3H3VH

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00575 S1 S1 RNA binding domain
H PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vH02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h3vH01
3J81j 3CPFA 1G51A 5GAHC 3LGJA 2NZOA 4LF7L 5M3FG 2BH8A 1EOVA 4DK3C 4JBWA 1BBUA 1HZBA 3E9HA 5C0XI 4C3JH 1E1TA 3E0EA 3K81C 1EUJA 1PH7A 5AJ3L 2ZM6Q 3S1RH 3A0JA 1KC8C 2R92H 1Y1VG 1C0AA 4RG1A 1AE3A 2GVBA 1KQSA 1PH5A 3HFZB 3S24A 4HIDA 1HNWL 1X54A 3ULLA 3HOZH 4DR6L 5IWAL 3FHWA 1WYDA 4LF8L 1X56A 2RHSB 4GLXA 2R7DA 4B3TQ 4BA1I 1DGSA 2MFIA 5LMNW 1XNQQ 2ES2A 4KHPQ 4LFCQ 2OQKA 2Q2IA 1N34Q 5IP7G 2K5NA 3NBHB 4YHHL 4A76A 3HOWH 4QL5A 4GKKL 4GLAC 3GTLH 4KHPL 4A4IA 4DAMA 4FDBA 3TREA 3PCOB 3G6EA 1QUQA 4OO1G 2NZHA 3S17H 1N33Q 4DV3L 3T1HQ 4EQ5A 3KDFB 5M3MG 3W1GA 4DR3Q 1U5KA 1YHAA 1EYGA 3CCQA 1GKHA 3JC66 2QEXA 1Q81C 3PSIA 4QIWE 2YTYA 1X3FA 4KHZA 1XMQL 3HOUH 5E7NA 2UXDL 5JEAJ 1NY4A 1EIFA 5ELOA 1KRSA 1RIPA 4R4QA 2VQEL 1VQPA 4LNQA 4JCVE 5JEAG 3DM3A 1Z9FA 4DR5Q 4DKAC 3EBEA 4UY8C 2GN5A 1N32L 1V43A 2UUBL 1VQNA 3TQYA 4A3JG 1AH9A 4PG3A 1VQBA 4LF8Q 3K8AA 4BY7H 4P75A 1OXSC 4L5TA 2LSSA 2YTXA 4KI0A 4OONA 2RHQB 4DV1L 4YWKA 3RNUA 3I4MH 4K0KQ 3RZOH 4ALPA 1YNXA 1Q86C 1K8AC 1VQ6A 2PMZE 1XMOQ 4YCVA 2PI2E 1FJGL 4X64Q 3BZCA 2IHEA 4GN3B 5M3FH 4DV3Q 3T1HL 3BJUA 2EQSA 1EQQA 2OTLA 2ID0A 2VQFQ 4JI0Q 3CCSA 4QGUA 3FKIG 3HOXG 1YJWA 5JJLA 3PO2G 4UP9A 1S72A 1OXTA 4HJ8A 4IOCA 1VQFA 3D31A 1PA6A 4AYBE 4MNOA 1U0LA 1PYBA 2IT1A 1OXUA 1SR3A 3W5OA 4C3IH 2E8GA 1QZGA 5GQOA 1E22A 2VL6A 4YY3Q 4GOPB 4JI5L 4DR4L 5AJ3Q 2ZM6L 1VQ7A 4WJ3M 4JI1Q 5C44G 4PZ6A 1L1OB 2JE6I 4A75A 4LF5Q 4L5SA 2UUAQ 1B70B 4DUYL 5H1SE 1VQGA 2K50A 1O7IA 2ZTEA 3A74A 3PUZA 3DLLA 4LF4L 3S1MH 1SLJA 1PYSB 1B7YB 5HGQA 1VQ9A 4LF9Q 4UP8A 3GTKH 3CF5A 1JMCA 1VQKA 4C3HH 2F4VQ 1UE5A 4DR2Q 2N3SA 1HNXL 3K7AH 2A8VA 1A63A 1T9HA 1LM0A 4DR3L 4PZ8A 3KF8B 1IXRA 1JT8A 3GTMH 2JJQA 3U58A 5C0XJ 2Y0SG 4X65Q 4A3MG 3U4VA 2XTIA 1UE1A 4XIGS 4NXMQ 2PQAA 4NPSA 5C4XG 3CD6A 1TWGH 4IFDJ 3S1NH 3AFQA 2N49A 4YCWA 1TWFH 4LF6Q 1L2FA 4A3CH 1Q1EA 1KD1C 4DK6C 3M85A 1I6HH 1BKBA 4AQYL 4OO1I 2OQ0A 1L1OC 2NN6G 1YHBA 2NVYH 4MTNA 1NE3A 3H0GG 4DV1Q 4AYBG 2B63G 1A0IA 3J80c 3M4QA 3UDIA 2E2IH 5IYDH 1QZHA 4GOPA 4IFDG 4Y52H 2VQFL 2OWOA 4AIMA 3PIPA 2IHFA 2D0OA 3UE1A 1XNRQ 1L1OA 3T1YL 3OYYA 1Y1WH 4A3GG 3F1ZA 3HKSA 4RMFA 1A62A 5DLQE 1IYJB 2BA1A 2H5XA 1HNXQ 5J3BA 1LUZA 3F2CA 4JV5Q 1Q8KA 4GOPC 1PH8A 4JBKA 2R92G 3UDFA 3KLWA 4A3IG 1LYLA 1WOCA 1J6QA 1WCMH 4UP7A 2ZJPA 5C4JH 1D8LA 1M90C 1L0WA 4L5QA 4C2MH 2YU9H 3J81c 1Q46A 2N8NA 5C44H 4GNXA 2CWAA 5LMUQ 3HOZG 3UDXA 2PNHA 3OTOQ 3J7A5 4HJ7A 1N32Q 4A3DG 2E2JH 1VQLA 4DV0Q 4J15A 1YEZA 4YWMA 3ZJYC 2I5MX 4YY3L 1UWVA 4APVA 5IWAQ 4DV7Q 4A3FH 3HOWG 4JYAQ 1R9TH 3GTQH 4B3RQ 4K0KL 1GVPA 1XPOA 2VNUD 2JA7H 1OXXK 3TS0A 2DUDA 1HR0L 1IBLL 3CMAA 2ALYB 1JJ2A 2R6GA 4BXXG 1GD7A 4X66Q 2V1CC 3KFUA 5BR8L 4JI6Q 2EIFA 2A1AA 3BZKA 2UXCL 5FJ8H 2JQOA 3NELA 2R93H 1XNRL 1JE5A 1N9WA 1CUKA 2JA9A 4DUZL 1I94Q 2K52A 3F8TA 2ATWA 4DR1Q 3M4PA 4DV4L 3GDEA 4JI2L 4HJ9A 1NMFA 2NVXH 2RCNA 2AKWB 4B3SQ 4X6AH 5FLMG 4A3JH 4AQYQ 1SROA 2RF4A 2WAQE 3F2DA 2B63H 4DR7L 1G6PA 3GO5A 2UUBQ 4B3MQ 2MNAA 2R7ZH 2Z0SA 4X62L 4P72A 4QY7A 3M7NA 3S15H 2GVAA 1KAWA 2L15A 3GTJH 5IT9c 3ER0A 3PUYA 1VQCA 3K0XA 1VQDA 4JI7Q 1MKHA 1JB7A 1YJ9A 4DR6Q 1FL0A 2HT1A 3ULPA 3RLOA 3NEMA 2N78A 4A3BH 3IRBA 3J81i 3KYHC 4JI7L 4Y7NH 1AE2A 1OXVA 2K75A 1KL9A 1VQ5A 4L5RC 3HOYG 4BY1G 2KCMA 2YV5A 1MJEA 3KOJA 4JI2Q 2JA8G 3B6YA 5M5XH 4A3LG 4LWCA 3KF6B 2VS1A 2F3IA 1I3QH 2I5HA 1P8LA 1WFQA 4LUOA 4DV2L 4POFA 2ZJRA 1PH2A 2Q2TA 3PO2H 2B3GA 3L2PA 4DR7Q 1TWHH 3OW2A 1NBWA 4DAYB 1Q82C 2WB1G 4WJ4A 2K5VA 2PI2A 4EX5A 4UPAA 2XGTA 3J80i 1D7QA 1PH9A 2OTJA 5HY6A 4JYAL 2LXJA 2UUCL 2HIVA 1Z47A 4YCUA 3K80C 3CCUA 4JI8Q 2FXQA 4LF4Q 1TWCH 1PFSA 1TXYA 3BU2A 1B8AA 4NXNQ 2K14A 3KDFA 4O0AA 5IYBH 5ELNA 1X3GA 2CQOA 1XNQL 4P74A 4JC0A 2PQAB 2WP8J 3ULJA 1PH4A 4IO9A 2YTVA 3M4OH 1N36L 1MJCA 5FLMH 2JA5H 4JI4L 4XTCS 5JJIA 1IZ6A 1X9NA 1S3OA 3F2BA 4JOIA 3G4SA 1NTGA 3I2ZA 4H02A 3U50C 1PH1A 3H3VH 5EAYA 3J7ZC 1IBML 2WAQG 4R4CA 2ASBA 3PO3H 2R7ZG 2CFMA 2R7FA 3G48A 4X62Q 1PV4A 4NXML 3HOVG 4OWWB 1KRTA 1E1OA 2QA4A 5C3EG 1XMQQ 2K5HA 2EXDA 2CKZB 2VQEQ 4HJAA 1ASZA 3HOUG 1VQAA 4JOIC 3RN5A 2UXBQ 4JBJA 3PF5A 2HHHQ 2JA6G 1HNWQ 1QVFA 1XMOL 1EFWA 5IP7H 3KJOA 1FJGQ 1HR0Q 4A3CG 5K36G 1HH2P 3I55A 2UXBL 4B3RL 1EWIA 4OX9L 2HHHL 5GAEC 4BBSG 3I4NG 3H0GH 4R4IA 1UEBA 4A3EH 1XJVA 2C35B 4LUZA 4DUZQ 3RZDH 3GTPH 2ZTDA 3U4ZA 4GNXC 4LFBQ 2NN6I 1YIJA 1CSPA 3CCEA 5LMNQ 4LF7Q 2BA0A 3S16H 1HZCA 4TVAB 5C0XG 4R4TA 2I0QA 1YZ6A 1IBMQ 1NMGA 1WI5A 3NENA 1EQRA 4IPGA 4JI4Q 4JBMA 1VQJA 1YI2A 4A3DH 5JJKA 3FKIH 3MEFA 3S2DH 4YWLA 2AWOA 4PZ7A 3E9IA 4A3FG 3HKZG 1Q1BA 2E5LQ 4BY7G 2LXKA 1WCMG 5GAGC 1W3SA 1PHJA 4MZ9A 3CC4A 3H15A 3OTOL 5IE8A 3CXCA 4BXXH 2HIXA 4HIOA 4JI8L 1IBKL 1N34L 4BBRG 5M5YH 5BR8Q 4JI6L 3CQZH 2R93G 3AYHB 3CPWA 2JEAI 2UUCQ 1VQEA 4GLVB 4LFAQ 1QUQB 5IYCG 4A3KH 2JA5G 1X6OA 2A19A 4DR2L 4R4OA 4IPHA 4IPDA 3RR5A 2Z6KA 2KBNA 1HZ9A 1SE8A 2YYZA 3T1YQ 1SMXA 1Y14B 1S40A 1QVGA 1JJCB 1VS0A 4DR1L 2UU9Q 3PO3G 3GTOH 3I4OA 3AFPA 1KIXA 1HNZQ 4NB3A 4GNXB 3AEVA 2KCTA 2VZAA 4TQUS 2UXDQ 5GADC 4X65L 3K7UC 3A5UA 2E5LL 2JK8A 3UDGA 5M5WH 2NVTH 1W2BA 3JAMc 1CKNB 1LTLA 4PMWA 2WB1E 1HJPA 3VDYA 2ZTCA 1YJNA 5FLXc 1KHIA 3I4NH 1GO3E 4BA2I 4OXPA 3CP0A 2F52A 1K3RA 4P73A 4R1JA 4AH6A 1C9OA 1SFOH 1OTCA 4LFBL 3STBD 2ZJQA 4JI0L 4LF5L 1FGUA 1A8VA 3KF6A 2CWPA 3M3YH 4A93H 2Q2HA 1JJGA 1SRUA 4X66L 4A3LH 4OX9Q 4A3MH 4DNIA 5IYDG 1SN8A 2KHIA 1IBLQ 4IOAA 3PIOA 2NVQH 1X3EA 1J5EL 1QVCA 4JV5L 3L7ZC 2QGQA 5C4XH 4DV6L 1N36Q 4GKJQ 3PF4A 2IY5B 1Y1WG 4DV4Q 2BH2A 2B29A 3CAMA 4BY1H 4DV2Q 1N33L 4ME3A 1HNZL 5GROA 5M3MH 1YVCA 3PUWA 1EIYB 3WWVA 2DGYA 4KLKA 2VW9A 1IL2A 3A5ZB 4A3IH 1X55A 1CKMA 4DR4Q 2IX0A 3UE0A 1WJJA 3PV0A 3I4MG 1VQMA 2MO0A 3H3VI 3GTGH 1I5FA 4HIMA 4OWXB 3CC7A 1CKOA 3CCMA 3SGIA 1M1KC 2KHJA 4JI3L 3CCLA 1YBYA 4HJ5A 2D0PA 2MO1A 3Q8DA 3G71A 1VQ4A 1UE6A 2JA7G 4GKKQ 1I94L 3MXNB 1X65A 2UU9L 3CC2A 1Q12A 3PUVA 2Q2UA 4JI3Q 1E3PA 1K0RA 2VUMG 4X64L 2UXCQ 1XPRA 3W1BA 1J5EQ 1VQHA 4O2DA 3PUXA 4DV6Q 3HOVH 4GKJL 3L0OA 2WFWA 3CMEA 3HKZE 5C3EH 4B3SL 1V9PA 5IP9G 1ASYA 3HOXH 2JEBI 1CKNA 5IY0A 1CSQA 1NJIC 2JA6H 1K8GA 4DV0L 2MQHA 4GS3A 3JAMi 2E2HH 4DUYQ 1MIUA 3RLFA 1Q7YC 3TS2A 1RL2A 3TRZA 4B3TL 1PH6A 1PH3A 3AQQA 4JI1L 3S2HH 4LFCL 1H95A 4A93G 1Y1VH 4JI5Q 1VCIA 4GN5A 5FJ8G 1N8RC 1E7ZA 4QJFA 2F4VL 3M9BA 4LW1A 4DPGA 3ICEA 1BBWA 4LUVA 4DV5L 1G291 4DV7L 4LF9L 4LFAL 1GM5A 1P16A 3CCVA 3GD7A 4P71A 1YHQA 1XTDA 4BBSH 1HZAA 5LMNL 3I7FA 1FVIA 2AWNA 3D0FA 3STBC 4YHHQ 4A3EG 2IX1A 2I5LX 1VQ8A 5LMUL 3FP9A 1KXLA 1YITA 3HOYH 3CW2C 4GN4B 1C7YA 1TWAH 1K83H 3EIVA 4JG2A 3CCJA 4IJHA 2VY3A 4OWTB 4HIKA 2Y0SE 4IJLA 4LF6L 1K73C 3KJPA 2Z6KC 2D62A 2AHOB 1IBKQ 2KENA 5IYCH 3RN2A 3EN2A 3I56A 4QQBX 3PGZA 4IFDI 3TEHB 2AMCB 4DR5L 4NXNL 4A3BG 1I50H 3ERSX 1VQOA 2UUAL 4B3ML 3S14H 4A3GH 3CCRA 2CCZA 4IPCA 2VUMH 1BVSA 1K9MC 1XPUA 4BBRH 1HR0W 1UE7A 4DV5Q 2JA8H 1VQIA 2OCEA 3RLNA 4POGA 2K4KA 1PVOA 1E24A 1V1QA 2HQLA 4A3KG 5IYBG 3S1QH 5IP9H
chains in the Genus database with same CATH superfamily
3KAKA 2HVRA 2D9UA 1WTQA 4LF7L 4FF4A 2H1EA 1T5XD 3H40A 4QW9A 4C3JH 3OIQA 3GTQB 1PH7A 4LJZC 3MTSA 4B3TH 4CDCC 2R92H 1XYIA 3T53B 2OLSA 3F2UA 1C0AA 1AE3A 2GVBA 1CHQD 4E6IA 3ULLA 5IWAL 1L0XB 1WYDA 1HCZA 5I9PA 2VOBA 3QB3A 5DG9A 2RHSB 5LMNW 3E5SA 1EYCA 4O4LF 4ED0A 1S10A 1KDAA 1JDBB 4KHPL 1IYUA 1TY2A 2F4IA 5E4WC 1KABA 1HFNA 1N33Q 1ENCA 1WD1A 5CB4F 1A6XA 1GKHA 5BN3A 3OTOH 1PZKD 1K0SA 1AW7A 1CQFA 2WAQA 4XT3B 1TT2A 3SHLA 2YTYA 4KHZA 1XMQL 1I4QA 1ML0D 2VQEL 4LNQA 1UNNC 5I6YA 1U4MA 2GPSA 4JCVE 1EZ8A 3K57A 4OGQC 4UY8C 1N32L 1MZBA 3TDQA 1RJQA 4TV9F 1T94A 2F0LA 5KG0A 4BY7H 1K83B 2DPIA 5FO9B 4P75A 4IFDJ 2LSSA 5FLXW 1KJ8A 2RCFA 3BQ0A 4JV1A 3T5LA 1VQ6A 1SE3A 2PMZE 1XMOQ 4IWYA 3RB0A 4X64Q 2C28A 3KTMA 2IHEA 4GN3B 4XYOA 5AFWA 2MPMA 1L2ZA 3T1HL 2OTLA 4O3QA 2ID0A 1D6EC 1CZGA 5CYUA 4CHTB 2VQFQ 4J6HA 3CCSA 4JI0Q 2E2DC 3I4MB 5JJLA 1EIGA 4YJ2F 5DQGA 4UP9A 1DOLA 1E4EB 3CKIB 4X3TA 1PYBA 1DV2A 2F0JA 3VPDA 4C3IH 1GSAA 1DZ1A 2E8GA 1EL0A 1QZGA 1HHVA 5GQOA 2VL6A 5FPRA 2HUGA 3G6YA 5AJ3Q 1VQ7A 3LWBA 4PZ6A 2JEGA 1OO9B 3K58A 2UUAQ 2BOSA 3KHRA 3DLLA 2R7NA 4A3MB 4LF4L 3A74A 1WTWA 2AQ4A 5HGQA 3RIZA 4DXFA 1PZJD 4RGTA 5JPMC 5DGBA 1UE5A 4HNUA 4DLKA 3FMCA 4JYAH 4LF5H 3I4LA 2JJQA 1XNRH 4U68A 2XTIA 2ZM6H 1BCPC 4NXMQ 1LTAD 3GTGB 5HBRB 4CC5A 2IMWP 2F0DA 1HPCA 2R82A 3AFQA 5KFEA 2I8CA 3U9OA 4KMUC 4KD3A 1EYZA 3PW5A 3M85A 3V6JA 1L1OC 3A7AB 1NE3A 2K7VA 3GV3A 5EPKA 5IYZF 1E0BA 1ZEQX 4AYBG 4RB1A 3PW0A 1JICA 4I55F 3M4QA 2E2IH 1ZHQA 1G2TA 5FD5A 2E2HA 2KUMA 4GOPA 3E3XA 1CE8A 4I7ZC 2BDOA 1KNEA 2PCFB 2IHFA 4TKOB 1Y1WH 1SYXB 1A62A 3O13A 3FDTA 3J81W 2EYJA 2JA6A 1PTOH 1XX8A 1Q8KA 4JBKA 5JPNC 4A3IG 4UP7A 2ZJPA 1D8LA 5D65A 3J81c 1Q46A 4GNXA 2CWAA 4DNTB 4FYDA 2HVQA 4A3DG 2B2UC 4LSXA 2ZJTA 1M8AA 1TAEA 1ET6A 1EU4A 1MGSA 4A3FH 3GTQH 4K0KL 1CT1D 3QOLA 1OXXK 4V190 2K33A 3BVMA 4BXXG 1GD7A 3K5NA 1Y1VB 2R87A 4YIJA 2UXCL 2JQOA 4N8FA 3GTGA 4ECXA 1SDFA 1KDBA 2K5WA 2XIGA 2YYAA 3H4BA 1JE5A 3OSPA 2JA9A 5D14A 5KFIA 2Z6BA 3GDEA 4ECYA 1CK1A 2RGVA 2NYZD 2NVXH 1ESFA 2L4NA 5FLMG 4AQYQ 2NU8B 4ZKBB 3K3PA 3F2DA 1G6PA 5I4DA 2MNAA 3DEOA 1E4GT 4G7ZC 2GVAA 4IUVA 4DL3A 2RDGA 2J7ZA 2K1BA 2GLTA 3D3RA 2DWCA 4ZUIA 1VQCA 1VQDA 4HAEA 1B6SA 1SFOA 1JB7A 3G6JB 2L5TA 4DR6Q 1FL0A 1GUTA 5CV7A 5IGDA 1PXUA 4TV8F 4YAKB 2MP1A 3BYTB 1GOZA 2KCMA 3A56A 1MJEA 3KOJA 4JI2Q 3MJFA 1U9RA 1GYFA 2DNEA 3IL8A 1P8LA 4ECRA 2HCIA 4DU9A 3L2PA 4MV7A 4DR7Q 1TWHH 4DAYB 3HOYB 1O75A 1JQYD 4ULLA 4WJ4A 2RSNA 2PI2A 4UPAA 1S97A 5KYIA 3BG5A 1HNXH 1LV9A 2HIVA 1JKJB 1N33H 4YCUA 2ASDA 2FXQA 4RFBA 4A2BA 4YR0A 3S9WA 3M9OB 3EQLC 3R2IA 3CQZA 3RAQA 2BE5C 3HOVB 4LSAA 5IYBH 1S5BD 4U7CA 3OSOA 1N56A 4JV0A 3H6MA 4JC0A 2DPJA 3VYTA 4UCOA 2YTVA 1N36L 3BABA 3MFYA 1MJCA 5IT9L 2JA5H 2EYFA 4DNRB 4JI4L 3MC0B 4JOIA 3G4SA 3I2ZA 4FF1A 4DXGA 1WR2A 4IUQA 1IBML 4PDBA 3EA6A 4RCOA 3K5IA 3HBLA 4NXML 2R3ZA 1S0MA 4K5XA 1E1OA 3CVZA 4JI8H 5C3EG 3TP5A 4DV7H 2K5HA 4HJAA 2CKZB 1ASZA 4JOIC 4ZRZA 3GTQA 1C4QA 2DLNA 4A3IB 2YRWA 1HNWQ 4TUYF 4I65A 3NSWA 3KJOA 1HR0Q 3EPIA 4A3CG 2VPSA 3SK6A 4OX9L 2HHHL 5EQ0A 3BVZA 1KJ9A 4X3SA 1XJVA 4FS2A 4DUZQ 4DL6A 3HEJA 2WKCA 3U4ZA 4PWQA 1YIJA 1K1SA 2W7PA 1CSPA 3QO2A 2K01A 2JSOA 3T16A 2BA0A 5C6AA 2O5IC 4TVAB 5C0XG 1KEEA 2A6ED 2JN4A 3NENA 1EQRA 4JI4Q 4EFEA 2QF7A 1LT6D 4YY3H 5JJKA 2Y0SA 3VR3A 4K6DA 3MEFA 3S2DH 2R7LA 4YWLA 2AWOA 4PZ7A 2PQEA 1G6ZA 4OIKA 3LWUA 4BY7G 2LXKA 5GAGC 1N36H 1CTMA 3GTJB 3JAME 5DLGA 3I91A 4MN3A 3MZ5A 5IE8A 1TR5A 1SEIA 5CGKA 3H3VC 1H9MA 5M5YH 4EGQA 3AYHB 4UCRA 3FEWX 4GLVB 4NXMH 2JA5G 4UDUC 4IPHA 2BQRA 2O4XA 1SE8A 5EPLA 2W8LA 2UVRA 5C4ZA 1QVGA 5KT4A 4DR1L 1Y69U 1I94H 5T1GA 1WTPA 4RUAA 4C3IG 1EY5A 2FJ2A 4O1NA 1HNZQ 4ECVA 1A15A 4RZRA 2AQ2B 5BN5A 4RGOS 1FNUA 1CKNB 1AN8A 4FM9A 4F88A 4DV0H 1Z2NX 4C2MB 5F9LA 1K3RA 3R5XA 3SE7A 3VYRA 2HDLA 1CFMA 2ZJQA 1EEFD 1A8VA 1EY6A 2Q8IB 2CWPA 3M3YH 4A93H 5CORA 1I7NA 3K5HA 1SRUA 1FR3A 4X66L 5KT2A 2AGOA 2NVXA 4DNIA 2CW0C 4IOAA 3PIOA 3NWTA 2XGPA 4C1NK 2B2WC 4FNFA 4DV6L 3PF4A 1UEAB 