3H3VI

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 13
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vI00
1WYDA 3PO2G 3M4PA 1GKHA 3CCMA 3STBD 5IP7H 5FLXc 4A76A 5J3BA 1VQ5A 1JT8A 4HIMA 3UDXA 1PH4A 1EIYB 4R4OA 4JI6L 2OQKA 4DV1L 1K0RA 5LMUQ 4A3BG 1LUZA 3I4OA 4QJFA 4YWKA 3OYYA 1CKNA 1MIUA 1HR0Q 1CSPA 1X3FA 1XTDA 3ICEA 1HH2P 2EXDA 3S1QH 1UEBA 2D62A 4LWCA 3HOZH 1K83H 2KENA 1PH2A 4DNIA 1LM0A 2RCNA 3CCRA 4JI3Q 5K36G 2ID0A 4LF5L 3GDEA 2UU9L 2ZM6Q 2HQLA 4QY7A 1J5EL 4GOPA 1UE6A 4OX9L 2NVTH 2K5NA 1HZ9A 5E7NA 2UUAQ 2XTIA 4TVAB 4GLAC 1Q1BA 4C2MH 4A3MG 1N8RC 3PO2H 1EQQA 4YY3L 1K8GA 1Y14B 2WFWA 2AWNA 3AYHB 4DR7Q 2NVXH 1FL0A 3PF4A 4A3BH 3GD7A 1VQBA 2R93G 2EQSA 3PO3H 1YJWA 5IT9c 3TRZA 4JG2A 1UWVA 5ELNA 1S72A 4DUYL 3CCSA 4WJ3M 1LTLA 4GOPC 1MKHA 1NJIC 1IL2A 1TWCH 4LF7Q 2UXCL 1Q86C 4DR5Q 4NXML 2OQ0A 3RLOA 1SR3A 2EIFA 3J81c 4JBMA 1UE7A 5HY6A 1EOVA 2PNHA 1PV4A 2ES2A 1JJGA 2PQAB 1YJ9A 4A3MH 3KF6B 2R7FA 3BJUA 1UE5A 5BR8L 5LMNL 3U4ZA 1JE5A 2R6GA 2VS1A 1FVIA 3PV0A 3A0JA 4O0AA 4IO9A 2I5LX 1VQKA 2OTLA 3S1RH 1JB7A 1KQSA 4O2DA 4DV3L 3HOYH 4BA1I 2R93H 4R4QA 4OXPA 1Q81C 3S14H 4X66L 5IWAL 1YEZA 2N3SA 3CW2C 1K8AC 1WI5A 4LUVA 1E3PA 4AH6A 2VNUD 3J80c 4DV4Q 2RF4A 1Q12A 2GN5A 2R7DA 1BKBA 2NVQH 1HNWQ 3H0GG 2UXDQ 4HJ5A 1PH6A 2UXBQ 1KC8C 1L1OA 2ZTDA 2MNAA 2VQFL 2OTJA 4A3LH 4A3IG 2VQEQ 2Q2TA 3J81i 4JI6Q 4GN3B 4UP7A 1I6HH 4BBRH 2Z0SA 3HOUH 1JJ2A 2PI2E 4X62L 3S17H 2R7ZH 4YWLA 4A3KG 5GADC 2BH8A 5C4JH 3I4MG 4IPCA 1M1KC 4BA2I 1RIPA 1KXLA 3I2ZA 4MZ9A 1YZ6A 1EFWA 1VQCA 3FP9A 2LXKA 2N49A 4HJ7A 3RN2A 1XMQL 2UUAL 3UDFA 5C0XI 4LF5Q 3K0XA 4FDBA 4DV5Q 3PCOB 5IYDG 1J5EQ 4LFBQ 4OX9Q 2VUMG 1KRSA 3EIVA 4DAYB 1SRUA 2MO1A 1TWGH 4JOIC 5IY0A 1X3GA 4LF4L 4DR6L 2Z6KC 3KDFB 4YY3Q 4A93G 4DR3Q 3HOWG 2NZHA 4XTCS 3GTGH 4B3TQ 3CCVA 3D0FA 4A4IA 5GAHC 2BA0A 4LF7L 2E2HH 1QVGA 2IHEA 3FKIH 1YIJA 1HNXQ 1HNZQ 1SMXA 5C3EH 1FGUA 4DUYQ 2IX1A 3S2HH 3TEHB 3GTMH 4IFDI 4B3MQ 1SN8A 1G291 1WFQA 2ASBA 1MJEA 2CCZA 3MXNB 1K9MC 1BVSA 3S1NH 3CCEA 5IYDH 1PFSA 3T1YQ 2VUMH 5JJKA 3CD6A 4QL5A 3UDGA 2R92G 3RR5A 3K81C 1CKMA 2Y0SG 4DPGA 4OWXB 3HOXG 4GKKL 1V9PA 1Q82C 4A93H 3PUXA 1CKOA 3HOWH 1SE8A 1I94Q 1X56A 2JE6I 5M3FG 1WCMH 2IHFA 3HKZE 4YCUA 4DV3Q 1LYLA 1A0IA 1U0LA 4GLVB 1W2BA 2UXDL 3KJOA 4OONA 2UXBL 4R4CA 2NN6I 4UP9A 1ASYA 1XPRA 2WB1E 1C7YA 1VQ7A 3A5UA 3OW2A 2VQEL 1K3RA 1L0WA 4C3JH 3U4VA 2KCMA 4IPHA 5IYCG 1XJVA 2LSSA 2VQFQ 3T1HL 2D0OA 5M5YH 4HIKA 2F4VQ 2V1CC 4RMFA 1Q8KA 3CC4A 4PZ8A 1VQOA 4GN5A 5C0XJ 3HOXH 4GNXB 3PUVA 4X62Q 2YTVA 4AIMA 3OTOQ 4DV2L 2HIVA 4A3CH 1J6QA 5M3FH 1E1OA 3M3YH 2JEBI 5GROA 4DV5L 3E9IA 3S2DH 4LFBL 4JI5L 3M7NA 2Q2HA 2C35B 3NELA 1XMQQ 1N33L 4C3IH 1H95A 3PIPA 3CXCA 3CCQA 2JK8A 3AFQA 4A3GG 1VQHA 3CPFA 5IE8A 3W1BA 2CKZB 4DR3L 3K80C 1O7IA 4OO1G 1AE3A 3CCJA 4LUZA 3K8AA 4P71A 4B3TL 4LF4Q 4JOIA 4LFCQ 4DR6Q 1CSQA 2Z6KA 4A3JG 2JQOA 4IFDJ 4KHZA 3VDYA 1W3SA 1QVCA 3NENA 4B3RL 1HNXL 3RLNA 1HNZL 4JV5L 4NXNQ 1P16A 2A19A 3EBEA 2K4KA 3GTQH 3I4NG 4DAMA 4B3ML 3UDIA 4Y52H 3UE1A 2I5HA 1QZHA 1V1QA 2ZTCA 4GS3A 2H5XA 4ALPA 2E8GA 2I0QA 3T1YL 4BBSG 2PQAA 3PUYA 4P72A 1XNRL 2ZTEA 2VL6A 1N32Q 1Z9FA 2WP8J 1X6OA 3PUWA 4LUOA 4A3DG 3AQQA 2JJQA 4PMWA 1YHBA 4X65L 1X3EA 4IJHA 2WAQG 3ULJA 4BXXG 1I94L 3E9HA 3CF5A 1PH5A 4AYBE 1PA6A 4L5SA 1UE1A 2AWOA 3CQZH 3SGIA 1I3QH 2UUBQ 4GKJQ 4WJ4A 3CC2A 1VQ4A 3M85A 1I50H 1KAWA 1HZCA 3BZCA 5IP9G 5JEAJ 4DR1Q 2DGYA 3Q8DA 2CWPA 4P74A 4BBSH 2F4VL 3CCUA 2F52A 1Q1EA 1S40A 4A3EG 1QVFA 1M90C 3T1HQ 4IJLA 4UPAA 1IBKL 2Q2UA 1B8AA 1NTGA 4LFAQ 1G51A 1X65A 1SLJA 4YCWA 3OTOL 3CMEA 2JA5G 3PF5A 4JI7L 1VQIA 1Y1VG 4KI0A 4LF6Q 2YV5A 4TQUS 2E5LL 2ATWA 2IX0A 4ME3A 4DV2Q 3CAMA 3RN5A 4IOCA 4IPDA 3K7AH 2MO0A 3HOVG 5FLMG 1AH9A 1N9WA 3W5OA 1XPUA 4JI5Q 3L0OA 3H0GH 4KHPL 1L1OB 2JA9A 5IP9H 1N33Q 1OXSC 1KD1C 1HZAA 2BA1A 4LFCL 5JJIA 2RHQB 1HZBA 3GTPH 4H02A 4A3IH 2BH2A 3HKSA 4P73A 3U50C 3I7FA 5AJ3L 3M4OH 3GTLH 1D8LA 1T9HA 4X64Q 4NXNL 3J7ZC 4JI1Q 3ER0A 4P75A 1XNQL 1NE3A 4GKKQ 4A3KH 4YHHQ 3RLFA 1E1TA 4B3RQ 3I4MH 4JV5Q 4K0KQ 1OXUA 2A8VA 2ALYB 1U5KA 2JA7G 1VCIA 1Q46A 3E0EA 4APVA 5M3MG 1D7QA 4JBKA 3TS0A 3LGJA 1IBLL 1IBML 3U58A 1N32L 5FLMH 1XMOQ 2D0PA 2MFIA 5C0XG 4RG1A 4HJ8A 4HJAA 1XNRQ 3FHWA 5IYBG 4LW1A 1BBWA 4C3HH 3I55A 2QEXA 1QUQB 4DV7Q 2K52A 1PYBA 1YITA 4JI0Q 1EUJA 4JI4Q 4X65Q 1VQEA 4DR2Q 4AQYQ 4A3FG 4XIGS 2PI2A 4NB3A 3H15A 4HIDA 4IOAA 1X55A 1B7YB 2YYZA 2UUBL 4GKJL 3G48A 1FJGL 3ZJYC 3H3VI 3GTOH 3F8TA 1C9OA 3JC66 2AKWB 2VY3A 3J7A5 1NMFA 3DLLA 4DR1L 3S1MH 4DV6Q 2UUCQ 1N34Q 1NMGA 1EYGA 1VQ6A 2JA7H 2FXQA 1JMCA 4HIOA 1QZGA 5GAEC 4IFDG 2CWAA 5DLQE 3CC7A 2N8NA 4EQ5A 3S15H 2NVYH 3B6YA 4GN4B 3CCLA 4LFAL 2JA6G 2R92H 4DR4Q 5IYBH 3K7UC 4IPGA 4PZ7A 3GTJH 3MEFA 4GNXA 1A63A 4LF6L 4QGUA 4JI2Q 3M4QA 4QIWE 1N36Q 1IBKQ 2E2JH 4DKAC 4A3FH 5M5WH 4BY1G 3JAMi 3RZDH 2E5LQ 1X54A 2RHSB 5FJ8G 2HHHL 3CPWA 1NBWA 3STBC 3F2DA 4OO1I 4BY7G 1PH3A 2N78A 3J81j 4DUZL 4L5RC 4L5QA 1VQNA 3H3VH 4KHPQ 2NN6G 4UY8C 1YHAA 4LF8Q 3ULLA 5IYCH 2A1AA 4X64L 3PO3G 1BBUA 4JI1L 3UE0A 4JBJA 1CKNB 1PHJA 2JA6H 2K14A 4UP8A 3ULPA 5AJ3Q 1EQRA 4OWTB 4JI8Q 4YHHL 2QA4A 2K75A 4K0KL 1CUKA 1NY4A 5JEAG 1Q7YC 3PGZA 1XNQQ 4JC0A 4JCVE 4BY1H 1YBYA 4JI7Q 2YU9H 4GOPB 3RNUA 5FJ8H 5HGQA 2PMZE 3S24A 1XMOL 1KL9A 4JYAL 2KBNA 2GVBA 3EN2A 3L2PA 1IYJB 1IBMQ 2Y0SE 3KF6A 1IBLQ 4BY7H 2IY5B 5JJLA 4DV7L 3G6EA 2ZJQA 4JI0L 4KLKA 4A3GH 1B70B 3GO5A 4DK6C 4JI4L 3IRBA 4DR2L 2VZAA 4AQYL 1KIXA 2K5VA 1TWFH 3HOYG 4YWMA 4POFA 2HIXA 3TS2A 4R4TA 1XPOA 1P8LA 4A3JH 1VQJA 1TWAH 4X6AH 4HJ9A 1MJCA 4EX5A 1PH7A 4B3SL 4DV6L 2UUCL 1N34L 1GO3E 5EAYA 2YTYA 5H1SE 2B29A 1R9TH 1FJGQ 3I4NH 5C4XG 1VQPA 1A62A 1EIFA 1Y1WG 1WJJA 1OXTA 3KJPA 4A3LG 4LNQA 4LF9L 4DK3C 4NPSA 4A75A 1Z47A 3ERSX 4BBRG 1G6PA 1PH8A 1JJCB 3CMAA 2JA8G 4DR4L 3HOUG 4GNXC 3BU2A 3D31A 3KOJA 4DV0Q 1GD7A 2CQOA 3CP0A 4JI2L 2R7ZG 1K73C 2K5HA 3F2CA 1N36L 2I5MX 1RL2A 4A3DH 5C44G 3RZOH 1L2FA 2ZJRA 3KFUA 4BXXH 1PYSB 3L7ZC 4JBWA 1GVPA 2K50A 3HKZG 1E22A 1S3OA 1YJNA 2IT1A 1OXVA 2OCEA 1VQAA 5C4XH 5M5XH 3NBHB 1AE2A 5LMNW 3NEMA 4YCVA 1SFOH 2HHHQ 1KHIA 1Y1WH 1OXXK 5LMUL 2WB1G 1C0AA 4LF8L 2AMCB 2KHJA 4OWWB 2B63G 4DUZQ 1SROA 3KDFA 3AFPA 2ZJPA 1YHQA 1HR0L 4DV1Q 1I5FA 2JA8H 4L5TA 4R1JA 4JI8L 4A3EH 4J15A 5GAGC 2VW9A 4MNOA 5ELOA 1VQ8A 1VQMA 4JI3L 3FKIG 2XGTA 3KF8B 2JA5H 1E7ZA 2LXJA 3KLWA 5C3EG 5C44H 2ZM6L 3AEVA 2KCTA 2KHIA 2NZOA 3A5ZB 3BZKA 4MTNA 1Y1VH 1E24A 2MQHA 1KRTA 1PH9A 1VQ9A 2OWOA 2GVAA 1EWIA 2CFMA 3HFZB 2UU9Q 3PIOA 1OTCA 1VQGA 4PZ6A 1HR0W 1YVCA 4Y7NH 3J80i 3HOVH 3I56A 2QGQA 3KYHC 2YTXA 4DR7L 3PUZA 4JYAQ 2B3GA 1YI2A 1V43A 2WAQE 2JEAI 3S16H 1QUQA 2B63H 1DGSA 3TQYA 2F3IA 3GTKH 1WOCA 1A8VA 1YNXA 1VQDA 3JAMc 1WCMG 3W1GA 1IZ6A 3DM3A 1VQLA 1VQFA 2HT1A 1ASZA 4DR5L 4GLXA 3TREA 5IP7G 4B3SQ 1TWHH 2AHOB 5GQOA 4R4IA 2UXCQ 5M3MH 4NXMQ 1TXYA 4DV0L 4PG3A 3G4SA 4LF9Q 1IXRA 3F1ZA 3G71A 2Q2IA 5BR8Q 5LMNQ 1GM5A 3HOZG 1VS0A 4A3CG 3F2BA 1PH1A 3WWVA 4AYBG 1HJPA 3A74A 4POGA 4QQBX 4DV4L 3M9BA 2E2IH 1HNWL 1PVOA 5IWAQ 4X66Q 1X9NA 3PSIA 2L15A 1L1OC 2DUDA
chains in the Genus database with same CATH superfamily
