3DM3 A;  4X3S A;  1B7Y B;  4Y7N B;  2E2H H;  2Q8T A;  4JI6 H;  3L0O A;  3IAY A;  1VQE A;  2DJG C;  4IPG A;  2XRS D;  2W71 A;  4A93 G;  1YIT A;  4EEQ A;  3QFF A;  1WVL A;  1Y1V A;  1ESF A;  1SNO A;  4LF5 Q;  3SDZ A;  1RJP A;  4HNT A;  4BY7 B;  4IJH A;  4JC0 A;  4OIK A;  2RGV A;  2F0S A;  4QWE A;  4FU0 A;  1R9T A;  2VUM H;  2I5H A;  3AFP A;  4HJ8 A;  4IPC A;  4IQZ A;  1TS2 A;  1LTT D;  2KBN A;  4R4C A;  3J80 E;  3QWN A;  2V4Q A;  4CKE A;  1PMR A;  3CKI B;  3GV5 B;  2LS0 1;  1DYQ A;  1T9H A;  3HG9 A;  2A5H A;  1CQI B;  4ZQI A;  2BCO A;  3E6Z X;  1M6V A;  1WR2 A;  2LMC B;  4RCN A;  1DIK A;  1KAW A;  1WH2 A;  1J6Q A;  3EA6 A;  4GOP A;  1GHK A;  1A3U A;  3NTI A;  4LUZ A;  3ORQ A;  2AHO B;  2K4K A;  3EIV A;  4G7Z C;  1IYV A;  4KY7 A;  5AJ3 L;  1ZHQ A;  5KYI A;  3S2H B;  4UHV A;  5IYZ F;  4X65 H;  3Q0A A;  4LSX A;  5IGE A;  4F7X A;  2FK1 A;  3UDF A;  4DAP A;  2M2L A;  4XYL B;  5FD5 A;  5D3D A;  3I56 A;  1PYS B;  1KQS A;  1K83 B;  3KHL A;  1SJH D;  4R4Q A;  3A8J E;  3GTO A;  3R3O A;  2FPI B;  1SLJ A;  4DUY L;  5COY A;  3TIN A;  5FPO A;  4RNN A;  4B3T Q;  4DR6 H;  5IGC A;  2K5W A;  3KDF A;  4FS2 A;  4O4H F;  4A93 H;  1L0X B;  1PLF A;  3FRP B;  4TQU S;  4XT3 B;  5CV7 A;  1IBK L;  2FE3 A;  1BBU A;  1PYW D;  4CC5 A;  3UDI A;  2WAQ A;  3T1H L;  2G9H D;  1ROD A;  1VQ5 A;  4IUV A;  4GC7 A;  2IP4 A;  5EDW A;  2OQK A;  1UE7 A;  1NTG A;  5EQ0 A;  3GQB A;  2PBZ A;  1STG A;  4ILW A;  2F0O A;  3D4D A;  4OWW B;  4KHP L;  1PH1 A;  5LMN L;  3H3V H;  5DG7 A;  4G3I A;  2A68 C;  4RNO A;  1D1K A;  3H4D A;  3K5L A;  2CH4 W;  2ZDQ A;  5KFR A;  1EHI A;  5C3E G;  4YCV A;  3OWF A;  1QWY A;  2DPJ A;  1VQ6 A;  1KRS A;  5CV4 A;  3HOX H;  3PF4 A;  1I6U A;  1GKH A;  2IL8 A;  4APV A;  3HOU B;  4A3I B;  2JA7 G;  1JIC A;  1J8I A;  1WTX A;  5KFU A;  4A3B G;  1XX8 A;  4HR7 B;  5C3E B;  4KJO A;  3HOY G;  2F52 A;  4F4Z A;  3A8I E;  1UC9 A;  4C3I B;  2R7F A;  5LXT F;  5BN5 A;  5M3F B;  4EFB A;  3MWE A;  4DV4 H;  4A3M B;  3CP0 A;  1UWV A;  3HOU G;  3SE7 A;  3MXP A;  2A73 B;  4K6L A;  4EYI B;  3CME A;  4A3B B;  3HXL A;  1SNP A;  4XXE A;  4HSP A;  4A3M H;  2HHH Q;  3G6E A;  3X3N A;  2KED A;  4YWK A;  1HNW H;  3KOJ A;  4X3K A;  5KT7 A;  4DK1 A;  4DA2 A;  5G3L F;  5I9P A;  1TY2 A;  3OUZ A;  3BG5 A;  4DR1 L;  3TIG A;  1ENF A;  3CU7 A;  1A15 A;  1EUJ A;  3AEV A;  4WRD A;  2DIK A;  2E2I A;  2C00 A;  5BR8 Q;  4XZ3 B;  2F0I A;  2JXM B;  4DV1 H;  4O2B F;  3QO2 A;  3FKI B;  4NPS A;  3EPI A;  4R8N A;  3CC7 A;  4FO2 A;  2VQE L;  4TSS A;  2LFN A;  1GXD C;  1K28 A;  2JA8 H;  2HD3 A;  3NEN A;  1DZ1 A;  1SAP A;  1B2T A;  1EY7 A;  3MFH A;  4YR2 A;  4GC6 A;  5A35 A;  1C0A A;  1HQM C;  4IWY A;  1XMQ H;  3MTS A;  2K50 A;  1N33 H;  2C28 A;  2AGP A;  1PH2 A;  4B3R L;  3J81 j;  1N32 L;  4DNR B;  1S97 A;  2VNU D;  2MP1 A;  1Z9F A;  4EBE A;  3I90 A;  5FJ8 H;  5DQI A;  1PFN A;  1HZB A;  1V1Q A;  4YQW A;  1HR0 W;  1NNX A;  4G4K A;  4PQX A;  4QIW E;  5KGU A;  4YY3 L;  4A93 B;  1I3Q B;  4P71 A;  2Y0S B;  3OW2 A;  2UUA L;  1XMQ Q;  2DWC A;  1B8A A;  4J0M A;  4OWX B;  2BQU A;  1N33 Q;  2BQR A;  2VL6 A;  4XYQ A;  4C3H H;  3K0Y A;  2B63 