1SXTA 1TWHB 2K05A 3AMUA 4C5AA 3TINA 1HNZL 4GZYC 5M3MH 1YVCA 1WTOA 2W6NA 1IKLA 1JOOA 2EYOA 4KLKA 3T13A 4WFN3 1IL2A 1F9SA 3A5ZB 1I7LA 4QF4A 4DR4Q 5EKIA 3M4YA 3P75A 4E4TA 2W6OA 5KX5F 3PZPA 1PTOC 1AZQA 1MD2D 1LTID 2KHJA 3L9AX 1VKZA 1RK6A 2UUAH 1D5XC 2D0PA 3Q8DA 2MUYA 1VQ4A 1EY4A 5IODA 2L12A 3N43B 3MXNB 2UU9L 3CC2A 1VF5C 1Q12A 5BPHA 1XPRA 3W1BA 4O2DA 2RDHA 2PZTA 2EOTA 1VBGA 4DV6Q 4KK7A 5BMVF 2HD3A 3OHAA 3VPBA 5C5JA 1T3NA 4DL5A 3QZ8A 3GTLA 1Y8PB 1HA6A 1DXMA 1CSQA 3MR6A 3SEBA 4GS3A 2B2YA 4DUYQ 3RLFA 2XD4A 1RL2A 3TRZA 1PH6A 3AQQA 3P20A 1C8CA 1EOTA 5M3FB 1H95A 4A93G 4X64H 2I07B 1F77A 1I6VC 2B2VC 1TWCA 2F4VL 4HMJA 5ELEA 1CQVA 3BA9A 4LFAL 5LL6b 3GD7A 1TU2B 4A3FB 1TA8A 4ED2A 1JB3A 1HZAA 1FVIA 1JXLA 2F0KA 2SNMA 5EKLA 3STBC 5C3EB 4GKKH 3C0FB 1YITA 4O42A 3H0GB 3T51B 4CJ2C 3HOYH 3RV3A 5FO7B 4LH7A 1F9QA 1JE4A 4DV6H 4IJLA 1CQIB 3DM1A 3JZIA 3KJPA 1D1IA 5L1JA 1O7ZA 2AHOB 1I4RA 2D62A 5IYCH 1IBKQ 2PMZB 3EN2A 3RN2A 4QQBX 3MWMA 3V4ZA 1H9KA 4IFDI 2YZMA 4DL7A 1I50H 3ERSX 4B3ML 3J7AV 4HEDA 3S14H 2FLLA 4JI7H 1QG7A 2B8FA 3CCRA 4CGYB 5K5PA 3EYYA 2VUMH 1BVSA 3TQTA 4BBRH 2JA8H 4DV1H 2YCHA 3RLNA 5LHY1 4Q0FA 4POGA 2K4KA 2O5JC 2KSWA 2R7KA 4FXKC 5DQIA 1V1QA 2HQLA 5D8DA 3HOWB 1W96A 3S1QH 1GLVA 5IP9H 5GAHC 4CDEC 5M3FG 4A93B 3VYSA 1M4VA 4MA5A 4JBWA 2IL8A 1BBUA 4Y7NB 3E9HA 5HURA 1E1TA 3E0EA 3K81C 2KCCA 1EUJA 2SCUB 1ZETA 5AJ3L 4Q43A 4PQXA 1U4LA 1RF2D 1SYGA 1ZXTA 3GIPA 3BDCA 4ECQA 2K32A 3I70A 3S24A 4HIDA 4A3GB 1HNWL 3J81L 3FKIB 3IG0A 3FHWA 3FMAA 4LF8L 5CBAE 1LABA 1HQRD 3OOCA 4HR7A 4EQPA 4BA1I 3S16B 2ES2A 1JX4A 1X32A 2Q2IA 4GKKL 4QL5A 5A2QW 3TSSA 3TREA 3WOEA 1IKMA 2A68C 4HCEA 4RHSA 4ABNA 4DV3L 1PX2A 3GV6A 3KDFB 4EQ5A 3W1GA 4DR3Q 3OUZA 2FK3A 3CCQA 4OELB 1Q81C 1PFMA 4PV1C 4YJ3F 1VDZA 3WO1A 1K28A 1GSHA 4QW8A 2FMAA 1X3FA 3TP8A 5JEAJ 5KFZA 1EIFA 5ELOA 4ED6A 2XWBB 1D1KA 5ELCA 4DR5Q 5KFCA 1QILA 3KHLA 1V43A 1VQNA 4H7BA 3TQYA 4A3JG 1Y1WB 1AH9A 1VQBA 2JXMB 4DV1L 2YTXA 4KI0A 2RHQB 3T5HA 5KFBA 2OF1A 3S15B 4EBEA 1FJGL 2PI2E 4N9TA 5M3FH 1RHPA 3C2PA 2PW7A 4BS9A 4DV4H 1PMRA 1EQQA 3FKIG 1HA5A 4RAZA 4J9KA 4O3NA 1OXTA 4B9WA 4ECWA 1PA6A 2B63B 4AYBE 1EUDB 1LACA 5E4XA 1B33N 4J9PA 4J8QA 1RJPA 2W70A 1STNA 1S03G 1E22A 2ICEC 4LMQD 1RJTA 1RCVD 3H09A 4IQZA 1WVLA 3PO2B 3S14B 4HNTA 4J9NA 2JE6I 4A75A 4LF5Q 1TKWB 2KA7A 1B70B 4DUYL 4LF6H 1K8MA 2VA2A 1B9NA 2Z4HA 1O7IA 4LF9H 5JOBA 3U9TA 1QNUA 5L1IA 2ZXPA 3S1QB 1W6KA 1E4EA 2C00A 4C3HH 5IGCA 2F4VQ 2VUGA 4DR2Q 4ZKCB 1BDOA 4JI1H 1HNXL 2RDFA 3D8GA 1GUNA 1T9HA 3Q22A 3HKZA 4PZ8A 3KF8B 2X69A 1JT8A 1A2TA 1YNJD 3U58A 1RODA 3MFIA 2PNRC 3RFCA 3U4VA 5C8YF 1UE1A 4TQRA 5HGTA 4J9OA 1CA6A 4BBSB 2HDMA 1S0NA 3S1NH 2R8GA 3BDLA 3VR6A 1TWFH 2EY5A 1L2FA 1V8QA 1KD1C 4DK6C 4AYBA 1BKBA 4AQYL 4OO1I 2OQ0A 2FE3A 2NN6G 1YHBA 2NVYH 5J39A 2CW7A 4DV5H 3BZDB 2B63G 2C9OA 5A35A 3FPPA 5J22A 1GUSA 1RYRA 3UDIA 1AFPA 2ALZA 1B1ZA 5DEHA 5EWFA 1AP0A 2CQAA 4MV4A 1FD7D 1VMPA 4AIMA 1W6JA 3PIPA 1XNRQ 3DF7A 4A3GG 2ICIA 4ZOLF 2FK1A 3HKSA 4RMFA 1IYJB 1HNXQ 5J3BA 1EY7A 2QEJC 4JV5Q 3GLKA 3BDOA 4FO2A 2R92G 4OX9H 2EYMA 3OHBA 3HRZC 4C2MH 2YU9H 2VB3X 5KFSA 2A6HD 5LMUQ 1STYA 4RNOA 3HOZG 3J7A5 2PNHA 1CS0A 4O2AF 3NTIA 1SFOB 3LX0A 2WTFA 4NW2A 3SK8A 5M5XB 4BY1B 1NR2A 4YY3L 2A5HA 4APVA 3HOWG 4JYAQ 1RJRA 2X6LA 3KK7A 4B3RQ 1GGOA 1S5DD 1GVPA 4MAMA 4ZQIA 3TS0A 2DUDA 5KT5A 4APMA 1IBLL 2FLNA 1WTVA 4I7HA 3CMAA 2F0UA 2V1CC 2YS6A 5BR8L 3BZKA 3IFTA 3NE5B 4K8JA 2R93H 1XNRL 4YP3A 1CUKA 1I94Q 3F8TA 3HGBA 2M9VA 1WTHA 4DR1Q 3M4PA 3NTKA 2XIWA 2G5DA 2JEIA 2NVYB 1NMFA 4Q8FA 2Q8TA 4RGNA 4B3SQ 2CW0D 4R8NA 5KFGA 1H9JA 3SI8A 1Z6HA 2ATLA 4FXDA 2WYOA 1TIID 3BVGA 1F9RA 5CV6A 2B2TA 1LTRD 2WIIB 5KFKA 4QY7A 3S15H 2P0AA 4B08A 4PMCA 2EXZA 4BWSC 2L15A 3GTJH 1XWEA 3UFXB 1S9FA 1SSOA 2QKIC 3KHGA 3K0XA 1FNWA 4OHJA 3MA2B 4LH6A 2SDFA 1HRJA 3NEMA 3IRBA 3J81i 4JI7L 3KXYT 1R4QB 1IL8A 3HOYG 4BY1G 1WTXA 2JA8G 5M5XH 4A3LG 4LWCA 4A3JB 2F0IA 2F3IA 1I3QH 1O7YA 4LUOA 1KC7A 2Q2TA 3PO2H 4JPBW 4J0MA 3OW2A 5EDWA 1NBWA 2ZXRA 5G3LF 4DR1H 1JWUD 4K2LA 2XGTA 3ND9A 2KQ3A 4JK1C 2F0TA 2OTJA 5HY6A 4JVZA 2LXJA 1D7QA 3CCUA 4U673 1PZID 5JUMA 4IWXA 1TXYA 2DJFC 3FRPB 4NXNQ 4LFCH 4BWGB 4DK1A 4EQOA 2CQOA 1I4GA 4RWSC 2JEJA 3R5FA 2JP1A 2M00A 4JW0A 2WP8J 3ULJA 3VA7A 1PH4A 2KHSA 4F4YA 3JAML 1A3UA 3RZOB 1ENAA 3QJYA 3J80E 4KKUA 2FMCA 5FLMH 1B44D 1IBLH 4BBRB 3RMHA 1NTGA 3GTKB 3U50C 2XC9A 2ASBA 2J0TD 1S5ED 2AU0A 4MV3A 4NMZA 4X62Q 1PV4A 2F0WA 1VAJA 1XMQQ 3PQIA 4QMGA 3HOUG 2VQEQ 2E76C 2XNAC 4L8JA 2UXBQ 1R9TA 2BCOA 4JBJA 5EBCA 2JA6G 1QVFA 4FS1A 1XMOL 3I72A 4QCLA 2R86A 3JSNA 2ZDQA 3I55A 3Q2OA 5E1FA 3IKJA 3QG1A 3I4NG 1Y8NB 3H0GH 1X3PA 1UEBA 4R4IA 5CV5A 4A3EH 2F0PA 1V1PB 3RZDH 4HYKA 4X3KA 4C3JB 5KFPA 4LF7Q 3S16H 4MV8A 1UNSA 1YZ6A 1PTOF 5KEEA 4N8X1 1NMGA 4KN4C 1IBMQ 2I0QA 2X6GA 4G4KA 4A3DH 4NP5A 2RA4A 3OIPA 3FKIH 1B2TA 4RNNA 3TIIA 2F0QA 3M4OB 1GSOA 3E9IA 4A3FG 1AUXA 4R8IA 1WCMG 5C3WA 3HB9A 2IW3A 5KFRA 2PYKA 4MZ9A 1SBBB 4BXXH 4HIOA 1IBKL 4JI8L 1EWCA 2L0CA 1N34L 4BBRG 3GIJA 1D5MC 1STGA 2TSSA 5BR8Q 2LMCB 4EFBA 3CPWA 2JEAI 1VQEA 3TBIB 3KF8A 3RUZA 3NWSA 3N40P 4B3SH 1GUOA 2W71A 4DR2L 4R4OA 4DV2H 2KBNA 1HZ9A 5C5MA 4JI4H 3T1YQ 3PMFA 1AN7A 5KFYA 3GP7A 4OL7A 1CM9A 1CQJB 2F0HA 1E4FT 4XYMB 3AFPA 1KIXA 1D2BA 1TWFB 4LFAH 4GNXB 1I3QA 2VZAA 4TQUS 2DY7A 3GV5B 3A5UA 3URYA 3UDGA 1W2BA 3JAMc 3KLSX 3W3AA 4F50A 5M3MB 2WB1E 4C3JG 2QK4A 4ZI7F 1KTKA 4F87A 2IP4A 3I4NH 1NSNS 2R85A 2R7MA 1A3TA 4FBUA 2QILA 3CP0A 1PLFA 4K8IA 4R1JA 1N32H 1BNZA 1H9SB 5EGTA 4IRDA 3STBD 1FGUA 3I90A 3KF6A 4KN7C 4ZCKA 4XQNA 3PW7A 1JJGA 3VMMA 5IYDG 4PNYA 3M7GA 2B63A 1J5EL 4JV5L 2G9HD 1SMYD 2B39A 2NVXB 1N36Q 2YL2A 4FBTA 4B9XA 3NTHA 2FPGB 4DV4Q 4K5WA 2B29A 2WV6D 3CAMA 4DV2Q 4UCSA 1B53A 4ETSA 2EY2A 3PR5B 2VQDA 2IX0A 5A2QL 2VUMB 2JA7A 4R8UA 4GKJH 2MO0A 2QDLA 4IUPA 3H3VI 4J9MA 2DNCA 5KRUA 5KFAA 1MSHA 1CKOA 2L11A 2Z4IA 1J9OA 1PYWD 5NUCA 1QCBD 1SE4A 3SGIA 3S2HB 1HNZH 3MFHA 2C5CA 4JI3L 4I7AA 5DQHA 2FHTA 3H94A 1UE6A 4QIWA 1I94L 5M5WB 1E3PA 1K0RA 2WE6A 2UXCQ 2XRSD 3OW7A 1J5EQ 3V2TA 2WINB 4HMIA 1DJRD 5C3EH 3CMEA 3AU7A 1SNMA 4B3SL 1V9PA 4C5BA 3HOXH 2JEBI 1V1PA 2KEEA 5JVH3 1XTCD 4DV0L 2MQHA 2R8JA 4MA0A 2E2HH 3GQBA 4G7OC 2W6PA 1MIUA 4EGVA 3D6CA 3RB6A 2UU9H 2I80A 1PH3A 2UXBH 3X3MA 4MIUA 1F2MA 1PRTF 2Y0SB 5C4XB 4GN5A 5FJ8G 1C3OA 1N8RC 1E7ZA 2XN9C 5CV8A 4DPGA 4LW1A 3J7YW 3S1RB 3ICEA 1JCKB 5KNBA 1G291 4DV7L 2NTTA 3JRXA 3TP6A 5K36H 5CBEE 1TWGB 4BBSH 1RD9D 3D0FA 2K5DA 2IX1A 4R7RA 2EJFC 4X3UA 1MHWC 3A8JE 4OO1H 2FINB 1KXLA 3BYYB 4DFAA 5KFXA 1K83H 4JI6H 4JG2A 3CCJA 5EWEA 3R2TA 2ASLA 2NN6H 3NPPA 3BS1A 2YS7A 4ECZA 2RKSA 4OWTB 1K1QA 2Y0SE 4S3SA 4EEYA 1K73C 2X0SA 4F4ZA 3OWEB 3I56A 1NUCA 2AMCB 4DR5L 1YNND 4NXNL 4A3BG 4A3GH 2UUAL 1HTPA 5LMUH 2WB1A 4NDXA 2W57A 1RDPD 1S4ZA 3SE0A 1K9MC 1XPUA 1HR0W 1ICWA 1UE7A 5L37A 4EG0A 1VQIA 1GUGA 2WDTA 4A3KG 5KFNA 4G7HC 4IFDH 5TSSA 1G51A 3S1NB 3VA5A 2BH8A 4QIWB 1HZBA 2ZDGA 2LKVA 3MXUA 5C0XI 4DF7A 3GIDA 2DZDA 2JA5B 2O2LD 4O3PA 3S1RH 1C48A 3A0JA 1XDNA 4F8MA 5D1PA 4RG1A 1BJTA 5KG1A 1PH5A 3WNZA 3S2DB 1ICFB 3C3LA 1X54A 1Y1VA 5KFWA 5C1PA 2W9AA 4U6PA 3N44B 5J1ZA 1X56A 2I46A 4IALA 4QB4A 5DM73 4K2KA 2R7DA 4DN4M 1XNQQ 1DGSA 2MFIA 2VXWA 4KHPQ 2F0FA 3PN1A 2A69C 5DM63 2OQKA 4XX0B 2K5NA 3NBHB 2B2UA 4YHHL 4A76A 4GLAC 3C46A 4DAMA 3OMGA 5JVLA 3PCOB 3G6EA 1QUQA 2NZHA 1SJED 2C2RA 2YZGA 5M3MG 5J2UF 1YHAA 1RK5A 1WCMA 2R93B 1LLRD 3L3OC 3I3CA 4X66H 3HOUH 3CRKC 5E7NA 3V96A 2UXDL 1KRSA 1RIPA 4R4QA 1KBLA 3DM3A 3A54A 2GN5A 3PO3B 2FPIB 4LF8Q 2F0EA 3EPGA 3K8AA 1OXSC 4OONA 3RNUA 5LXTF 1BQQT 1RTNA 4IUNA 5EKKA 4K0KQ 1S5FD 1LTSD 2R92A 3GTOB 4ALPA 1YNXA 1Q86C 3ORQA 1G91A 4M9UA 2PZUA 3BZCA 2W9CB 3A7LA 3Q0AA 1KDCA 4DV3Q 2EQSA 4MTKA 5KFQA 2BQUA 3C1EA 3GIQA 1YJWA 3PO2G 1S72A 3KLRA 1VQFA 3D31A 4XQJA 3RB4A 4MNOA 3DMUA 2OEOA 2W6QA 4WRDA 4F7XA 5FKAC 1KJJA 1OXUA 3N41B 2J6SA 3W5OA 1PRTB 4G3IA 4YY3Q 1AEXA 5IGBA 3IN5A 1D5ZC 1EUCB 4LMYA 2ZM6L 4WJ3M 2F0MA 4L5SA 5DG7A 2W9CA 5KFDA 2Z1CA 2ZTEA 3PUZA 1EHIA 1EEID 2UXDH 1B4OA 1B7YB 1N48A 4LF9Q 1ZKOA 3NXWA 3GTKH 2FB9A 1NNXA 3KALA 3M4IA 4UHVA 1HXYD 5EJWA 5JJZA 1W93A 2V4QA 2N3SA 1BCPB 3LMLA 2A8VA 1A63A 4J9SA 1LM0A 4QUCA 1PFBA 4DAPA 1IXRA 5KFLA 3GTMH 1PDQA 1II3A 4FVMA 4RAUC 5C0XJ 4H0LC 1B9MA 5CC4A 4X65Q 1WH2A 3PIP3 1SNQA 5FLXL 4XIGS 1RYSA 2P5ZX 2PQAA 5KT3A 1MI2A 5C4XG 3GILA 1TWGH 3K3VA 1IBMH 3NHHA 2N49A 4YCWA 4LF6Q 4A3CH 1Q1EA 1Q90A 3EROA 1I6HH 3RZDB 3H0GG 1HQMC 1Z2OX 3NBHA 5KNDA 3N8DA 3J80c 1PK8A 1BF4A 5IYDH 1QZHA 2ENBA 4RHRA 5D1OB 3Q8PB 4Y52H 5GONF 1QNKA 4C56C 3R23A 3WO0A 4A3DB 2OWOA 2K04A 3UE1A 2D0OA 1L1OA 4LF7H 3F1ZA 2CW8A 5FPOA 2BA1A 1DD2A 3F2CA 4ECTA 4X62H 4IRCA 1PH8A 3UDFA 2KVMA 4DR6H 1WOCA 1J6QA 1PRTC 5C4JH 4AYBB 3ERQA 2LFNA 2LY7A 2N8NA 2AQ1B 2KJXA 5EBDA 3RB3A 3QFFA 2D2CC 4HJ7A 1N32Q 4CJ0B 2E2JH 2PMZA 3MXPA 5CAEB 2NWGA 2N88A 3ZJYC 4UCTA 1UWVA 3HG9A 4QUFA 2MHVA 5ELDA 4J9LA 2UUCH 1EQTA 2NUAB 1HR0L 4KHPH 1DONA 2R6GA 4ZK9B 4X66Q 4JI6Q 2RDIA 2EIFA 2A1AA 2J6UA 5FJ8H 2BQ3A 4RGMA 1N9WA 4DUZL 2YW2A 2ATWA 2E2IB 4F4WA 2PW5A 3T1HH 1RTOA 2PZWA 5IIFA 1IOWA 3ONAB 2V9WA 3P7JA 2NBFA 2AKWB 4X6AH 2F3VA 4A3JH 1TWCB 4FU0A 2HQEA 3CQZB 1JC7A 2B63H 5BR8H 4ODGA 2UUBQ 4B3MQ 2R7ZH 4QWAA 3NGDA 1KLUD 4X62L 4P72A 1Z2PX 1KAWA 1WTRA 5DGAA 4KY6A 2JA8B 2MCTA 1YNJC 2WAQB 4FXGC 4J9RA 4EVOA 4XYLB 3ULPA 3RLOA 2N78A 4A3BH 3UQ8A 4Y7NH 1AE2A 1VQ5A 1KL9A 5D1OA 2NU9B 4OIJA 3R3OA 3GTOA 1BXTA 3B6YA 3C1FA 3KF6B 1IHZA 2VS1A 2I5HA 1KJIA 1WFQA 3OUUA 4DV2L 4POFA 2EPBA 5FK9C 2B3GA 1JWMD 2GPWA 2B2WA 4YHHH 1PTOB 4EYHB 3J80i 2EY1A 2XCLA 1O7LA 2M2LA 3K80C 1PFSA 4YBZB 5DLFA 2NVQB 2C2EA 4ECSA 4KY7A 2K14A 5KFJA 2FFKB 4O0AA 1X3GA 4NKLA 4P74A 1ET9A 2WACA 3M9NB 4DUYH 3H4DA 3BJYA 1STEA 2BR0A 4HR7B 5FLXE 4Y8VB 3A8IE 5JJIA 1X9NA 1S3OA 2FJZA 4UFZA 1HTLD 1PH1A 3K5OA 3FKIA 3GTPA 2WAQG 3CHBD 2CZGA 2EZVA 3P1HA 4HCSA 3PO3H 4EGJA 3TMEA 2R7FA 2KECA 2A73B 3EFXD 1SNCA 3R93A 1DM0B 3HOVG 4OWWB 1DCZA 2QA4A 2PBZA 4YQWA 2SNSA 1STBA 5CV4A 2EXDA 3U9SA 1VQAA 4YAJB 3PF5A 2HHHQ 2SOBA 1EFWA 1FJGQ 1SYFA 5JEAH 5K36G 4ZUJA 4EQNA 4B3RL 2KOLA 1H9SA 5GAEC 4BBSG 1BXRA 4UAIA 2C35B 5F9NA 2YU9A 3GTPH 2ZTDA 4GNXC 2FMMA 1EY0A 4FF3A 5L1KA 1Q3LA 2NN6I 4RCNA 4Q44A 2LS01 4JUZA 4JI0H 2KEDA 4A2AA 5KG4A 4YR3A 1EYDA 3H91A 2RGRA 3KHHA 2AUKA 3N6RA 1WI5A 1FGBD 4JBMA 1VQJA 1YI2A 1CZWA 5CMDA 4HSVA 2PN1A 3I12A 1SCUB 3HKZG 2E5LQ 4ID6A 3VR5A 3I8ZA 1EZ6A 2ZDHA 1TS4A 3CC4A 3DWQA 3H15A 4C3IB 2BE5D 3DEPA 1SE2A 3CXCA 2F4VH 3G6XA 3L4JA 2NVYA 2NTSA 3K5LA 4K5VA 1V4YA 2EY6A 4JI6L 5BPFA 3Q8QB 2R6FA 2VA3A 4H44C 2UUCQ 4RZQA 1MSGA 3HOZB 1QUQB 5IYCG 4IHJF 1X6OA 3SDZA 1TWGA 2K28A 3RR5A 1JLLB 2Z6KA 5H80A 1JDEA 2B8GA 1S40A 2UU9Q 4MTDA 3GTOH 1LT3D 3GTLB 3DWAA 5F2DA 3AEVA 2DIKA 1M6VA 3K7UC 1HFGA 2JK8A 1QE6A 3V4SA 2D5DA 5M5WH 1ZYRC 3MR5A 1SYCA 4PMWA 2V4DA 1HJPA 3VDYA 1KHIA 5LOVF 1G2SA 1GO3E 1SNDA 1EWHA 4C1NI 4EEQA 4WORA 4BA2I 2R7ZA 4OXPA 4KV6A 5KT7A 5I2XA 1SFOH 1C9OA 4LFBL 1N34H 4JI0L 2HJWA 2NB0A 2C2DA 2Q2HA 1Q8IA 3QOJA 1JOQA 4A3MH 1FYCA 1SN8A 2KHIA 2WB1B 1IBLQ 2NVQH 3L4KA 3OSNA 4DR5H 1R4PB 4KKTA 1ZHSA 5C4XH 1ZQ7A 2IY5B 4DV3H 2BH2A 2IPKD 4HTHA 2MJ8A 4CBVA 3VPCA 3PUWA 1EIYB 3WWVA 2DGYA 4GC7A 4R8UB 5ISRA 1X55A 1GJXA 5KG5A 1CKMA 2XVSA 