3P1HA 1Y8NB 1GKHA 5C4HA 3CCMA 5FLXc 4A76A 1O80A 4R4OA 2OQKA 2EE1A 2DY8A 4A3DB 3U9OA 3NTKA 1MIUA 1HR0Q 1X3FA 3ICEA 1G6ZA 2PQEA 2MP1A 1UEBA 2KENA 4KN7C 2WV6D 4JI3Q 3D6CA 4QY7A 5I9OA 1ESRA 1LT5D 2NVTH 2EJGC 1HZ9A 4X3SA 5E7NA 1Y1WB 2NTTA 1BXTA 3K5NA 4EQOA 1EQQA 4YY3L 1Y14B 2XSCA 3GQBA 1OO9B 3DWPA 3Q23A 2EQSA 1RTOA 1YJWA 1SYGA 1SYBA 4OGQC 2PPBC 1S4ZA 4G57A 1IL2A 2F0UA 2J0TD 1QCBD 4IUNA 3RLOA 1EOVA 1LV9A 2PQAB 3FDTA 2DY7A 3R2IA 1A3TA 2EYMA 5BR8L 5LMNL 1JE5A 2VS1A 1DJRD 3S1RH 1JB7A 4O2DA 3HOYH 1SE2A 1ET6A 1B9NA 4J8QA 2N3SA 4LUVA 1PTOB 1TWHB 2VNUD 3VR2A 2R7DA 2QKIC 2UXDQ 5J22A 4XT1B 4XQNA 2EOTA 3MFGA 2OTJA 4A3IG 2VQEQ 3J81i 2FJ2A 4JI6Q 1BOSA 3HOUH 3X3MA 4L63B 2F0WA 4K8JA 5GADC 1D5MC 1KXLA 1RIPA 3JAME 1YZ6A 2N49A 5C0XI 2F0VA 2D5DA 3K0XA 4FDBA 3PCOB 1J5EQ 4LJZC 4OX9Q 2VUMG 4ZRZA 4C1NK 5IY0A 3M4YA 2JXMB 3KBGA 3R93A 1TT2A 1JE4A 3HOWG 2NZHA 1SYDA 4XTCS 5ELBA 1K3BC 3HOZB 1KABA 5GAHC 2BA0A 2K33A 3FKIH 2IX1A 1HNZQ 3S2HH 2KOLA 1G291 2ASBA 1MJEA 2CCZA 1K9MC 2WIIB 3T1YQ 3T13A 2VUMH 2NVXB 3RR5A 3K81C 4DPGA 2IX3A 2IJ0A 3PO3B 2RKSA 3PUXA 3QR8A 3HOWH 1SE8A 4HSPA 1TU2B 2D2CC 1ZYRD 2HCCA 4H13C 3DUZA 4OONA 2RCFA 1NSNS 2K7VA 2WB1E 1C7YA 4PNYA 1XJVA 1NCVA 3E3XA 1ET9A 2D0OA 2F4VQ 3CC4A 1XTCD 1QOHA 4X62Q 3CRKC 1SJHD 2YTVA 4P2CB 4AIMA 4IZ8A 2HIVA 4KKTA 1LTAD 1STNA 4B9WA 5IT9E 2NVQB 1E0BA 1K8MA 3H3VC 3BDCA 3NELA 4JVZA 4A3GG 1VQHA 3TZDA 4BBRB 4DR3L 4LFCQ 2KUMA 1JB3A 3S17B 2R7ZB 4DR6Q 2DNCA 1CSQA 1GUOA 2JQOA 4KHZA 4QF4A 5ELDA 5C44B 5EKKA 5IIFA 1HNXL 3RLNA 4JV5L 1O7ZA 3I4NG 1A2TA 1LT6D 4KHVA 4ZUJA 4B3ML 5E1FA 4GS3A 2H5XA 2MJ8A 2CH4W 4P72A 3VA5A 1TWGB 2A74C 1SBBB 5M9OA 2E75C 1KDCA 4PMBA 3AQQA 2JJQA 4X65L 1YHBA 2WAQG 3TP5A 3ULJA 1PH5A 4NDXA 3SGIA 3V2TA 5C3EB 4I7ZC 3CC2A 1EWHA 4FO2A 1CM9A 4DAVA 2F0NA 4DR1Q 2DGYA 4LK1C 5JPNC 4P74A 3TP6A 5COYA 2B2YC 4UPAA 1SMYC 5IGDA 4LFAQ 5TSSA 1SLJA 3OTOL 2B2VA 5I4DA 2YV5A 2E5LL 2PNRC 4X3UA 3CAMA 3OW7A 1TVXA 4IPDA 4UAIA 1F9QA 3VR3A 4DAYA 4C3JB 4JI5Q 1XPUA 4KHPL 1L1OB 4PV1C 1N33Q 5JJIA 1HZBA 4H02A 2Y0SB 1UNSA 2F0FA 4P73A 4CDEC 4EGVA 3HOXB 3M4OH 1JWUD 1XNQL 4GKKQ 4AYBB 4A3KH 4IQZA 3HEJA 3S2DB 4UHVA 3NUCA 2NVTB 1U5KA 2JA7G 4C3IB 2OT2A 1NR4A 4JBKA 1IBML 4KN4C 1AFPA 1ENAA 2D0PA 4RG1A 1XNRQ 1BBWA 4JI0Q 1PYBA 1TS4A 1EEID 4JI4Q 4A3FG 4QB4A 2UUBL 1B7YB 2RDHA 2YYZA 4GKJL 2F0TA 1FJGL 3SDZA 3GTOH 3F8TA 1EFID 1QB5D 3EROA 3OWFA 3DLLA 3S1MH 4IUQA 4EVOA 2JA7H 2FXQA 3SK6A 4C1NI 1QZGA 2PW5A 3CC7A 2NVYH 2Q8IB 2SEBD 4KK7A 3SK8A 4FXDA 3K7UC 4IPGA 4PZ7A 3GTJH 4GNXA 1PZKD 5KRUA 1A2UA 1B2TA 2B39A 4A3FH 4ZAIA 4KMUC 1ZYRC 4BY1G 1F9SA 2F0GA 1EYAA 2L11A 2CW0D 4FYDA 3STBC 2P5ZX 2LKVA 1PH3A 5EJWA 1B50A 3L9AX 3J81E 5C5LA 3ULLA 5IYCH 2A1AA 1AZPA 3UE0A 4JI1L 1PHJA 1V8QA 4OELB 2QA4A 4IUTA 4YHHL 1NY4A 2SNSA 3K7AB 2F0HA 4BY1H 5IGFA 1YBYA 4JI7Q 2D9UA 2FINB 2IY5B 3SK5A 4DV7L 4A3IB 3OMCA 3G6EA 2ZJQA 1FNVA 4DK6C 2EYOA 4RKLA 5ISRA 4R4TA 3HZXA 4A3JH 4QIWB 4DV6L 5C4XG 2RDFA 1VQPA 3WDNA 1WJJA 1Y1WG 1OXTA 1B3AA 3K57A 4LNQA 3V05A 4G4KA 2L55A 4DK3C 2A68D 4DR4L 1VMPA 1EOTA 3BU2A 2EXZA 3NK9A 3D31A 1QJOA 4UDUC 4JI2L 4A3DH 1CT1D 1EY4A 2CHBD 2KQ3A 3PIP3 3HOWB 3D6WA 1TIID 1L2FA 3RZOH 3KFUA 3EJIA 3L7ZC 1GVPA 1MHWC 4HCSA 3E5SA 3HKZG 4IUPA 5C4XH 1IKMA 3NEMA 2F0QA 5LL6S 4BWGB 1Y1WH 3QOLA 2AMCB 2KHJA 3NP8A 4QCLA 1HR0L 2ZJPA 3VYUA 4DV1Q 2F0MA 1JCKB 3KUPA 2VW9A 1VQ8A 4JI3L 4JK1C 3KLWA 2B8FA 2KJXA 3BVMA 2KCTA 2LFNA 3DEPA 1KRTA 1HFGA 1B53A 2UU9Q 3PIOA 4ZYSA 3J80i 4B9XA 3I56A 2QGQA 4JYAQ 2JEAI 1SNQA 1QUQA 3DXJC 3TQYA 2JA6B 4IALA 1VQDA 1WCMG 2M2LA 2DN8A 1KDBA 1VQFA 1G91A 2YU9B 4GLXA 1VDZA 3TREA 4I7AA 5IP7G 2ICIA 3WOFA 1PTOH 1TWHH 2AHOB 1YNJD 5GQOA 1HTLD 3A7AB 1ICFB 1TXYA 1C48A 3Q6SA 3U9SA 4A3GB 4DV0L 1TWFB 2EY1A 3HOZG 1GM5A 3KLRA 1TWAB 1VS0A 4F88A 4CDDC 1PH1A 1HJPA 3A74A 5E4XA 3I4NB 4FF4A 1R9TB 4HAEA 1PVOA 2QDLA 1X9NA 3Q22A 5CV8A 3PO2G 5IP7H 2A73B 1PH4A 4JI6L 4KTAA 5EPLA 5LMUQ 1LUZA 4YWKA 3PIO3 1GUTA 4IFDH 3IL8A 1CKNA 1CSPA 1XTDA 2WAQB 3N6RA 4ZKCB 3PQIA 1HHVA 4LWCA 3HOZH 5CYUA 1PH2A 1LM0A 3CCRA 2E2DC 3GDEA 1HQMC 1J5EL 4GOPA 1UE6A 4OX9L 4DAPA 2K5NA 4MTKA 1SFOB 3G6JB 2XTIA 3QIAA 3UI2A 4GLAC 1Q1BA 1N8RC 3PO2H 3W3AA 2JA8B 2N88A 4DR7Q 1GJXA 1KDAA 5C3WA 2NVXH 1VQBA 2R93G 3PO3H 1S5CD 4JG2A 5ELNA 1S72A 1Q90A 1CFMA 2MUYA 2M00A 4WJ3M 1O78A 4LF7Q 3VYTA 1HFNA 1BO0A 2UXCL 3ERQA 2QEJC 3MEHA 4NXML 4KD4A 4ZK9B 2OQ0A 3J81c 1JJGA 1UE7A 3DM1A 5A2QE 2ES2A 4KY6A 2R7FA 4O0AA 4FP5D 3I73A 4IO9A 1PZJD 1HUNA 1KQSA 2R93H 1SYFA 2F0KA 4ME5A 4OXPA 5IWAL 1YEZA 1EQVA 1RCVD 5FLXL 1K8AC 3K5LA 4AH6A 4ID6A 3W2DA 2ZXPA 2NVQH 3H0GG 2UXBQ 1XWEA 1PH6A 3MXPA 1L1OA 2O2LD 4A3LH 2VXWA 2Q2TA 4GN3B 4BBRH 2Z0SA 5I6YA 1JJ2A 1KLGD 4X62L 3S17H 2EY6A 4A3FB 2R7ZH 4YWLA 2Z8LA 1UUPA 1S5DD 3I2ZA 4MZ9A 2QF7A 1VQCA 3FP9A 2LXKA 2UUAL 4RA8A 4DGZA 4DV5Q 1PDQA 1R4QB 4LFBQ 3RUZA 4DAYB 2B2WC 1B44D 3F2UA 1TWGH 1HCZA 4K2LA 4DR6L 3KDFB 2E74C 2KEEA 2FHTA 1K83B 3CCVA 3D0FA 4A4IA 2PZTA 4K6LA 4CDFC 2E2HH 2Z4IA 3Q24A 4BY1B 4PMCA 1DCZA 1FNWA 1SNDA 5C3EH 1FGUA 5I6WA 1CQFA 2K04A 4IFDI 2I46A 4FNFA 2EYHA 1JR0D 3SXHA 3CCEA 1PFSA 2G9DA 5I2YA 5IGGA 2Y0SG 4BS9A 3QWNA 5A35A 3HOXG 3VR5A 2L5TA 1I94Q 3DEOA 4XYQA 3P75A 2K05A 1WTVA 4CDCC 1A0IA 1QE6A 2KEDA 1U0LA 4GLVB 4R4CA 4UP9A 1XPRA 3OW2A 1PYWD 1SXTA 1L0WA 4C3JH 2JP1A 2VQFQ 3EFXD 3P20A 5M5YH 2M9VA 4HIKA 2V1CC 1Q8KA 2B2VC 2K1BA 3T51B 2HDMA 3RZOB 1WTWA 3QB3A 4GN5A 3HOXH 4GNXB 1F9RA 5A2QL 3PUVA 5C5MA 4NKLA 3T56B 4A3CH 1E1OA 2SDFA 1SNPA 3S2DH 5C4XB 1U9RA 2QW7A 4JI5L 2Q2HA 1XMQQ 1N33L 4C3IH 1XXGA 3AFQA 2Z9HA 1T5EA 3CPFA 5IE8A 1DD2A 4KY7A 2CKZB 4H7BA 1O7IA 1AE3A 4B3TL 4LF4Q 4JOIA 4N8FA 2Z6KA 5C4JB 3OIQA 4DNRB 2K4KA 1FNUA 3T16A 3HKZB 3ZYYX 4ZUIA 1LTID 2HQEA 1FD7D 2ZTCA 2H4OA 1EIGA 1XNRL 5CV4A 1I6VC 5CR3A 2TMPA 2WP8J 3PUWA 1PTOF 4LUOA 4S3SA 4PMWA 5KGUA 1X3EA 2R3ZA 4BXXG 3E9HA 4AYBE 1PA6A 3CQZH 4WJ4A 2NB0A 3OPOA 3S1NB 5JEAJ 1U4LA 3FRPB 3HP3A 3CCUA 1ZEQX 2XWJB 2C9OA 4A3EG 3T1HQ 1JWMD 3IKJA 1X65A 2JA5G 1WCMB 1RHPA 4ODGA 1VQIA 1I4GA 1Y1VG 5DM73 4LF6Q 1I4RA 3K7AH 4Q0FA 2MO0A 4OL7A 4E6IA 3HOVG 1AH9A 1C4QA 2CVRA 1DOLA 2JA9A 1KD1C 4C3HG 4A3IH 1RKNA 4C56C 3HKSA 3U50C 3I7FA 1BR9A 4K14A 4NXNL 1STHA 3A8KE 5BN3A 2F03A 1NE3A 2RQXA 3NBIA 3RLFA 1E1TA 2PZWA 4B3RQ 4K0KQ 4N9PA 2ALYB 1D7QA 1Q46A 5M3MG 3TS0A 3LGJA 3PO2B 3U58A 2RA4A 1N32L 5JVG3 5IYBG 4C3HH 2QEXA 3I55A 1QUQB 1WTOA 1EUJA 1VQEA 4DR2Q 4C3IG 4FVMA 3GTQB 2PI2A 2B2UA 3H15A 1PTOC 3G48A 3R8BA 4ZKBB 3JC66 1C9OA 2AKWB 2VY3A 1NMFA 1CTMA 3VYRA 2UUCQ 1SSOA 1HUMA 1N34Q 1EYGA 3C3LA 1VQ6A 2F0DA 3Q0AA 1LTRD 4HIOA 5GAEC 1JORA 3I3CA 4QUCA 2N8NA 1R4PB 2B2TA 2EY5A 3B6YA 4GN4B 2JA6G 1AEXA 2MHVA 5IOCA 5IYBH 1ONLA 3MEFA 5KEEA 2R93B 2F3VA 4QIWE 1ENCA 5EBCA 4DKAC 1I3QB 1B1ZA 1NUCA 1UEAB 5E3FA 4EQNA 3RZDH 3SHLA 1JC7A 3MZ5A 4DXGA 1NBWA 4RWSC 2XVSA 4JW0A 4L5RC 1A15A 2PCFB 2NN6G 4F7XA 1YHAA 4X64L 3HGBA 1PFNA 5DNFA 1CKNB 2JA6H 4QUFA 4JI8Q 2K75A 2F0EA 1CUKA 3EVQA 5JEAG 3PGZA 4RGNA 2YU9H 4GOPB 5HGQA 3H0GB 2PMZE 1XMOL 4JYAL 2F0LA 1EY5A 3L2PA 3JAML 4Z9CB 5JJLA 1BDOA 5C4ZA 4A3GH 4DU9A 4KLKA 4CHTB 4R8IA 3IRBA 2F0OA 3BDLA 4AQYL 3GTLB 1KIXA 1TWFH 1U4MA 4CJ2C 2E2HB 1XPOA 1P8LA 1VQJA 1CZWA 1TWAH 1DYQA 2GA4B 4HJ9A 3MXGA 1F2LA 5CGKA 3I4NH 2DJFC 5JEAH 1R9TH 2AQ2B 2ZXRA 1A62A 2ZXOA 1LABA 2KCNA 3DMUA 4RFBA 3NTIA 2XIWA 5NUCA 1JJCB 2JA8G 1TQOA 3KOJA 2BCOA 3D4DA 3SEBA 1K73C 2K5HA 1D5ZC 3F2CA 1N36L 1Z6HA 2EYFA 3FPUB 2ZJRA 3QG1A 1GHKA 2IT1A 4DXFA 1OXVA 2A6ED 1HQRD 5L37A 3NBHB 1SFOH 5LMNW 4YCVA 