H;  4I50 F;  3HOU H;  5KT3 A;  4JYA H;  2D5D A;  3OPO A;  4F88 A;  3Q2O A;  3TQT A;  1JE5 A;  1SN8 A;  3VYT A;  5IWA Q;  3RN2 A;  4IRK A;  4JI5 Q;  5BR8 H;  1R4P B;  3M4P A;  3B6Y A;  2ATL A;  4OX9 H;  4K2K A;  3KHH A;  1PH7 A;  3RV3 A;  2N49 A;  4AQY H;  4HCS A;  2LXJ A;  4JI7 H;  1FYC A;  5FO8 B;  1UE5 A;  4JI1 Q;  2J4X A;  1MD2 D;  3FMC A;  2JQO A;  3F1Z A;  3M7G A;  1T94 A;  4KMU C;  1TWG B;  3A7A B;  1FGB D;  1YNJ C;  4DK6 C;  5C5J A;  4TRD A;  4A3D B;  1TS4 A;  4B3M Q;  5L9X A;  5M3F H;  4HIM A;  1BKB A;  2VR1 A;  2UUB Q;  2FIN B;  3CPW A;  2F0G A;  4JBM A;  1JOQ A;  3ZYY X;  5LOV F;  2J6S A;  1CKM A;  2W9B A;  3GTG H;  2RBM A;  5DNF A;  1QZG A;  1BUV T;  1A2T A;  4WFN 3;  1HFN A;  4A2B A;  1CSP A;  3MR3 A;  1I94 Q;  2OQ0 A;  5D1O B;  3MWY W;  3FMA A;  1I4X A;  3HOZ G;  4IR1 A;  4EGJ A;  1ONL A;  3I73 A;  4DNI A;  2GLT A;  3LX0 A;  2ID0 A;  3KLW A;  4ED7 A;  1BNZ A;  1Y1V G;  3D4W A;  4R8U B;  2A6E C;  5KG4 A;  1K8A C;  3A0J A;  4JI4 Q;  2EYP A;  2FMC A;  1LTL A;  5KFY A;  1TWC A;  1TVX A;  4MV1 A;  1II3 A;  4QWD A;  2IMW P;  1KL9 A;  1IOW A;  3K6O A;  4DNT B;  3TQ1 A;  2K5Q A;  1GGO A;  1XNR L;  1C9O A;  4A2A A;  2QIL A;  1CKN B;  4B3M L;  1E0B A;  2HVR A;  2E2H A;  5LMN Q;  1XPO A;  4ECZ A;  4YWM A;  2UUC Q;  1K0R A;  2RF4 A;  1VQA A;  4C3J G;  1M1K C;  2EPB A;  4HYK A;  3RB4 A;  1Q3L A;  4JI1 L;  2IWH A;  2IX3 A;  4PDB A;  3BVG A;  4P73 A;  5IT9 c;  3SR1 A;  1YBY A;  2VQF L;  4LF8 L;  2I0Q A;  4EQ5 A;  3L9A X;  4DV7 Q;  2R7Z A;  2WYO A;  1SE3 A;  1YHA A;  2F1M A;  2JEA I;  3TZU A;  4RG1 A;  2F0K A;  3BAA A;  4RAZ A;  4GN3 B;  4LW1 A;  1I4G A;  5M3F G;  1JKJ B;  5HUR A;  5ELD A;  1PRT F;  2JP1 A;  4C5A A;  3KK7 A;  2O5J C;  5KFA A;  2HCI A;  2L0C A;  1MI2 A;  2R3Z A;  3PF5 A;  4Q44 A;  4JI0 H;  5JOB A;  4FP5 D;  2PMZ B;  3H4B A;  5E7N A;  1S5B D;  4OHJ A;  3Q8P B;  5JEA H;  1N36 H;  2F3W A;  1YEZ A;  5LL6 X;  1QNK A;  1S5C D;  1D2B A;  1Z6H A;  5KG0 A;  3KLR A;  3MXN B;  1WTP A;  4EX5 A;  1VBG A;  4DR4 Q;  1Y8N B;  2C35 B;  2RVL A;  3BZC A;  4IFD J;  2ZDG A;  4Z9C B;  5ELO A;  1HNZ Q;  2NN6 I;  4EG0 A;  3SVM A;  4A3K G;  3HKZ E;  2P0A A;  1X3E A;  3NWS A;  3MEF A;  4YBZ B;  3AMU A;  2ZXP A;  4R8I A;  1VQ8 A;  3IKJ A;  2JA5 H;  4LFC Q;  4MNO A;  4CGY B;  3VA5 A;  1HA5 A;  2ASD A;  2W6Z A;  4DR4 H;  4A3G B;  4Q43 A;  4GKK H;  4FDB A;  3I3C A;  4XQN A;  1XPU A;  4OL7 A;  3FPU B;  3GTL H;  4IZO A;  4CDC C;  5JQW A;  1O78 A;  2JYO A;  5C0X H;  2CVR A;  5DG8 A;  3GTQ A;  5LYJ F;  4WJ4 A;  3OHA A;  4LF4 H;  1F9Q A;  4DL6 A;  1Q12 A;  3NHH A;  4ALP A;  3E5N A;  1PA6 A;  2W6Q A;  3BA9 A;  4LFC H;  4JI8 L;  4ED0 A;  3R93 A;  4UPA A;  3PR4 A;  4B9X A;  3H91 A;  3OTO Q;  1IYU A;  2BE5 D;  1PZI D;  1A3V A;  3V6H A;  5KFV A;  1FJG H;  2F0N A;  4ECV A;  2ASJ A;  4DV3 H;  4ECU A;  4OEM B;  3MZ5 A;  1S9F A;  4BBS B;  3JC6 6;  3PIP 3;  3DMU A;  1PTO D;  2QCP X;  5LHY 1;  4EYH B;  2K7V A;  4A3C G;  2AWO A;  2QEJ C;  3O13 A;  2RDF A;  2A1A A;  3SHL A;  1Q1B A;  1HPC A;  2K5H A;  1LTI D;  3VR3 A;  4CDF C;  2SEB D;  5CGK A;  3A5Z B;  3GIP A;  1EYD A;  5EGT A;  3OUU A;  