3E6ZX 3OWFA 3HOXB 3PV0A 1VQMA 4LF8H 1I5FA 3RGZA 5LMNH 4HIMA 4OWXB 4C3HB 2OT2A 2VQFH 3CC7A 1F2YA 4RUCA 3D4DA 2F03A 2PPBC 2J6TA 1ONLA 3A55A 3VR4A 1M1KC 1GHKA 5IT9W 1BCPD 3WOFA 1YBYA 3CCLA 3G71A 2R8KA 2CQYA 2HHHH 4GKKQ 1FJGH 2NVTB 1KNAA 3PUVA 1TQOA 4CC6A 5EZYF 1VQHA 1GHJA 2QCPX 1ZYRD 3HZXA 4YR2A 4LFBH 4C2MA 4J1MA 2F3WA 2WFWA 4H13C 3HKZE 3QIAA 1I6HB 2NUCA 4GC6A 1S5CD 1EZ1A 2AGQA 4IUTA 1CKNA 5IY0A 2JA6H 1NJIC 2RSOA 4J9QA 2EYHA 2IBKA 2V4RA 1Q7YC 3TS2A 4LAAA 3D4WA 1QB5D 2OXPA 2YU9B 3T4AC 4LK1C 2UVWA 1Y1VH 5KYLA 5I6WA 4JI5Q 1VCIA 1K8OA 4QJFA 1U4PA 3M9BA 1JIHA 1BBWA 4DV5L 2E2HB 5KG6A 4LF9L 1GM5A 3MEHA 1U4RA 4WBNF 4KD4A 1J5EH 4P71A 1JWSD 5M5YB 1LO5D 5LMNL 2AWNA 1TWFA 3ND8A 3NUCA 1EIHA 4YHHQ 2VR1A 2B2VA 2FK2A 3JAMW 3GTMA 4C3HG 4UCUA 3FP9A 1DV1A 1S68A 4M7EA 3NQTA 4GN4B 1C7YA 5IOCA 1I50B 2TMPA 1PTOD 2VY3A 4OEMB 1B6RA 1ENFA 2VQEH 4LF6L 2W9BA 1TS5A 4JI2H 4L63B 1A3VA 1F9PA 3TEHB 2NZ1D 4AQYH 1F2ZA 2F0GA 1VQOA 2RDJA 4JV2A 4IPCA 4DV5Q 4P2CB 4K6LA 3HKZB 5IT9E 1I4PA 1E24A 4O3SA 3MAQA 3J81j 3CPFA 3LGJA 2NZOA 3V6KA 4DK3C 1EOVA 1XMQH 3M3YB 2L1BA 1HUMA 4HQ6A 4NXNH 3X3NA 1B3AA 2DN8A 1R9TB 2M05A 1JOKA 2ZM6Q 2EDGA 1KC8C 1Y1VG 1B3QA 1BNCA 2R93A 5IGEA 3BA8A 2CH4A 3KUPA 1KQSA 3HFZB 1I3QB 1SJHD 4FF2A 3HOZH 4DR6L 3PW2A 2L55A 5EOYA 3TZUA 3MXGA 2A6EC 4M1UB 3AB9A 1QJOA 2RVLA 2I87A 4GLXA 4B3TQ 2XWJB 4LFCQ 1NR4A 4HSPA 1N34Q 5IP7G 3HOWH 4ED1A 5ELFA 3GTLH 3CU7A 4A4IA 4OO1G 4FDBA 4B3RH 3K59A 3S17H 3T1HQ 1U5KA 3E0JA 1EYGA 3JC66 2QEXA 5CA0F 3I73A 1XXGA 2A6HC 3PSIA 1NAPA 4QIWE 3KBXA 1BUVT 5DG8A 3LP8A 4DL2A 2A68D 1NY4A 2DJGC 5I2YA 1VQPA 3RTXA 3RJ0A 2IA6A 3KBGA 2XSCA 5JEAG 3Q24A 1DYQA 1Z9FA 4DKAC 3EBEA 3PW4A 4XDXA 4C5CA 2UUBL 3QR8A 4PG3A 5C4HA 4N9PA 3Q1KA 3MR2A 2XGQA 3MXNA 2E2JB 4L5TA 3E5NA 3I4MH 1SAPA 4PMBA 1L0YB 4YWKA 3BAAA 3RZOH 1K8AC 4YCVA 2FPPB 3PR4A 2CH4W 1LTTD 2B2TC 1SYEA 3OHXC 4KJOA 3F8NA 3HS0C 3RGXA 3BJUA 4ED7A 2AGPA 4CDFC 1VBHA 4QGUA 2RQXA 5LL6S 3HOXG 2JA6B 4HJ8A 4M8AA 4IOCA 3K5MA 2N55A 1B04A 5T14A 1U0LA 2IT1A 1SR3A 3MR3A 1G8ZD 4TRDA 2QW7A 3NQIA 2NU6B 4GOPB 4O4HF 4ED8A 1B50A 4JI5L 4IRKA 4DR4L 1AZPA 3G8CA 3T1YH 3OPOA 4JI1Q 5C44G 2J9GA 4QWEA 1L1OB 4IR9A 2SEBD 5H1SE 1VQGA 2K50A 5I9OA 1SYBA 2JYOA 3SK5A 4ECUA 3S1MH 1SLJA 1PYSB 4FP5D 1I50A 4L6TB 1VQ9A 5J2TF 4UP8A 3CF5A 1JMCA 1VQKA 5KFFA 4CKCA 3BG3A 2CVRA 3K7AH 4QWCA 2HCCA 2AUJD 4DR3L 2UXCH 1ILPA 2Y0SG 3Q8RB 3DHQA 4A3MG 2Z9HA 4CKEA 4IR1A 1TWAA 4RU9A 4NPSA 3CD6A 1ULZA 2F0OA 1UC9A 1FNVA 3HP3A 3J80W 2QYZA 1UUPA 2VB2X 1K3BC 5D3DA 2FLPA 3N6XA 4NLGA 2E75C 3PVXA 4MTNA 1IW7D 1J8IA 4DV1Q 1A0IA 1QOHA 3N42B 3RV4A 1KLGD 4ZHQF 2R8IA 4ZYSA 2AQ3B 3D4RA 3DXJC 3G7LA 2VQFL 4IFDG 1JORA 5JH7F 2R8HA 2OH2A 1FKAH 1ILQA 2R7ZB 1RKNA 3TP7A 3T1YL 3OYYA 1DIKA 4BY7B 1V51A 5T1IA 4QWBA 5DLQE 2H5XA 3ORRA 5LYJF 4DR2H 1LUZA 1LTBD 1UAPA 1WSCA 3V6HA 4GOPC 1JR0D 3GTPB 3JRWA 3KLWA 1LYLA 1M90C 1WCMH 2RBMA 1M7JA 1L0WA 1O80A 4L5QA 2ASJA 5C44H 3UDXA 3OTOQ 3HXLA 1Y8OB 3V05A 4IZOA 1EU3A 3TQ1A 4A3KB 3T56B 1SMYC 1VQLA 3Q23A 5KT6A 4RKLA 4DV0Q 4J15A 1YEZA 4YWMA 5IWAQ 2I5MX 2IWHA 4DV7Q 1EQVA 4KKSA 1IYVA 1R9TH 2WKDA 1BGWA 3A8KE 1XPOA 2VNUD 2JA7H 5L1LA 3Q6SA 4EBDA 3MHBA 2ALYB 1JJ2A 4I4TF 4L1KA 1AUVA 5KNCA 1STAA 3KFUA 1E2ZA 2YRXA 5M9OA 4JI5H 3NELA 3R5HA 5L9XA 2K52A 4DV4L 4JI2L 4KY5A 4HJ9A 2ZXOA 2H4OA 4TSSA 2RCNA 1WD0A 4DK0A 2IX3A 1CI3M 4LF4H 1SROA 2RF4A 2WAQE 4DR7L 2EYLA 4UCVA 4XXEA 3GO5A 2A69D 3GIKA 3FPUB 1O78A 2CHBD 2Z0SA 3M7NA 4DUZH 1E2VA 3FDSA 2C22A 5JVG3 2EE1A 5IT9c 4MV9A 2Z8LA 3ER0A 2HGSA 4IZ8A 3PUYA 2QDBA 4JI7Q 1MKHA 5LL6X 3K7AB 1YJ9A 5FO8B 4ME5A 2HT1A 1TWHA 4YB8B 5KFUA 3GIIA 1S0OA 2W9BB 4XZ3B 3K0YA 3KYHC 5C44B 1OXVA 2K75A 4L5RC 4HNVA 4RA8A 1C30A 1VF7A 2YV5A 4O2BF 4RB3C 3MWYW 3QZ7A 1K83A 1SNOA 1V1OA 2EYPA 2V59A 4Q8EA 4DAYA 2ZJRA 1PH2A 5C0XH 3GTMB 2HVSA 3JSLA 1Q82C 5KG3A 2WB1G 3ZYYX 2K5VA 4EX5A 4DA2A 1BCPF 1MBYA 2L9HA 1PH9A 4JYAL 2UUCL 1Z47A 4JI8Q 1T36A 2E74C 4LF4Q 1TWCH 5KFVA 3BU2A 5LA6F 1B8AA 5ELBA 1GUWA 3KDFA 3TIGA 3FVQA 4ILWA 5ELNA 3NBIA 4KTAA 3R8BA 2F1MA 1XNQL 2PQAB 3TZDA 4Z9CB 1EFID 4CJ1B 4IO9A 4JI3H 3M4OH 5COYA 2W6MA 4KJNA 3ETJA 5CA1F 1YNNC 2PVPA 1CHPD 1TY0A 1IZ6A 4XTCS 5G3LD 3F2BA 2UUBH 4H02A 3I4NB 3H3VH 5EAYA 3J7ZC 4R4CA 1DOKA 2R7ZG 2K6AA 2CFMA 2EVBA 4CDDC 3Q8SB 3NP8A 4HN7A 3G48A 5D3IB 1KRTA 5IWAH 4KHVA 2NU7B 5C1OA 5HV6A 4X65H 3RN5A 1VMCA 1IOVA 3DWPA 1CA5A 1A9XA 1EY8A 5IP7H 3J81E 1KJQA 2F0NA 1HH2P 2UXBL 3T5JA 5KIXA 1BBXC 1EWIA 5JVDF 4EBCA 4RAYA 4MV6A 4MTEA 1BR9A 4Q0YA 4WJWA 1SEBD 1I6UA 4LUZA 3TN2A 3MWDA 3ITPA 4LFBQ 3IFDA 2W6ZA 3N52A 1T5EA 2A74C 3CCEA 5LMNQ 2ZT9C 1OWTA 5KG7A 1HZCA 1NCVA 3HOUB 4R4TA 4DR4H 3DUZA 2G9DA 4XT1B 4IPGA 1PFNA 4R9WA 5C3XA 4K0KH 1EYAA 2EJGC 2UVVA 2K03A 2JA5A 1Q1BA 5K2MA 1IW7C 1W3SA 1PHJA 2E2IA 1Z7TA 4G57A 5DAUA 5KKNB 3OTOL 4EYIB 4TQSA 4ED3A 5IGGA 2HIXA 2O03A 4A3EB 3CQZH 4IN3A 3W2DA 3QWNA 2R93G 5E3FA 3VYUA 2XRQD 3GV7B 4IUUA 3J7AF 4LFAQ 1X3QA 4A3KH 1SYDA 1A2UA 3PIO3 3H20A 3RUPA 3M9MB 3VR2A 2A19A 2F0VA 4IPDA 1BO0A 2YYZA 1TWAB 1SMXA 1Y14B 1WCMB 1JJCB 1VS0A 3PO3G 2V58A 3I4OA 3G6VA 3RAXA 2KCNA 5KFOA 3SVMA 2MGSA 4O3OA 4DGZA 2UVUA 4F4XA 3GIMA 4NB3A 3BQ1A 2KCTA 3D6WA 2UXDQ 5GADC 4IAJA 4X65L 2JEFA 1XNQH 2E5LL 3CRLC 1H9RA 4DL4A 2NVTH 5DNFA 4JV5H 1LTLA 1LTGD 3LWEA 5KGUA 4QWDA 3MVVA 2R61A 2ZTCA 1YJNA 5FLXc 5A2QE 1DOMA 4CKBA 3KLSA 1E2WA 1ESRA 3S17B 2R92B 3KAJA 2F52A 4P73A 1OTCA 4AH6A 2FP4B 4LF5L 3OMCA 4RB0A 4A3LH 4OX9Q 4ZLTF 1X3EA 1QVCA 3L7ZC 2QGQA 2F0SA 4MHEA 1TS2A 4GKJQ 5IGFA 1Y1WG 1M0WA 1N33L 1HUNA 4BY1H 4ME3A 5GROA 2XCAA 4O4IF 1M0TA 5EWGA 2VW9A 4A3IH 3RBEA 3UE0A 1WJJA 3I4MG 3EVQA 4WD3A 3GTGH 3H0GA 3K6OA 1QWYA 3SR1A 5KG2A 4IURA 4ME6A 3CCMA 4Q45A 2E5LH 5I47A 1XMOH 3MWEA 2GA4B 4HJ5A 5KFTA 2MO1A 2JA7G 1I4XA 2DY8A 3LNNA 1X65A 4JI3Q 2Q2UA 5C4JB 2VUMG 4X64L 2EJMA 3PUXA 1I4HA 3HOVH 4GKJL 3L0OA 1LT5D 4RB2C 3SXHA 5LP6F 5IP9G 4Q5VA 1ASYA 3BQ2A 4I50F 2VPQA 1K8GA 3JAMi 5EPJA 3RF2A 5JAVA 2W7OA 1Y1WA 4B3TL 4JI1L 5KFHA 3S2HH 3MFGA 1TS3A 4LFCL 4DR7H 1TVXA 1SNPA 5CR3A 4V0BA 5JQWA 4LUVA 1UC8A 2B2YC 2PO4A 1P16A 3WDNA 3CCVA 2K5QA 1YHQA 3EJIA 1XTDA 3S1MB 3I7FA 4O3RA 4A3EG 3GQCA 2FKLA 4RH6A 2I5LX 4A3BB 1GXDC 1KAAA 2J4XA 1VQ8A 2XCPA 2R84A 5LMUL 2V5AA 5CV9A 3CW2C 4K14A 2YZNA 1TWAH 3GV8B 3EIVA 5C5LA 3GTKA 4IJHA 1PRTD 4MV1A 1HNWH 2JA7B 2VUMA 3NK9A 4DR3H 3T5KA 4HIKA 3IAYA 3J7AK 1IBKH 4B3MH 3RD4A 2BDNA 2Q8RE 5FD6A 5KFMA 2Z6KC 1BOSA 1LT4D 2KENA 4XYQA 5BN4A 3ETHA 3PGZA 2IJ0A 2W8KA 5FOBB 3RBDA 4RNMA 1F2LA 3GTJA 2CCZA 4ZQ3A 4XQQA 4DAVA 1STHA 4ZAIA 1EY9A 2OCEA 1HR0H 3J80L 1PVOA 3SK4A 3UI2A 5IYBG 4RKBA
chains in the Genus database with same CATH topology
3J81j 3CPFA 1G51A 5GAHC 3LGJA 2NZOA 4LF7L 5M3FG 2BH8A 1EOVA 4DK3C 4JBWA 1BBUA 1HZBA 3E9HA 5C0XI 4C3JH 1E1TA 3E0EA 3K81C 1EUJA 1PH7A 5AJ3L 2ZM6Q 3S1RH 3A0JA 1KC8C 2R92H 1Y1VG 1C0AA 4RG1A 1AE3A 2GVBA 1KQSA 1PH5A 3HFZB 3S24A 4HIDA 1HNWL 1X54A 3ULLA 3HOZH 4DR6L 5IWAL 3FHWA 1WYDA 4LF8L 1X56A 2RHSB 4GLXA 2R7DA 4B3TQ 4BA1I 1DGSA 2MFIA 5LMNW 1XNQQ 2ES2A 4KHPQ 4LFCQ 2OQKA 2Q2IA 1N34Q 5IP7G 2K5NA 3NBHB 4YHHL 4A76A 3HOWH 4QL5A 4GKKL 4GLAC 3GTLH 4KHPL 4A4IA 4DAMA 4FDBA 3TREA 3PCOB 3G6EA 1QUQA 4OO1G 2NZHA 3S17H 1N33Q 4DV3L 3T1HQ 4EQ5A 3KDFB 5M3MG 3W1GA 4DR3Q 1U5KA 1YHAA 1EYGA 3CCQA 1GKHA 3JC66 2QEXA 1Q81C 3PSIA 4QIWE 2YTYA 1X3FA 4KHZA 1XMQL 3HOUH 5E7NA 2UXDL 5JEAJ 1NY4A 1EIFA 5ELOA 1KRSA 1RIPA 4R4QA 2VQEL 1VQPA 4LNQA 4JCVE 5JEAG 3DM3A 1Z9FA 4DR5Q 4DKAC 3EBEA 4UY8C 2GN5A 1N32L 1V43A 2UUBL 1VQNA 3TQYA 4A3JG 1AH9A 4PG3A 1VQBA 4LF8Q 3K8AA 4BY7H 4P75A 1OXSC 4L5TA 2LSSA 2YTXA 4KI0A 4OONA 2RHQB 4DV1L 4YWKA 3RNUA 3I4MH 4K0KQ 3RZOH 4ALPA 1YNXA 1Q86C 1K8AC 1VQ6A 2PMZE 1XMOQ 4YCVA 2PI2E 1FJGL 4X64Q 3BZCA 2IHEA 4GN3B 5M3FH 4DV3Q 3T1HL 3BJUA 2EQSA 1EQQA 2OTLA 2ID0A 2VQFQ 4JI0Q 3CCSA 4QGUA 3FKIG 3HOXG 1YJWA 5JJLA 3PO2G 4UP9A 1S72A 1OXTA 4HJ8A 4IOCA 1VQFA 3D31A 1PA6A 4AYBE 4MNOA 1U0LA 1PYBA 2IT1A 1OXUA 1SR3A 3W5OA 4C3IH 2E8GA 1QZGA 5GQOA 1E22A 2VL6A 4YY3Q 4GOPB 4JI5L 4DR4L 5AJ3Q 2ZM6L 1VQ7A 4WJ3M 4JI1Q 5C44G 4PZ6A 1L1OB 2JE6I 4A75A 4LF5Q 4L5SA 2UUAQ 1B70B 4DUYL 5H1SE 1VQGA 2K50A 1O7IA 2ZTEA 3A74A 3PUZA 3DLLA 4LF4L 3S1MH 1SLJA 1PYSB 1B7YB 5HGQA 1VQ9A 4LF9Q 4UP8A 3GTKH 3CF5A 1JMCA 1VQKA 4C3HH 2F4VQ 1UE5A 4DR2Q 2N3SA 1HNXL 3K7AH 2A8VA 1A63A 1T9HA 1LM0A 4DR3L 4PZ8A 3KF8B 1IXRA 1JT8A 3GTMH 2JJQA 3U58A 5C0XJ 2Y0SG 4X65Q 4A3MG 3U4VA 2XTIA 1UE1A 4XIGS 4NXMQ 2PQAA 4NPSA 5C4XG 3CD6A 1TWGH 4IFDJ 3S1NH 3AFQA 2N49A 4YCWA 1TWFH 4LF6Q 1L2FA 4A3CH 1Q1EA 1KD1C 4DK6C 3M85A 1I6HH 1BKBA 4AQYL 4OO1I 2OQ0A 1L1OC 2NN6G 1YHBA 2NVYH 4MTNA 1NE3A 3H0GG 4DV1Q 4AYBG 2B63G 1A0IA 3J80c 3M4QA 3UDIA 2E2IH 5IYDH 1QZHA 4GOPA 4IFDG 4Y52H 2VQFL 2OWOA 4AIMA 3PIPA 2IHFA 2D0OA 3UE1A 1XNRQ 1L1OA 3T1YL 3OYYA 1Y1WH 4A3GG 3F1ZA 3HKSA 4RMFA 1A62A 5DLQE 1IYJB 2BA1A 2H5XA 1HNXQ 5J3BA 1LUZA 3F2CA 4JV5Q 1Q8KA 4GOPC 1PH8A 4JBKA 2R92G 3UDFA 3KLWA 4A3IG 1LYLA 1WOCA 1J6QA 1WCMH 4UP7A 2ZJPA 5C4JH 1D8LA 1M90C 1L0WA 4L5QA 4C2MH 2YU9H 3J81c 1Q46A 2N8NA 5C44H 4GNXA 2CWAA 5LMUQ 3HOZG 3UDXA 2PNHA 3OTOQ 3J7A5 4HJ7A 1N32Q 4A3DG 2E2JH 1VQLA 4DV0Q 4J15A 1YEZA 4YWMA 3ZJYC 2I5MX 4YY3L 1UWVA 4APVA 5IWAQ 4DV7Q 4A3FH 3HOWG 4JYAQ 1R9TH 3GTQH 4B3RQ 4K0KL 1GVPA 1XPOA 2VNUD 2JA7H 1OXXK 3TS0A 2DUDA 1HR0L 1IBLL 3CMAA 2ALYB 1JJ2A 2R6GA 4BXXG 1GD7A 4X66Q 2V1CC 3KFUA 5BR8L 4JI6Q 2EIFA 2A1AA 3BZKA 2UXCL 5FJ8H 2JQOA 3NELA 2R93H 1XNRL 1JE5A 1N9WA 1CUKA 2JA9A 4DUZL 1I94Q 2K52A 3F8TA 2ATWA 4DR1Q 3M4PA 4DV4L 3GDEA 4JI2L 4HJ9A 1NMFA 2NVXH 2RCNA 2AKWB 4B3SQ 4X6AH 5FLMG 4A3JH 4AQYQ 1SROA 2RF4A 2WAQE 3F2DA 2B63H 4DR7L 1G6PA 3GO5A 2UUBQ 4B3MQ 2MNAA 2R7ZH 2Z0SA 4X62L 4P72A 4QY7A 3M7NA 3S15H 2GVAA 1KAWA 2L15A 3GTJH 5IT9c 3ER0A 3PUYA 1VQCA 3K0XA 1VQDA 4JI7Q 1MKHA 1JB7A 1YJ9A 4DR6Q 1FL0A 2HT1A 3ULPA 3RLOA 3NEMA 2N78A 4A3BH 3IRBA 3J81i 3KYHC 4JI7L 4Y7NH 1AE2A 1OXVA 2K75A 1KL9A 1VQ5A 4L5RC 3HOYG 4BY1G 2KCMA 2YV5A 1MJEA 3KOJA 4JI2Q 2JA8G 3B6YA 5M5XH 4A3LG 4LWCA 3KF6B 2VS1A 2F3IA 1I3QH 2I5HA 1P8LA 1WFQA 4LUOA 4DV2L 4POFA 2ZJRA 1PH2A 2Q2TA 3PO2H 2B3GA 3L2PA 4DR7Q 1TWHH 3OW2A 1NBWA 4DAYB 1Q82C 2WB1G 4WJ4A 2K5VA 2PI2A 4EX5A 4UPAA 2XGTA 3J80i 1D7QA 1PH9A 2OTJA 5HY6A 4JYAL 2LXJA 2UUCL 2HIVA 1Z47A 4YCUA 3K80C 3CCUA 4JI8Q 2FXQA 4LF4Q 1TWCH 1PFSA 1TXYA 3BU2A 1B8AA 4NXNQ 2K14A 3KDFA 4O0AA 5IYBH 5ELNA 1X3GA 2CQOA 1XNQL 4P74A 4JC0A 2PQAB 2WP8J 3ULJA 1PH4A 4IO9A 2YTVA 3M4OH 1N36L 1MJCA 5FLMH 2JA5H 4JI4L 4XTCS 5JJIA 1IZ6A 1X9NA 1S3OA 3F2BA 4JOIA 3G4SA 1NTGA 3I2ZA 4H02A 3U50C 1PH1A 3H3VH 5EAYA 3J7ZC 1IBML 2WAQG 4R4CA 2ASBA 3PO3H 2R7ZG 2CFMA 2R7FA 3G48A 4X62Q 1PV4A 4NXML 3HOVG 4OWWB 1KRTA 1E1OA 2QA4A 5C3EG 1XMQQ 2K5HA 2EXDA 2CKZB 2VQEQ 4HJAA 1ASZA 3HOUG 1VQAA 4JOIC 3RN5A 2UXBQ 4JBJA 3PF5A 2HHHQ 2JA6G 1HNWQ 1QVFA 1XMOL 1EFWA 5IP7H 3KJOA 1FJGQ 1HR0Q 4A3CG 5K36G 1HH2P 3I55A 2UXBL 4B3RL 1EWIA 4OX9L 2HHHL 5GAEC 4BBSG 3I4NG 3H0GH 4R4IA 1UEBA 4A3EH 1XJVA 2C35B 4LUZA 4DUZQ 3RZDH 3GTPH 2ZTDA 3U4ZA 4GNXC 4LFBQ 2NN6I 1YIJA 1CSPA 3CCEA 5LMNQ 4LF7Q 2BA0A 3S16H 1HZCA 4TVAB 5C0XG 4R4TA 2I0QA 1YZ6A 1IBMQ 1NMGA 1WI5A 3NENA 1EQRA 4IPGA 4JI4Q 4JBMA 1VQJA 1YI2A 4A3DH 5JJKA 3FKIH 3MEFA 3S2DH 4YWLA 2AWOA 4PZ7A 3E9IA 4A3FG 3HKZG 1Q1BA 2E5LQ 