2HHHQ 2EYLA 1KHIA 2OWOA 1GUSA 5LMUL 2F0SA 3TMEA 4LF8L 5M5YB 3KDFA 2JA8H 3BS1A 1NAPA 3MFYA 4MNOA 5M5WB 4ULLA 3NXWA 3DWAA 4GOPC 2KHIA 2NZOA 5CC4A 3NSWA 2K6AA 2XNAC 1E24A 2MQHA 4HTHA 4CJ0B 1CK1A 3D8GA 1VQ9A 2CFMA 4ZQ3A 2IW3A 5D65A 1OTCA 1EYDA 1EY7A 3AU7A 4Y7NH 1NR2A 4DR7L 1YI2A 5IT9L 2WAQE 3OMGA 1DGSA 1WOCA 2WKCA 1YNXA 3JAMc 5EGTA 1IZ6A 1VQLA 1H9KA 5JOBA 2Z1CA 3FVQA 4B3SQ 1AP0A 3NPPA 4ZCKA 1IXRA 4N8X1 3F1ZA 3T53B 3G71A 2Q2IA 5BR8Q 5LMNQ 3D4RA 2JSOA 3CQZB 5EPKA 3WWVA 3M9BA 2NZ1D 1Y8OB 5LHY1 2L15A 1L1OC 4NPSA 1JOQA 5JJZA 1WYDA 3M4PA 3T4AC 2KECA 1JT8A 4HIMA 3URYA 5DAUA 1EIYB 4K5WA 1K0RA 4A3BG 4QJFA 3I4OA 3I70A 3MWYW 1EQTA 3GP7A 2SNMA 1L0XB 5HURA 1HH2P 3S1QH 4CKBA 2EVBA 2KA7A 1ILPA 1K83H 1K8OA 5KNCA 4K2KA 4DNIA 2RCNA 1KAAA 5K36G 2ID0A 2PO4A 2ZM6Q 5M5XB 2A69D 3WOEA 1QNKA 1TR5A 1U4RA 3KK7A 3TZUA 3I90A 2AWNA 4A3EB 3K6OA 4A3BH 1EZ6A 3GD7A 5CBEE 5K5PA 2JA5B 1XX8A 5IT9c 3TRZA 1UWVA 3A8JE 1Y1VB 3CCSA 1LTLA 4WJWA 2VB2X 1TWCH 1SNCA 4RAUC 3HOVB 1SR3A 2EIFA 4IN3A 4JBMA 5HY6A 1PV4A 4OIJA 3KF6B 4C3HB 5EPJA 3GTKB 1UE5A 1F2ZA 3U4ZA 2R6GA 2OTLA 1VQKA 1IYUA 1BUVT 1BNZA 1DXMA 1EU4A 4BA1I 2A5HA 1JWSD 2H1EA 1SE3A 1Q81C 4X66L 4DK1A 1WI5A 1YNND 2GN5A 1BKBA 5CV5A 5M3MB 1TS2A 3MVVA 4HJ5A 1KC8C 1F2MA 2MNAA 2VQFL 2WINB 1EY0A 4J6HA 5CV9A 4FXKC 3RZDB 5C4JH 3I4MG 4BA2I 2L9HA 4KY5A 1EFWA 3RN2A 4HJ7A 1XMQL 3UDFA 4LF5Q 3K0YA 1LACA 5IYDG 1TY2A 1KRSA 1B9MA 3EIVA 1SRUA 3VYSA 4FXGC 4JOIC 1H9RA 1X3GA 4LF4L 2Z6KC 2HCIA 5ELFA 4A93G 1JOOA 4DR3Q 1CQVA 4CGYB 3K5MA 2V4DA 1IHZA 2FMMA 1Z7TA 2IHEA 3J81L 1HNXQ 4N9TA 4DUYQ 3TEHB 4HN7A 3GTMH 2C5CA 4B3MQ 1SN8A 4C2MB 3NHHA 2QILA 3S1NH 5IYDH 1CA6A 5JJKA 1EEFD 3CD6A 4QL5A 2R92G 3MXUA 1CKMA 4IUVA 5ELCA 4OWXB 1G2SA 1SNMA 5FKAC 1Q82C 4A93H 4XXEA 5M3FG 2JE6I 1WCMH 2IHFA 3HKZE 4DV3Q 1I4QA 3D4WA 2UXDL 3KJOA 2E76C 1ASYA 1VQ7A 2VQEL 1K3RA 3U4VA 2KCMA 3T1HL 3AB9A 4PZ8A 5C0XJ 5I9PA 2QCPX 3S14B 2JYOA 3OTOQ 2BOSA 1J6QA 5M3FH 2JEBI 2WACA 2F0JA 1MSHA 2CW0C 1A3UA 4Q5VA 1H95A 1MBYA 3CXCA 3CCQA 2JK8A 4CKEA 2I07B 3A54A 4XDXA 4I65A 4DNTB 3MAQA 3K8AA 1V1PB 1S5BD 4OEMB 2EYPA 3VDYA 1QVCA 3NENA 4B3RL 2J4XA 1HNZL 5CORA 1P16A 2A19A 3I4LA 3GTQH 5D14A 4DAMA 1WTHA 3UDIA 2NBFA 2RDGA 3UE1A 1LTTD 1QZHA 1H9SA 3TSSA 4Y7NB 4ALPA 3T1YL 4RCOA 3GV6A 3GV3A 2EY2A 3PMFA 3PUYA 1X6OA 2RSOA 4IJHA 2B2UC 4QMGA 3GTGB 3CF5A 2MGSA 4L5SA 2AWOA 2F4IA 4WFN3 1I3QH 3H09A 1F77A 1EY9A 2UUBQ 4GKJQ 3IFTA 2FMCA 1B3QA 1KAWA 1HZCA 3NBHA 1STGA 5G3LD 2OF1A 2ZT9C 2A68C 2CWPA 1ENFA 2B2TC 1D5XC 2F4VL 1XYIA 2F52A 1Q1EA 4IJLA 2Q2UA 1G51A 4YCWA 3CMEA 2EDGA 3PF5A 1WVLA 3A55A 4KI0A 4TQUS 3J7YW 2IX0A 1EYCA 1WTXA 4DV2Q 2LMCB 3RN5A 5FLMG 1EY8A 3W5OA 2XRQD 3L0OA 1ICWA 2AUJD 3H0GH 1K28A 3NE5B 1OXSC 1HZAA 2BA1A 4LFCL 4FF1A 3S1QB 3GTLH 1T9HA 1I4XA 3J7ZC 4JI1Q 5KNDA 1KNEA 4YHHQ 4HMIA 2A8VA 1V1OA 2OXPA 1VCIA 3E0EA 4APVA 2Q8RE 4KJOA 5JAVA 4LMQD 4NW2A 5FLMH 2MFIA 2X6LA 5C0XG 4HJAA 3FHWA 4A3BB 4LW1A 4DV7Q 1ZKOA 1X55A 1TWCB 3ZJYC 1NNXA 3H3VI 1QWYA 4DFAA 4DR1L 4DV6Q 1YNJC 3FEWX 1JMCA 3QJYA 1PLFA 3MC0B 3D3RA 5KIXA 4EQ5A 3BYTB 3VR4A 3R3OA 4LFAL 4DR4Q 4KJNA 2KVMA 1A63A 4JI2Q 1EL0A 1GUNA 1IBKQ 2E2JH 1SJED 5M5WH 1WTQA 5IGEA 1I50B 2HHHL 3LX0A 4G7OC 4RGTA 4KKUA 1SYEA 2R61A 4BBSB 1JQYD 2N78A 3R2TA 2EJMA 4TSSA 4L5QA 5FO9B 2O4XA 4XYOA 1BBUA 2Z4HA 4NP5A 3C2PA 2K14A 4UP8A 3ULPA 5AJ3Q 4GKKL 4JC0A 4JCVE 2OEOA 2VB3X 1O7LA 2X6GA 1J8IA 2KBNA 3J80E 2GVBA 1IBLQ 2Y0SE 3KF6A 3GTPB 3N52A 4JI0L 1B70B 4JI4L 2VZAA 2K5VA 3HOYG 1T5XD 3IFDA 4HSVA 3TS2A 1Y8PB 5CV6A 3I4MB 4X6AH 1KNAA 4EX5A 1PH7A 4B3SL 3GTMB 5H1SE 2B29A 1BQQT 1WTPA 1LTSD 1MSGA 4CKCA 1EIFA 3KJPA 3NWSA 5JVH3 1Y69U 2L0CA 3ERSX 3CMAA 3HOUG 4GNXC 4DV0Q 1GD7A 4A93B 1RL2A 1SMYD 3TN2A 1TKWB 4BXXH 2RBMA 4JBWA 1SE4A 1Q3LA 1E22A 1YJNA 3CRLC 2HDLA 1PFMA 5M5XH 3EA6A 4B08A 3DHQA 1GUGA 1AE2A 1OXXK 2WB1G 2Q8TA 1LLRD 5EBDA 3S15B 4OWWB 2B63G 4DUZQ 1SROA 5IODA 2R92B 1STAA 1PZID 4A3EH 4J15A 5GAGC 3ITPA 1E2VA 3FKIG 3KF8B 2JA5H 1E7ZA 2LXJA 2LY7A 5M3FB 2ZM6L 1GXDC 3A5ZB 3AEVA 4JI7L 1Y1VH 1PH9A 2GVAA 1EWIA 3MTSA 1VQGA 4PZ6A 4ABNA 5AFWA 3HOVH 2XRSD 3KYHC 2YTXA 3PUZA 1BF4A 2B3GA 1V43A 2B63H 2K5WA 3GTKH 1A8VA 4FF2A 1CA5A 4MIUA 4YIJA 3RD4A 4HEDA 5DEHA 1X3PA 2IL8A 5IGCA 4R4IA 2UXCQ 5M3MH 2G9HD 4NXMQ 4BY7B 5CV7A 1SAPA 2F3WA 4PG3A 3G4SA 4LF9Q 4L6TB 1IW7D 4XQQA 2KHSA 4RHSA 3J80L 3F2BA 4QQBX 3ONAB 3ND8A 1E2ZA 4OHJA 5IWAQ 1FYCA 2EJFC 2DUDA 5EKLA 3STBD 5J3BA 3I8ZA 1VQ5A 3UDXA 5FO7B 3E6ZX 4DV1L 1II3A 1TS3A 1V1PA 3OYYA 1DONA 1WD0A 2L12A 2EXDA 4HMJA 2D62A 1VF5C 3CHBD 5CMDA 1HPCA 4LF5L 2UU9L 2HQLA 1AZQA 1FGBD 2UUAQ 1LTGD 3OHXC 4TVAB 4C2MH 4A3MG 1G2TA 2G5DA 3BDOA 1SYCA 2PZUA 1K8GA 1JICA 3KBXA 2B2WA 2WFWA 3AYHB 1FL0A 2NN6H 3PF4A 3ND9A 4L8JA 5DM63 4DUYL 1GHJA 1MKHA 1NJIC 3SE0A 1WTRA 4RGMA 1LT4D 1Q86C 3A7LA 4DR5Q 1H9SB 5EQ0A 4DN4M 4KD3A 1HXYD 1STYA 2PNHA 4R8NA 2EYJA 1YJ9A 3CKIB 4A3MH 3S16B 1B4OA 3BJUA 1LTBD 1FVIA 3PV0A 2AQ3B 3A0JA 2I5LX 1AW7A 3J7AF 4DV3L 1L0YB 1J9OA 4R4QA 3S14H 1KLUD 3CW2C 3E0JA 3H6MA 1E3PA 3J80c 4DV4Q 2RF4A 1Q12A 1RTNA 1HNWQ 1TY0A 1PRTD 3V96A 4K6DA 2ZTDA 2Z6BA 3DWQA 4XT3B 4F87A 1BBXC 2QDBA 4UP7A 1I6HH 1LT3D 4CJ1B 2PI2E 2E2JB 4A3KG 2BH8A 5F2DA 5EKIA 4IPCA 1M1KC 2E2IB 1DOMA 3A8IE 3C46A 5IGBA 1DOKA 1UAPA 2HUGA 4U68A 1EY6A 4WORA 2AQ1B 1A3VA 1D2BA 4H44C 5I2XA 2MO1A 4FF3A 5BN4A 4M8AA 4YY3Q 3L3OC 3GTGH 4B3TQ 1SEBD 3LWUA 4LF7L 4H0LC 1QVGA 1YIJA 1SMXA 2RVLA 3SVMA 4TKOB 1STEA 1WFQA 3MXNB 1BVSA 3UDGA 3TP7A 5D3DA 3TDQA 2SOBA 1EZ8A 4HR7B 4R9WA 3TBIB 1V9PA 4PQXA 1CKOA 1QILA 1DM0B 1X56A 1HA6A 4YCUA 2ENBA 4G7HC 1LYLA 1W2BA 2UXBL 1IYVA 2NN6I 1SNOA 3A5UA 1MGSA 1S5FD 3MHBA 3A56A 4IPHA 5IYCG 2LSSA 4JPBW 1IW7C 3C1FA 5KNBA 2BE5D 4K8IA 3S1RB 4RMFA 1F9PA 4ILWA 1G8ZD 3HOYB 1VQOA 4TRDA 1AN8A 3QO2A 1PRTF 5J1ZA 4DV2L 2K03A 3M3YH 5GROA 4DV5L 3E9IA 4LFBL 3M7NA 2C35B 1EWCA 1ML0D 1BCPD 3PIPA 1D6EC 3BVZA 4IURA 1PRTB 3W1BA 3K80C 5JPMC 3HOUB 4OO1G 3CCJA 1SDFA 3O13A 4LUZA 4P71A 4A3JG 1DZ1A 4IFDJ 1ILQA 1W3SA 2K5QA 4GZYC 4WRDA 4NXNQ 3EBEA 3K59A 3HG9A 4Y52H 1EIHA 5K36H 3EQLC 2I5HA 1V1QA 2I0QA 2E8GA 4BBSG 4G7ZC 2PQAA 1M8AA 2ZTEA 2FFKB 2WB1B 2VL6A 1N32Q 1Z9FA 2B63B 4A3DG 2CQAA 3K5OA 1VMCA 1C8CA 1I94L 4OO1H 3BVGA 1D1KA 1LO5D 1UE1A 3FKIB 2O5JC 3S2HB 4EQPA 1STBA 3I72A 1E2WA 1VQ4A 2F0IA 3M85A 1I50H 3BZCA 5IP9G 2VUMB 3C1EA 3Q8DA 2IPKD 1M4VA 4BBSH 5C3XA 5T1GA 2ICEC 3G7LA 1S40A 4RGOS 1QVFA 4F8MA 1M90C 3AMUA 1IBKL 1B8AA 1NTGA 1PXUA 2K28A 3KLSA 2RSNA 3KF8A 1PMRA 3VR6A 4O42A 2ATWA 5FK9C 4ME3A 2AUKA 3OOCA 3MA2B 2A6EC 4IOCA 1PRTC 2DJGC 1N9WA 3CU7A 5IP9H 2PMZB 1ESFA 2RHQB 3GTPH 2BH2A 4O1NA 1HTPA 4KKSA 5AJ3L 1I4PA 1D8LA 5T1IA 1RF2D 2NWGA 1F2YA 4X64Q 2X69A 2HD3A 3ER0A 4P75A 2EZVA 1BCPF 2F1MA 3I4MH 4JV5Q 1I4HA 1OXUA 3X3NA 2JN4A 2CH4A 5D3IB 1IBLL 4DK0A 2NYZD 2BDOA 1XMOQ 2NUCA 1BCPB 4HJ8A 5FLXE 1O7YA 4K5XA 3HRZC 2K52A 1YITA 4X65Q 4AQYQ 2MPMA 4XIGS 4NB3A 4HIDA 4IOAA 3K58A 3J7A5 3P7JA 1H9MA 2A6HD 1NMGA 1PFBA 2NTSA 4MN3A 4A3MB 4IFDG 2CWAA 5DLQE 1K0SA 2K32A 3S15H 3BYYB 1W6JA 3RMHA 3CCLA 2R92H 4LF6L 4QGUA 2WKDA 1IKLA 1H9JA 1S5ED 2B2YA 3M4QA 3OSOA 4DA2A 5C6AA 1N36Q 5HGTA 3JAMi 2E5LQ 1X54A 2RHSB 3QOJA 5FJ8G 1Q8IA 4IUUA 3CPWA 2BDNA 3F2DA 4OO1I 4BY7G 4DUZL 3J81j 1VQNA 3H3VH 1FR3A 1I6HB 4KHPQ 4UY8C 3OIPA 2BE5C 4LF8Q 3PO3G 3LWEA 4JBJA 3H94A 4CBVA 