2XN9 C;  1WSC A;  4IAL A;  2UXB Q;  5DGA A;  4KY5 A;  2EIF A;  1UE6 A;  3NEL A;  2ZJQ A;  2V58 A;  3FDS A;  2B3G A;  1Y1W H;  5KYL A;  3GIL A;  5I6W A;  5JVD F;  3J7A 5;  4RU9 A;  4LF7 L;  3LGJ A;  5FO7 B;  3M9M B;  3DF7 A;  3EYY A;  4UCR A;  5IGG A;  2ATW A;  2DY7 A;  1VCI A;  3CCU A;  3D31 A;  4F4Y A;  4BBS H;  1VQJ A;  2F4V Q;  5D8D A;  3HOV H;  1UE1 A;  2F0E A;  3J7A K;  3G48 A;  5EAY A;  4A3L G;  2W6P A;  1MBY A;  2PQA B;  4JBJ A;  3SK5 A;  4Q8E A;  4X65 L;  1EL0 A;  1LT6 D;  3S1Q B;  4HIO A;  2NUC A;  2ES2 A;  5J22 A;  3EFX D;  1UEA B;  4QCL A;  3HOZ B;  2DPI A;  1KBL A;  4RB3 C;  2HDL A;  3T16 A;  4AYB B;  4B9W A;  3J7Z C;  1S5F D;  3KAK A;  3M9O B;  3S1M B;  5I2Y A;  3Q24 A;  4LNQ A;  1GJX A;  3GII A;  3CMA A;  1LT3 D;  4YR3 A;  4O42 A;  1Q7Y C;  4DR5 Q;  1DV1 A;  2IW3 A;  5EPJ A;  5IGF A;  4ECR A;  4DV2 H;  2B63 G;  3PUX A;  1ICW A;  3MEH A;  2KCT A;  2NU7 B;  1RDP D;  1H9S A;  2UXB H;  4LF8 Q;  1AUX A;  3F8T A;  1HTP A;  5IT9 E;  3I4N G;  4XDX A;  1PHJ A;  2MPM A;  4OEL B;  4Y8V B;  5C0X J;  4GKJ H;  2O03 A;  3DLL A;  3OSN A;  5CBE E;  3EN2 A;  3MHB A;  2L12 A;  4JBK A;  4DV2 Q;  1KXL A;  1H95 A;  2PI2 A;  4Q0Y A;  4GNX A;  1VQK A;  2HJW A;  3BG3 A;  2HQL A;  2X69 A;  3E9I A;  4LMQ D;  5IE8 A;  3GTJ H;  2NZ1 D;  1S4Z A;  4IPD A;  1SYB A;  4F50 A;  3E0J A;  1WCM B;  3PUV A;  1X3F A;  2YTV A;  5FLX c;  2VB3 X;  4DUZ Q;  5KFZ A;  4WJ3 M;  2QEX A;  4YY3 H;  5C1O A;  2PCF B;  1K8M A;  2W8K A;  1JLL B;  3KYH C;  1YI2 A;  2K28 A;  5JPN C;  3R23 A;  3TP6 A;  2Q2U A;  2YU9 H;  3U50 C;  2R86 A;  4Y7N H;  1VQP A;  4RKL A;  4U68 A;  5KIX A;  2XVS A;  4LH7 A;  2NTS A;  1SNM A;  2V1C C;  2V4D A;  3VPC A;  2CKZ B;  1KRT A;  1BJT A;  4DL2 A;  1U5K A;  1R9T H;  4FF1 A;  2A6H D;  3S15 H;  5GAD C;  3TS2 A;  4RB1 A;  2KJX A;  4M8A A;  4GKJ Q;  3PIO 3;  1G6Z A;  2R8I A;  5KRU A;  4IUR A;  2W6O A;  1W3S A;  1AZQ A;  3PQI A;  4BWG B;  1DD2 A;  3PO2 H;  4F87 A;  5A2Q W;  4O3N A;  1F9P A;  4J9K A;  3C0F B;  4RHS A;  3RUP A;  2XWJ B;  5LL6 S;  2DN8 A;  3CCE A;  1ET9 A;  4A3K B;  5J2U F;  2K14 A;  1KHI A;  1PH4 A;  4J9N A;  4F4X A;  2CFM A;  4UY8 C;  2UU9 H;  1HR0 Q;  3GTP A;  4NXM Q;  4DV0 H;  1N36 L;  5KND A;  3FHW A;  3TZD A;  4DV1 Q;  1Y1W B;  2J0T D;  1HA6 A;  3BDC A;  3RUZ A;  2F4V L;  3BJU A;  4L1K A;  2KCN A;  5IYC G;  4QY7 A;  2WE6 A;  1ESR A;  5BPH A;  3M9N B;  4IUQ A;  1S0N A;  1E1O A;  5FO9 B;  3C46 A;  3L2P A;  3GIJ A;  1LUZ A;  1JE4 A;  4H44 C;  1MJE A;  2F0J A;  2PZW A;  2VUM A;  3QZ8 A;  2EYO A;  5EBC A;  3OSO A;  1Q82 C;  2QKI C;  3DXJ C;  5IT9 L;  4CDE C;  4U6P A;  4JK1 C;  1TWG H;  3RB0 A;  3QG1 A;  2L11 A;  1DCZ A;  3NQT A;  4P74 A;  1A6X A;  3Q6S A;  4MZ9 A;  3U9O A;  2Z9H A;  2UUC H;  2WII B;  1VQO A;  5I2X A;  4EGV A;  2C9O A;  3S1R B;  2OH2 A;  4EVO A;  5F9N A;  1M4V A;  4ZLT F;  3UE1 A;  2NN6 H;  1DOK A;  3CAM A;  2YU9 B;  2NBF A;  3PO3 G;  4RZR A;  3CCV A;  5EJW A;  2WB1 A;  3A54 A;  2UXC L;  3SK6 A;  1VQ4 A;  1B3A A;  4GLX A;  1HHV A;  3W5O A;  3CCS A;  4TQR A;  2W70 A;  2A69 D;  2EJM A;  3BVZ A;  1SFO H;  5EKK A;  1STY A;  2UVV A;  4Q0F A;  1GHJ A;  