4BY7G 2LXKA 1WCMG 5GAGC 1W3SA 1PHJA 4MZ9A 3CC4A 3H15A 3OTOL 5IE8A 3CXCA 4BXXH 2HIXA 4HIOA 4JI8L 1IBKL 1N34L 4BBRG 5M5YH 5BR8Q 4JI6L 3CQZH 2R93G 3AYHB 3CPWA 2JEAI 2UUCQ 1VQEA 4GLVB 4LFAQ 1QUQB 5IYCG 4A3KH 2JA5G 1X6OA 2A19A 4DR2L 4R4OA 4IPHA 4IPDA 3RR5A 2Z6KA 2KBNA 1HZ9A 1SE8A 2YYZA 3T1YQ 1SMXA 1Y14B 1S40A 1QVGA 1JJCB 1VS0A 4DR1L 2UU9Q 3PO3G 3GTOH 3I4OA 3AFPA 1KIXA 1HNZQ 4NB3A 4GNXB 3AEVA 2KCTA 2VZAA 4TQUS 2UXDQ 5GADC 4X65L 3K7UC 3A5UA 2E5LL 2JK8A 3UDGA 5M5WH 2NVTH 1W2BA 3JAMc 1CKNB 1LTLA 4PMWA 2WB1E 1HJPA 3VDYA 2ZTCA 1YJNA 5FLXc 1KHIA 3I4NH 1GO3E 4BA2I 4OXPA 3CP0A 2F52A 1K3RA 4P73A 4R1JA 4AH6A 1C9OA 1SFOH 1OTCA 4LFBL 3STBD 2ZJQA 4JI0L 4LF5L 1FGUA 1A8VA 3KF6A 2CWPA 3M3YH 4A93H 2Q2HA 1JJGA 1SRUA 4X66L 4A3LH 4OX9Q 4A3MH 4DNIA 5IYDG 1SN8A 2KHIA 1IBLQ 4IOAA 3PIOA 2NVQH 1X3EA 1J5EL 1QVCA 4JV5L 3L7ZC 2QGQA 5C4XH 4DV6L 1N36Q 4GKJQ 3PF4A 2IY5B 1Y1WG 4DV4Q 2BH2A 2B29A 3CAMA 4BY1H 4DV2Q 1N33L 4ME3A 1HNZL 5GROA 5M3MH 1YVCA 3PUWA 1EIYB 3WWVA 2DGYA 4KLKA 2VW9A 1IL2A 3A5ZB 4A3IH 1X55A 1CKMA 4DR4Q 2IX0A 3UE0A 1WJJA 3PV0A 3I4MG 1VQMA 2MO0A 3H3VI 3GTGH 1I5FA 4HIMA 4OWXB 3CC7A 1CKOA 3CCMA 3SGIA 1M1KC 2KHJA 4JI3L 3CCLA 1YBYA 4HJ5A 2D0PA 2MO1A 3Q8DA 3G71A 1VQ4A 1UE6A 2JA7G 4GKKQ 1I94L 3MXNB 1X65A 2UU9L 3CC2A 1Q12A 3PUVA 2Q2UA 4JI3Q 1E3PA 1K0RA 2VUMG 4X64L 2UXCQ 1XPRA 3W1BA 1J5EQ 1VQHA 4O2DA 3PUXA 4DV6Q 3HOVH 4GKJL 3L0OA 2WFWA 3CMEA 3HKZE 5C3EH 4B3SL 1V9PA 5IP9G 1ASYA 3HOXH 2JEBI 1CKNA 5IY0A 1CSQA 1NJIC 2JA6H 1K8GA 4DV0L 2MQHA 4GS3A 3JAMi 2E2HH 4DUYQ 1MIUA 3RLFA 1Q7YC 3TS2A 1RL2A 3TRZA 4B3TL 1PH6A 1PH3A 3AQQA 4JI1L 3S2HH 4LFCL 1H95A 4A93G 1Y1VH 4JI5Q 1VCIA 4GN5A 5FJ8G 1N8RC 1E7ZA 4QJFA 2F4VL 3M9BA 4LW1A 4DPGA 3ICEA 1BBWA 4LUVA 4DV5L 1G291 4DV7L 4LF9L 4LFAL 1GM5A 1P16A 3CCVA 3GD7A 4P71A 1YHQA 1XTDA 4BBSH 1HZAA 5LMNL 3I7FA 1FVIA 2AWNA 3D0FA 3STBC 4YHHQ 4A3EG 2IX1A 2I5LX 1VQ8A 5LMUL 3FP9A 1KXLA 1YITA 3HOYH 3CW2C 4GN4B 1C7YA 1TWAH 1K83H 3EIVA 4JG2A 3CCJA 4IJHA 2VY3A 4OWTB 4HIKA 2Y0SE 4IJLA 4LF6L 1K73C 3KJPA 2Z6KC 2D62A 2AHOB 1IBKQ 2KENA 5IYCH 3RN2A 3EN2A 3I56A 4QQBX 3PGZA 4IFDI 3TEHB 2AMCB 4DR5L 4NXNL 4A3BG 1I50H 3ERSX 1VQOA 2UUAL 4B3ML 3S14H 4A3GH 3CCRA 2CCZA 4IPCA 2VUMH 1BVSA 1K9MC 1XPUA 4BBRH 1HR0W 1UE7A 4DV5Q 2JA8H 1VQIA 2OCEA 3RLNA 4POGA 2K4KA 1PVOA 1E24A 1V1QA 2HQLA 4A3KG 5IYBG 3S1QH 5IP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 j;  3CPF A;  1G51 A;  5GAH C;  3LGJ A;  2NZO A;  4LF7 L;  5M3F G;  2BH8 A;  1EOV A;  4DK3 C;  4JBW A;  1BBU A;  1HZB A;  3E9H A;  5C0X I;  4C3J H;  1E1T A;  3E0E A;  3K81 C;  1EUJ A;  1PH7 A;  5AJ3 L;  2ZM6 Q;  3S1R H;  3A0J A;  1KC8 C;  2R92 H;  1Y1V G;  1C0A A;  4RG1 A;  1AE3 A;  2GVB A;  1KQS A;  1PH5 A;  3HFZ B;  3S24 A;  4HID A;  1HNW L;  1X54 A;  3ULL A;  3HOZ H;  4DR6 L;  5IWA L;  3FHW A;  1WYD A;  4LF8 L;  1X56 A;  2RHS B;  4GLX A;  2R7D A;  4B3T Q;  4BA1 I;  1DGS A;  2MFI A;  5LMN W;  1XNQ Q;  2ES2 A;  4KHP Q;  4LFC Q;  2OQK A;  2Q2I A;  1N34 Q;  5IP7 G;  2K5N A;  3NBH B;  4YHH L;  4A76 A;  3HOW H;  4QL5 A;  4GKK L;  4GLA C;  3GTL H;  4KHP L;  4A4I A;  4DAM A;  4FDB A;  3TRE A;  3PCO B;  3G6E A;  1QUQ A;  4OO1 G;  2NZH A;  3S17 H;  1N33 Q;  4DV3 L;  3T1H Q;  4EQ5 A;  3KDF B;  5M3M G;  3W1G A;  4DR3 Q;  1U5K A;  1YHA A;  1EYG A;  3CCQ A;  1GKH A;  3JC6 6;  2QEX A;  1Q81 C;  3PSI A;  4QIW E;  2YTY A;  1X3F A;  4KHZ A;  1XMQ L;  3HOU H;  5E7N A;  2UXD L;  5JEA J;  1NY4 A;  1EIF A;  5ELO A;  1KRS A;  1RIP A;  4R4Q A;  2VQE L;  1VQP A;  4LNQ A;  4JCV E;  5JEA G;  3DM3 A;  1Z9F A;  4DR5 Q;  4DKA C;  3EBE A;  4UY8 C;  2GN5 A;  1N32 L;  1V43 A;  2UUB L;  1VQN A;  3TQY A;  4A3J G;  1AH9 A;  4PG3 A;  1VQB A;  4LF8 Q;  3K8A A;  4BY7 H;  4P75 A;  1OXS C;  4L5T A;  2LSS A;  2YTX A;  4KI0 A;  4OON A;  2RHQ B;  4DV1 L;  4YWK A;  3RNU A;  3I4M H;  4K0K Q;  3RZO H;  4ALP A;  1YNX A;  1Q86 C;  1K8A C;  1VQ6 A;  2PMZ E;  1XMO Q;  4YCV A;  2PI2 E;  1FJG L;  4X64 Q;  3BZC A;  2IHE A;  4GN3 B;  5M3F H;  4DV3 Q;  3T1H L;  3BJU A;  2EQS A;  1EQQ A;  2OTL A;  2ID0 A;  2VQF Q;  4JI0 Q;  3CCS A;  4QGU A;  3FKI G;  3HOX G;  1YJW A;  5JJL A;  3PO2 G;  4UP9 A;  1S72 A;  1OXT A;  4HJ8 A;  4IOC A;  1VQF A;  3D31 A;  1PA6 A;  4AYB E;  4MNO A;  1U0L A;  1PYB A;  2IT1 A;  1OXU A;  1SR3 A;  3W5O A;  4C3I H;  2E8G A;  1QZG A;  5GQO A;  1E22 A;  2VL6 A;  4YY3 Q;  4GOP B;  4JI5 L;  4DR4 L;  5AJ3 Q;  2ZM6 L;  1VQ7 A;  4WJ3 M;  4JI1 Q;  5C44 G;  4PZ6 A;  1L1O B;  2JE6 I;  4A75 A;  4LF5 Q;  4L5S A;  2UUA Q;  1B70 B;  4DUY L;  5H1S E;  1VQG A;  2K50 A;  1O7I A;  2ZTE A;  3A74 A;  3PUZ A;  3DLL A;  4LF4 L;  3S1M H;  1SLJ A;  1PYS B;  1B7Y B;  5HGQ A;  1VQ9 A;  4LF9 Q;  4UP8 A;  3GTK H;  3CF5 A;  1JMC A;  1VQK A;  4C3H H;  2F4V Q;  1UE5 A;  4DR2 Q;  2N3S A;  1HNX L;  3K7A H;  2A8V A;  1A63 A;  1T9H A;  1LM0 A;  4DR3 L;  4PZ8 A;  3KF8 B;  1IXR A;  1JT8 A;  3GTM H;  2JJQ A;  3U58 A;  5C0X J;  2Y0S G;  4X65 Q;  4A3M G;  3U4V A;  2XTI A;  1UE1 A;  4XIG S;  4NXM Q;  2PQA A;  4NPS A;  5C4X G;  3CD6 A;  1TWG H;  4IFD J;  3S1N H;  3AFQ A;  2N49 A;  4YCW A;  1TWF H;  4LF6 Q;  1L2F A;  4A3C H;  1Q1E A;  1KD1 C;  4DK6 C;  3M85 A;  1I6H H;  1BKB A;  4AQY L;  4OO1 I;  2OQ0 A;  1L1O C;  2NN6 G;  1YHB A;  2NVY H;  4MTN A;  1NE3 A;  3H0G G;  4DV1 Q;  4AYB G;  2B63 G;  1A0I A;  3J80 c;  3M4Q A;  3UDI A;  2E2I H;  5IYD H;  1QZH A;  4GOP A;  4IFD G;  4Y52 H;  2VQF L;  2OWO A;  4AIM A;  3PIP A;  2IHF A;  2D0O A;  3UE1 A;  1XNR Q;  1L1O A;  3T1Y L;  3OYY A;  1Y1W H;  4A3G G;  3F1Z A;  3HKS A;  4RMF A;  1A62 A;  5DLQ E;  1IYJ B;  2BA1 A;  2H5X A;  1HNX Q;  5J3B A;  1LUZ A;  3F2C A;  4JV5 Q;  1Q8K A;  4GOP C;  1PH8 A;  4JBK A;  2R92 G;  3UDF A;  3KLW A;  4A3I G;  1LYL A;  1WOC A;  1J6Q A;  1WCM H;  4UP7 A;  2ZJP A;  5C4J H;  1D8L A;  1M90 C;  1L0W A;  4L5Q A;  4C2M H;  2YU9 H;  3J81 c;  1Q46 A;  2N8N A;  5C44 H;  4GNX A;  2CWA A;  5LMU Q;  3HOZ G;  3UDX A;  2PNH A;  3OTO Q;  3J7A 5;  4HJ7 A;  1N32 Q;  4A3D G;  2E2J H;  1VQL A;  4DV0 Q;  4J15 A;  1YEZ A;  4YWM A;  3ZJY C;  2I5M X;  4YY3 L;  1UWV A;  4APV A;  5IWA Q;  4DV7 Q;  4A3F H;  3HOW G;  4JYA Q;  1R9T H;  3GTQ H;  4B3R Q;  4K0K L;  1GVP A;  1XPO A;  2VNU D;  2JA7 H;  1OXX K;  3TS0 A;  2DUD A;  1HR0 L;  1IBL L;  3CMA A;  2ALY B;  1JJ2 A;  2R6G A;  4BXX G;  1GD7 A;  4X66 Q;  2V1C C;  3KFU A;  5BR8 L;  4JI6 Q;  2EIF A;  2A1A A;  3BZK A;  2UXC L;  5FJ8 H;  2JQO A;  3NEL A;  2R93 H;  1XNR L;  1JE5 A;  1N9W A;  1CUK A;  2JA9 A;  4DUZ L;  1I94 Q;  2K52 A;  3F8T A;  2ATW A;  4DR1 Q;  3M4P A;  4DV4 L;  3GDE A;  4JI2 L;  4HJ9 A;  1NMF A;  2NVX H;  2RCN A;  2AKW B;  4B3S Q;  4X6A H;  5FLM G;  4A3J H;  4AQY Q;  1SRO A;  2RF4 A;  2WAQ E;  3F2D A;  2B63 H;  4DR7 L;  1G6P A;  3GO5 A;  2UUB Q;  4B3M Q;  2MNA A;  2R7Z H;  2Z0S A;  4X62 L;  4P72 A;  4QY7 A;  3M7N A;  3S15 H;  2GVA A;  1KAW A;  2L15 A;  3GTJ H;  5IT9 c;  3ER0 A;  3PUY A;  1VQC A;  3K0X A;  1VQD A;  4JI7 Q;  1MKH A;  1JB7 A;  1YJ9 A;  4DR6 Q;  1FL0 A;  2HT1 A;  3ULP A;  3RLO A;  3NEM A;  2N78 A;  4A3B H;  3IRB A;  3J81 i;  3KYH C;  4JI7 L;  4Y7N H;  1AE2 A;  1OXV A;  2K75 A;  1KL9 A;  1VQ5 A;  4L5R C;  3HOY G;  4BY1 G;  2KCM A;  2YV5 A;  1MJE A;  3KOJ A;  4JI2 Q;  2JA8 G;  3B6Y A;  5M5X H;  4A3L G;  4LWC A;  3KF6 B;  2VS1 A;  2F3I A;  1I3Q H;  2I5H A;  1P8L A;  1WFQ A;  4LUO A;  4DV2 L;  4POF A;  2ZJR A;  1PH2 A;  2Q2T A;  3PO2 H;  2B3G A;  3L2P A;  4DR7 Q;  1TWH H;  3OW2 A;  1NBW A;  4DAY B;  1Q82 C;  2WB1 G;  4WJ4 A;  2K5V A;  2PI2 A;  4EX5 A;  4UPA A;  2XGT A;  3J80 i;  1D7Q A;  1PH9 A;  2OTJ A;  5HY6 A;  4JYA L;  2LXJ A;  2UUC L;  2HIV A;  1Z47 A;  4YCU A;  3K80 C;  3CCU A;  4JI8 Q;  2FXQ A;  4LF4 Q;  1TWC H;  1PFS A;  1TXY A;  3BU2 A;  1B8A A;  4NXN Q;  2K14 A;  3KDF A;  4O0A A;  5IYB H;  5ELN A;  1X3G A;  2CQO A;  1XNQ L;  4P74 A;  4JC0 A;  2PQA B;  2WP8 J;  3ULJ A;  1PH4 A;  4IO9 A;  2YTV A;  3M4O H;  1N36 L;  1MJC A;  5FLM H;  2JA5 H;  4JI4 L;  4XTC S;  5JJI A;  1IZ6 A;  1X9N A;  1S3O A;  3F2B A;  4JOI A;  3G4S A;  1NTG A;  3I2Z A;  4H02 A;  3U50 C;  1PH1 A;  3H3V H;  5EAY A;  3J7Z C;  1IBM L;  2WAQ G;  4R4C A;  2ASB A;  3PO3 H;  2R7Z G;  2CFM A;  2R7F A;  3G48 A;  4X62 Q;  1PV4 A;  4NXM L;  3HOV G;  4OWW B;  1KRT A;  1E1O A;  2QA4 A;  5C3E G;  1XMQ Q;  2K5H A;  2EXD A;  2CKZ B;  2VQE Q;  4HJA A;  1ASZ A;  3HOU G;  1VQA A;  4JOI C;  3RN5 A;  2UXB Q;  4JBJ A;  3PF5 A;  2HHH Q;  2JA6 G;  1HNW Q;  1QVF A;  1XMO L;  1EFW A;  5IP7 H;  3KJO A;  1FJG Q;  1HR0 Q;  4A3C G;  5K36 G;  1HH2 P;  3I55 A;  2UXB L;  4B3R L;  1EWI A;  4OX9 L;  2HHH L;  5GAE C;  4BBS G;  3I4N G;  3H0G H;  4R4I A;  1UEB A;  4A3E H;  1XJV A;  2C35 B;  4LUZ A;  4DUZ Q;  3RZD H;  3GTP H;  2ZTD A;  3U4Z A;  4GNX C;  4LFB Q;  2NN6 I;  1YIJ A;  1CSP A;  3CCE A;  5LMN Q;  4LF7 Q;  2BA0 A;  3S16 H;  1HZC A;  4TVA B;  5C0X G;  4R4T A;  2I0Q A;  1YZ6 A;  1IBM Q;  1NMG A;  1WI5 A;  3NEN A;  1EQR A;  4IPG A;  4JI4 Q;  4JBM A;  1VQJ A;  1YI2 A;  4A3D H;  5JJK A;  3FKI H;  3MEF A;  3S2D H;  4YWL A;  2AWO A;  4PZ7 A;  3E9I A;  4A3F G;  3HKZ G;  1Q1B A;  2E5L Q;  4BY7 G;  2LXK A;  1WCM G;  5GAG C;  1W3S A;  1PHJ A;  4MZ9 A;  3CC4 A;  3H15 A;  3OTO L;  5IE8 A;  3CXC A;  4BXX H;  2HIX A;  4HIO A;  4JI8 L;  1IBK L;  1N34 L;  4BBR G;  5M5Y H;  5BR8 Q;  4JI6 L;  3CQZ H;  2R93 G;  3AYH B;  3CPW A;  2JEA I;  2UUC Q;  1VQE A;  4GLV B;  4LFA Q;  1QUQ B;  5IYC G;  4A3K H;  2JA5 G;  1X6O A;  2A19 A;  4DR2 L;  4R4O A;  4IPH A;  4IPD A;  3RR5 A;  2Z6K A;  2KBN A;  1HZ9 A;  1SE8 A;  2YYZ A;  3T1Y Q;  1SMX A;  1Y14 B;  1S40 A;  1QVG A;  1JJC B;  1VS0 A;  4DR1 L;  2UU9 Q;  3PO3 G;  3GTO H;  3I4O A;  3AFP A;  1KIX A;  1HNZ Q;  4NB3 A;  4GNX B;  3AEV A;  2KCT A;  2VZA A;  4TQU S;  2UXD Q;  5GAD C;  4X65 L;  3K7U C;  3A5U A;  2E5L L;  2JK8 A;  3UDG A;  5M5W H;  2NVT H;  1W2B A;  3JAM c;  1CKN B;  1LTL A;  4PMW A;  2WB1 E;  1HJP A;  3VDY A;  2ZTC A;  1YJN A;  5FLX c;  1KHI A;  3I4N H;  1GO3 E;  4BA2 I;  4OXP A;  3CP0 A;  2F52 A;  1K3R A;  4P73 A;  4R1J A;  4AH6 A;  1C9O A;  1SFO H;  1OTC A;  4LFB L;  3STB D;  2ZJQ A;  4JI0 L;  4LF5 L;  1FGU A;  1A8V A;  3KF6 A;  2CWP A;  3M3Y H;  4A93 H;  2Q2H A;  1JJG A;  1SRU A;  4X66 L;  4A3L H;  4OX9 Q;  4A3M H;  4DNI A;  5IYD G;  1SN8 A;  2KHI A;  1IBL Q;  4IOA A;  3PIO A;  2NVQ H;  1X3E A;  1J5E L;  1QVC A;  4JV5 L;  3L7Z C;  2QGQ A;  5C4X H;  4DV6 L;  1N36 Q;  4GKJ Q;  3PF4 A;  2IY5 B;  1Y1W G;  4DV4 Q;  2BH2 A;  2B29 A;  3CAM A;  4BY1 H;  4DV2 Q;  1N33 L;  4ME3 A;  1HNZ L;  5GRO A;  5M3M H;  1YVC A;  3PUW A;  1EIY B;  3WWV A;  2DGY A;  4KLK A;  2VW9 A;  1IL2 A;  3A5Z B;  4A3I H;  1X55 A;  1CKM A;  4DR4 Q;  2IX0 A;  3UE0 A;  1WJJ A;  3PV0 A;  3I4M G;  1VQM A;  2MO0 A;  3H3V I;  3GTG H;  1I5F A;  4HIM A;  4OWX B;  3CC7 A;  1CKO A;  3CCM A;  3SGI A;  1M1K C;  2KHJ A;  4JI3 L;  3CCL A;  1YBY A;  4HJ5 A;  2D0P A;  2MO1 A;  3Q8D A;  3G71 A;  1VQ4 A;  1UE6 A;  2JA7 G;  4GKK Q;  1I94 L;  3MXN B;  1X65 A;  2UU9 L;  3CC2 A;  1Q12 A;  3PUV A;  2Q2U A;  4JI3 Q;  1E3P A;  1K0R A;  2VUM G;  4X64 L;  2UXC Q;  1XPR A;  3W1B A;  1J5E Q;  1VQH A;  4O2D A;  3PUX A;  4DV6 Q;  3HOV H;  4GKJ L;  3L0O A;  2WFW A;  3CME A;  3HKZ E;  5C3E H;  4B3S L;  1V9P A;  5IP9 G;  1ASY A;  3HOX H;  2JEB I;  1CKN A;  5IY0 A;  1CSQ A;  1NJI C;  2JA6 H;  1K8G A;  4DV0 L;  2MQH A;  4GS3 A;  3JAM i;  2E2H H;  4DUY Q;  1MIU A;  3RLF A;  1Q7Y C;  3TS2 A;  1RL2 A;  3TRZ A;  4B3T L;  1PH6 A;  1PH3 A;  3AQQ A;  4JI1 L;  3S2H H;  4LFC L;  1H95 A;  4A93 G;  1Y1V H;  4JI5 Q;  1VCI A;  4GN5 A;  5FJ8 G;  1N8R C;  1E7Z A;  4QJF A;  2F4V L;  3M9B A;  4LW1 A;  4DPG A;  3ICE A;  1BBW A;  4LUV A;  4DV5 L;  1G29 1;  4DV7 L;  4LF9 L;  4LFA L;  1GM5 A;  1P16 A;  3CCV A;  3GD7 A;  4P71 A;  1YHQ A;  1XTD A;  4BBS H;  1HZA A;  5LMN L;  3I7F A;  1FVI A;  2AWN A;  3D0F A;  3STB C;  4YHH Q;  4A3E G;  2IX1 A;  2I5L X;  1VQ8 A;  5LMU L;  3FP9 A;  1KXL A;  1YIT A;  3HOY H;  3CW2 C;  4GN4 B;  1C7Y A;  1TWA H;  1K83 H;  3EIV A;  4JG2 A;  3CCJ A;  4IJH A;  2VY3 A;  4OWT B;  4HIK A;  2Y0S E;  4IJL A;  4LF6 L;  1K73 C;  3KJP A;  2Z6K C;  2D62 A;  2AHO B;  1IBK Q;  2KEN A;  5IYC H;  3RN2 A;  3EN2 A;  3I56 A;  4QQB X;  3PGZ A;  4IFD I;  3TEH B;  2AMC B;  4DR5 L;  4NXN L;  4A3B G;  1I50 H;  3ERS X;  1VQO A;  2UUA L;  4B3M L;  3S14 H;  4A3G H;  3CCR A;  2CCZ A;  4IPC A;  2VUM H;  1BVS A;  1K9M C;  1XPU A;  4BBR H;  1HR0 W;  1UE7 A;  4DV5 Q;  2JA8 H;  1VQI A;  2OCE A;  3RLN A;  4POG A;  2K4K A;  1PVO A;  1E24 A;  1V1Q A;  2HQL A;  4A3K G;  5IYB G;  3S1Q H;  5IP9 H; 