1EQRA 4OWTB 5FO8B 4K0KL 5J39A 5LL6X 1Q7YC 3M7GA 1XNQQ 4V190 1JOKA 3NTHA 1TS5A 4KV6A 2A69C 3RNUA 5FJ8H 4RH6A 1BCPC 5BN5A 3S24A 1KL9A 3FPPA 5KYLA 3SK4A 3LNNA 2O5IC 4RHRA 3EN2A 1IBMQ 1IYJB 1X3QA 4BY7H 3BZDB 2PYKA 3GO5A 3M4OB 4DR2L 4YWMA 4POFA 2HIXA 4A3KB 1CHPD 3KLSX 4K5VA 1MJCA 2UUCL 1N34L 1GO3E 5EAYA 2YTYA 1FJGQ 1CHQD 4M1UB 4A3LG 1QNUA 1GUWA 4LF9L 4A75A 1Z47A 4BBRG 1G6PA 1PH8A 4U673 2LS01 2CQOA 1W6KA 2DNEA 3CP0A 4LAAA 2R7ZG 1EU3A 3FMCA 2I5MX 3OWEB 2PW7A 5C44G 1PYSB 2XWBB 1WD1A 3GTOB 1ZXTA 2K50A 3S1MB 4XQJA 1S3OA 1YNNC 2K5DA 4DF7A 2OCEA 2JA7B 1VQAA 4HCEA 2L1BA 3SR1A 2TSSA 4OIKA 1HRJA 2K01A 1C0AA 3S9WA 4V0BA 2NVYB 5CBAE 3AFPA 1YHQA 3GTJB 1I5FA 4L5TA 4R1JA 4JI8L 2KCCA 5ELOA 3IAYA 1VQMA 2XGTA 1MI2A 5C3EG 4ZLTF 5C44H 3M3YB 1D1IA 5FOBB 3BZKA 4MTNA 3HS0C 4RCNA 2XN9C 3BG3A 3HFZB 4J1MA 5E4WC 3TP8A 3MXNA 3NWTA 1HR0W 4RKBA 1YVCA 1CZGA 3J7AV 4NMZA 1RD9D 1IL8A 3NQIA 3S16H 2F3IA 2B8GA 3I91A 1QG7A 3H91A 3W1GA 3DM3A 2IWHA 1PTOD 2J7ZA 1MD2D 3NQTA 1RODA 1GOZA 2HT1A 1U4PA 1ASZA 4DR5L 2N55A 5KYIA 1X32A 4MHEA 4C3JG 1KTKA 1VF7A 5C0XH 1CI3M 1RJTA 4X3TA 1RDPD 4A3JB 2L4NA 4A3CG 4X3KA 4AYBG 5G3LF 2EPBA 3VA7A 4POGA 4DV4L 2F0PA 5ELEA 2E2IH 1HNWL 1HA5A 4X66Q 2A6HC 3PSIA 1A6XA
chains in the Genus database with same CATH topology
1WYDA 3PO2G 3M4PA 1GKHA 3CCMA 3STBD 5IP7H 5FLXc 4A76A 5J3BA 1VQ5A 1JT8A 4HIMA 3UDXA 1PH4A 1EIYB 4R4OA 4JI6L 2OQKA 4DV1L 1K0RA 5LMUQ 4A3BG 1LUZA 3I4OA 4QJFA 4YWKA 3OYYA 1CKNA 1MIUA 1HR0Q 1CSPA 1X3FA 1XTDA 3ICEA 1HH2P 2EXDA 3S1QH 1UEBA 2D62A 4LWCA 3HOZH 1K83H 2KENA 1PH2A 4DNIA 1LM0A 2RCNA 3CCRA 4JI3Q 5K36G 2ID0A 4LF5L 3GDEA 2UU9L 2ZM6Q 2HQLA 4QY7A 1J5EL 4GOPA 1UE6A 4OX9L 2NVTH 2K5NA 1HZ9A 5E7NA 2UUAQ 2XTIA 4TVAB 4GLAC 1Q1BA 4C2MH 4A3MG 1N8RC 3PO2H 1EQQA 4YY3L 1K8GA 1Y14B 2WFWA 2AWNA 3AYHB 4DR7Q 2NVXH 1FL0A 3PF4A 4A3BH 3GD7A 1VQBA 2R93G 2EQSA 3PO3H 1YJWA 5IT9c 3TRZA 4JG2A 1UWVA 5ELNA 1S72A 4DUYL 3CCSA 4WJ3M 1LTLA 4GOPC 1MKHA 1NJIC 1IL2A 1TWCH 4LF7Q 2UXCL 1Q86C 4DR5Q 4NXML 2OQ0A 3RLOA 1SR3A 2EIFA 3J81c 4JBMA 1UE7A 5HY6A 1EOVA 2PNHA 1PV4A 2ES2A 1JJGA 2PQAB 1YJ9A 4A3MH 3KF6B 2R7FA 3BJUA 1UE5A 5BR8L 5LMNL 3U4ZA 1JE5A 2R6GA 2VS1A 1FVIA 3PV0A 3A0JA 4O0AA 4IO9A 2I5LX 1VQKA 2OTLA 3S1RH 1JB7A 1KQSA 4O2DA 4DV3L 3HOYH 4BA1I 2R93H 4R4QA 4OXPA 1Q81C 3S14H 4X66L 5IWAL 1YEZA 2N3SA 3CW2C 1K8AC 1WI5A 4LUVA 1E3PA 4AH6A 2VNUD 3J80c 4DV4Q 2RF4A 1Q12A 2GN5A 2R7DA 1BKBA 2NVQH 1HNWQ 3H0GG 2UXDQ 4HJ5A 1PH6A 2UXBQ 1KC8C 1L1OA 2ZTDA 2MNAA 2VQFL 2OTJA 4A3LH 4A3IG 2VQEQ 2Q2TA 3J81i 4JI6Q 4GN3B 4UP7A 1I6HH 4BBRH 2Z0SA 3HOUH 1JJ2A 2PI2E 4X62L 3S17H 2R7ZH 4YWLA 4A3KG 5GADC 2BH8A 5C4JH 3I4MG 4IPCA 1M1KC 4BA2I 1RIPA 1KXLA 3I2ZA 4MZ9A 1YZ6A 1EFWA 1VQCA 3FP9A 2LXKA 2N49A 4HJ7A 3RN2A 1XMQL 2UUAL 3UDFA 5C0XI 4LF5Q 3K0XA 4FDBA 4DV5Q 3PCOB 5IYDG 1J5EQ 4LFBQ 4OX9Q 2VUMG 1KRSA 3EIVA 4DAYB 1SRUA 2MO1A 1TWGH 4JOIC 5IY0A 1X3GA 4LF4L 4DR6L 2Z6KC 3KDFB 4YY3Q 4A93G 4DR3Q 3HOWG 2NZHA 4XTCS 3GTGH 4B3TQ 3CCVA 3D0FA 4A4IA 5GAHC 2BA0A 4LF7L 2E2HH 1QVGA 2IHEA 3FKIH 1YIJA 1HNXQ 1HNZQ 1SMXA 5C3EH 1FGUA 4DUYQ 2IX1A 3S2HH 3TEHB 3GTMH 4IFDI 4B3MQ 1SN8A 1G291 1WFQA 2ASBA 1MJEA 2CCZA 3MXNB 1K9MC 1BVSA 3S1NH 3CCEA 5IYDH 1PFSA 3T1YQ 2VUMH 5JJKA 3CD6A 4QL5A 3UDGA 2R92G 3RR5A 3K81C 1CKMA 2Y0SG 4DPGA 4OWXB 3HOXG 4GKKL 1V9PA 1Q82C 4A93H 3PUXA 1CKOA 3HOWH 1SE8A 1I94Q 1X56A 2JE6I 5M3FG 1WCMH 2IHFA 3HKZE 4YCUA 4DV3Q 1LYLA 1A0IA 1U0LA 4GLVB 1W2BA 2UXDL 3KJOA 4OONA 2UXBL 4R4CA 2NN6I 4UP9A 1ASYA 1XPRA 2WB1E 1C7YA 1VQ7A 3A5UA 3OW2A 2VQEL 1K3RA 1L0WA 4C3JH 3U4VA 2KCMA 4IPHA 5IYCG 1XJVA 2LSSA 2VQFQ 3T1HL 2D0OA 5M5YH 4HIKA 2F4VQ 2V1CC 4RMFA 1Q8KA 3CC4A 4PZ8A 1VQOA 4GN5A 5C0XJ 3HOXH 4GNXB 3PUVA 4X62Q 2YTVA 4AIMA 3OTOQ 4DV2L 2HIVA 4A3CH 1J6QA 5M3FH 1E1OA 3M3YH 2JEBI 5GROA 4DV5L 3E9IA 3S2DH 4LFBL 4JI5L 3M7NA 2Q2HA 2C35B 3NELA 1XMQQ 1N33L 4C3IH 1H95A 3PIPA 3CXCA 3CCQA 2JK8A 3AFQA 4A3GG 1VQHA 3CPFA 5IE8A 3W1BA 2CKZB 4DR3L 3K80C 1O7IA 4OO1G 1AE3A 3CCJA 4LUZA 3K8AA 4P71A 4B3TL 4LF4Q 4JOIA 4LFCQ 4DR6Q 1CSQA 2Z6KA 4A3JG 2JQOA 4IFDJ 4KHZA 3VDYA 1W3SA 1QVCA 3NENA 4B3RL 1HNXL 3RLNA 1HNZL 4JV5L 4NXNQ 1P16A 2A19A 3EBEA 2K4KA 3GTQH 3I4NG 4DAMA 4B3ML 3UDIA 4Y52H 3UE1A 2I5HA 1QZHA 1V1QA 2ZTCA 4GS3A 2H5XA 4ALPA 2E8GA 2I0QA 3T1YL 4BBSG 2PQAA 3PUYA 4P72A 1XNRL 2ZTEA 2VL6A 1N32Q 1Z9FA 2WP8J 1X6OA 3PUWA 4LUOA 4A3DG 3AQQA 2JJQA 4PMWA 1YHBA 4X65L 1X3EA 4IJHA 2WAQG 3ULJA 4BXXG 1I94L 3E9HA 3CF5A 1PH5A 4AYBE 1PA6A 4L5SA 1UE1A 2AWOA 3CQZH 3SGIA 1I3QH 2UUBQ 4GKJQ 4WJ4A 3CC2A 1VQ4A 3M85A 1I50H 1KAWA 1HZCA 3BZCA 5IP9G 5JEAJ 4DR1Q 2DGYA 3Q8DA 2CWPA 4P74A 4BBSH 2F4VL 3CCUA 2F52A 1Q1EA 1S40A 4A3EG 1QVFA 1M90C 3T1HQ 4IJLA 4UPAA 1IBKL 2Q2UA 1B8AA 1NTGA 4LFAQ 1G51A 1X65A 1SLJA 4YCWA 3OTOL 3CMEA 2JA5G 3PF5A 4JI7L 1VQIA 1Y1VG 4KI0A 4LF6Q 2YV5A 4TQUS 2E5LL 2ATWA 2IX0A 4ME3A 4DV2Q 3CAMA 3RN5A 4IOCA 4IPDA 3K7AH 2MO0A 3HOVG 5FLMG 1AH9A 1N9WA 3W5OA 1XPUA 4JI5Q 3L0OA 3H0GH 4KHPL 1L1OB 2JA9A 5IP9H 1N33Q 1OXSC 1KD1C 1HZAA 2BA1A 4LFCL 5JJIA 2RHQB 1HZBA 3GTPH 4H02A 4A3IH 2BH2A 3HKSA 4P73A 3U50C 3I7FA 5AJ3L 3M4OH 3GTLH 1D8LA 1T9HA 4X64Q 4NXNL 3J7ZC 4JI1Q 3ER0A 4P75A 1XNQL 1NE3A 4GKKQ 4A3KH 4YHHQ 3RLFA 1E1TA 4B3RQ 3I4MH 4JV5Q 4K0KQ 1OXUA 2A8VA 2ALYB 1U5KA 2JA7G 1VCIA 1Q46A 3E0EA 4APVA 5M3MG 1D7QA 4JBKA 3TS0A 3LGJA 1IBLL 1IBML 3U58A 1N32L 5FLMH 1XMOQ 2D0PA 2MFIA 5C0XG 4RG1A 4HJ8A 4HJAA 1XNRQ 3FHWA 5IYBG 4LW1A 1BBWA 4C3HH 3I55A 2QEXA 1QUQB 4DV7Q 2K52A 1PYBA 1YITA 4JI0Q 1EUJA 4JI4Q 4X65Q 1VQEA 4DR2Q 4AQYQ 4A3FG 4XIGS 2PI2A 4NB3A 3H15A 4HIDA 4IOAA 1X55A 1B7YB 2YYZA 2UUBL 4GKJL 3G48A 1FJGL 3ZJYC 3H3VI 3GTOH 3F8TA 1C9OA 3JC66 2AKWB 2VY3A 3J7A5 1NMFA 3DLLA 4DR1L 3S1MH 4DV6Q 2UUCQ 1N34Q 1NMGA 1EYGA 1VQ6A 2JA7H 2FXQA 1JMCA 4HIOA 1QZGA 5GAEC 4IFDG 2CWAA 5DLQE 3CC7A 2N8NA 4EQ5A 3S15H 2NVYH 3B6YA 4GN4B 3CCLA 4LFAL 2JA6G 2R92H 4DR4Q 5IYBH 3K7UC 4IPGA 4PZ7A 3GTJH 3MEFA 4GNXA 1A63A 4LF6L 4QGUA 4JI2Q 3M4QA 4QIWE 1N36Q 1IBKQ 2E2JH 4DKAC 4A3FH 5M5WH 4BY1G 3JAMi 3RZDH 2E5LQ 1X54A 2RHSB 5FJ8G 2HHHL 3CPWA 1NBWA 3STBC 3F2DA 4OO1I 4BY7G 1PH3A 2N78A 3J81j 4DUZL 4L5RC 4L5QA 1VQNA 3H3VH 4KHPQ 2NN6G 4UY8C 1YHAA 4LF8Q 3ULLA 5IYCH 2A1AA 4X64L 3PO3G 1BBUA 4JI1L 3UE0A 4JBJA 1CKNB 1PHJA 2JA6H 2K14A 4UP8A 3ULPA 5AJ3Q 1EQRA 4OWTB 4JI8Q 4YHHL 2QA4A 2K75A 4K0KL 1CUKA 1NY4A 5JEAG 1Q7YC 3PGZA 1XNQQ 4JC0A 4JCVE 4BY1H 1YBYA 4JI7Q 2YU9H 4GOPB 3RNUA 5FJ8H 5HGQA 2PMZE 3S24A 1XMOL 1KL9A 4JYAL 2KBNA 2GVBA 3EN2A 3L2PA 1IYJB 1IBMQ 2Y0SE 3KF6A 1IBLQ 4BY7H 2IY5B 5JJLA 4DV7L 3G6EA 2ZJQA 4JI0L 4KLKA 4A3GH 1B70B 3GO5A 4DK6C 4JI4L 3IRBA 4DR2L 2VZAA 4AQYL 1KIXA 2K5VA 1TWFH 3HOYG 4YWMA 4POFA 2HIXA 3TS2A 4R4TA 1XPOA 1P8LA 4A3JH 1VQJA 1TWAH 4X6AH 4HJ9A 1MJCA 4EX5A 1PH7A 4B3SL 4DV6L 2UUCL 1N34L 1GO3E 5EAYA 2YTYA 5H1SE 2B29A 1R9TH 1FJGQ 3I4NH 5C4XG 1VQPA 1A62A 1EIFA 1Y1WG 1WJJA 1OXTA 3KJPA 4A3LG 4LNQA 4LF9L 4DK3C 4NPSA 4A75A 1Z47A 3ERSX 4BBRG 1G6PA 1PH8A 1JJCB 3CMAA 2JA8G 4DR4L 3HOUG 4GNXC 3BU2A 3D31A 3KOJA 4DV0Q 1GD7A 2CQOA 3CP0A 4JI2L 2R7ZG 1K73C 2K5HA 3F2CA 1N36L 2I5MX 1RL2A 4A3DH 5C44G 3RZOH 1L2FA 2ZJRA 3KFUA 4BXXH 1PYSB 3L7ZC 4JBWA 1GVPA 2K50A 3HKZG 1E22A 1S3OA 1YJNA 2IT1A 1OXVA 2OCEA 1VQAA 5C4XH 5M5XH 3NBHB 1AE2A 5LMNW 3NEMA 4YCVA 1SFOH 2HHHQ 1KHIA 1Y1WH 1OXXK 5LMUL 2WB1G 1C0AA 4LF8L 2AMCB 