1A0I A;  1STN A;  2F0F A;  1Q90 A;  2FKL A;  1EIH A;  2FK3 A;  4EQO A;  2CW7 A;  4GNX B;  2OWO A;  1N32 Q;  1DV2 A;  3I7F A;  1EYA A;  3A7L A;  3F2D A;  4AQY Q;  2KEE A;  1UNN C;  4KK7 A;  2V9W A;  2OLS A;  2AQ1 B;  5H1S E;  2VPS A;  3GTL B;  2QK4 A;  1KEE A;  5C0X G;  4JI0 L;  4POG A;  4MV3 A;  1IZ6 A;  2GA4 B;  2EZV A;  4KHP Q;  4FM9 A;  2VY3 A;  3NBI A;  1N32 H;  2BR0 A;  2WFW A;  4DAY A;  1Q8K A;  4AYB G;  3C1F A;  1S0M A;  2KOL A;  2WDT A;  4LFA H;  1Z47 A;  4B08 A;  1I7N A;  5CMD A;  5G3L D;  1RD9 D;  1KJQ A;  2NZO A;  3LWE A;  1BF4 A;  3Q8S B;  2KSW A;  2OCE A;  3IG0 A;  4L8J A;  1J5E H;  4BA1 I;  1V1P B;  1Y14 B;  5C4X H;  1LTA D;  3OYY A;  1NSN S;  1IYJ B;  1BBX C;  4J9R A;  4OO1 H;  1T3N A;  4LH6 A;  2Z4I A;  1MSG A;  3OMC A;  1GLV A;  2UVR A;  4ETS A;  1E2V A;  4LF7 H;  3DUZ A;  3I8Z A;  2JA7 H;  1PTO F;  1J5E Q;  5ELE A;  2HVS A;  1TWF H;  4R4O A;  2GVA A;  1B6S A;  3H20 A;  2VQE Q;  1S10 A;  3OW7 A;  2MCT A;  5M5X B;  4KTA A;  1PRT C;  5GRO A;  4UP8 A;  1C48 A;  5JAV A;  3PUZ A;  2WTF A;  4JI7 Q;  1VAJ A;  2H1E A;  4JI1 H;  2KHS A;  2HT1 A;  4NW2 A;  5IGD A;  2FP4 B;  1EEI D;  4PV1 C;  2C2E A;  2UXD H;  5FPR A;  3LML A;  3RLN A;  3V6K A;  2BE5 C;  3F2U A;  3R2T A;  2PN1 A;  4A3I H;  4WBN F;  3CCQ A;  1FJG Q;  3RB3 A;  4FBT A;  1HFG A;  5JJL A;  1ZEQ X;  2ZTD A;  1GSA A;  4C5C A;  3PGZ A;  1SJE D;  3QOL A;  2IJ0 A;  3T13 A;  2UVU A;  2B2W A;  4P72 A;  1GUS A;  3PZP A;  1DOM A;  1VQF A;  1I50 H;  3T1H Q;  2B2T C;  4ZYS A;  3IN5 A;  1BCP C;  4DPG A;  3HKS A;  3VMM A;  2F4I A;  5JUM A;  1BOS A;  1CUK A;  2WKD A;  3N52 A;  5J1Z A;  3SXH A;  2RDI A;  1WTH A;  4B3T L;  1CFM A;  5KFT A;  3L4J A;  3NSW A;  1TWF B;  2PW5 A;  2NUA B;  1RK5 A;  1HZA A;  5KNB A;  2NZH A;  4OO1 G;  4RNM A;  2PW7 A;  2R84 A;  1SR3 A;  1Y69 U;  4I4T F;  1BCP B;  4MTK A;  4DV7 L;  1JOO A;  1VQ9 A;  1PK8 A;  5FJ8 G;  1ILP A;  2JEI A;  1HNW L;  3WOF A;  2I87 A;  1ZYR C;  2R7L A;  4GOP B;  4QW8 A;  4NB3 A;  2W9A A;  3HOX B;  4R7R A;  5C5L A;  2YYA A;  1VQM A;  5ELB A;  4K5X A;  3M4O H;  4ZRZ A;  4CJ2 C;  3OIQ A;  1CHP D;  5T14 A;  3S24 A;  1SCU B;  1STE A;  1C3O A;  1O80 A;  2R6G A;  1SE4 A;  4J15 A;  1AUV A;  4DL3 A;  3RF2 A;  1XTD A;  1K73 C;  1RKN A;  1K83 A;  4O1N A;  4A3I G;  1W6J A;  1L0W A;  4O3S A;  2K5V A;  4WJW A;  1QJO A;  5CR3 A;  1BXT A;  4C56 C;  4JOI A;  1F9R A;  2R93 G;  4ZKB B;  3RBD A;  5E1F A;  5FLX E;  1DOL A;  5DQG A;  4LF8 H;  4C5B A;  1XMO Q;  2JA6 G;  3M4O B;  1IL2 A;  3MWM A;  1G29 1;  2DUD A;  3TRE A;  1XJV A;  5M5Y B;  4JI3 L;  2M00 A;  3KLS X;  2N78 A;  2XGP A;  2IA6 A;  2D9U A;  4A3E H;  2EYM A;  3HBL A;  3V2T A;  4IOC A;  5KG5 A;  3MFG A;  4KHZ A;  1OXS C;  3R5H A;  2EYF A;  1L2Z A;  2QA4 A;  1TWC H;  3UDG A;  5KFM A;  2CWP A;  2Z1C A;  3RD4 A;  3H0G H;  2NVT H;  1NMF A;  4TV8 F;  4UFZ A;  3GTK B;  1JDB B;  4X64 Q;  2R8G A;  4YHH Q;  2BQ3 A;  4APM A;  4V0B A;  2SNS A;  5IOC A;  1CS0 A;  5JVG 3;  3KHR A;  4DUY H;  2IT1 A;  4HJ5 A;  3M3Y H;  3QB3 A;  3T53 B;  3U4Z A;  4DF7 A;  3CQZ A;  5L1J A;  4X3T A;  3GTP B;  4C3I H;  4KY6 A;  1Y1V H;  3S17 H;  5J2T