#chains in the Genus database with same CATH topology
 3KAK A;  2HVR A;  2D9U A;  1WTQ A;  4LF7 L;  4FF4 A;  2H1E A;  1T5X D;  3H40 A;  4QW9 A;  4C3J H;  3OIQ A;  3GTQ B;  1PH7 A;  4LJZ C;  3MTS A;  4B3T H;  4CDC C;  2R92 H;  1XYI A;  3T53 B;  2OLS A;  3F2U A;  1C0A A;  1AE3 A;  2GVB A;  1CHQ D;  4E6I A;  3ULL A;  5IWA L;  1L0X B;  1WYD A;  1HCZ A;  5I9P A;  2VOB A;  3QB3 A;  5DG9 A;  2RHS B;  5LMN W;  3E5S A;  1EYC A;  4O4L F;  4ED0 A;  1S10 A;  1KDA A;  1JDB B;  4KHP L;  1IYU A;  1TY2 A;  2F4I A;  5E4W C;  1KAB A;  1HFN A;  1N33 Q;  1ENC A;  1WD1 A;  5CB4 F;  1A6X A;  1GKH A;  5BN3 A;  3OTO H;  1PZK D;  1K0S A;  1AW7 A;  1CQF A;  2WAQ A;  4XT3 B;  1TT2 A;  3SHL A;  2YTY A;  4KHZ A;  1XMQ L;  1I4Q A;  1ML0 D;  2VQE L;  4LNQ A;  1UNN C;  5I6Y A;  1U4M A;  2GPS A;  4JCV E;  1EZ8 A;  3K57 A;  4OGQ C;  4UY8 C;  1N32 L;  1MZB A;  3TDQ A;  1RJQ A;  4TV9 F;  1T94 A;  2F0L A;  5KG0 A;  4BY7 H;  1K83 B;  2DPI A;  5FO9 B;  4P75 A;  4IFD J;  2LSS A;  5FLX W;  1KJ8 A;  2RCF A;  3BQ0 A;  4JV1 A;  3T5L A;  1VQ6 A;  1SE3 A;  2PMZ E;  1XMO Q;  4IWY A;  3RB0 A;  4X64 Q;  2C28 A;  3KTM A;  2IHE A;  4GN3 B;  4XYO A;  5AFW A;  2MPM A;  1L2Z A;  3T1H L;  2OTL A;  4O3Q A;  2ID0 A;  1D6E C;  1CZG A;  5CYU A;  4CHT B;  2VQF Q;  4J6H A;  3CCS A;  4JI0 Q;  2E2D C;  3I4M B;  5JJL A;  1EIG A;  4YJ2 F;  5DQG A;  4UP9 A;  1DOL A;  1E4E B;  3CKI B;  4X3T A;  1PYB A;  1DV2 A;  2F0J A;  3VPD A;  4C3I H;  1GSA A;  1DZ1 A;  2E8G A;  1EL0 A;  1QZG A;  1HHV A;  5GQO A;  2VL6 A;  5FPR A;  2HUG A;  3G6Y A;  5AJ3 Q;  1VQ7 A;  3LWB A;  4PZ6 A;  2JEG A;  1OO9 B;  3K58 A;  2UUA Q;  2BOS A;  3KHR A;  3DLL A;  2R7N A;  4A3M B;  4LF4 L;  3A74 A;  1WTW A;  2AQ4 A;  5HGQ A;  3RIZ A;  4DXF A;  1PZJ D;  4RGT A;  5JPM C;  5DGB A;  1UE5 A;  4HNU A;  4DLK A;  3FMC A;  4JYA H;  4LF5 H;  3I4L A;  2JJQ A;  1XNR H;  4U68 A;  2XTI A;  2ZM6 H;  1BCP C;  4NXM Q;  1LTA D;  3GTG B;  5HBR B;  4CC5 A;  2IMW P;  2F0D A;  1HPC A;  2R82 A;  3AFQ A;  5KFE A;  2I8C A;  3U9O A;  4KMU C;  4KD3 A;  1EYZ A;  3PW5 A;  3M85 A;  3V6J A;  1L1O C;  3A7A B;  1NE3 A;  2K7V A;  3GV3 A;  5EPK A;  5IYZ F;  1E0B A;  1ZEQ X;  4AYB G;  4RB1 A;  3PW0 A;  1JIC A;  4I55 F;  3M4Q A;  2E2I H;  1ZHQ A;  1G2T A;  5FD5 A;  2E2H A;  2KUM A;  4GOP A;  3E3X A;  1CE8 A;  4I7Z C;  2BDO A;  1KNE A;  2PCF B;  2IHF A;  4TKO B;  1Y1W H;  1SYX B;  1A62 A;  3O13 A;  3FDT A;  3J81 W;  2EYJ A;  2JA6 A;  1PTO H;  1XX8 A;  1Q8K A;  4JBK A;  5JPN C;  4A3I G;  4UP7 A;  2ZJP A;  1D8L A;  5D65 A;  3J81 c;  1Q46 A;  4GNX A;  2CWA A;  4DNT B;  4FYD A;  2HVQ A;  4A3D G;  2B2U C;  4LSX A;  2ZJT A;  1M8A A;  1TAE A;  1ET6 A;  1EU4 A;  1MGS A;  4A3F H;  3GTQ H;  4K0K L;  1CT1 D;  3QOL A;  1OXX K;  4V19 0;  2K33 A;  3BVM A;  4BXX G;  1GD7 A;  3K5N A;  1Y1V B;  2R87 A;  4YIJ A;  2UXC L;  2JQO A;  4N8F A;  3GTG A;  4ECX A;  1SDF A;  1KDB A;  2K5W A;  2XIG A;  2YYA A;  3H4B A;  1JE5 A;  3OSP A;  2JA9 A;  5D14 A;  5KFI A;  2Z6B A;  3GDE A;  4ECY A;  1CK1 A;  2RGV A;  2NYZ D;  2NVX H;  1ESF A;  2L4N A;  5FLM G;  4AQY Q;  2NU8 B;  4ZKB B;  3K3P A;  3F2D A;  1G6P A;  5I4D A;  2MNA A;  3DEO A;  1E4G T;  4G7Z C;  2GVA A;  4IUV A;  4DL3 A;  2RDG A;  2J7Z A;  2K1B A;  2GLT A;  3D3R A;  2DWC A;  4ZUI A;  1VQC A;  1VQD A;  4HAE A;  1B6S A;  1SFO A;  1JB7 A;  3G6J B;  2L5T A;  4DR6 Q;  1FL0 A;  1GUT A;  5CV7 A;  5IGD A;  1PXU A;  4TV8 F;  4YAK B;  2MP1 A;  3BYT B;  1GOZ A;  2KCM A;  3A56 A;  1MJE A;  3KOJ A;  4JI2 Q;  3MJF A;  1U9R A;  1GYF A;  2DNE A;  3IL8 A;  1P8L A;  4ECR A;  2HCI A;  4DU9 A;  3L2P A;  4MV7 A;  4DR7 Q;  1TWH H;  4DAY B;  3HOY B;  1O75 A;  1JQY D;  4ULL A;  4WJ4 A;  2RSN A;  2PI2 A;  4UPA A;  1S97 A;  5KYI A;  3BG5 A;  1HNX H;  1LV9 A;  2HIV A;  1JKJ B;  1N33 H;  4YCU A;  2ASD A;  2FXQ A;  4RFB A;  4A2B A;  4YR0 A;  3S9W A;  3M9O B;  3EQL C;  3R2I A;  3CQZ A;  3RAQ A;  2BE5 C;  3HOV B;  4LSA A;  5IYB H;  1S5B D;  4U7C A;  3OSO A;  1N56 A;  4JV0 A;  3H6M A;  4JC0 A;  2DPJ A;  3VYT A;  4UCO A;  2YTV A;  1N36 L;  3BAB A;  3MFY A;  1MJC A;  5IT9 L;  2JA5 H;  2EYF A;  4DNR B;  4JI4 L;  3MC0 B;  4JOI A;  3G4S A;  3I2Z A;  4FF1 A;  4DXG A;  1WR2 A;  4IUQ A;  1IBM L;  4PDB A;  3EA6 A;  4RCO A;  3K5I A;  3HBL A;  4NXM L;  2R3Z A;  1S0M A;  4K5X A;  1E1O A;  3CVZ A;  4JI8 H;  5C3E G;  3TP5 A;  4DV7 H;  2K5H A;  4HJA A;  2CKZ B;  1ASZ A;  4JOI C;  4ZRZ A;  3GTQ A;  1C4Q A;  2DLN A;  4A3I B;  2YRW A;  1HNW Q;  4TUY F;  4I65 A;  3NSW A;  3KJO A;  1HR0 Q;  3EPI A;  4A3C G;  2VPS A;  3SK6 A;  4OX9 L;  2HHH L;  5EQ0 A;  3BVZ A;  1KJ9 A;  4X3S A;  1XJV A;  4FS2 A;  4DUZ Q;  4DL6 A;  3HEJ A;  2WKC A;  3U4Z A;  4PWQ A;  1YIJ A;  1K1S A;  2W7P A;  1CSP A;  3QO2 A;  2K01 A;  2JSO A;  3T16 A;  2BA0 A;  5C6A A;  2O5I C;  4TVA B;  5C0X G;  1KEE A;  2A6E D;  2JN4 A;  3NEN A;  1EQR A;  4JI4 Q;  4EFE A;  2QF7 A;  1LT6 D;  4YY3 H;  5JJK A;  2Y0S A;  3VR3 A;  4K6D A;  3MEF A;  3S2D H;  2R7L A;  4YWL A;  2AWO A;  4PZ7 A;  2PQE A;  1G6Z A;  4OIK A;  3LWU A;  4BY7 G;  2LXK A;  5GAG C;  1N36 H;  1CTM A;  3GTJ B;  3JAM E;  5DLG A;  3I91 A;  4MN3 A;  3MZ5 A;  5IE8 A;  1TR5 A;  1SEI A;  5CGK A;  3H3V C;  1H9M A;  5M5Y H;  4EGQ A;  3AYH B;  4UCR A;  3FEW X;  4GLV B;  4NXM H;  2JA5 G;  4UDU C;  4IPH A;  2BQR A;  2O4X A;  1SE8 A;  5EPL A;  2W8L A;  2UVR A;  5C4Z A;  1QVG A;  5KT4 A;  4DR1 L;  1Y69 U;  1I94 H;  5T1G A;  1WTP A;  4RUA A;  4C3I G;  1EY5 A;  2FJ2 A;  4O1N A;  1HNZ Q;  4ECV A;  1A15 A;  4RZR A;  2AQ2 B;  5BN5 A;  4RGO S;  1FNU A;  1CKN B;  1AN8 A;  4FM9 A;  4F88 A;  4DV0 H;  1Z2N X;  4C2M B;  5F9L A;  1K3R A;  3R5X A;  3SE7 A;  3VYR A;  2HDL A;  1CFM A;  2ZJQ A;  1EEF D;  1A8V A;  1EY6 A;  2Q8I B;  2CWP A;  3M3Y H;  4A93 H;  5COR A;  1I7N A;  3K5H A;  1SRU A;  1FR3 A;  4X66 L;  5KT2 A;  2AGO A;  2NVX A;  4DNI A;  2CW0 C;  4IOA A;  3PIO A;  3NWT A;  2XGP A;  4C1N K;  2B2W C;  4FNF A;  4DV6 L;  3PF4 A;  1UEA B;  1SXT A;  1TWH B;  2K05 A;  3AMU A;  4C5A A;  3TIN A;  1HNZ L;  4GZY C;  5M3M H;  1YVC A;  1WTO A;  2W6N A;  1IKL A;  1JOO A;  2EYO A;  4KLK A;  3T13 A;  4WFN 3;  1IL2 A;  1F9S A;  3A5Z B;  1I7L A;  4QF4 A;  4DR4 Q;  5EKI A;  3M4Y A;  3P75 A;  4E4T A;  2W6O A;  5KX5 F;  3PZP A;  1PTO C;  1AZQ A;  1MD2 D;  1LTI D;  2KHJ A;  3L9A X;  1VKZ A;  1RK6 A;  2UUA H;  1D5X C;  2D0P A;  3Q8D A;  2MUY A;  1VQ4 A;  1EY4 A;  5IOD A;  2L12 A;  3N43 B;  3MXN B;  2UU9 L;  3CC2 A;  1VF5 C;  1Q12 A;  5BPH A;  1XPR A;  3W1B A;  4O2D A;  2RDH A;  2PZT A;  2EOT A;  1VBG A;  4DV6 Q;  4KK7 A;  5BMV F;  2HD3 A;  3OHA A;  3VPB A;  5C5J A;  1T3N A;  4DL5 A;  3QZ8 A;  3GTL A;  1Y8P B;  1HA6 A;  1DXM A;  1CSQ A;  3MR6 A;  3SEB A;  4GS3 A;  2B2Y A;  4DUY Q;  3RLF A;  2XD4 A;  1RL2 A;  3TRZ A;  1PH6 A;  3AQQ A;  3P20 A;  1C8C A;  1EOT A;  5M3F B;  1H95 A;  4A93 G;  4X64 H;  2I07 B;  1F77 A;  1I6V C;  2B2V C;  1TWC A;  2F4V L;  4HMJ A;  5ELE A;  1CQV A;  3BA9 A;  4LFA L;  5LL6 b;  3GD7 A;  1TU2 B;  4A3F B;  1TA8 A;  4ED2 A;  1JB3 A;  1HZA A;  1FVI A;  1JXL A;  2F0K A;  2SNM A;  5EKL A;  3STB C;  5C3E B;  4GKK H;  3C0F B;  1YIT A;  4O42 A;  3H0G B;  3T51 B;  4CJ2 C;  3HOY H;  3RV3 A;  5FO7 B;  4LH7 A;  1F9Q A;  1JE4 A;  4DV6 H;  4IJL A;  1CQI B;  3DM1 A;  3JZI A;  3KJP A;  1D1I A;  5L1J A;  1O7Z A;  2AHO B;  1I4R A;  2D62 A;  5IYC H;  1IBK Q;  2PMZ B;  3EN2 A;  3RN2 A;  4QQB X;  3MWM A;  3V4Z A;  1H9K A;  4IFD I;  2YZM A;  4DL7 A;  1I50 H;  3ERS X;  4B3M L;  3J7A V;  4HED A;  3S14 H;  2FLL A;  4JI7 H;  1QG7 A;  2B8F A;  3CCR A;  4CGY B;  5K5P A;  3EYY A;  2VUM H;  1BVS A;  3TQT A;  4BBR H;  2JA8 H;  4DV1 H;  2YCH A;  3RLN A;  5LHY 1;  4Q0F A;  4POG A;  2K4K A;  2O5J C;  2KSW A;  2R7K A;  4FXK C;  5DQI A;  1V1Q A;  2HQL A;  5D8D A;  3HOW B;  1W96 A;  3S1Q H;  1GLV A;  5IP9 H;  5GAH C;  4CDE C;  5M3F G;  4A93 B;  3VYS A;  1M4V A;  4MA5 A;  4JBW A;  2IL8 A;  1BBU A;  4Y7N B;  3E9H A;  5HUR A;  1E1T A;  3E0E A;  3K81 C;  2KCC A;  1EUJ A;  2SCU B;  1ZET A;  5AJ3 L;  4Q43 A;  4PQX A;  1U4L A;  1RF2 D;  1SYG A;  1ZXT A;  3GIP A;  3BDC A;  4ECQ A;  2K32 A;  3I70 A;  3S24 A;  4HID A;  4A3G B;  1HNW L;  3J81 L;  3FKI B;  3IG0 A;  3FHW A;  3FMA A;  4LF8 L;  5CBA E;  1LAB A;  1HQR D;  3OOC A;  4HR7 A;  4EQP A;  4BA1 I;  3S16 B;  2ES2 A;  1JX4 A;  1X32 A;  2Q2I A;  4GKK L;  4QL5 A;  5A2Q W;  3TSS A;  3TRE A;  3WOE A;  1IKM A;  2A68 C;  4HCE A;  4RHS A;  4ABN A;  4DV3 L;  1PX2 A;  3GV6 A;  3KDF B;  4EQ5 A;  3W1G A;  4DR3 Q;  3OUZ A;  2FK3 A;  3CCQ A;  4OEL B;  1Q81 C;  1PFM A;  4PV1 C;  4YJ3 F;  1VDZ A;  3WO1 A;  1K28 A;  1GSH A;  4QW8 A;  2FMA A;  1X3F A;  3TP8 A;  5JEA J;  5KFZ A;  1EIF A;  5ELO A;  4ED6 A;  2XWB B;  1D1K A;  5ELC A;  4DR5 Q;  5KFC A;  1QIL A;  3KHL A;  1V43 A;  1VQN A;  4H7B A;  3TQY A;  4A3J G;  1Y1W B;  1AH9 A;  1VQB A;  2JXM B;  4DV1 L;  2YTX A;  4KI0 A;  2RHQ B;  3T5H A;  5KFB A;  2OF1 A;  3S15 B;  4EBE A;  1FJG L;  2PI2 E;  4N9T A;  5M3F H;  1RHP A;  3C2P A;  2PW7 A;  4BS9 A;  4DV4 H;  1PMR A;  1EQQ A;  3FKI G;  1HA5 A;  4RAZ A;  4J9K A;  4O3N A;  1OXT A;  4B9W A;  4ECW A;  1PA6 A;  2B63 B;  4AYB E;  1EUD B;  1LAC A;  5E4X A;  1B33 N;  4J9P A;  4J8Q A;  1RJP A;  2W70 A;  1STN A;  1S03 G;  1E22 A;  2ICE C;  4LMQ D;  1RJT A;  1RCV D;  3H09 A;  4IQZ A;  1WVL A;  3PO2 B;  3S14 B;  4HNT A;  4J9N A;  2JE6 I;  4A75 A;  4LF5 Q;  1TKW B;  2KA7 A;  1B70 B;  4DUY L;  4LF6 H;  1K8M A;  2VA2 A;  1B9N A;  2Z4H