2KHJA 4OWWB 2B63G 4DUZQ 1SROA 3KDFA 3AFPA 2ZJPA 1YHQA 1HR0L 4DV1Q 1I5FA 2JA8H 4L5TA 4R1JA 4JI8L 4A3EH 4J15A 5GAGC 2VW9A 4MNOA 5ELOA 1VQ8A 1VQMA 4JI3L 3FKIG 2XGTA 3KF8B 2JA5H 1E7ZA 2LXJA 3KLWA 5C3EG 5C44H 2ZM6L 3AEVA 2KCTA 2KHIA 2NZOA 3A5ZB 3BZKA 4MTNA 1Y1VH 1E24A 2MQHA 1KRTA 1PH9A 1VQ9A 2OWOA 2GVAA 1EWIA 2CFMA 3HFZB 2UU9Q 3PIOA 1OTCA 1VQGA 4PZ6A 1HR0W 1YVCA 4Y7NH 3J80i 3HOVH 3I56A 2QGQA 3KYHC 2YTXA 4DR7L 3PUZA 4JYAQ 2B3GA 1YI2A 1V43A 2WAQE 2JEAI 3S16H 1QUQA 2B63H 1DGSA 3TQYA 2F3IA 3GTKH 1WOCA 1A8VA 1YNXA 1VQDA 3JAMc 1WCMG 3W1GA 1IZ6A 3DM3A 1VQLA 1VQFA 2HT1A 1ASZA 4DR5L 4GLXA 3TREA 5IP7G 4B3SQ 1TWHH 2AHOB 5GQOA 4R4IA 2UXCQ 5M3MH 4NXMQ 1TXYA 4DV0L 4PG3A 3G4SA 4LF9Q 1IXRA 3F1ZA 3G71A 2Q2IA 5BR8Q 5LMNQ 1GM5A 3HOZG 1VS0A 4A3CG 3F2BA 1PH1A 3WWVA 4AYBG 1HJPA 3A74A 4POGA 4QQBX 4DV4L 3M9BA 2E2IH 1HNWL 1PVOA 5IWAQ 4X66Q 1X9NA 3PSIA 2L15A 1L1OC 2DUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYD A;  3PO2 G;  3M4P A;  1GKH A;  3CCM A;  3STB D;  5IP7 H;  5FLX c;  4A76 A;  5J3B A;  1VQ5 A;  1JT8 A;  4HIM A;  3UDX A;  1PH4 A;  1EIY B;  4R4O A;  4JI6 L;  2OQK A;  4DV1 L;  1K0R A;  5LMU Q;  4A3B G;  1LUZ A;  3I4O A;  4QJF A;  4YWK A;  3OYY A;  1CKN A;  1MIU A;  1HR0 Q;  1CSP A;  1X3F A;  1XTD A;  3ICE A;  1HH2 P;  2EXD A;  3S1Q H;  1UEB A;  2D62 A;  4LWC A;  3HOZ H;  1K83 H;  2KEN A;  1PH2 A;  4DNI A;  1LM0 A;  2RCN A;  3CCR A;  4JI3 Q;  5K36 G;  2ID0 A;  4LF5 L;  3GDE A;  2UU9 L;  2ZM6 Q;  2HQL A;  4QY7 A;  1J5E L;  4GOP A;  1UE6 A;  4OX9 L;  2NVT H;  2K5N A;  1HZ9 A;  5E7N A;  2UUA Q;  2XTI A;  4TVA B;  4GLA C;  1Q1B A;  4C2M H;  4A3M G;  1N8R C;  3PO2 H;  1EQQ A;  4YY3 L;  1K8G A;  1Y14 B;  2WFW A;  2AWN A;  3AYH B;  4DR7 Q;  2NVX H;  1FL0 A;  3PF4 A;  4A3B H;  3GD7 A;  1VQB A;  2R93 G;  2EQS A;  3PO3 H;  1YJW A;  5IT9 c;  3TRZ A;  4JG2 A;  1UWV A;  5ELN A;  1S72 A;  4DUY L;  3CCS A;  4WJ3 M;  1LTL A;  4GOP C;  1MKH A;  1NJI C;  1IL2 A;  1TWC H;  4LF7 Q;  2UXC L;  1Q86 C;  4DR5 Q;  4NXM L;  2OQ0 A;  3RLO A;  1SR3 A;  2EIF A;  3J81 c;  4JBM A;  1UE7 A;  5HY6 A;  1EOV A;  2PNH A;  1PV4 A;  2ES2 A;  1JJG A;  2PQA B;  1YJ9 A;  4A3M H;  3KF6 B;  2R7F A;  3BJU A;  1UE5 A;  5BR8 L;  5LMN L;  3U4Z A;  1JE5 A;  2R6G A;  2VS1 A;  1FVI A;  3PV0 A;  3A0J A;  4O0A A;  4IO9 A;  2I5L X;  1VQK A;  2OTL A;  3S1R H;  1JB7 A;  1KQS A;  4O2D A;  4DV3 L;  3HOY H;  4BA1 I;  2R93 H;  4R4Q A;  4OXP A;  1Q81 C;  3S14 H;  4X66 L;  5IWA L;  1YEZ A;  2N3S A;  3CW2 C;  1K8A C;  1WI5 A;  4LUV A;  1E3P A;  4AH6 A;  2VNU D;  3J80 c;  4DV4 Q;  2RF4 A;  1Q12 A;  2GN5 A;  2R7D A;  1BKB A;  2NVQ H;  1HNW Q;  3H0G G;  2UXD Q;  4HJ5 A;  1PH6 A;  2UXB Q;  1KC8 C;  1L1O A;  2ZTD A;  2MNA A;  2VQF L;  2OTJ A;  4A3L H;  4A3I G;  2VQE Q;  2Q2T A;  3J81 i;  4JI6 Q;  4GN3 B;  4UP7 A;  1I6H H;  4BBR H;  2Z0S A;  3HOU H;  1JJ2 A;  2PI2 E;  4X62 L;  3S17 H;  2R7Z H;  4YWL A;  4A3K G;  5GAD C;  2BH8 A;  5C4J H;  3I4M G;  4IPC A;  1M1K C;  4BA2 I;  1RIP A;  1KXL A;  3I2Z A;  4MZ9 A;  1YZ6 A;  1EFW A;  1VQC A;  3FP9 A;  2LXK A;  2N49 A;  4HJ7 A;  3RN2 A;  1XMQ L;  2UUA L;  3UDF A;  5C0X I;  4LF5 Q;  3K0X A;  4FDB A;  4DV5 Q;  3PCO B;  5IYD G;  1J5E Q;  4LFB Q;  4OX9 Q;  2VUM G;  1KRS A;  3EIV A;  4DAY B;  1SRU A;  2MO1 A;  1TWG H;  4JOI C;  5IY0 A;  1X3G A;  4LF4 L;  4DR6 L;  2Z6K C;  3KDF B;  4YY3 Q;  4A93 G;  4DR3 Q;  3HOW G;  2NZH A;  4XTC S;  3GTG H;  4B3T Q;  3CCV A;  3D0F A;  4A4I A;  5GAH C;  2BA0 A;  4LF7 L;  2E2H H;  1QVG A;  2IHE A;  3FKI H;  1YIJ A;  1HNX Q;  1HNZ Q;  1SMX A;  5C3E H;  1FGU A;  4DUY Q;  2IX1 A;  3S2H H;  3TEH B;  3GTM H;  4IFD I;  4B3M Q;  1SN8 A;  1G29 1;  1WFQ A;  2ASB A;  1MJE A;  2CCZ A;  3MXN B;  1K9M C;  1BVS A;  3S1N H;  3CCE A;  5IYD H;  1PFS A;  3T1Y Q;  2VUM H;  5JJK A;  3CD6 A;  4QL5 A;  3UDG A;  2R92 G;  3RR5 A;  3K81 C;  1CKM A;  2Y0S G;  4DPG A;  4OWX B;  3HOX G;  4GKK L;  1V9P A;  1Q82 C;  4A93 H;  3PUX A;  1CKO A;  3HOW H;  1SE8 A;  1I94 Q;  1X56 A;  2JE6 I;  5M3F G;  1WCM H;  2IHF A;  3HKZ E;  4YCU A;  4DV3 Q;  1LYL A;  1A0I A;  1U0L A;  4GLV B;  1W2B A;  2UXD L;  3KJO A;  4OON A;  2UXB L;  4R4C A;  2NN6 I;  4UP9 A;  1ASY A;  1XPR A;  2WB1 E;  1C7Y A;  1VQ7 A;  3A5U A;  3OW2 A;  2VQE L;  1K3R A;  1L0W A;  4C3J H;  3U4V A;  2KCM A;  4IPH A;  5IYC G;  1XJV A;  2LSS A;  2VQF Q;  3T1H L;  2D0O A;  5M5Y H;  4HIK A;  2F4V Q;  2V1C C;  4RMF A;  1Q8K A;  3CC4 A;  4PZ8 A;  1VQO A;  4GN5 A;  5C0X J;  3HOX H;  4GNX B;  3PUV A;  4X62 Q;  2YTV A;  4AIM A;  3OTO Q;  4DV2 L;  2HIV A;  4A3C H;  1J6Q A;  5M3F H;  1E1O A;  3M3Y H;  2JEB I;  5GRO A;  4DV5 L;  3E9I A;  3S2D H;  4LFB L;  4JI5 L;  3M7N A;  2Q2H A;  2C35 B;  3NEL A;  1XMQ Q;  1N33 L;  4C3I H;  1H95 A;  3PIP A;  3CXC A;  3CCQ A;  2JK8 A;  3AFQ A;  4A3G G;  1VQH A;  3CPF A;  5IE8 A;  3W1B A;  2CKZ B;  4DR3 L;  3K80 C;  1O7I A;  4OO1 G;  1AE3 A;  3CCJ A;  4LUZ A;  3K8A A;  4P71 A;  4B3T L;  4LF4 Q;  4JOI A;  4LFC Q;  4DR6 Q;  1CSQ A;  2Z6K A;  4A3J G;  2JQO A;  4IFD J;  4KHZ A;  3VDY A;  1W3S A;  1QVC A;  3NEN A;  4B3R L;  1HNX L;  3RLN A;  1HNZ L;  4JV5 L;  4NXN Q;  1P16 A;  2A19 A;  3EBE A;  2K4K A;  3GTQ H;  3I4N G;  4DAM A;  4B3M L;  3UDI A;  4Y52 H;  3UE1 A;  2I5H A;  1QZH A;  1V1Q A;  2ZTC A;  4GS3 A;  2H5X A;  4ALP A;  2E8G A;  2I0Q A;  3T1Y L;  4BBS G;  2PQA A;  3PUY A;  4P72 A;  1XNR L;  2ZTE A;  2VL6 A;  1N32 Q;  1Z9F A;  2WP8 J;  1X6O A;  3PUW A;  4LUO A;  4A3D G;  3AQQ A;  2JJQ A;  4PMW A;  1YHB A;  4X65 L;  1X3E A;  4IJH A;  2WAQ G;  3ULJ A;  4BXX G;  1I94 L;  3E9H A;  3CF5 A;  1PH5 A;  4AYB E;  1PA6 A;  4L5S A;  1UE1 A;  2AWO A;  3CQZ H;  3SGI A;  1I3Q H;  2UUB Q;  4GKJ Q;  4WJ4 A;  3CC2 A;  1VQ4 A;  3M85 A;  1I50 H;  1KAW A;  1HZC A;  3BZC A;  5IP9 G;  5JEA J;  4DR1 Q;  2DGY A;  3Q8D A;  2CWP A;  4P74 A;  4BBS H;  2F4V L;  3CCU A;  2F52 A;  1Q1E A;  1S40 A;  4A3E G;  1QVF A;  1M90 C;  3T1H Q;  4IJL A;  4UPA A;  1IBK L;  2Q2U A;  1B8A A;  1NTG A;  4LFA Q;  1G51 A;  1X65 A;  1SLJ A;  4YCW A;  3OTO L;  3CME A;  2JA5 G;  3PF5 A;  4JI7 L;  1VQI A;  1Y1V G;  4KI0 A;  4LF6 Q;  2YV5 A;  4TQU S;  2E5L L;  2ATW A;  2IX0 A;  4ME3 A;  4DV2 Q;  3CAM A;  3RN5 A;  4IOC A;  4IPD A;  3K7A H;  2MO0 A;  3HOV G;  5FLM G;  1AH9 A;  1N9W A;  3W5O A;  1XPU A;  4JI5 Q;  3L0O A;  3H0G H;  4KHP L;  1L1O B;  2JA9 A;  5IP9 H;  1N33 Q;  1OXS C;  1KD1 C;  1HZA A;  2BA1 A;  4LFC L;  5JJI A;  2RHQ B;  1HZB A;  3GTP H;  4H02 A;  4A3I H;  2BH2 A;  3HKS A;  4P73 A;  3U50 C;  3I7F A;  5AJ3 L;  3M4O H;  3GTL H;  1D8L A;  1T9H A;  4X64 Q;  4NXN L;  3J7Z C;  4JI1 Q;  3ER0 A;  4P75 A;  1XNQ L;  1NE3 A;  4GKK Q;  4A3K H;  4YHH Q;  3RLF A;  1E1T A;  4B3R Q;  3I4M H;  4JV5 Q;  4K0K Q;  1OXU A;  2A8V A;  2ALY B;  1U5K A;  2JA7 G;  1VCI A;  1Q46 A;  3E0E A;  4APV A;  5M3M G;  1D7Q A;  4JBK A;  3TS0 A;  3LGJ A;  1IBL L;  1IBM L;  3U58 A;  1N32 L;  5FLM H;  1XMO Q;  2D0P A;  2MFI A;  5C0X G;  4RG1 A;  4HJ8 A;  4HJA A;  1XNR Q;  3FHW A;  5IYB G;  4LW1 A;  1BBW A;  4C3H H;  3I55 A;  2QEX A;  1QUQ B;  4DV7 Q;  2K52 A;  1PYB A;  1YIT A;  4JI0 Q;  1EUJ A;  4JI4 Q;  4X65 Q;  1VQE A;  4DR2 Q;  4AQY Q;  4A3F