F;  1IBM H;  1JB7 A;  5EWF A;  2B2V C;  3K7A B;  3PV0 A;  4OGQ C;  3ORR A;  3FEW X;  4TKO B;  5C3X A;  1K0S A;  1XMO L;  5KT2 A;  1KAB A;  4IUT A;  1OXV A;  1ZQ7 A;  4K8I A;  1CQV A;  1KDC A;  2HHH L;  3GV8 B;  3H0G B;  2FXQ A;  4JCV E;  1TT2 A;  3TII A;  3ITP A;  4GNX C;  2R92 H;  2VUM B;  3BZD B;  1V43 A;  2Y0S G;  3TP5 A;  3OMG A;  4BS9 A;  4X66 Q;  5ISR A;  1IXR A;  1OXU A;  4O2D A;  2A6E D;  4IUU A;  1EZ6 A;  2NN6 G;  1K1S A;  1SE8 A;  4HID A;  3GQC A;  3GTM A;  2F0W A;  3NBH B;  1VQN A;  2PZT A;  2CQY A;  2YZN A;  5IOD A;  1LM0 A;  4A3D H;  2JEF A;  4NXM H;  3I4L A;  4YWL A;  1S0O A;  3RTX A;  1JWS D;  1JJC B;  4U67 3;  4ED3 A;  1KD1 C;  2XGQ A;  1SMY D;  2EY5 A;  5E4X A;  5C5M A;  1JJ2 A;  1WTW A;  3VPB A;  5KG7 A;  4DV6 Q;  4KKT A;  5FD6 A;  5IT9 W;  2WB1 B;  1BCP F;  2BA0 A;  3PUW A;  4G7O C;  1RK6 A;  4K0K Q;  1VQC A;  1GO3 E;  2VUG A;  4ED6 A;  4PZ8 A;  1SFO B;  1XNR H;  1LTS D;  1NMG A;  2HGS A;  2EQS A;  4KD4 A;  3GLK A;  4RCO A;  4YIJ A;  5IYD G;  1MSH A;  4DLK A;  1MGS A;  3IL8 A;  1L0Y B;  1EWC A;  1SYX B;  3ETJ A;  1EUC B;  4YAJ B;  4EEY A;  1R4Q B;  1N9W A;  1MJC A;  5D65 A;  2VPQ A;  4HN7 A;  1EU3 A;  3T5K A;  1WD0 A;  3RZD H;  5FK9 C;  2I80 A;  1C7Y A;  2JEG A;  4A76 A;  3NK9 A;  2E8G A;  2RA4 A;  1M90 C;  3K3V A;  4DKA C;  4DV5 L;  3S1Q H;  5A2Q L;  2CZG A;  1EQV A;  1PTO B;  4HNV A;  3STB D;  1ZYR D;  1BNC A;  3BQ0 A;  3K80 C;  1CT1 D;  5IYC H;  5T1G A;  3R5X A;  3UFX B;  3T5J A;  2Z4H A;  1TQO A;  3ULL A;  1EY9 A;  5KX5 F;  3AB9 A;  2B63 A;  4ME6 A;  4QUC A;  1HQR D;  2ASB A;  2KUM A;  3GD7 A;  4UCS A;  2D0P A;  2AGQ A;  1I4Q A;  2JA8 B;  3J7A V;  3RNU A;  5I6Y A;  3HS0 C;  3U9S A;  2QW7 A;  4YHH H;  5L1K A;  3QR8 A;  3FPP A;  1KJJ A;  3JAM i;  2YCH A;  4K5W A;  4XYO A;  4YCU A;  1E4G T;  1O7L A;  1IL8 A;  3VDY A;  1LV9 A;  4ECQ A;  4FF2 A;  4ECT A;  3H09 A;  1QE6 A;  4DR6 L;  4Y52 H;  4DL4 A;  5ELC A;  5KFH A;  1BCP D;  3S2D B;  2V5A A;  3DWP A;  1SBB B;  2LKV A;  4O0A A;  2H4O A;  3CHB D;  4PMC A;  1QG7 A;  5EBD A;  3W1G A;  3HOZ H;  2PVP A;  1EY4 A;  2F0D A;  5IP7 G;  4MTE A;  3ER0 A;  3MFY A;  4EQN A;  2K6A A;  1P8L A;  5D1O A;  3D8G A;  3G6Y A;  2CQA A;  1I4R A;  1TS5 A;  4K2L A;  3VR2 A;  1WFQ A;  4ZOL F;  2FLL A;  5COR A;  4GOP C;  2JSO A;  2JA7 B;  3G6X A;  1GOZ A; 
#chains in the Genus database with same CATH homology
 3KF8 B;  5GAG C;  2PQA B;  4JBJ A;  3G71 A;  4GLA C;  3UDX A;  5JJK A;  4X65 L;  2WB1 G;  4LFC L;  2ZM6 L;  4QQB X;  3S14 H;  1D7Q A;  1FJG L;  1BVS A;  1N8R C;  3RLO A;  4HIO A;  2VS1 A;  2ES2 A;  3GO5 A;  3I4O A;  5DLQ E;  4DV4 Q;  4POF A;  3CC2 A;  4JG2 A;  1NJI C;  4QJF A;  2JA5 G;  3CF5 A;  3J7Z C;  3PIP A;  2D62 A;  4LNQ A;  3CMA A;  3U58 A;  3CCM A;  1Q7Y C;  3S1M H;  4BA2 I;  4DR5 Q;  4KLK A;  1AH9 A;  2JEB I;  3GTQ H;  2B63 G;  3PUX A;  4X64 L;  1X65 A;  2KCT A;  1E24 A;  4QL5 A;  3G4S A;  2WAQ G;  5HGQ A;  2Z0S A;  4LF8 Q;  1L1O C;  4X6A H;  2UUA Q;  3F8T A;  4A3D G;  3FP9 A;  4C3J H;  4GS3 A;  5J3B A;  1PHJ A;  3I4N G;  1MKH A;  4A3G G;  4GN4 B;  5C0X J;  1X54 A;  2RCN A;  4BY1 H;  4AH6 A;  3DLL A;  