A;  1O7I A;  4LF9 H;  5JOB A;  3U9T A;  1QNU A;  5L1I A;  2ZXP A;  3S1Q B;  1W6K A;  1E4E A;  2C00 A;  4C3H H;  5IGC A;  2F4V Q;  2VUG A;  4DR2 Q;  4ZKC B;  1BDO A;  4JI1 H;  1HNX L;  2RDF A;  3D8G A;  1GUN A;  1T9H A;  3Q22 A;  3HKZ A;  4PZ8 A;  3KF8 B;  2X69 A;  1JT8 A;  1A2T A;  1YNJ D;  3U58 A;  1ROD A;  3MFI A;  2PNR C;  3RFC A;  3U4V A;  5C8Y F;  1UE1 A;  4TQR A;  5HGT A;  4J9O A;  1CA6 A;  4BBS B;  2HDM A;  1S0N A;  3S1N H;  2R8G A;  3BDL A;  3VR6 A;  1TWF H;  2EY5 A;  1L2F A;  1V8Q A;  1KD1 C;  4DK6 C;  4AYB A;  1BKB A;  4AQY L;  4OO1 I;  2OQ0 A;  2FE3 A;  2NN6 G;  1YHB A;  2NVY H;  5J39 A;  2CW7 A;  4DV5 H;  3BZD B;  2B63 G;  2C9O A;  5A35 A;  3FPP A;  5J22 A;  1GUS A;  1RYR A;  3UDI A;  1AFP A;  2ALZ A;  1B1Z A;  5DEH A;  5EWF A;  1AP0 A;  2CQA A;  4MV4 A;  1FD7 D;  1VMP A;  4AIM A;  1W6J A;  3PIP A;  1XNR Q;  3DF7 A;  4A3G G;  2ICI A;  4ZOL F;  2FK1 A;  3HKS A;  4RMF A;  1IYJ B;  1HNX Q;  5J3B A;  1EY7 A;  2QEJ C;  4JV5 Q;  3GLK A;  3BDO A;  4FO2 A;  2R92 G;  4OX9 H;  2EYM A;  3OHB A;  3HRZ C;  4C2M H;  2YU9 H;  2VB3 X;  5KFS A;  2A6H D;  5LMU Q;  1STY A;  4RNO A;  3HOZ G;  3J7A 5;  2PNH A;  1CS0 A;  4O2A F;  3NTI A;  1SFO B;  3LX0 A;  2WTF A;  4NW2 A;  3SK8 A;  5M5X B;  4BY1 B;  1NR2 A;  4YY3 L;  2A5H A;  4APV A;  3HOW G;  4JYA Q;  1RJR A;  2X6L A;  3KK7 A;  4B3R Q;  1GGO A;  1S5D D;  1GVP A;  4MAM A;  4ZQI A;  3TS0 A;  2DUD A;  5KT5 A;  4APM A;  1IBL L;  2FLN A;  1WTV A;  4I7H A;  3CMA A;  2F0U A;  2V1C C;  2YS6 A;  5BR8 L;  3BZK A;  3IFT A;  3NE5 B;  4K8J A;  2R93 H;  1XNR L;  4YP3 A;  1CUK A;  1I94 Q;  3F8T A;  3HGB A;  2M9V A;  1WTH A;  4DR1 Q;  3M4P A;  3NTK A;  2XIW A;  2G5D A;  2JEI A;  2NVY B;  1NMF A;  4Q8F A;  2Q8T A;  4RGN A;  4B3S Q;  2CW0 D;  4R8N A;  5KFG A;  1H9J A;  3SI8 A;  1Z6H A;  2ATL A;  4FXD A;  2WYO A;  1TII D;  3BVG A;  1F9R A;  5CV6 A;  2B2T A;  1LTR D;  2WII B;  5KFK A;  4QY7 A;  3S15 H;  2P0A A;  4B08 A;  4PMC A;  2EXZ A;  4BWS C;  2L15 A;  3GTJ H;  1XWE A;  3UFX B;  1S9F A;  1SSO A;  2QKI C;  3KHG A;  3K0X A;  1FNW A;  4OHJ A;  3MA2 B;  4LH6 A;  2SDF A;  1HRJ A;  3NEM A;  3IRB A;  3J81 i;  4JI7 L;  3KXY T;  1R4Q B;  1IL8 A;  3HOY G;  4BY1 G;  1WTX A;  2JA8 G;  5M5X H;  4A3L G;  4LWC A;  4A3J B;  2F0I A;  2F3I A;  1I3Q H;  1O7Y A;  4LUO A;  1KC7 A;  2Q2T A;  3PO2 H;  4JPB W;  4J0M A;  3OW2 A;  5EDW A;  1NBW A;  2ZXR A;  5G3L F;  4DR1 H;  1JWU D;  4K2L A;  2XGT A;  3ND9 A;  2KQ3 A;  4JK1 C;  2F0T A;  2OTJ A;  5HY6 A;  4JVZ A;  2LXJ A;  1D7Q A;  3CCU A;  4U67 3;  1PZI D;  5JUM A;  4IWX A;  1TXY A;  2DJF C;  3FRP B;  4NXN Q;  4LFC H;  4BWG B;  4DK1 A;  4EQO A;  2CQO A;  1I4G A;  4RWS C;  2JEJ A;  3R5F A;  2JP1 A;  2M00 A;  4JW0 A;  2WP8 J;  3ULJ A;  3VA7 A;  1PH4 A;  2KHS A;  4F4Y A;  3JAM L;  1A3U A;  3RZO B;  1ENA A;  3QJY A;  3J80 E;  4KKU A;  2FMC A;  5FLM H;  1B44 D;  1IBL H;  4BBR B;  3RMH A;  1NTG A;  3GTK B;  3U50 C;  2XC9 A;  2ASB A;  2J0T D;  1S5E D;  2AU0 A;  4MV3 A;  4NMZ A;  4X62 Q;  1PV4 A;  2F0W A;  1VAJ A;  1XMQ Q;  3PQI A;  4QMG A;  3HOU G;  2VQE Q;  2E76 C;  2XNA C;  4L8J A;  2UXB Q;  1R9T A;  2BCO A;  4JBJ A;  5EBC A;  2JA6 G;  1QVF A;  4FS1 A;  1XMO L;  3I72 A;  4QCL A;  2R86 A;  3JSN A;  2ZDQ A;  3I55 A;  3Q2O A;  5E1F A;  3IKJ A;  3QG1 A;  3I4N G;  1Y8N B;  3H0G H;  1X3P A;  1UEB A;  4R4I A;  5CV5 A;  4A3E H;  2F0P A;  1V1P B;  3RZD H;  4HYK A;  4X3K A;  4C3J B;  5KFP A;  4LF7 Q;  3S16 H;  4MV8 A;  1UNS A;  1YZ6 A;  1PTO F;  5KEE A;  4N8X 1;  1NMG A;  4KN4 C;  1IBM Q;  2I0Q A;  2X6G A;  4G4K A;  4A3D H;  4NP5 A;  2RA4 A;  3OIP A;  3FKI H;  1B2T A;  4RNN A;  3TII A;  2F0Q A;  3M4O B;  1GSO A;  3E9I A;  4A3F G;  1AUX A;  4R8I A;  1WCM G;  5C3W A;  3HB9 A;  2IW3 A;  5KFR A;  2PYK A;  4MZ9 A;  1SBB B;  4BXX H;  4HIO A;  1IBK L;  4JI8 L;  1EWC A;  2L0C A;  1N34 L;  4BBR G;  3GIJ A;  1D5M C;  1STG A;  2TSS A;  5BR8 Q;  2LMC B;  4EFB A;  3CPW A;  2JEA I;  1VQE A;  3TBI B;  3KF8 A;  3RUZ A;  3NWS A;  3N40 P;  4B3S H;  1GUO A;  2W71 A;  4DR2 L;  4R4O A;  4DV2 H;  2KBN A;  1HZ9 A;  5C5M A;  4JI4 H;  3T1Y Q;  3PMF A;  1AN7 A;  5KFY A;  3GP7 A;  4OL7 A;  1CM9 A;  1CQJ B;  2F0H A;  1E4F T;  4XYM B;  3AFP A;  1KIX A;  1D2B A;  1TWF B;  4LFA H;  4GNX B;  1I3Q A;  2VZA A;  4TQU S;  2DY7 A;  3GV5 B;  3A5U A;  3URY A;  3UDG A;  1W2B A;  3JAM c;  3KLS X;  3W3A A;  4F50 A;  5M3M B;  2WB1 E;  4C3J G;  2QK4 A;  4ZI7 F;  1KTK A;  4F87 A;  2IP4 A;  3I4N H;  1NSN S;  2R85 A;  2R7M A;  1A3T A;  4FBU A;  2QIL A;  3CP0 A;  1PLF A;  4K8I A;  4R1J A;  1N32 H;  1BNZ A;  1H9S B;  5EGT A;  4IRD A;  3STB D;  1FGU A;  3I90 A;  3KF6 A;  4KN7 C;  4ZCK A;  4XQN A;  3PW7 A;  1JJG A;  3VMM A;  5IYD G;  4PNY A;  3M7G A;  2B63 A;  1J5E L;  4JV5 L;  2G9H D;  1SMY D;  2B39 A;  2NVX B;  1N36 Q;  2YL2 A;  4FBT A;  4B9X A;  3NTH A;  2FPG B;  4DV4 Q;  4K5W A;  2B29 A;  2WV6 D;  3CAM A;  4DV2 Q;  4UCS A;  1B53 A;  4ETS A;  2EY2 A;  3PR5 B;  2VQD A;  2IX0 A;  5A2Q L;  2VUM B;  2JA7 A;  4R8U A;  4GKJ H;  2MO0 A;  2QDL A;  4IUP A;  3H3V I;  4J9M A;  2DNC A;  5KRU A;  5KFA A;  1MSH A;  1CKO A;  2L11 A;  2Z4I A;  1J9O A;  1PYW D;  5NUC A;  1QCB D;  1SE4 A;  3SGI A;  3S2H B;  1HNZ H;  3MFH A;  2C5C A;  4JI3 L;  4I7A A;  5DQH A;  2FHT A;  3H94 A;  1UE6 A;  4QIW A;  1I94 L;  5M5W B;  1E3P A;  1K0R A;  2WE6 A;  2UXC Q;  2XRS D;  3OW7 A;  1J5E Q;  3V2T A;  2WIN B;  4HMI A;  1DJR D;  5C3E H;  3CME A;  3AU7 A;  1SNM A;  4B3S L;  1V9P A;  4C5B A;  3HOX H;  2JEB I;  1V1P A;  2KEE A;  5JVH 3;  1XTC D;  4DV0 L;  2MQH A;  2R8J A;  4MA0 A;  2E2H H;  3GQB A;  4G7O C;  2W6P A;  1MIU A;  4EGV A;  3D6C A;  3RB6 A;  2UU9 H;  2I80 A;  1PH3 A;  2UXB H;  3X3M A;  4MIU A;  1F2M A;  1PRT F;  2Y0S B;  5C4X B;  4GN5 A;  5FJ8 G;  1C3O A;  1N8R C;  1E7Z A;  2XN9 C;  5CV8 A;  4DPG A;  4LW1 A;  3J7Y W;  3S1R B;  3ICE A;  1JCK B;  5KNB A;  1G29 1;  4DV7 L;  2NTT A;  3JRX A;  3TP6 A;  5K36 H;  5CBE E;  1TWG B;  4BBS H;  1RD9 D;  3D0F A;  2K5D A;  2IX1 A;  4R7R A;  2EJF C;  4X3U A;  1MHW C;  3A8J E;  4OO1 H;  2FIN B;  1KXL A;  3BYY B;  4DFA A;  5KFX A;  1K83 H;  4JI6 H;  4JG2 A;  3CCJ A;  5EWE A;  3R2T A;  2ASL A;  2NN6 H;  3NPP A;  3BS1 A;  2YS7 A;  4ECZ A;  2RKS A;  4OWT B;  1K1Q A;  2Y0S E;  4S3S A;  4EEY A;  1K73 C;  2X0S A;  4F4Z A;  3OWE B;  3I56 A;  1NUC A;  2AMC B;  4DR5 L;  1YNN D;  4NXN L;  4A3B G;  4A3G H;  2UUA L;  1HTP A;  5LMU H;  2WB1 A;  4NDX A;  2W57 A;  1RDP D;  1S4Z A;  3SE0 A;  1K9M C;  1XPU A;  1HR0 W;  1ICW A;  1UE7 A;  5L37 A;  4EG0 A;  1VQI A;  1GUG A;  2WDT A;  4A3K G;  5KFN A;  4G7H C;  4IFD H;  5TSS A;  1G51 A;  3S1N B;  3VA5 A;  2BH8 A;  4QIW B;  1HZB A;  2ZDG A;  2LKV A;  3MXU A;  5C0X I;  4DF7 A;  3GID A;  2DZD A;  2JA5 B;  2O2L D;  4O3P A;  3S1R H;  1C48 A;  3A0J A;  1XDN A;  4F8M A;  5D1P A;  4RG1 A;  1BJT A;  5KG1 A;  1PH5 A;  3WNZ A;  3S2D B;  1ICF B;  3C3L A;  1X54 A;  1Y1V A;  5KFW A;  5C1P A;  2W9A A;  4U6P A;  3N44 B;  5J1Z A;  1X56 A;  2I46 A;  4IAL A;  4QB4 A;  5DM7 3;  4K2K A;  2R7D A;  4DN4 M;  1XNQ Q;  1DGS A;  2MFI A;  2VXW A;  4KHP Q;  2F0F A;  3PN1 A;  2A69 C;  5DM6 3;  2OQK A;  4XX0 B;  2K5N A;  3NBH B;  2B2U A;  4YHH L;  4A76 A;  4GLA C;  3C46 A;  4DAM A;  3OMG A;  5JVL A;  3PCO B;  3G6E A;  1QUQ A;  2NZH A;  1SJE D;  2C2R A;  2YZG A;  5M3M G;  5J2U F;  1YHA A;  1RK5 A;  1WCM A;  2R93 B;  1LLR D;  3L3O C;  3I3C A;  4X66 H;  3HOU H;  3CRK C;  5E7N A;  3V96 A;  2UXD L;  1KRS A;  1RIP A;  4R4Q A;  1KBL A;  3DM3 A;  3A54 A;  2GN5 A;  3PO3 B;  2FPI B;  4LF8 Q;  2F0E A;  3EPG A;  3K8A A;  1OXS C;  4OON A;  3RNU A;  5LXT F;  1BQQ T;  1RTN A;  4IUN A;  5EKK A;  4K0K Q;  1S5F D;  1LTS D;  2R92 A;  3GTO B;  4ALP A;  1YNX A;  1Q86 C;  3ORQ A;  1G91 A;  4M9U A;  2PZU A;  3BZC A;  2W9C B;  3A7L A;  3Q0A A;  1KDC A;  4DV3 Q;  2EQS A;  4MTK A;  5KFQ A;  2BQU A;  3C1E A;  3GIQ A;  1YJW A;  3PO2 G;  1S72 A;  3KLR A;  1VQF A;  3D31 A;  4XQJ A;  3RB4 A;  4MNO A;  3DMU A;  2OEO A;  2W6Q A;  4WRD A;  4F7X A;  5FKA C;  1KJJ A;  1OXU A;  3N41 B;  2J6S A;  3W5O A;  1PRT B;  4G3I A;  4YY3 Q;  1AEX A;  5IGB A;  3IN5 A;  1D5Z C;  1EUC B;  4LMY A;  2ZM6 L;  4WJ3 M;  2F0M A;  4L5S A;  5DG7 A;  2W9C A;  5KFD A;  2Z1C A;  2ZTE A;  3PUZ A;  1EHI A;  1EEI D;  2UXD H;  1B4O A;  1B7Y B;  1N48 A;  4LF9 Q;  1ZKO A;  3NXW A;  3GTK H;  2FB9 A;  1NNX A;  3KAL A;  3M4I A;  4UHV A;  1HXY D;  5EJW A;  5JJZ A;  1W93 A;  2V4Q A;  2N3S A;  1BCP B;  3LML A;  2A8V A;  1A63 A;  4J9S A;  1LM0 A;  4QUC A;  1PFB A;  4DAP A;  1IXR A;  5KFL A;  3GTM H;  1PDQ A;  1II3 A;  4FVM A;  4RAU C;  5C0X J;  4H0L C;  1B9M A;  5CC4 A;  4X65 Q;  1WH2 A;  3PIP 3;  1SNQ A;  5FLX L;  4XIG S;  1RYS A;  2P5Z X;  2PQA A;  5KT3 A;  1MI2 A;  5C4X G;  3GIL A;  1TWG H;  3K3V A;  1IBM H;  3NHH A;  2N49 A;  4YCW A;  4LF6 Q;  4A3C H;  1Q1E A;  1Q90 A;  3ERO A;  1I6H H;  3RZD B;  3H0G G;  1HQM C;  1Z2O X;  3NBH A;  5KND A;  3N8D A;  3J80 c;  1PK8 A;  1BF4 A;  5IYD H;  1QZH A;  2ENB A;  4RHR A;  5D1O B;  3Q8P B;  4Y52 H;  5GON F;  1QNK A;  4C56 C;  3R23 A;  3WO0 A;  4A3D B;  2OWO A;  2K04 A;  3UE1 A;  2D0O A;  1L1O A;  4LF7 H;  3F1Z A;  2CW8 A;  5FPO A;  2BA1 A;  1DD2 A;  3F2C A;  4ECT A;  4X62 H;  4IRC A;  1PH8 A;  3UDF A;  2KVM A;  4DR6 H;  1WOC A;  1J6Q A;  1PRT C;  5C4J H;  4AYB B;  3ERQ A;  2LFN A;  2LY7 A;  2N8N A;  2AQ1 B;  2KJX A;  5EBD A;  3RB3 A;  3QFF A;  2D2C C;  4HJ7 A;  1N32 Q;  4CJ0 B;  2E2J H;  2PMZ A;  3MXP A;  5CAE B;  2NWG A;  2N88 A;  3ZJY C;  4UCT A;  1UWV A;  3HG9 A;  4QUF A;  2MHV A;  5ELD A;  4J9L A;  2UUC H;  1EQT A;  2NUA B;  1HR0 L;  4KHP H;  1DON A;  2R6G A;  4ZK9 B;  4X66 Q;  4JI6 Q;  2RDI A;  2EIF A;  2A1A A;  2J6U A;  5FJ8 H;  2BQ3 A;  4RGM A;  1N9W A;  4DUZ L;  2YW2 A;  2ATW A;  2E2I B;  4F4W A;  2PW5 A;  3T1H H;  1RTO A;  2PZW A;  5IIF A;  1IOW A;  3ONA B;  2V9W A;  3P7J A;  2NBF A;  2AKW B;  4X6A H;  2F3V A;  4A3J H;  1TWC B;  4FU0 A;  2HQE A;  3CQZ B;  1JC7 A;  2B63 H;  5BR8 H;  4ODG A;  2UUB Q;  4B3M Q;  2R7Z H;  4QWA A;  3NGD A;  1KLU D;  4X62 L;  4P72 A;  1Z2P X;  1KAW A;  1WTR A;  5DGA A;  4KY6 A;  2JA8 B;  2MCT A;  1YNJ C;  2WAQ B;  4FXG C;  4J9R A;  4EVO A;  4XYL B;  3ULP A;  3RLO A;  2N78 A;  4A3B H;  3UQ8 A;  4Y7N H;  1AE2 A;  1VQ5 A;  1KL9 A;  5D1O A;  2NU9 B;  4OIJ A;  3R3O A;  3GTO A;  1BXT A;  3B6Y A;  3C1F A;  3KF6 B;  1IHZ A;  2VS1 A;  2I5H A;  1KJI A;  1WFQ A;  3OUU A;  4DV2 L;  4POF A;  2EPB A;  5FK9 C;  2B3G A;  1JWM D;  2GPW A;  2B2W A;  4YHH H;  1PTO B;  4EYH B;  3J80 i;  2EY1 A;  2XCL A;  1O7L A;  2M2L A;  3K80 C;  1PFS A;  4YBZ B;  5DLF A;  2NVQ B;  2C2E A;  4ECS A;  4KY7 A;  2K14 A;  5KFJ A;  2FFK B;  4O0A A;  1X3G A;  4NKL A;  4P74 A;  1ET9 A;  2WAC A;  3M9N B;  4DUY H;  3H4D A;  3BJY A;  1STE A;  2BR0 A;  4HR7 B;  5FLX E;  4Y8V B;  3A8I E;  5JJI A;  1X9N A;  1S3O A;  2FJZ A;  4UFZ A;  1HTL D;  1PH1 A;  3K5O A;  3FKI A;  3GTP A;  2WAQ G;  3CHB D;  2CZG A;  2EZV A;  3P1H A;  4HCS A;  3PO3 