G;  4XIG S;  2PI2 A;  4NB3 A;  3H15 A;  4HID A;  4IOA A;  1X55 A;  1B7Y B;  2YYZ A;  2UUB L;  4GKJ L;  3G48 A;  1FJG L;  3ZJY C;  3H3V I;  3GTO H;  3F8T A;  1C9O A;  3JC6 6;  2AKW B;  2VY3 A;  3J7A 5;  1NMF A;  3DLL A;  4DR1 L;  3S1M H;  4DV6 Q;  2UUC Q;  1N34 Q;  1NMG A;  1EYG A;  1VQ6 A;  2JA7 H;  2FXQ A;  1JMC A;  4HIO A;  1QZG A;  5GAE C;  4IFD G;  2CWA A;  5DLQ E;  3CC7 A;  2N8N A;  4EQ5 A;  3S15 H;  2NVY H;  3B6Y A;  4GN4 B;  3CCL A;  4LFA L;  2JA6 G;  2R92 H;  4DR4 Q;  5IYB H;  3K7U C;  4IPG A;  4PZ7 A;  3GTJ H;  3MEF A;  4GNX A;  1A63 A;  4LF6 L;  4QGU A;  4JI2 Q;  3M4Q A;  4QIW E;  1N36 Q;  1IBK Q;  2E2J H;  4DKA C;  4A3F H;  5M5W H;  4BY1 G;  3JAM i;  3RZD H;  2E5L Q;  1X54 A;  2RHS B;  5FJ8 G;  2HHH L;  3CPW A;  1NBW A;  3STB C;  3F2D A;  4OO1 I;  4BY7 G;  1PH3 A;  2N78 A;  3J81 j;  4DUZ L;  4L5R C;  4L5Q A;  1VQN A;  3H3V H;  4KHP Q;  2NN6 G;  4UY8 C;  1YHA A;  4LF8 Q;  3ULL A;  5IYC H;  2A1A A;  4X64 L;  3PO3 G;  1BBU A;  4JI1 L;  3UE0 A;  4JBJ A;  1CKN B;  1PHJ A;  2JA6 H;  2K14 A;  4UP8 A;  3ULP A;  5AJ3 Q;  1EQR A;  4OWT B;  4JI8 Q;  4YHH L;  2QA4 A;  2K75 A;  4K0K L;  1CUK A;  1NY4 A;  5JEA G;  1Q7Y C;  3PGZ A;  1XNQ Q;  4JC0 A;  4JCV E;  4BY1 H;  1YBY A;  4JI7 Q;  2YU9 H;  4GOP B;  3RNU A;  5FJ8 H;  5HGQ A;  2PMZ E;  3S24 A;  1XMO L;  1KL9 A;  4JYA L;  2KBN A;  2GVB A;  3EN2 A;  3L2P A;  1IYJ B;  1IBM Q;  2Y0S E;  3KF6 A;  1IBL Q;  4BY7 H;  2IY5 B;  5JJL A;  4DV7 L;  3G6E A;  2ZJQ A;  4JI0 L;  4KLK A;  4A3G H;  1B70 B;  3GO5 A;  4DK6 C;  4JI4 L;  3IRB A;  4DR2 L;  2VZA A;  4AQY L;  1KIX A;  2K5V A;  1TWF H;  3HOY G;  4YWM A;  4POF A;  2HIX A;  3TS2 A;  4R4T A;  1XPO A;  1P8L A;  4A3J H;  1VQJ A;  1TWA H;  4X6A H;  4HJ9 A;  1MJC A;  4EX5 A;  1PH7 A;  4B3S L;  4DV6 L;  2UUC L;  1N34 L;  1GO3 E;  5EAY A;  2YTY A;  5H1S E;  2B29 A;  1R9T H;  1FJG Q;  3I4N H;  5C4X G;  1VQP A;  1A62 A;  1EIF A;  1Y1W G;  1WJJ A;  1OXT A;  3KJP A;  4A3L G;  4LNQ A;  4LF9 L;  4DK3 C;  4NPS A;  4A75 A;  1Z47 A;  3ERS X;  4BBR G;  1G6P A;  1PH8 A;  1JJC B;  3CMA A;  2JA8 G;  4DR4 L;  3HOU G;  4GNX C;  3BU2 A;  3D31 A;  3KOJ A;  4DV0 Q;  1GD7 A;  2CQO A;  3CP0 A;  4JI2 L;  2R7Z G;  1K73 C;  2K5H A;  3F2C A;  1N36 L;  2I5M X;  1RL2 A;  4A3D H;  5C44 G;  3RZO H;  1L2F A;  2ZJR A;  3KFU A;  4BXX H;  1PYS B;  3L7Z C;  4JBW A;  1GVP A;  2K50 A;  3HKZ G;  1E22 A;  1S3O A;  1YJN A;  2IT1 A;  1OXV A;  2OCE A;  1VQA A;  5C4X H;  5M5X H;  3NBH B;  1AE2 A;  5LMN W;  3NEM A;  4YCV A;  1SFO H;  2HHH Q;  1KHI A;  1Y1W H;  1OXX K;  5LMU L;  2WB1 G;  1C0A A;  4LF8 L;  2AMC B;  2KHJ A;  4OWW B;  2B63 G;  4DUZ Q;  1SRO A;  3KDF A;  3AFP A;  2ZJP A;  1YHQ A;  1HR0 L;  4DV1 Q;  1I5F A;  2JA8 H;  4L5T A;  4R1J A;  4JI8 L;  4A3E H;  4J15 A;  5GAG C;  2VW9 A;  4MNO A;  5ELO A;  1VQ8 A;  1VQM A;  4JI3 L;  3FKI G;  2XGT A;  3KF8 B;  2JA5 H;  1E7Z A;  2LXJ A;  3KLW A;  5C3E G;  5C44 H;  2ZM6 L;  3AEV A;  2KCT A;  2KHI A;  2NZO A;  3A5Z B;  3BZK A;  4MTN A;  1Y1V H;  1E24 A;  2MQH A;  1KRT A;  1PH9 A;  1VQ9 A;  2OWO A;  2GVA A;  1EWI A;  2CFM A;  3HFZ B;  2UU9 Q;  3PIO A;  1OTC A;  1VQG A;  4PZ6 A;  1HR0 W;  1YVC A;  4Y7N H;  3J80 i;  3HOV H;  3I56 A;  2QGQ A;  3KYH C;  2YTX A;  4DR7 L;  3PUZ A;  4JYA Q;  2B3G A;  1YI2 A;  1V43 A;  2WAQ E;  2JEA I;  3S16 H;  1QUQ A;  2B63 H;  1DGS A;  3TQY A;  2F3I A;  3GTK H;  1WOC A;  1A8V A;  1YNX A;  1VQD A;  3JAM c;  1WCM G;  3W1G A;  1IZ6 A;  3DM3 A;  1VQL A;  1VQF A;  2HT1 A;  1ASZ A;  4DR5 L;  4GLX A;  3TRE A;  5IP7 G;  4B3S Q;  1TWH H;  2AHO B;  5GQO A;  4R4I A;  2UXC Q;  5M3M H;  4NXM Q;  1TXY A;  4DV0 L;  4PG3 A;  3G4S A;  4LF9 Q;  1IXR A;  3F1Z A;  3G71 A;  2Q2I A;  5BR8 Q;  5LMN Q;  1GM5 A;  3HOZ G;  1VS0 A;  4A3C G;  3F2B A;  1PH1 A;  3WWV A;  4AYB G;  1HJP A;  3A74 A;  4POG A;  4QQB X;  4DV4 L;  3M9B A;  2E2I H;  1HNW L;  1PVO A;  5IWA Q;  4X66 Q;  1X9N A;  3PSI A;  2L15 A;  1L1O C;  2DUD A; 
#chains in the Genus database with same CATH topology
 3P1H A;  1Y8N B;  1GKH A;  5C4H A;  3CCM A;  5FLX c;  4A76 A;  1O80 A;  4R4O A;  2OQK A;  2EE1 A;  2DY8 A;  4A3D B;  3U9O A;  3NTK A;  1MIU A;  1HR0 Q;  1X3F A;  3ICE A;  1G6Z A;  2PQE A;  2MP1 A;  1UEB A;  2KEN A;  4KN7 C;  2WV6 D;  4JI3 Q;  3D6C A;  4QY7 A;  5I9O A;  1ESR A;  1LT5 D;  2NVT H;  2EJG C;  1HZ9 A;  4X3S A;  5E7N A;  1Y1W B;  2NTT A;  1BXT A;  3K5N A;  4EQO A;  1EQQ A;  4YY3 L;  1Y14 B;  2XSC A;  3GQB A;  1OO9 B;  3DWP A;  3Q23 A;  2EQS A;  1RTO A;  1YJW A;  1SYG A;  1SYB A;  4OGQ C;  2PPB C;  1S4Z A;  4G57 A;  1IL2 A;  2F0U A;  2J0T D;  1QCB D;  4IUN A;  3RLO A;  1EOV A;  1LV9 A;  2PQA B;  3FDT A;  2DY7 A;  3R2I A;  1A3T A;  2EYM A;  5BR8 L;  5LMN L;  1JE5 A;  2VS1 A;  1DJR D;  3S1R H;  1JB7 A;  4O2D A;  3HOY H;  1SE2 A;  1ET6 A;  1B9N A;  4J8Q A;  2N3S A;  4LUV A;  1PTO B;  1TWH B;  2VNU D;  3VR2 A;  2R7D A;  2QKI C;  2UXD Q;  5J22 A;  4XT1 B;  4XQN A;  2EOT A;  3MFG A;  2OTJ A;  4A3I G;  2VQE Q;  3J81 i;  2FJ2 A;  4JI6 Q;  1BOS A;  3HOU H;  3X3M A;  4L63 B;  2F0W A;  4K8J A;  5GAD C;  1D5M C;  1KXL A;  1RIP A;  3JAM E;  1YZ6 A;  2N49 A;  5C0X I;  2F0V A;  2D5D A;  3K0X A;  4FDB A;  3PCO B;  1J5E Q;  4LJZ C;  4OX9 Q;  2VUM G;  4ZRZ A;  4C1N K;  5IY0 A;  3M4Y A;  2JXM B;  3KBG A;  3R93 A;  1TT2 A;  1JE4 A;  3HOW G;  2NZH A;  1SYD A;  4XTC S;  5ELB A;  1K3B C;  3HOZ B;  1KAB A;  5GAH C;  2BA0 A;  2K33 A;  3FKI H;  2IX1 A;  1HNZ Q;  3S2H H;  2KOL A;  1G29 1;  2ASB A;  1MJE A;  2CCZ A;  1K9M C;  2WII B;  3T1Y Q;  3T13 A;  2VUM H;  2NVX B;  3RR5 A;  3K81 C;  4DPG A;  2IX3 A;  2IJ0 A;  3PO3 B;  2RKS A;  3PUX A;  3QR8 A;  3HOW H;  1SE8 A;  4HSP A;  1TU2 B;  2D2C C;  1ZYR D;  2HCC A;  4H13 C;  3DUZ A;  4OON A;  2RCF A;  1NSN S;  2K7V A;  2WB1 E;  1C7Y A;  4PNY A;  1XJV A;  1NCV A;  3E3X A;  1ET9 A;  2D0O A;  2F4V Q;  3CC4 A;  1XTC D;  1QOH A;  4X62 Q;  3CRK C;  1SJH D;  2YTV A;  4P2C B;  4AIM A;  4IZ8 A;  2HIV A;  4KKT A;  1LTA D;  1STN A;  4B9W A;  5IT9 E;  2NVQ B;  1E0B A;  1K8M A;  3H3V C;  3BDC A;  3NEL A;  4JVZ A;  4A3G G;  1VQH A;  3TZD A;  4BBR B;  4DR3 L;  4LFC Q;  2KUM A;  1JB3 A;  3S17 B;  2R7Z B;  4DR6 Q;  2DNC A;  1CSQ A;  1GUO A;  2JQO A;  4KHZ A;  4QF4 A;  5ELD A;  5C44 B;  5EKK A;  5IIF A;  1HNX L;  3RLN A;  4JV5 L;  1O7Z A;  3I4N G;  1A2T A;  1LT6 D;  4KHV A;  4ZUJ A;  4B3M L;  5E1F A;  4GS3 A;  2H5X A;  2MJ8 A;  2CH4 W;  4P72 A;  3VA5 A;  1TWG B;  2A74 C;  1SBB B;  5M9O A;  2E75 C;  1KDC A;  4PMB A;  3AQQ A;  2JJQ A;  4X65 L;  1YHB A;  2WAQ G;  3TP5 A;  3ULJ A;  1PH5 A;  4NDX A;  3SGI A;  3V2T A;  5C3E B;  4I7Z C;  3CC2 A;  1EWH A;  4FO2 A;  1CM9 A;  4DAV A;  2F0N A;  4DR1 Q;  2DGY A;  4LK1 C;  5JPN C;  4P74 A;  3TP6 A;  5COY A;  2B2Y C;  4UPA A;  1SMY C;  5IGD A;  4LFA Q;  5TSS A;  1SLJ A;  3OTO L;  2B2V A;  5I4D A;  2YV5 A;  2E5L L;  2PNR C;  4X3U A;  3CAM A;  3OW7 A;  1TVX A;  4IPD A;  4UAI A;  1F9Q A;  3VR3 A;  4DAY A;  4C3J B;  4JI5 Q;  1XPU A;  4KHP L;  1L1O B;  4PV1 C;  1N33 Q;  5JJI A;  1HZB A;  4H02 A;  2Y0S B;  1UNS A;  2F0F A;  4P73 A;  4CDE C;  4EGV A;  3HOX B;  3M4O H;  1JWU D;  1XNQ L;  4GKK Q;  4AYB B;  4A3K