1XNQ Q;  3M9B A;  3EN2 A;  3ULP A;  3T1Y Q;  4JBK A;  3M85 A;  4DV2 Q;  3Q8D A;  4GKJ L;  1KXL A;  1H95 A;  2KHJ A;  2PI2 A;  4BBR H;  4GNX A;  1VQK A;  3E9H A;  3J80 i;  4JOI C;  3U4V A;  4JI3 Q;  2HQL A;  3E9I A;  4LWC A;  4NXN L;  5IE8 A;  3GTJ H;  4IFD G;  1PFS A;  1HZ9 A;  4IJL A;  4IPD A;  1MIU A;  4DR3 Q;  3PUV A;  3H15 A;  1X3F A;  2YTV A;  1P16 A;  5FLX c;  5IWA L;  1OXX K;  2JJQ A;  4DUZ Q;  4DV1 L;  4DV2 L;  4WJ3 M;  2IHE A;  2QEX A;  4X66 L;  4PG3 A;  3CCJ A;  3M4Q A;  2OTJ A;  2Z6K A;  4L5S A;  5IYD H;  1XNQ L;  5M3M G;  3KYH C;  1YI2 A;  2ZTC A;  2Q2U A;  2YU9 H;  3U50 C;  2KCM A;  1DGS A;  4Y7N H;  4A3K H;  2Q2I A;  1VQP A;  3TRZ A;  3HOY H;  5LMN W;  2V1C C;  2UXC Q;  2CKZ B;  1KRT A;  4DK3 C;  2JE6 I;  1AE2 A;  1U5K A;  1HNX L;  1R9T H;  4DR5 L;  4OO1 I;  3S15 H;  5GAD C;  3TS2 A;  3PO2 G;  1VS0 A;  4GKJ Q;  1Q46 A;  1QUQ A;  3GTM H;  3GTO H;  2I5L X;  3E0E A;  3CCR A;  1W3S A;  1CKO A;  2JA9 A;  1N34 L;  4A3J H;  1HNX Q;  2ZJR A;  5LMU Q;  1I5F A;  3J80 c;  3PO2 H;  4GLV B;  2NVX H;  4IPH A;  2HIV A;  3ULJ A;  1K9M C;  3PCO B;  1D8L A;  3IRB A;  4DR2 L;  1FL0 A;  4YY3 Q;  1E3P A;  2RHQ B;  4DV6 L;  3DM3 A;  2VZA A;  3CCE A;  1B7Y B;  2E2H H;  2K14 A;  1KHI A;  1PH4 A;  3L0O A;  2CFM A;  4UY8 C;  1VQE A;  1GD7 A;  1HR0 Q;  3GTK H;  4IPG A;  4NXM Q;  1YIT A;  5M5W H;  4A3L H;  4A93 G;  1EQR A;  1N36 L;  3FHW A;  4DV1 Q;  1QUQ B;  2F4V L;  3BJU A;  1PH6 A;  4LF5 Q;  5IYC G;  4QY7 A;  4BXX H;  4JV5 Q;  3CC4 A;  4IJH A;  5IP9 H;  2MO0 A;  4JC0 A;  2R92 G;  2E5L L;  1E1O A;  3AQQ A;  3L2P A;  2NVQ H;  4AQY L;  1LUZ A;  2VUM H;  1YVC A;  4JI7 L;  4R1J A;  2I5H A;  1MJE A;  4A3M G;  3AFP A;  4XTC S;  1YZ6 A;  1G51 A;  4IPC A;  4DV5 Q;  4HJ8 A;  4JI4 L;  2KBN A;  4R4C A;  5C0X I;  4XIG S;  4HIK A;  1PVO A;  1Q82 C;  1TWH H;  1T9H A;  1XPR A;  3K81 C;  5GAE C;  2UXD L;  4DR2 Q;  1TWG H;  3PSI A;  4P74 A;  1KAW A;  1E22 A;  4MZ9 A;  3HOW G;  1J6Q A;  4LF4 L;  4GOP A;  4LUZ A;  3GTP H;  1VQO A;  2F3I A;  2JK8 A;  2AHO B;  5IYB G;  4TVA B;  1I94 L;  2K4K A;  4LUO A;  3EIV A;  1PH9 A;  4PZ7 A;  5AJ3 L;  3UE1 A;  4IOA A;  2B29 A;  2CQO A;  2GN5 A;  3CAM A;  3OTO L;  1IBM Q;  3UDF A;  4A3E G;  3PO3 G;  3CCV A;  1YJN A;  4DV3 Q;  4K0K L;  4YHH L;  1PYS B;  1WCM G;  4GN5 A;  3I56 A;  1KQS A;  3K8A A;  2UXC L;  1VQ4 A;  4GLX A;  3K7U C;  5JEA J;  3W5O A;  3CCS A;  4R4Q A;  1QZH A;  2IY5 B;  3H0G G;  4HJA A;  1SFO H;  5LMU L;  4X62 L;  4X65 Q;  2NVY H;  1SLJ A;  4DUY L;  1A0I A;  4LF6 L;  4ME3 A;  1S72 A;  3I4M H;  2YTX A;  4B3T Q;  4OX9 Q;  3KDF A;  5M5Y H;  4GNX B;  4A3F G;  2OWO A;  1N32 Q;  3I7F A;  4P75 A;  3JAM c;  4JI0 Q;  4GKK Q;  3F2D A;  4AQY Q;  4A93 H;  1WJJ A;  1PYB A;  4HJ9 A;  4TQU S;  4BBS G;  1X3G A;  4DR7 L;  1IBK L;  4JBW A;  1IBL L;  1JJG A;  1BBU A;  3KJP A;  3UDI A;  4LF4 Q;  3F2B A;  3T1H L;  4JYA Q;  4JV5 L;  1XNR Q;  5GQO A;  5H1S E;  1PH8 A;  3J81 i;  5C0X G;  1VQ5 A;  4JI0 L;  4POG A;  1IZ6 A;  2JA6 G;  2OQK A;  4KHP Q;  1UE7 A;  2VY3 A;  1VQB A;  1NTG A;  3M7N A;  1FGU A;  2WFW A;  1YNX A;  1Q8K A;  4YCW A;  4AYB G;  3KFU A;  4KHP