H;  4EGJ A;  3TME A;  2R7F A;  2KEC A;  2A73 B;  3EFX D;  1SNC A;  3R93 A;  1DM0 B;  3HOV G;  4OWW B;  1DCZ A;  2QA4 A;  2PBZ A;  4YQW A;  2SNS A;  1STB A;  5CV4 A;  2EXD A;  3U9S A;  1VQA A;  4YAJ B;  3PF5 A;  2HHH Q;  2SOB A;  1EFW A;  1FJG Q;  1SYF A;  5JEA H;  5K36 G;  4ZUJ A;  4EQN A;  4B3R L;  2KOL A;  1H9S A;  5GAE C;  4BBS G;  1BXR A;  4UAI A;  2C35 B;  5F9N A;  2YU9 A;  3GTP H;  2ZTD A;  4GNX C;  2FMM A;  1EY0 A;  4FF3 A;  5L1K A;  1Q3L A;  2NN6 I;  4RCN A;  4Q44 A;  2LS0 1;  4JUZ A;  4JI0 H;  2KED A;  4A2A A;  5KG4 A;  4YR3 A;  1EYD A;  3H91 A;  2RGR A;  3KHH A;  2AUK A;  3N6R A;  1WI5 A;  1FGB D;  4JBM A;  1VQJ A;  1YI2 A;  1CZW A;  5CMD A;  4HSV A;  2PN1 A;  3I12 A;  1SCU B;  3HKZ G;  2E5L Q;  4ID6 A;  3VR5 A;  3I8Z A;  1EZ6 A;  2ZDH A;  1TS4 A;  3CC4 A;  3DWQ A;  3H15 A;  4C3I B;  2BE5 D;  3DEP A;  1SE2 A;  3CXC A;  2F4V H;  3G6X A;  3L4J A;  2NVY A;  2NTS A;  3K5L A;  4K5V A;  1V4Y A;  2EY6 A;  4JI6 L;  5BPF A;  3Q8Q B;  2R6F A;  2VA3 A;  4H44 C;  2UUC Q;  4RZQ A;  1MSG A;  3HOZ B;  1QUQ B;  5IYC G;  4IHJ F;  1X6O A;  3SDZ A;  1TWG A;  2K28 A;  3RR5 A;  1JLL B;  2Z6K A;  5H80 A;  1JDE A;  2B8G A;  1S40 A;  2UU9 Q;  4MTD A;  3GTO H;  1LT3 D;  3GTL B;  3DWA A;  5F2D A;  3AEV A;  2DIK A;  1M6V A;  3K7U C;  1HFG A;  2JK8 A;  1QE6 A;  3V4S A;  2D5D A;  5M5W H;  1ZYR C;  3MR5 A;  1SYC A;  4PMW A;  2V4D A;  1HJP A;  3VDY A;  1KHI A;  5LOV F;  1G2S A;  1GO3 E;  1SND A;  1EWH A;  4C1N I;  4EEQ A;  4WOR A;  4BA2 I;  2R7Z A;  4OXP A;  4KV6 A;  5KT7 A;  5I2X A;  1SFO H;  1C9O A;  4LFB L;  1N34 H;  4JI0 L;  2HJW A;  2NB0 A;  2C2D A;  2Q2H A;  1Q8I A;  3QOJ A;  1JOQ A;  4A3M H;  1FYC A;  1SN8 A;  2KHI A;  2WB1 B;  1IBL Q;  2NVQ H;  3L4K A;  3OSN A;  4DR5 H;  1R4P B;  4KKT A;  1ZHS A;  5C4X H;  1ZQ7 A;  2IY5 B;  4DV3 H;  2BH2 A;  2IPK D;  4HTH A;  2MJ8 A;  4CBV A;  3VPC A;  3PUW A;  1EIY B;  3WWV A;  2DGY A;  4GC7 A;  4R8U B;  5ISR A;  1X55 A;  1GJX A;  5KG5 A;  1CKM A;  2XVS A;  3E6Z X;  3OWF A;  3HOX B;  3PV0 A;  1VQM A;  4LF8 H;  1I5F A;  3RGZ A;  5LMN H;  4HIM A;  4OWX B;  4C3H B;  2OT2 A;  2VQF H;  3CC7 A;  1F2Y A;  4RUC A;  3D4D A;  2F03 A;  2PPB C;  2J6T A;  1ONL A;  3A55 A;  3VR4 A;  1M1K C;  1GHK A;  5IT9 W;  1BCP D;  3WOF A;  1YBY A;  3CCL A;  3G71 A;  2R8K A;  2CQY A;  2HHH H;  4GKK Q;  1FJG H;  2NVT B;  1KNA A;  3PUV A;  1TQO A;  4CC6 A;  5EZY F;  1VQH A;  1GHJ A;  2QCP X;  1ZYR D;  3HZX A;  4YR2 A;  4LFB H;  4C2M A;  4J1M A;  2F3W A;  2WFW A;  4H13 C;  3HKZ E;  3QIA A;  1I6H B;  2NUC A;  4GC6 A;  1S5C D;  1EZ1 A;  2AGQ A;  4IUT A;  1CKN A;  5IY0 A;  2JA6 H;  1NJI C;  2RSO A;  4J9Q A;  2EYH A;  2IBK A;  2V4R A;  1Q7Y C;  3TS2 A;  4LAA A;  3D4W A;  1QB5 D;  2OXP A;  2YU9 B;  3T4A C;  4LK1 C;  2UVW A;  1Y1V H;  5KYL A;  5I6W A;  4JI5 Q;  1VCI A;  1K8O A;  4QJF A;  1U4P A;  3M9B A;  1JIH A;  1BBW A;  4DV5 L;  2E2H B;  5KG6 A;  4LF9 L;  1GM5 A;  3MEH A;  1U4R A;  4WBN F;  4KD4 A;  1J5E H;  4P71 A;  1JWS D;  5M5Y B;  1LO5 D;  5LMN L;  2AWN A;  1TWF A;  3ND8 A;  3NUC A;  1EIH A;  4YHH Q;  2VR1 A;  2B2V A;  2FK2 A;  3JAM W;  3GTM A;  4C3H G;  4UCU A;  3FP9 A;  1DV1 A;  1S68 A;  4M7E A;  3NQT A;  4GN4 B;  1C7Y A;  5IOC A;  1I50 B;  2TMP A;  1PTO D;  2VY3 A;  4OEM B;  1B6R A;  1ENF A;  2VQE H;  4LF6 L;  2W9B A;  1TS5 A;  4JI2 H;  4L63 B;  1A3V A;  1F9P A;  3TEH B;  2NZ1 D;  4AQY H;  1F2Z A;  2F0G A;  1VQO A;  2RDJ A;  4JV2 A;  4IPC A;  4DV5 Q;  4P2C B;  4K6L A;  3HKZ B;  5IT9 E;  1I4P A;  1E24 A;  4O3S A;  3MAQ A;  3J81 j;  3CPF A;  3LGJ A;  2NZO A;  3V6K A;  4DK3 C;  1EOV A;  1XMQ H;  3M3Y B;  2L1B A;  1HUM A;  4HQ6 A;  4NXN H;  3X3N A;  1B3A A;  2DN8 A;  1R9T B;  2M05 A;  1JOK A;  2ZM6 Q;  2EDG A;  1KC8 C;  1Y1V G;  1B3Q A;  1BNC A;  2R93 A;  5IGE A;  3BA8 A;  2CH4 A;  3KUP A;  1KQS A;  3HFZ B;  1I3Q B;  1SJH D;  4FF2 A;  3HOZ H;  4DR6 L;  3PW2 A;  2L55 A;  5EOY A;  3TZU A;  3MXG A;  2A6E C;  4M1U B;  3AB9 A;  1QJO A;  2RVL A;  2I87 A;  4GLX A;  4B3T Q;  2XWJ B;  4LFC Q;  1NR4 A;  4HSP A;  1N34 Q;  5IP7 G;  3HOW H;  4ED1 A;  5ELF A;  3GTL H;  3CU7 A;  4A4I A;  4OO1 G;  4FDB A;  4B3R H;  3K59 A;  3S17 H;  3T1H Q;  1U5K A;  3E0J A;  1EYG A;  3JC6 6;  2QEX A;  5CA0 F;  3I73 A;  1XXG A;  2A6H C;  3PSI A;  1NAP A;  4QIW E;  3KBX A;  1BUV T;  5DG8 A;  3LP8 A;  4DL2 A;  2A68 D;  1NY4 A;  2DJG C;  5I2Y A;  1VQP A;  3RTX A;  3RJ0 A;  2IA6 A;  3KBG A;  2XSC A;  5JEA G;  3Q24 A;  1DYQ A;  1Z9F A;  4DKA C;  3EBE A;  3PW4 A;  4XDX A;  4C5C A;  2UUB L;  3QR8 A;  4PG3 A;  5C4H A;  4N9P A;  3Q1K A;  3MR2 A;  2XGQ A;  3MXN A;  2E2J B;  4L5T A;  3E5N A;  3I4M H;  1SAP A;  4PMB A;  1L0Y B;  4YWK A;  3BAA A;  3RZO H;  1K8A C;  4YCV A;  2FPP B;  3PR4 A;  2CH4 W;  1LTT D;  2B2T C;  1SYE A;  3OHX C;  4KJO A;  3F8N A;  3HS0 C;  3RGX A;  3BJU A;  4ED7 A;  2AGP A;  4CDF C;  1VBH A;  4QGU A;  2RQX A;  5LL6 S;  3HOX G;  2JA6 B;  4HJ8 A;  4M8A A;  4IOC A;  3K5M A;  2N55 A;  1B04 A;  5T14 A;  1U0L A;  2IT1 A;  1SR3 A;  3MR3 A;  1G8Z D;  4TRD A;  2QW7 A;  3NQI A;  2NU6 B;  4GOP B;  4O4H F;  4ED8 A;  1B50 A;  4JI5 L;  4IRK A;  4DR4 L;  1AZP A;  3G8C A;  3T1Y H;  3OPO A;  4JI1 Q;  5C44 G;  2J9G A;  4QWE A;  1L1O B;  4IR9 A;  2SEB D;  5H1S E;  1VQG A;  2K50 A;  5I9O A;  1SYB A;  2JYO A;  3SK5 A;  4ECU A;  3S1M H;  1SLJ A;  1PYS B;  4FP5 D;  1I50 A;  4L6T B;  1VQ9 A;  5J2T F;  4UP8 A;  3CF5 A;  1JMC A;  1VQK A;  5KFF A;  4CKC A;  3BG3 A;  2CVR A;  3K7A H;  4QWC A;  2HCC A;  2AUJ D;  4DR3 L;  2UXC H;  1ILP A;  2Y0S G;  3Q8R B;  3DHQ A;  4A3M G;  2Z9H A;  4CKE A;  4IR1 A;  1TWA A;  4RU9 A;  4NPS A;  3CD6 A;  1ULZ A;  2F0O A;  1UC9 A;  1FNV A;  3HP3 A;  3J80 W;  2QYZ A;  1UUP A;  2VB2 X;  1K3B C;  5D3D A;  2FLP A;  3N6X A;  4NLG A;  2E75 C;  3PVX A;  4MTN A;  1IW7 D;  1J8I A;  4DV1 Q;  1A0I A;  1QOH A;  3N42 B;  3RV4 A;  1KLG D;  4ZHQ F;  2R8I A;  4ZYS A;  2AQ3 B;  3D4R A;  3DXJ C;  3G7L A;  2VQF L;  4IFD G;  1JOR A;  5JH7 F;  2R8H A;  2OH2 A;  1FKA H;  1ILQ A;  2R7Z B;  1RKN A;  3TP7 A;  3T1Y L;  3OYY A;  1DIK A;  4BY7 B;  1V51 A;  5T1I A;  4QWB A;  5DLQ E;  2H5X A;  3ORR A;  5LYJ F;  4DR2 H;  1LUZ A;  1LTB D;  1UAP A;  1WSC A;  3V6H A;  4GOP C;  1JR0 D;  3GTP B;  3JRW A;  3KLW A;  1LYL A;  1M90 C;  1WCM H;  2RBM A;  1M7J A;  1L0W A;  1O80 A;  4L5Q A;  2ASJ A;  5C44 H;  3UDX A;  3OTO Q;  3HXL A;  1Y8O B;  3V05 A;  4IZO A;  1EU3 A;  3TQ1 A;  4A3K B;  3T56 B;  1SMY C;  1VQL A;  3Q23 A;  5KT6 A;  4RKL A;  4DV0 Q;  4J15 A;  1YEZ A;  4YWM A;  5IWA Q;  2I5M X;  2IWH A;  4DV7 Q;  1EQV A;  4KKS A;  1IYV A;  1R9T H;  2WKD A;  1BGW A;  3A8K E;  1XPO A;  2VNU D;  2JA7 H;  5L1L A;  3Q6S A;  4EBD A;  3MHB A;  2ALY B;  1JJ2 A;  4I4T F;  4L1K A;  1AUV A;  5KNC A;  1STA A;  3KFU A;  1E2Z A;  2YRX A;  5M9O A;  4JI5 H;  3NEL A;  3R5H A;  5L9X A;  2K52 A;  4DV4 L;  4JI2 L;  4KY5 A;  4HJ9 A;  2ZXO A;  2H4O A;  4TSS A;  2RCN A;  1WD0 A;  4DK0 A;  2IX3 A;  1CI3 M;  4LF4 H;  1SRO A;  2RF4 A;  2WAQ E;  4DR7 L;  2EYL A;  4UCV A;  4XXE A;  3GO5 A;  2A69 D;  3GIK A;  3FPU B;  1O78 A;  2CHB D;  2Z0S A;  3M7N A;  4DUZ H;  1E2V A;  3FDS A;  2C22 A;  5JVG 3;  2EE1 A;  5IT9 c;  4MV9 A;  2Z8L A;  3ER0 A;  2HGS A;  4IZ8 A;  3PUY A;  2QDB A;  4JI7 Q;  1MKH A;  5LL6 X;  3K7A B;  1YJ9 A;  5FO8 B;  4ME5 A;  2HT1 A;  1TWH A;  4YB8 B;  5KFU A;  3GII A;  1S0O A;  2W9B B;  4XZ3 B;  3K0Y A;  3KYH C;  5C44 B;  1OXV A;  2K75 A;  4L5R C;  4HNV A;  4RA8 A;  1C30 A;  1VF7 A;  2YV5 A;  4O2B F;  4RB3 C;  3MWY W;  3QZ7 A;  1K83 A;  1SNO A;  1V1O A;  2EYP A;  2V59 A;  4Q8E A;  4DAY A;  2ZJR A;  1PH2 A;  5C0X H;  3GTM B;  2HVS A;  3JSL A;  1Q82 C;  5KG3 A;  2WB1 G;  3ZYY X;  2K5V A;  4EX5 A;  4DA2 A;  1BCP F;  1MBY A;  2L9H A;  1PH9 A;  4JYA L;  2UUC L;  1Z47 A;  4JI8 Q;  1T36 A;  2E74 C;  4LF4 Q;  1TWC H;  5KFV A;  3BU2 A;  5LA6 F;  1B8A A;  5ELB A;  1GUW A;  3KDF A;  3TIG A;  3FVQ A;  4ILW A;  5ELN A;  3NBI A;  4KTA A;  3R8B A;  2F1M A;  1XNQ L;  2PQA B;  3TZD A;  4Z9C B;  1EFI D;  4CJ1 B;  4IO9 A;  4JI3 H;  3M4O H;  5COY A;  2W6M A;  4KJN A;  3ETJ A;  5CA1 F;  1YNN C;  2PVP A;  1CHP D;  1TY0 A;  1IZ6 A;  4XTC S;  5G3L D;  3F2B A;  2UUB H;  4H02 A;  3I4N B;  3H3V H;  5EAY A;  3J7Z C;  4R4C A;  1DOK A;  2R7Z G;  2K6A A;  2CFM A;  2EVB A;  4CDD C;  3Q8S B;  3NP8 A;  4HN7 A;  3G48 A;  5D3I B;  1KRT A;  5IWA H;  4KHV A;  2NU7 B;  5C1O A;  5HV6 A;  4X65 H;  3RN5 A;  1VMC A;  1IOV A;  3DWP A;  1CA5 A;  1A9X A;  1EY8 A;  5IP7 H;  3J81 E;  1KJQ A;  2F0N A;  1HH2 P;  2UXB L;  3T5J A;  5KIX A;  1BBX C;  1EWI A;  5JVD F;  4EBC A;  4RAY A;  4MV6 A;  4MTE A;  1BR9 A;  4Q0Y A;  4WJW A;  1SEB D;  1I6U A;  4LUZ A;  3TN2 A;  3MWD A;  3ITP A;  4LFB Q;  3IFD A;  2W6Z A;  3N52 A;  1T5E A;  2A74 C;  3CCE A;  5LMN Q;  2ZT9 C;  1OWT A;  5KG7 A;  1HZC A;  1NCV A;  3HOU B;  4R4T A;  4DR4 H;  3DUZ A;  2G9D A;  4XT1 B;  4IPG A;  1PFN A;  4R9W A;  5C3X A;  4K0K H;  1EYA A;  2EJG C;  2UVV A;  2K03 A;  2JA5 A;  1Q1B A;  5K2M A;  1IW7 C;  1W3S A;  1PHJ A;  2E2I A;  1Z7T A;  4G57 A;  5DAU A;  5KKN B;  3OTO L;  4EYI B;  4TQS A;  4ED3 A;  5IGG A;  2HIX A;  2O03 A;  4A3E B;  3CQZ H;  4IN3 A;  3W2D A;  3QWN A;  2R93 G;  5E3F A;  3VYU A;  2XRQ D;  3GV7 B;  4IUU A;  3J7A F;  4LFA Q;  1X3Q A;  4A3K H;  1SYD A;  1A2U A;  3PIO 3;  3H20 A;  3RUP A;  3M9M B;  3VR2 A;  2A19 A;  2F0V A;  4IPD A;  1BO0 A;  2YYZ A;  1TWA B;  1SMX A;  1Y14 B;  1WCM B;  1JJC B;  1VS0 A;  3PO3 G;  2V58 A;  3I4O A;  3G6V A;  3RAX A;  2KCN A;  5KFO A;  3SVM A;  2MGS A;  4O3O A;  4DGZ A;  2UVU A;  4F4X A;  3GIM A;  4NB3 A;  3BQ1 A;  2KCT A;  3D6W A;  2UXD Q;  5GAD C;  4IAJ A;  4X65 L;  2JEF A;  1XNQ H;  2E5L L;  3CRL C;  1H9R A;  4DL4 A;  2NVT H;  5DNF A;  4JV5 H;  1LTL A;  1LTG D;  3LWE A;  5KGU A;  4QWD A;  3MVV A;  2R61 A;  2ZTC A;  1YJN A;  5FLX c;  5A2Q E;  1DOM A;  4CKB A;  3KLS A;  1E2W A;  1ESR A;  3S17 B;  2R92 B;  3KAJ A;  2F52 A;  4P73 A;  1OTC A;  4AH6 A;  2FP4 B;  4LF5 L;  3OMC A;  4RB0 A;  4A3L H;  4OX9 Q;  4ZLT F;  1X3E A;  1QVC A;  3L7Z C;  2QGQ A;  2F0S A;  4MHE A;  1TS2 A;  4GKJ Q;  5IGF A;  1Y1W G;  1M0W A;  1N33 L;  1HUN A;  4BY1 H;  4ME3 A;  5GRO A;  2XCA A;  4O4I F;  1M0T A;  5EWG A;  2VW9 A;  4A3I H;  3RBE A;  3UE0 A;  1WJJ A;  3I4M G;  3EVQ A;  4WD3 A;  3GTG H;  3H0G A;  3K6O A;  1QWY A;  3SR1 A;  5KG2 A;  4IUR A;  4ME6 A;  3CCM A;  4Q45 A;  2E5L H;  5I47 A;  1XMO H;  3MWE A;  2GA4 B;  4HJ5 A;  5KFT A;  2MO1 A;  2JA7 G;  1I4X A;  2DY8 A;  3LNN A;  1X65 A;  4JI3 Q;  2Q2U A;  5C4J B;  2VUM G;  4X64 L;  2EJM A;  3PUX A;  1I4H A;  3HOV H;  4GKJ L;  3L0O A;  1LT5 D;  4RB2 C;  3SXH A;  5LP6 F;  5IP9 G;  4Q5V A;  1ASY A;  3BQ2 A;  4I50 F;  2VPQ A;  1K8G A;  3JAM i;  5EPJ A;  3RF2 A;  5JAV A;  2W7O A;  1Y1W A;  4B3T L;  4JI1 L;  5KFH A;  3S2H H;  3MFG A;  1TS3 A;  4LFC L;  4DR7 H;  1TVX A;  1SNP A;  5CR3 A;  4V0B A;  5JQW A;  4LUV A;  1UC8 A;  2B2Y C;  2PO4 A;  1P16 A;  3WDN A;  3CCV A;  2K5Q A;  1YHQ A;  3EJI A;  1XTD A;  3S1M B;  3I7F A;  4O3R A;  4A3E G;  3GQC A;  2FKL A;  4RH6 A;  2I5L X;  4A3B B;  1GXD C;  1KAA A;  2J4X A;  1VQ8 A;  2XCP A;  2R84 A;  5LMU L;  2V5A A;  5CV9 A;  3CW2 C;  4K14 A;  2YZN A;  1TWA H;  3GV8 B;  3EIV A;  5C5L A;  3GTK A;  4IJH A;  1PRT D;  4MV1 A;  1HNW H;  2JA7 B;  2VUM A;  3NK9 A;  4DR3 H;  3T5K A;  4HIK A;  3IAY A;  3J7A K;  1IBK H;  4B3M H;  3RD4 A;  2BDN A;  2Q8R E;  5FD6 A;  5KFM A;  2Z6K C;  1BOS A;  1LT4 D;  2KEN A;  4XYQ A;  5BN4 A;  3ETH A;  3PGZ A;  2IJ0 A;  2W8K A;  5FOB B;  3RBD A;  4RNM A;  1F2L A;  3GTJ A;  2CCZ A;  4ZQ3 A;  4XQQ A;  4DAV A;  1STH A;  4ZAI A;  1EY9 A;  2OCE A;  1HR0 H;  3J80 L;  1PVO A;  3SK4 A;  3UI2 A;  5IYB G;  4RKB A; 