H;  4IQZ A;  3HEJ A;  3S2D B;  4UHV A;  3NUC A;  2NVT B;  1U5K A;  2JA7 G;  4C3I B;  2OT2 A;  1NR4 A;  4JBK A;  1IBM L;  4KN4 C;  1AFP A;  1ENA A;  2D0P A;  4RG1 A;  1XNR Q;  1BBW A;  4JI0 Q;  1PYB A;  1TS4 A;  1EEI D;  4JI4 Q;  4A3F G;  4QB4 A;  2UUB L;  1B7Y B;  2RDH A;  2YYZ A;  4GKJ L;  2F0T A;  1FJG L;  3SDZ A;  3GTO H;  3F8T A;  1EFI D;  1QB5 D;  3ERO A;  3OWF A;  3DLL A;  3S1M H;  4IUQ A;  4EVO A;  2JA7 H;  2FXQ A;  3SK6 A;  4C1N I;  1QZG A;  2PW5 A;  3CC7 A;  2NVY H;  2Q8I B;  2SEB D;  4KK7 A;  3SK8 A;  4FXD A;  3K7U C;  4IPG A;  4PZ7 A;  3GTJ H;  4GNX A;  1PZK D;  5KRU A;  1A2U A;  1B2T A;  2B39 A;  4A3F H;  4ZAI A;  4KMU C;  1ZYR C;  4BY1 G;  1F9S A;  2F0G A;  1EYA A;  2L11 A;  2CW0 D;  4FYD A;  3STB C;  2P5Z X;  2LKV A;  1PH3 A;  5EJW A;  1B50 A;  3L9A X;  3J81 E;  5C5L A;  3ULL A;  5IYC H;  2A1A A;  1AZP A;  3UE0 A;  4JI1 L;  1PHJ A;  1V8Q A;  4OEL B;  2QA4 A;  4IUT A;  4YHH L;  1NY4 A;  2SNS A;  3K7A B;  2F0H A;  4BY1 H;  5IGF A;  1YBY A;  4JI7 Q;  2D9U A;  2FIN B;  2IY5 B;  3SK5 A;  4DV7 L;  4A3I B;  3OMC A;  3G6E A;  2ZJQ A;  1FNV A;  4DK6 C;  2EYO A;  4RKL A;  5ISR A;  4R4T A;  3HZX A;  4A3J H;  4QIW B;  4DV6 L;  5C4X G;  2RDF A;  1VQP A;  3WDN A;  1WJJ A;  1Y1W G;  1OXT A;  1B3A A;  3K57 A;  4LNQ A;  3V05 A;  4G4K A;  2L55 A;  4DK3 C;  2A68 D;  4DR4 L;  1VMP A;  1EOT A;  3BU2 A;  2EXZ A;  3NK9 A;  3D31 A;  1QJO A;  4UDU C;  4JI2 L;  4A3D H;  1CT1 D;  1EY4 A;  2CHB D;  2KQ3 A;  3PIP 3;  3HOW B;  3D6W A;  1TII D;  1L2F A;  3RZO H;  3KFU A;  3EJI A;  3L7Z C;  1GVP A;  1MHW C;  4HCS A;  3E5S A;  3HKZ G;  4IUP A;  5C4X H;  1IKM A;  3NEM A;  2F0Q A;  5LL6 S;  4BWG B;  1Y1W H;  3QOL A;  2AMC B;  2KHJ A;  3NP8 A;  4QCL A;  1HR0 L;  2ZJP A;  3VYU A;  4DV1 Q;  2F0M A;  1JCK B;  3KUP A;  2VW9 A;  1VQ8 A;  4JI3 L;  4JK1 C;  3KLW A;  2B8F A;  2KJX A;  3BVM A;  2KCT A;  2LFN A;  3DEP A;  1KRT A;  1HFG A;  1B53 A;  2UU9 Q;  3PIO A;  4ZYS A;  3J80 i;  4B9X A;  3I56 A;  2QGQ A;  4JYA Q;  2JEA I;  1SNQ A;  1QUQ A;  3DXJ C;  3TQY A;  2JA6 B;  4IAL A;  1VQD A;  1WCM G;  2M2L A;  2DN8 A;  1KDB A;  1VQF A;  1G91 A;  2YU9 B;  4GLX A;  1VDZ A;  3TRE A;  4I7A A;  5IP7 G;  2ICI A;  3WOF A;  1PTO H;  1TWH H;  2AHO B;  1YNJ D;  5GQO A;  1HTL D;  3A7A B;  1ICF B;  1TXY A;  1C48 A;  3Q6S A;  3U9S A;  4A3G B;  4DV0 L;  1TWF B;  2EY1 A;  3HOZ G;  1GM5 A;  3KLR A;  1TWA B;  1VS0 A;  4F88 A;  4CDD C;  1PH1 A;  1HJP A;  3A74 A;  5E4X A;  3I4N B;  4FF4 A;  1R9T B;  4HAE A;  1PVO A;  2QDL A;  1X9N A;  3Q22 A;  5CV8 A;  3PO2 G;  5IP7 H;  2A73 B;  1PH4 A;  4JI6 L;  4KTA A;  5EPL A;  5LMU Q;  1LUZ A;  4YWK A;  3PIO 3;  1GUT A;  4IFD H;  3IL8 A;  1CKN A;  1CSP A;  1XTD A;  2WAQ B;  3N6R A;  4ZKC B;  3PQI A;  1HHV A;  4LWC A;  3HOZ H;  5CYU A;  1PH2 A;  1LM0 A;  3CCR A;  2E2D C;  3GDE A;  1HQM C;  1J5E L;  4GOP A;  1UE6 A;  4OX9 L;  4DAP A;  2K5N A;  4MTK A;  1SFO B;  3G6J B;  2XTI A;  3QIA A;  3UI2 A;  4GLA C;  1Q1B A;  1N8R C;  3PO2 H;  3W3A A;  2JA8 B;  2N88 A;  4DR7 Q;  1GJX A;  1KDA A;  5C3W A;  2NVX H;  1VQB A;  2R93 G;  3PO3 H;  1S5C D;  4JG2 A;  5ELN A;  1S72 A;  1Q90 A;  1CFM A;  2MUY A;  2M00 A;  4WJ3 M;  1O78 A;  4LF7 Q;  3VYT A;  1HFN A;  1BO0 A;  2UXC L;  3ERQ A;  2QEJ C;  3MEH A;  4NXM L;  4KD4 A;  4ZK9 B;  2OQ0 A;  3J81 c;  1JJG A;  1UE7 A;  3DM1 A;  5A2Q E;  2ES2 A;  4KY6 A;  2R7F A;  4O0A A;  4FP5 D;  3I73 A;  4IO9 A;  1PZJ D;  1HUN A;  1KQS A;  2R93 H;  1SYF A;  2F0K A;  4ME5 A;  4OXP A;  5IWA L;  1YEZ A;  1EQV A;  1RCV D;  5FLX L;  1K8A C;  3K5L A;  4AH6 A;  4ID6 A;  3W2D A;  2ZXP A;  2NVQ H;  3H0G G;  2UXB Q;  1XWE A;  1PH6 A;  3MXP A;  1L1O A;  2O2L D;  4A3L H;  2VXW A;  2Q2T A;  4GN3 B;  4BBR H;  2Z0S A;  5I6Y A;  1JJ2 A;  1KLG D;  4X62 L;  3S17 H;  2EY6 A;  4A3F B;  2R7Z H;  4YWL A;  2Z8L A;  1UUP A;  1S5D D;  3I2Z A;  4MZ9 A;  2QF7 A;  1VQC A;  3FP9 A;  2LXK A;  2UUA L;  4RA8 A;  4DGZ A;  4DV5 Q;  1PDQ A;  1R4Q B;  4LFB Q;  3RUZ A;  4DAY B;  2B2W C;  1B44 D;  3F2U A;  1TWG H;  1HCZ A;  4K2L A;  4DR6 L;  3KDF B;  2E74 C;  2KEE A;  2FHT A;  1K83 B;  3CCV A;  3D0F A;  4A4I A;  2PZT A;  4K6L A;  4CDF C;  2E2H H;  2Z4I A;  3Q24 A;  4BY1 B;  4PMC A;  1DCZ A;  1FNW A;  1SND A;  5C3E H;  1FGU A;  5I6W A;  1CQF A;  2K04 A;  4IFD I;  2I46 A;  4FNF A;  2EYH A;  1JR0 D;  3SXH A;  3CCE A;  1PFS A;  2G9D A;  5I2Y A;  5IGG A;  2Y0S G;  4BS9 A;  3QWN A;  5A35 A;  3HOX G;  3VR5 A;  2L5T A;  1I94 Q;  3DEO A;  4XYQ A;  3P75 A;  2K05 A;  1WTV A;  4CDC C;  1A0I A;  1QE6 A;  2KED A;  1U0L A;  4GLV B;  4R4C A;  4UP9 A;  1XPR A;  3OW2 A;  1PYW D;  1SXT A;  1L0W A;  4C3J H;  2JP1 A;  2VQF Q;  3EFX D;  3P20 A;  5M5Y H;  2M9V A;  4HIK A;  2V1C C;  1Q8K A;  2B2V C;  2K1B A;  3T51 B;  2HDM A;  3RZO B;  1WTW A;  3QB3 A;  4GN5 A;  3HOX H;  4GNX B;  1F9R A;  5A2Q L;  3PUV A;  5C5M A;  4NKL A;  3T56 B;  4A3C H;  1E1O A;  2SDF A;  1SNP A;  3S2D H;  5C4X B;  1U9R A;  2QW7 A;  4JI5 L;  2Q2H A;  1XMQ Q;  1N33 L;  4C3I H;  1XXG A;  3AFQ A;  2Z9H A;  1T5E A;  3CPF A;  5IE8 A;  1DD2 A;  4KY7 A;  2CKZ B;  4H7B A;  1O7I A;  1AE3 A;  4B3T L;  4LF4 Q;  4JOI A;  4N8F A;  2Z6K A;  5C4J B;  3OIQ A;  4DNR B;  2K4K A;  1FNU A;  3T16 A;  3HKZ B;  3ZYY X;  4ZUI A;  1LTI D;  2HQE A;  1FD7 D;  2ZTC A;  2H4O A;  1EIG A;  1XNR L;  5CV4 A;  1I6V C;  5CR3 A;  2TMP A;  2WP8 J;  3PUW A;  1PTO F;  4LUO A;  4S3S A;  4PMW A;  5KGU A;  1X3E A;  2R3Z A;  4BXX G;  3E9H A;  4AYB E;  1PA6 A;  3CQZ H;  4WJ4 A;  2NB0 A;  3OPO A;  3S1N B;  5JEA J;  1U4L A;  3FRP B;  3HP3 A;  3CCU A;  1ZEQ X;  2XWJ B;  2C9O A;  4A3E G;  3T1H Q;  1JWM D;  3IKJ A;  1X65 A;  2JA5 G;  1WCM B;  1RHP A;  4ODG A;  1VQI A;  1I4G A;  1Y1V G;  5DM7 3;  4LF6 Q;  1I4R A;  3K7A H;  4Q0F A;  2MO0 A;  4OL7 A;  4E6I A;  3HOV G;  1AH9 A;  1C4Q A;  2CVR A;  1DOL A;  2JA9 A;  1KD1 C;  4C3H G;  4A3I H;  1RKN A;  4C56 C;  3HKS A;  3U50 C;  3I7F A;  1BR9 A;  4K14 A;  4NXN L;  1STH A;  3A8K E;  5BN3 A;  2F03 A;  1NE3 A;  2RQX A;  3NBI A;  3RLF A;  1E1T A;  2PZW A;  4B3R Q;  4K0K Q;  4N9P A;  2ALY B;  1D7Q A;  1Q46 A;  5M3M G;  3TS0 A;  3LGJ A;  3PO2 B;  3U58 A;  2RA4 A;  1N32 L;  5JVG 3;  5IYB G;  4C3H H;  2QEX A;  3I55 A;  1QUQ B;  1WTO A;  1EUJ A;  1VQE A;  4DR2 Q;  4C3I G;  4FVM A;  3GTQ B;  2PI2 A;  2B2U A;  3H15 A;  1PTO C;  3G48 A;  3R8B A;  4ZKB B;  3JC6 6;  1C9O A;  2AKW B;  2VY3 A;  1NMF A;  1CTM A;  3VYR A;  2UUC Q;  1SSO A;  1HUM A;  1N34 Q;  1EYG A;  3C3L A;  1VQ6 A;  2F0D A;  3Q0A A;  1LTR D;  4HIO A;  5GAE C;  1JOR A;  3I3C A;  4QUC A;  2N8N A;  1R4P B;  2B2T A;  2EY5 A;  3B6Y A;  4GN4 B;  2JA6 G;  1AEX A;  2MHV A;  5IOC A;  5IYB H;  1ONL A;  3MEF A;  5KEE A;  2R93 B;  2F3V A;  4QIW E;  1ENC A;  5EBC A;  4DKA C;  1I3Q B;  1B1Z A;  1NUC A;  1UEA B;  5E3F A;  4EQN A;  3RZD H;  3SHL A;  1JC7 A;  3MZ5 A;  4DXG A;  1NBW A;  4RWS C;  2XVS A;  4JW0 A;  4L5R C;  1A15 A;  2PCF B;  2NN6 G;  4F7X A;  1YHA A;  4X64 L;  3HGB A;  1PFN A;  5DNF A;  1CKN B;  2JA6 H;  4QUF A;  4JI8 Q;  2K75 A;  2F0E A;  1CUK A;  3EVQ A;  5JEA G;  3PGZ A;  4RGN A;  2YU9 H;  4GOP B;  5HGQ A;  3H0G B;  2PMZ E;  1XMO L;  4JYA L;  2F0L