L;  4OWW B;  2UUC L;  3UE0 A;  5LMN L;  1EOV A;  1PH1 A;  3TQY A;  3H3V H;  1Z47 A;  2XGT A;  1J5E L;  3KDF B;  2NZO A;  4C2M H;  5C3E G;  5ELN A;  2OCE A;  4YCV A;  4NXN Q;  3FKI H;  4BA1 I;  1Y14 B;  5C4X H;  2N3S A;  4LF7 Q;  3RZO H;  1VQ6 A;  1G6P A;  1KRS A;  4GKK L;  3OYY A;  3HOX H;  3PF4 A;  1PH5 A;  4R4T A;  1GKH A;  1WI5 A;  2GVB A;  1IYJ B;  4APV A;  2JA7 G;  4JI2 Q;  3GDE A;  2L15 A;  2MFI A;  1CKN A;  4A3B G;  3K7A H;  3HOY G;  2ALY B;  2F52 A;  2AMC B;  2R7F A;  2VW9 A;  2JA7 H;  2I5M X;  1J5E Q;  3I4N H;  5IP9 G;  4UP9 A;  1NE3 A;  3CP0 A;  1TWF H;  1UWV A;  4R4O A;  2MO1 A;  4L5Q A;  2GVA A;  1TWA H;  2A19 A;  1ASY A;  3HOU G;  3CME A;  5JEA G;  2VQE Q;  2E2I H;  4A3M H;  1K3R A;  1X6O A;  4UP8 A;  5GRO A;  4JI6 L;  2HHH Q;  3G6E A;  3PUZ A;  4YWK A;  4JI7 Q;  3KOJ A;  1YHB A;  4PZ6 A;  1WOC A;  5C44 G;  2HT1 A;  2E5L Q;  4DUZ L;  2K5N A;  4DR1 L;  1SRO A;  3RLN A;  2EXD A;  2KHI A;  1PV4 A;  4L5T A;  1L1O B;  1IBL Q;  3AEV A;  1EUJ A;  4A3I H;  3CCQ A;  4A75 A;  1FJG Q;  3BU2 A;  5BR8 Q;  2JA8 G;  4OX9 L;  4NPS A;  5JJL A;  2ZTD A;  1EQQ A;  5HY6 A;  3CC7 A;  3PGZ A;  2VQE L;  3S16 H;  1A62 A;  1YHQ A;  1EIY B;  3J81 c;  2Q2T A;  3A5U A;  4P72 A;  3D0F A;  2E2J H;  2JA8 H;  3NEN A;  1EYG A;  1HJP A;  1VQF A;  1N33 L;  1I50 H;  2IX1 A;  3CPF A;  3T1H Q;  3TS0 A;  4JYA L;  1C0A A;  2WAQ E;  2RHS B;  3KF6 A;  3WWV A;  1HZC A;  1IBK Q;  4LF5 L;  4DPG A;  1E1T A;  2K50 A;  1JT8 A;  3HKS A;  1PH2 A;  4B3R L;  2H5X A;  3RN5 A;  3J81 j;  1I6H H;  1CUK A;  1N32 L;  1YJ9 A;  2VNU D;  4B3T L;  1JMC A;  1VQ7 A;  1Z9F A;  5FJ8 H;  1HZB A;  1NBW A;  1V1Q A;  1HR0 W;  4QIW E;  1RL2 A;  1HZA A;  4A3G H;  2NZH A;  4YY3 L;  3TEH B;  4P71 A;  3OW2 A;  2UUA L;  4OO1 G;  1SR3 A;  1XMQ Q;  1B8A A;  4OWX B;  4DV7 L;  1N33 Q;  1VQ9 A;  2VL6 A;  5FJ8 G;  1PH3 A;  4DR7 Q;  3RLF A;  1HNW L;  1UEB A;  4C3H H;  4BBR G;  2B63 H;  2WB1 E;  2PMZ E;  3HOU H;  4GOP B;  4NB3 A;  4UP7 A;  1VQH A;  1CSQ A;  4JI2 L;  2YTY A;  1W2B A;  5FLM G;  3PO3 H;  1VQM A;  1JE5 A;  1SN8 A;  3AYH B;  3M4O H;  2UU9 L;  2Z6K C;  5IWA Q;  2YYZ A;  3PIO A;  3RN2 A;  3S24 A;  3AFQ A;  1QVG A;  4JI5 Q;  2R6G A;  3B6Y A;  3M4P A;  4J15 A;  2CCZ A;  2YV5 A;  1XTD A;  1PH7 A;  1V9P A;  1SMX A;  1K73 C;  4IFD I;  3CCL A;  4A3I G;  3S1R H;  3T1Y L;  1GM5 A;  2N49 A;  4NXM L;  2LXJ A;  1L0W A;  1UE5 A;  1U0L A;  2R7D A;  2K5V A;  4JI1 Q;  3SGI A;  2R7Z H;  2QGQ A;  4JOI A;  4DUY Q;  2JQO A;  3EBE A;  3F1Z A;  5M5X H;  2R93 G;  3PUY A;  3I55 A;  1A63 A;  1YIJ A;  4DAM A;  4DK6 C;  1XMQ L;  1TXY A;  1O7I A;  3A74 A;  3KJO A;  1XMO Q;  4B3M Q;  1VQD A;  3HFZ B;  5M3F H;  4HIM A;  1BKB A;  1IL2 A;  1G29 1;  2DUD A;  1EFW A;  2Q2H A;  3TRE A;  3CPW A;  1XJV A;  2UUB Q;  4A3J G;  4JBM A;  4JI3 L;  1CKM A;  3I4M G;  4MTN A;  2N78 A;  3GTG H;  4DR4 L;  4H02 A;  1QZG A;  1AE3 A;  5AJ3 Q;  4A3E H;  4JI6 Q;  4QGU A;  2A8V A;  2AKW B;  1CSP A;  4B3S Q;  1I94 Q;  4IOC A;  2OQ0 A;  2UXB L;  4KHZ A;  4PMW A;  1OXS C;  4X62 Q;  3HOZ G;  1HH2 P;  2QA4 A;  1TWC H;  3CQZ H;  4DAY B;  4DNI A;  3UDG A;  2CWP A;  2NVT H;  