#chains in the Genus database with same CATH homology
 3J81 j;  3CPF A;  1G51 A;  5GAH C;  3LGJ A;  2NZO A;  4LF7 L;  5M3F G;  2BH8 A;  1EOV A;  4DK3 C;  4JBW A;  1BBU A;  1HZB A;  3E9H A;  5C0X I;  4C3J H;  1E1T A;  3E0E A;  3K81 C;  1EUJ A;  1PH7 A;  5AJ3 L;  2ZM6 Q;  3S1R H;  3A0J A;  1KC8 C;  2R92 H;  1Y1V G;  1C0A A;  4RG1 A;  1AE3 A;  2GVB A;  1KQS A;  1PH5 A;  3HFZ B;  3S24 A;  4HID A;  1HNW L;  1X54 A;  3ULL A;  3HOZ H;  4DR6 L;  5IWA L;  3FHW A;  1WYD A;  4LF8 L;  1X56 A;  2RHS B;  4GLX A;  2R7D A;  4B3T Q;  4BA1 I;  1DGS A;  2MFI A;  5LMN W;  1XNQ Q;  2ES2 A;  4KHP Q;  4LFC Q;  2OQK A;  2Q2I A;  1N34 Q;  5IP7 G;  2K5N A;  3NBH B;  4YHH L;  4A76 A;  3HOW H;  4QL5 A;  4GKK L;  4GLA C;  3GTL H;  4KHP L;  4A4I A;  4DAM A;  4FDB A;  3TRE A;  3PCO B;  3G6E A;  1QUQ A;  4OO1 G;  2NZH A;  3S17 H;  1N33 Q;  4DV3 L;  3T1H Q;  4EQ5 A;  3KDF B;  5M3M G;  3W1G A;  4DR3 Q;  1U5K A;  1YHA A;  1EYG A;  3CCQ A;  1GKH A;  3JC6 6;  2QEX A;  1Q81 C;  3PSI A;  4QIW E;  2YTY A;  1X3F A;  4KHZ A;  1XMQ L;  3HOU H;  5E7N A;  2UXD L;  5JEA J;  1NY4 A;  1EIF A;  5ELO A;  1KRS A;  1RIP A;  4R4Q A;  2VQE L;  1VQP A;  4LNQ A;  4JCV E;  5JEA G;  3DM3 A;  1Z9F A;  4DR5 Q;  4DKA C;  3EBE A;  4UY8 C;  2GN5 A;  1N32 L;  1V43 A;  2UUB L;  1VQN A;  3TQY A;  4A3J G;  1AH9 A;  4PG3 A;  1VQB A;  4LF8 Q;  3K8A A;  4BY7 H;  4P75 A;  1OXS C;  4L5T A;  2LSS A;  2YTX A;  4KI0 A;  4OON A;  2RHQ B;  4DV1 L;  4YWK A;  3RNU A;  3I4M H;  4K0K Q;  3RZO H;  4ALP A;  1YNX A;  1Q86 C;  1K8A C;  1VQ6 A;  2PMZ E;  1XMO Q;  4YCV A;  2PI2 E;  1FJG L;  4X64 Q;  3BZC A;  2IHE A;  4GN3 B;  5M3F H;  4DV3 Q;  3T1H L;  3BJU A;  2EQS A;  1EQQ A;  2OTL A;  2ID0 A;  2VQF Q;  4JI0 Q;  3CCS A;  4QGU A;  3FKI G;  3HOX G;  1YJW A;  5JJL A;  3PO2 G;  4UP9 A;  1S72 A;  1OXT A;  4HJ8 A;  4IOC A;  1VQF A;  3D31 A;  1PA6 A;  4AYB E;  4MNO A;  1U0L A;  1PYB A;  2IT1 A;  1OXU A;  1SR3 A;  3W5O A;  4C3I H;  2E8G A;  1QZG A;  5GQO A;  1E22 A;  2VL6 A;  4YY3 Q;  4GOP B;  4JI5 L;  4DR4 L;  5AJ3 Q;  2ZM6 L;  1VQ7 A;  4WJ3 M;  4JI1 Q;  5C44 G;  4PZ6 A;  1L1O B;  2JE6 I;  4A75 A;  4LF5 Q;  4L5S A;  2UUA Q;  1B70 B;  4DUY L;  5H1S E;  1VQG A;  2K50 A;  1O7I A;  2ZTE A;  3A74 A;  3PUZ A;  3DLL A;  4LF4 L;  3S1M H;  1SLJ A;  1PYS B;  1B7Y B;  5HGQ A;  1VQ9 A;  4LF9 Q;  4UP8 A;  3GTK H;  3CF5 A;  1JMC A;  1VQK A;  4C3H H;  2F4V Q;  1UE5 A;  4DR2 Q;  2N3S A;  1HNX L;  3K7A H;  2A8V A;  1A63 A;  1T9H A;  1LM0 A;  4DR3 L;  4PZ8 A;  3KF8 B;  1IXR A;  1JT8 A;  3GTM H;  2JJQ A;  3U58 A;  5C0X J;  2Y0S G;  4X65 Q;  4A3M G;  3U4V A;  2XTI A;  1UE1 A;  4XIG S;  4NXM Q;  2PQA A;  4NPS A;  5C4X G;  3CD6 A;  1TWG H;  4IFD J;  3S1N H;  3AFQ A;  2N49 A;  4YCW A;  1TWF H;  4LF6 Q;  1L2F A;  4A3C H;  1Q1E A;  1KD1 C;  4DK6 C;  3M85 A;  1I6H H;  1BKB A;  4AQY L;  4OO1 I;  2OQ0 A;  1L1O C;  2NN6 G;  1YHB A;  2NVY H;  4MTN A;  1NE3 A;  3H0G G;  4DV1 Q;  4AYB G;  2B63 G;  1A0I A;  3J80 c;  3M4Q A;  3UDI A;  2E2I H;  5IYD H;  1QZH A;  4GOP A;  4IFD G;  4Y52 H;  2VQF L;  2OWO A;  4AIM A;  3PIP A;  2IHF A;  2D0O A;  3UE1 A;  1XNR Q;  1L1O A;  3T1Y L;  3OYY A;  1Y1W H;  4A3G G;  3F1Z A;  3HKS A;  4RMF A;  1A62 A;  5DLQ E;  1IYJ B;  2BA1 A;  2H5X A;  1HNX Q;  5J3B A;  1LUZ A;  3F2C A;  4JV5 Q;  1Q8K A;  4GOP C;  1PH8 A;  4JBK A;  2R92 G;  3UDF A;  3KLW A;  4A3I G;  1LYL A;  1WOC A;  1J6Q A;  1WCM H;  4UP7 A;  2ZJP A;  5C4J H;  1D8L A;  1M90 C;  1L0W A;  4L5Q A;  4C2M H;  2YU9 H;  3J81 c;  1Q46 A;  2N8N A;  5C44 H;  4GNX A;  2CWA A;  5LMU Q;  3HOZ G;  3UDX A;  2PNH A;  3OTO Q;  3J7A 5;  4HJ7 A;  1N32 Q;  4A3D G;  2E2J H;  1VQL A;  4DV0 Q;  4J15 A;  1YEZ A;  4YWM A;  3ZJY C;  2I5M X;  4YY3 L;  1UWV A;  4APV A;  5IWA Q;  4DV7 Q;  4A3F H;  3HOW G;  4JYA Q;  1R9T H;  3GTQ H;  4B3R Q;  4K0K L;  1GVP A;  1XPO A;  2VNU D;  2JA7 H;  1OXX K;  3TS0 A;  2DUD A;  1HR0 L;  1IBL L;  3CMA A;  2ALY B;  1JJ2 A;  2R6G A;  4BXX G;  1GD7 A;  4X66 Q;  2V1C C;  3KFU A;  5BR8 L;  4JI6 Q;  2EIF A;  2A1A A;  3BZK A;  2UXC L;  5FJ8 H;  2JQO A;  3NEL A;  2R93 H;  1XNR L;  1JE5 A;  1N9W A;  1CUK A;  2JA9 A;  4DUZ L;  1I94 Q;  2K52 A;  3F8T A;  2ATW A;  4DR1 Q;  3M4P A;  4DV4 L;  3GDE A;  4JI2 L;  4HJ9 A;  1NMF A;  2NVX H;  2RCN A;  2AKW B;  4B3S Q;  4X6A H;  5FLM G;  4A3J H;  4AQY Q;  1SRO A;  2RF4 A;  2WAQ E;  3F2D A;  2B63 H;  4DR7 L;  1G6P A;  3GO5 A;  2UUB Q;  4B3M Q;  2MNA A;  2R7Z H;  2Z0S A;  4X62 L;  4P72 A;  4QY7 A;  3M7N A;  3S15 H;  2GVA A;  1KAW A;  2L15 A;  3GTJ H;  5IT9 c;  3ER0 A;  3PUY A;  1VQC A;  3K0X A;  1VQD A;  4JI7 Q;  1MKH A;  1JB7 A;  1YJ9 A;  4DR6 Q;  1FL0 A;  2HT1 A;  3ULP A;  3RLO A;  3NEM A;  2N78 A;  4A3B H;  3IRB A;  3J81 i;  3KYH C;  4JI7 L;  4Y7N H;  1AE2 A;  1OXV A;  2K75 A;  1KL9 A;  1VQ5 A;  4L5R C;  3HOY G;  4BY1 G;  2KCM A;  2YV5 A;  1MJE A;  3KOJ A;  4JI2 Q;  2JA8 G;  3B6Y A;  5M5X H;  4A3L G;  4LWC A;  3KF6 B;  2VS1 A;  2F3I A;  1I3Q H;  2I5H A;  1P8L A;  1WFQ A;  4LUO A;  4DV2 L;  4POF A;  2ZJR A;  1PH2 A;  2Q2T A;  3PO2 H;  2B3G A;  3L2P A;  4DR7 Q;  1TWH H;  3OW2 A;  1NBW A;  4DAY B;  1Q82 C;  2WB1 G;  4WJ4 A;  2K5V A;  2PI2 A;  4EX5 A;  4UPA A;  2XGT A;  3J80 i;  1D7Q A;  1PH9 A;  2OTJ A;  5HY6 A;  4JYA L;  2LXJ A;  2UUC L;  2HIV A;  1Z47 A;  4YCU A;  3K80 C;  3CCU A;  4JI8 Q;  2FXQ A;  4LF4 Q;  1TWC H;  1PFS A;  1TXY A;  3BU2 A;  1B8A A;  4NXN Q;  2K14 A;  3KDF A;  4O0A A;  5IYB H;  5ELN A;  1X3G A;  2CQO A;  1XNQ L;  4P74 A;  4JC0 A;  2PQA B;  2WP8 J;  3ULJ A;  1PH4 A;  4IO9 A;  2YTV A;  3M4O H;  1N36 L;  1MJC A;  5FLM H;  2JA5 H;  4JI4 L;  4XTC S;  5JJI A;  1IZ6 A;  1X9N A;  1S3O A;  3F2B A;  4JOI A;  3G4S A;  1NTG A;  3I2Z A;  4H02 A;  3U50 C;  1PH1 A;  3H3V H;  5EAY A;  3J7Z C;  1IBM L;  2WAQ G;  4R4C A;  2ASB A;  3PO3 H;  2R7Z G;  2CFM A;  2R7F A;  3G48 A;  4X62 Q;  1PV4 A;  4NXM L;  3HOV G;  4OWW B;  1KRT A;  1E1O A;  2QA4 A;  5C3E G;  1XMQ Q;  2K5H A;  2EXD A;  2CKZ B;  2VQE Q;  4HJA A;  1ASZ A;  3HOU G;  1VQA A;  4JOI C;  3RN5 A;  2UXB Q;  4JBJ A;  3PF5 A;  2HHH Q;  2JA6 G;  1HNW Q;  1QVF A;  1XMO L;  1EFW A;  5IP7 H;  3KJO A;  1FJG Q;  1HR0 Q;  4A3C G;  5K36 G;  1HH2 P;  3I55 A;  2UXB L;  4B3R L;  1EWI A;  4OX9 L;  2HHH L;  5GAE C;  4BBS G;  3I4N G;  3H0G H;  4R4I A;  1UEB A;  4A3E H;  1XJV A;  2C35 B;  4LUZ A;  4DUZ Q;  3RZD H;  3GTP H;  2ZTD A;  3U4Z A;  4GNX C;  4LFB Q;  2NN6 I;  1YIJ A;  1CSP A;  3CCE A;  5LMN Q;  4LF7 Q;  2BA0 A;  3S16 H;  1HZC A;  4TVA B;  5C0X G;  4R4T A;  2I0Q A;  1YZ6 A;  1IBM Q;  1NMG A;  1WI5 A;  3NEN A;  1EQR A;  4IPG A;  4JI4 Q;  4JBM A;  1VQJ A;  1YI2 A;  4A3D H;  5JJK A;  3FKI H;  3MEF A;  3S2D H;  4YWL A;  2AWO A;  4PZ7 A;  3E9I A;  4A3F G;  3HKZ G;  1Q1B A;  2E5L Q;  4BY7 G;  2LXK A;  1WCM G;  5GAG C;  1W3S A;  1PHJ A;  4MZ9 A;  3CC4 A;  3H15 A;  3OTO L;  5IE8 A;  3CXC A;  4BXX H;  2HIX A;  4HIO A;  4JI8 L;  1IBK L;  1N34 L;  4BBR G;  5M5Y H;  5BR8 Q;  4JI6 L;  3CQZ H;  2R93 G;  3AYH B;  3CPW A;  2JEA I;  2UUC Q;  1VQE A;  4GLV B;  4LFA Q;  1QUQ B;  5IYC G;  4A3K H;  2JA5 G;  1X6O A;  2A19 A;  4DR2 L;  4R4O A;  4IPH A;  4IPD A;  3RR5 A;  2Z6K A;  2KBN A;  1HZ9 A;  1SE8 A;  2YYZ A;  3T1Y Q;  1SMX A;  1Y14 B;  1S40 A;  1QVG A;  1JJC B;  1VS0 A;  4DR1 L;  2UU9 Q;  3PO3 G;  3GTO H;  3I4O A;  3AFP A;  1KIX A;  1HNZ Q;  4NB3 A;  4GNX B;  3AEV A;  2KCT A;  2VZA A;  4TQU S;  2UXD Q;  5GAD C;  4X65 L;  3K7U C;  3A5U A;  2E5L L;  2JK8 A;  3UDG A;  5M5W H;  2NVT H;  1W2B A;  3JAM c;  1CKN B;  1LTL A;  4PMW A;  2WB1 E;  1HJP A;  3VDY A;  2ZTC A;  1YJN A;  5FLX c;  1KHI A;  3I4N H;  1GO3 E;  4BA2 I;  4OXP A;  3CP0 A;  2F52 A;  1K3R A;  4P73 A;  4R1J A;  4AH6 A;  1C9O A;  1SFO H;  1OTC A;  4LFB L;  3STB D;  2ZJQ A;  4JI0 L;  4LF5 L;  1FGU A;  1A8V A;  3KF6 A;  2CWP A;  3M3Y H;  4A93 H;  2Q2H A;  1JJG A;  1SRU A;  4X66 L;  4A3L H;  4OX9 Q;  4A3M H;  4DNI A;  5IYD G;  1SN8 A;  2KHI A;  1IBL Q;  4IOA A;  3PIO A;  2NVQ H;  1X3E A;  1J5E L;  1QVC A;  4JV5 L;  3L7Z C;  2QGQ A;  5C4X H;  4DV6 L;  1N36 Q;  4GKJ Q;  3PF4 A;  2IY5 B;  1Y1W G;  4DV4 Q;  2BH2 A;  2B29 A;  3CAM A;  4BY1 H;  4DV2 Q;  1N33 L;  4ME3 A;  1HNZ L;  5GRO A;  5M3M H;  1YVC A;  3PUW A;  1EIY B;  3WWV A;  2DGY A;  4KLK A;  2VW9 A;  1IL2 A;  3A5Z B;  4A3I H;  1X55 A;  1CKM A;  4DR4 Q;  2IX0 A;  3UE0 A;  1WJJ A;  3PV0 A;  3I4M G;  1VQM A;  2MO0 A;  3H3V I;  3GTG H;  1I5F A;  4HIM A;  4OWX B;  3CC7 A;  1CKO A;  3CCM A;  3SGI A;  1M1K C;  2KHJ A;  4JI3 L;  3CCL A;  1YBY A;  4HJ5 A;  2D0P A;  2MO1 A;  3Q8D A;  3G71 A;  1VQ4 A;  1UE6 A;  2JA7 G;  4GKK Q;  1I94 L;  3MXN B;  1X65 A;  2UU9 L;  3CC2 A;  1Q12 A;  3PUV A;  2Q2U A;  4JI3 Q;  1E3P A;  1K0R A;  2VUM G;  4X64 L;  2UXC Q;  1XPR A;  3W1B A;  1J5E Q;  1VQH A;  4O2D A;  3PUX A;  4DV6 Q;  3HOV H;  4GKJ L;  3L0O A;  2WFW A;  3CME A;  3HKZ E;  5C3E H;  4B3S L;  1V9P A;  5IP9 G;  1ASY A;  3HOX H;  2JEB I;  1CKN A;  5IY0 A;  1CSQ A;  1NJI C;  2JA6 H;  1K8G A;  4DV0 L;  2MQH A;  4GS3 A;  3JAM i;  2E2H H;  4DUY Q;  1MIU A;  3RLF A;  1Q7Y C;  3TS2 A;  1RL2 A;  3TRZ A;  4B3T L;  1PH6 A;  1PH3 A;  3AQQ A;  4JI1 L;  3S2H H;  4LFC L;  1H95 A;  4A93 G;  1Y1V H;  4JI5 Q;  1VCI A;  4GN5 A;  5FJ8 G;  1N8R C;  1E7Z A;  4QJF A;  2F4V L;  3M9B A;  4LW1 A;  4DPG A;  3ICE A;  1BBW A;  4LUV A;  4DV5 L;  1G29 1;  4DV7 L;  4LF9 L;  4LFA L;  1GM5 A;  1P16 A;  3CCV A;  3GD7 A;  4P71 A;  1YHQ A;  1XTD A;  4BBS H;  1HZA A;  5LMN L;  3I7F A;  1FVI A;  2AWN A;  3D0F A;  3STB C;  4YHH Q;  4A3E G;  2IX1 A;  2I5L X;  1VQ8 A;  5LMU L;  3FP9 A;  1KXL A;  1YIT A;  3HOY H;  3CW2 C;  4GN4 B;  1C7Y A;  1TWA H;  1K83 H;  3EIV A;  4JG2 A;  3CCJ A;  4IJH A;  2VY3 A;  4OWT B;  4HIK A;  2Y0S E;  4IJL A;  4LF6 L;  1K73 C;  3KJP A;  2Z6K C;  2D62 A;  2AHO B;  1IBK Q;  2KEN A;  5IYC H;  3RN2 A;  3EN2 A;  3I56 A;  4QQB X;  3PGZ A;  4IFD I;  3TEH B;  2AMC B;  4DR5 L;  4NXN L;  4A3B G;  1I50 H;  3ERS X;  1VQO A;  2UUA L;  4B3M L;  3S14 H;  4A3G H;  3CCR A;  2CCZ A;  4IPC A;  2VUM H;  1BVS A;  1K9M C;  1XPU A;  4BBR H;  1HR0 W;  1UE7 A;  4DV5 Q;  2JA8 H;  1VQI A;  2OCE A;  3RLN A;  4POG A;  2K4K A;  1PVO A;  1E24 A;  1V1Q A;  2HQL A;  4A3K G;  5IYB G;  3S1Q H;  5IP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...