1I3Q H;  3H0G H;  2ZJP A;  1QVC A;  1WYD A;  1NMF A;  2ID0 A;  3KLW A;  1VQL A;  3CW2 C;  4X64 Q;  1X55 A;  4YHH Q;  2PQA A;  3HOV G;  1Y1V G;  1ASZ A;  1K8A C;  3A0J A;  1FVI A;  3K0X A;  4JI4 Q;  2IT1 A;  4HJ5 A;  2HIX A;  1LTL A;  3U4Z A;  2MQH A;  3M3Y H;  1KL9 A;  2MNA A;  4C3I H;  2OTL A;  1Y1V H;  3S17 H;  2LXK A;  1XNR L;  1C9O A;  1JB7 A;  2UUB L;  5C3E H;  4LF9 Q;  3PV0 A;  3ZJY C;  2K52 A;  4DV4 L;  3W1B A;  1CKN B;  1XMO L;  4B3M L;  3HKZ G;  2PI2 E;  1YJW A;  1OXV A;  2UU9 Q;  2VQF Q;  2XTI A;  5LMN Q;  1XPO A;  1N36 Q;  4YWM A;  1Q86 C;  2HHH L;  2UUC Q;  5K36 G;  2RF4 A;  1K0R A;  2FXQ A;  1VQA A;  4JCV E;  4DV0 Q;  1M1K C;  1OTC A;  4GNX C;  2R92 H;  3F2C A;  4DR6 Q;  4JI1 L;  1V43 A;  2IX0 A;  2Y0S G;  4P73 A;  4X66 Q;  5M3M H;  5IT9 c;  3CD6 A;  1YBY A;  2VQF L;  4LF8 L;  1IXR A;  1OXU A;  4EQ5 A;  1BBW A;  4O2D A;  4DV7 Q;  2I0Q A;  2NN6 G;  5C4X G;  1YHA A;  2JEA I;  1SE8 A;  4HID A;  3NBH B;  1VQN A;  4RG1 A;  4JI5 L;  2ZTE A;  1HNZ L;  4GN3 B;  3HOX G;  4LFA L;  1Q81 C;  4LW1 A;  1VQG A;  5M3F G;  1LM0 A;  1L1O A;  4A3D H;  4YWL A;  1X9N A;  1GVP A;  1Y1W G;  3HOW H;  3BZK A;  4A3B H;  1JJC B;  5IP7 H;  1KD1 C;  1HR0 L;  1JJ2 A;  3PF5 A;  3I2Z A;  4DV6 Q;  4IO9 A;  1S40 A;  5E7N A;  4A3F H;  2BA0 A;  3PUW A;  4K0K Q;  1YEZ A;  1VQC A;  2PNH A;  1GO3 E;  3ICE A;  2Y0S E;  3KF6 B;  4PZ8 A;  1IBM L;  1LYL A;  1NMG A;  2EQS A;  1RIP A;  3MXN B;  4DV0 L;  1K8G A;  4EX5 A;  1NY4 A;  1SRU A;  4R4I A;  4DR4 Q;  2C35 B;  3BZC A;  5IYD G;  4IFD J;  5GAH C;  4OXP A;  2R93 H;  5IY0 A;  1B70 B;  5ELO A;  1HNZ Q;  2NN6 I;  4A3K G;  3HKZ E;  1X3E A;  4DR1 Q;  3MEF A;  4LF9 L;  1VQ8 A;  3S2H H;  1N9W A;  1MJC A;  4BY7 H;  2JA5 H;  2JA6 H;  2UXD Q;  1X56 A;  3RZD H;  2ZM6 Q;  4LFC Q;  3H3V I;  2DGY A;  4MNO A;  3S1N H;  4LFB L;  1C7Y A;  3L7Z C;  1K83 H;  4A76 A;  4LF6 Q;  2E8G A;  2CWA A;  1M90 C;  4FDB A;  1XPU A;  4BY7 G;  3STB C;  4LFB Q;  3GTL H;  4DKA C;  4DV5 L;  3S1Q H;  4A4I A;  5BR8 L;  4WJ4 A;  3STB D;  1Q12 A;  3K80 C;  3ERS X;  4ALP A;  4DR3 L;  2N8N A;  5IYC H;  4BXX G;  1PA6 A;  2LSS A;  4HJ7 A;  4KI0 A;  1E7Z A;  4JI8 L;  5C4J H;  4UPA A;  4RMF A;  4A3C H;  3ULL A;  3OTO Q;  4B3S L;  2R7Z G;  5FLM H;  2ASB A;  5IYB H;  3GD7 A;  2D0P A;  3JC6 6;  2D0O A;  4LUV A;  3RNU A;  3FKI G;  4LFA Q;  1OXT A;  4A3C G;  2AWO A;  1S3O A;  4OON A;  1HNW Q;  1A8V A;  2A1A A;  1KC8 C;  1Q1B A;  2K5H A;  3JAM i;  2IHF A;  3NEM A;  3S2D H;  2BH8 A;  4YCU A;  1Q1E A;  4BY1 G;  3A5Z B;  4DV3 L;  3VDY A;  5C44 H;  1N34 Q;  2VUM G;  1EIF A;  4DR6 L;  2KEN A;  2UXB Q;  4Y52 H;  1EWI A;  1VQI A;  2EIF A;  4OWT B;  1UE6 A;  3NEL A;  2ZJQ A;  4O0A A;  2B3G A;  3W1G A;  3CXC A;  1Y1W H;  3HOZ H;  2WP8 J;  5JJI A;  5IP7 G;  3J7A 5;  4B3R Q;  4LF7 L;  1L2F A;  3ER0 A;  3LGJ A;  4JI8 Q;  1KIX A;  2ATW A;  3CCU A;  1P8L A;  1VCI A;  3D31 A;  1QVF A;  4AYB E;  1VQJ A;  1WCM H;  4BBS H;  3RR5 A;  4AIM A;  4L5R C;  2BA1 A;  2F4V Q;  3HOV H;  1UE1 A;  1WFQ A;  2K75 A;  2AWN A;  4GOP C;  2BH2 A;  3G48 A;  5EAY A;  4A3L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...