A;  1EY5 A;  3L2P A;  3JAM L;  4Z9C B;  5JJL A;  1BDO A;  5C4Z A;  4A3G H;  4DU9 A;  4KLK A;  4CHT B;  4R8I A;  3IRB A;  2F0O A;  3BDL A;  4AQY L;  3GTL B;  1KIX A;  1TWF H;  1U4M A;  4CJ2 C;  2E2H B;  1XPO A;  1P8L A;  1VQJ A;  1CZW A;  1TWA H;  1DYQ A;  2GA4 B;  4HJ9 A;  3MXG A;  1F2L A;  5CGK A;  3I4N H;  2DJF C;  5JEA H;  1R9T H;  2AQ2 B;  2ZXR A;  1A62 A;  2ZXO A;  1LAB A;  2KCN A;  3DMU A;  4RFB A;  3NTI A;  2XIW A;  5NUC A;  1JJC B;  2JA8 G;  1TQO A;  3KOJ A;  2BCO A;  3D4D A;  3SEB A;  1K73 C;  2K5H A;  1D5Z C;  3F2C A;  1N36 L;  1Z6H A;  2EYF A;  3FPU B;  2ZJR A;  3QG1 A;  1GHK A;  2IT1 A;  4DXF A;  1OXV A;  2A6E D;  1HQR D;  5L37 A;  3NBH B;  1SFO H;  5LMN W;  4YCV A;  2HHH Q;  2EYL A;  1KHI A;  2OWO A;  1GUS A;  5LMU L;  2F0S A;  3TME A;  4LF8 L;  5M5Y B;  3KDF A;  2JA8 H;  3BS1 A;  1NAP A;  3MFY A;  4MNO A;  5M5W B;  4ULL A;  3NXW A;  3DWA A;  4GOP C;  2KHI A;  2NZO A;  5CC4 A;  3NSW A;  2K6A A;  2XNA C;  1E24 A;  2MQH A;  4HTH A;  4CJ0 B;  1CK1 A;  3D8G A;  1VQ9 A;  2CFM A;  4ZQ3 A;  2IW3 A;  5D65 A;  1OTC A;  1EYD A;  1EY7 A;  3AU7 A;  4Y7N H;  1NR2 A;  4DR7 L;  1YI2 A;  5IT9 L;  2WAQ E;  3OMG A;  1DGS A;  1WOC A;  2WKC A;  1YNX A;  3JAM c;  5EGT A;  1IZ6 A;  1VQL A;  1H9K A;  5JOB A;  2Z1C A;  3FVQ A;  4B3S Q;  1AP0 A;  3NPP A;  4ZCK A;  1IXR A;  4N8X 1;  3F1Z A;  3T53 B;  3G71 A;  2Q2I A;  5BR8 Q;  5LMN Q;  3D4R A;  2JSO A;  3CQZ B;  5EPK A;  3WWV A;  3M9B A;  2NZ1 D;  1Y8O B;  5LHY 1;  2L15 A;  1L1O C;  4NPS A;  1JOQ A;  5JJZ A;  1WYD A;  3M4P A;  3T4A C;  2KEC A;  1JT8 A;  4HIM A;  3URY A;  5DAU A;  1EIY B;  4K5W A;  1K0R A;  4A3B G;  4QJF A;  3I4O A;  3I70 A;  3MWY W;  1EQT A;  3GP7 A;  2SNM A;  1L0X B;  5HUR A;  1HH2 P;  3S1Q H;  4CKB A;  2EVB A;  2KA7 A;  1ILP A;  1K83 H;  1K8O A;  5KNC A;  4K2K A;  4DNI A;  2RCN A;  1KAA A;  5K36 G;  2ID0 A;  2PO4 A;  2ZM6 Q;  5M5X B;  2A69 D;  3WOE A;  1QNK A;  1TR5 A;  1U4R A;  3KK7 A;  3TZU A;  3I90 A;  2AWN A;  4A3E B;  3K6O A;  4A3B H;  1EZ6 A;  3GD7 A;  5CBE E;  5K5P A;  2JA5 B;  1XX8 A;  5IT9 c;  3TRZ A;  1UWV A;  3A8J E;  1Y1V B;  3CCS A;  1LTL A;  4WJW A;  2VB2 X;  1TWC H;  1SNC A;  4RAU C;  3HOV B;  1SR3 A;  2EIF A;  4IN3 A;  4JBM A;  5HY6 A;  1PV4 A;  4OIJ A;  3KF6 B;  4C3H B;  5EPJ A;  3GTK B;  1UE5 A;  1F2Z A;  3U4Z A;  2R6G A;  2OTL A;  1VQK A;  1IYU A;  1BUV T;  1BNZ A;  1DXM A;  1EU4 A;  4BA1 I;  2A5H A;  1JWS D;  2H1E A;  1SE3 A;  1Q81 C;  4X66 L;  4DK1 A;  1WI5 A;  1YNN D;  2GN5 A;  1BKB A;  5CV5 A;  5M3M B;  1TS2 A;  3MVV A;  4HJ5 A;  1KC8 C;  1F2M A;  2MNA A;  2VQF L;  2WIN B;  1EY0 A;  4J6H A;  5CV9 A;  4FXK C;  3RZD B;  5C4J H;  3I4M G;  4BA2 I;  2L9H A;  4KY5 A;  1EFW A;  3RN2 A;  4HJ7 A;  1XMQ L;  3UDF A;  4LF5 Q;  3K0Y A;  1LAC A;  5IYD G;  1TY2 A;  1KRS A;  1B9M A;  3EIV A;  1SRU A;  3VYS A;  4FXG C;  4JOI C;  1H9R A;  1X3G A;  4LF4 L;  2Z6K C;  2HCI A;  5ELF A;  4A93 G;  1JOO A;  4DR3 Q;  1CQV A;  4CGY B;  3K5M A;  2V4D A;  1IHZ A;  2FMM A;  1Z7T A;  2IHE A;  3J81 L;  1HNX Q;  4N9T A;  4DUY Q;  3TEH B;  4HN7 A;  3GTM H;  2C5C A;  4B3M Q;  1SN8 A;  4C2M B;  3NHH A;  2QIL A;  3S1N H;  5IYD H;  1CA6 A;  5JJK A;  1EEF D;  3CD6 A;  4QL5 A;  2R92 G;  3MXU A;  1CKM A;  4IUV A;  5ELC A;  4OWX B;  1G2S A;  1SNM A;  5FKA C;  1Q82 C;  4A93 H;  4XXE A;  5M3F G;  2JE6 I;  1WCM H;  2IHF A;  3HKZ E;  4DV3 Q;  1I4Q A;  3D4W A;  2UXD L;  3KJO A;  2E76 C;  1ASY A;  1VQ7 A;  2VQE L;  1K3R A;  3U4V A;  2KCM A;  3T1H L;  3AB9 A;  4PZ8 A;  5C0X J;  5I9P A;  2QCP X;  3S14 B;  2JYO A;  3OTO Q;  2BOS A;  1J6Q A;  5M3F H;  2JEB I;  2WAC A;  2F0J A;  1MSH A;  2CW0 C;  1A3U A;  4Q5V A;  1H95 A;  1MBY A;  3CXC A;  3CCQ A;  2JK8 A;  4CKE A;  2I07 B;  3A54 A;  4XDX A;  4I65 A;  4DNT B;  3MAQ A;  3K8A A;  1V1P B;  1S5B D;  4OEM B;  2EYP A;  3VDY A;  1QVC A;  3NEN A;  4B3R L;  2J4X A;  1HNZ L;  5COR A;  1P16 A;  2A19 A;  3I4L A;  3GTQ H;  5D14 A;  4DAM A;  1WTH A;  3UDI A;  2NBF A;  2RDG A;  3UE1 A;  1LTT D;  1QZH A;  1H9S A;  3TSS A;  4Y7N B;  4ALP A;  3T1Y L;  4RCO A;  3GV6 A;  3GV3 A;  2EY2 A;  3PMF A;  3PUY A;  1X6O A;  2RSO A;  4IJH A;  2B2U C;  4QMG A;  3GTG B;  3CF5 A;  2MGS A;  4L5S A;  2AWO A;  2F4I A;  4WFN 3;  1I3Q H;  3H09 A;  1F77 A;  1EY9 A;  2UUB Q;  4GKJ Q;  3IFT A;  2FMC A;  1B3Q A;  1KAW A;  1HZC A;  3NBH A;  1STG A;  5G3L D;  2OF1 A;  2ZT9 C;  2A68 C;  2CWP A;  1ENF A;  2B2T C;  1D5X C;  2F4V L;  1XYI A;  2F52 A;  1Q1E A;  4IJL A;  2Q2U A;  1G51 A;  4YCW A;  3CME A;  2EDG A;  3PF5 A;  1WVL A;  3A55 A;  4KI0 A;  4TQU S;  3J7Y W;  2IX0 A;  1EYC A;  1WTX A;  4DV2 Q;  2LMC B;  3RN5 A;  5FLM G;  1EY8 A;  3W5O A;  2XRQ D;  3L0O A;  1ICW A;  2AUJ D;  3H0G H;  1K28 A;  3NE5 B;  1OXS C;  1HZA A;  2BA1 A;  4LFC L;  4FF1 A;  3S1Q B;  3GTL H;  1T9H A;  1I4X A;  3J7Z C;  4JI1 Q;  5KND A;  1KNE A;  4YHH Q;  4HMI A;  2A8V A;  1V1O A;  2OXP A;  1VCI A;  3E0E A;  4APV A;  2Q8R E;  4KJO A;  5JAV A;  4LMQ D;  4NW2 A;  5FLM H;  2MFI A;  2X6L A;  5C0X G;  4HJA A;  3FHW A;  4A3B B;  4LW1 A;  4DV7 Q;  1ZKO A;  1X55 A;  1TWC B;  3ZJY C;  1NNX A;  3H3V I;  1QWY A;  4DFA A;  4DR1 L;  4DV6 Q;  1YNJ C;  3FEW X;  1JMC A;  3QJY A;  1PLF A;  3MC0 B;  3D3R A;  5KIX A;  4EQ5 A;  3BYT B;  3VR4 A;  3R3O A;  4LFA L;  4DR4 Q;  4KJN A;  2KVM A;  1A63 A;  4JI2 Q;  1EL0 A;  1GUN A;  1IBK Q;  2E2J H;  1SJE D;  5M5W H;  1WTQ A;  5IGE A;  1I50 B;  2HHH L;  3LX0 A;  4G7O C;  4RGT A;  4KKU A;  1SYE A;  2R61 A;  4BBS B;  1JQY D;  2N78 A;  3R2T A;  2EJM A;  4TSS A;  4L5Q A;  5FO9 B;  2O4X A;  4XYO A;  1BBU A;  2Z4H A;  4NP5 A;  3C2P A;  2K14 A;  4UP8 A;  3ULP A;  5AJ3 Q;  4GKK L;  4JC0 A;  4JCV E;  2OEO A;  2VB3 X;  1O7L A;  2X6G A;  1J8I A;  2KBN A;  3J80 E;  2GVB A;  1IBL Q;  2Y0S E;  3KF6 A;  3GTP B;  3N52 A;  4JI0 L;  1B70 B;  4JI4 L;  2VZA A;  2K5V A;  3HOY G;  1T5X D;  3IFD A;  4HSV A;  3TS2 A;  1Y8P B;  5CV6 A;  3I4M B;  4X6A H;  1KNA A;  4EX5 A;  1PH7 A;  4B3S L;  3GTM B;  5H1S E;  2B29 A;  1BQQ T;  1WTP A;  1LTS D;  1MSG A;  4CKC A;  1EIF A;  3KJP A;  3NWS A;  5JVH 3;  1Y69 U;  2L0C A;  3ERS X;  3CMA A;  3HOU G;  4GNX C;  4DV0 Q;  1GD7 A;  4A93 B;  1RL2 A;  1SMY D;  3TN2 A;  1TKW B;  4BXX H;  2RBM A;  4JBW A;  1SE4 A;  1Q3L A;  1E22 A;  1YJN A;  3CRL C;  2HDL A;  1PFM A;  5M5X H;  3EA6 A;  4B08 A;  3DHQ A;  1GUG A;  1AE2 A;  1OXX K;  2WB1 G;  2Q8T A;  1LLR D;  5EBD A;  3S15 B;  4OWW B;  2B63 G;  4DUZ Q;  1SRO A;  5IOD A;  2R92 B;  1STA A;  1PZI D;  4A3E H;  4J15 A;  5GAG C;  3ITP A;  1E2V A;  3FKI G;  3KF8 B;  2JA5 H;  1E7Z A;  2LXJ A;  2LY7 A;  5M3F B;  2ZM6 L;  1GXD C;  3A5Z B;  3AEV A;  4JI7 L;  1Y1V H;  1PH9 A;  2GVA A;  1EWI A;  3MTS A;  1VQG A;  4PZ6 A;  4ABN A;  5AFW A;  3HOV H;  2XRS D;  3KYH C;  2YTX A;  3PUZ A;  1BF4 A;  2B3G A;  1V43 A;  2B63 H;  2K5W A;  3GTK H;  1A8V A;  4FF2 A;  1CA5 A;  4MIU A;  4YIJ A;  3RD4 A;  4HED A;  5DEH A;  1X3P A;  2IL8 A;  5IGC A;  4R4I A;  2UXC Q;  5M3M H;  2G9H D;  4NXM Q;  4BY7 B;  5CV7 A;  1SAP A;  2F3W A;  4PG3 A;  3G4S A;  4LF9 Q;  4L6T B;  1IW7 D;  4XQQ A;  2KHS A;  4RHS A;  3J80 L;  3F2B A;  4QQB X;  3ONA B;  3ND8 A;  1E2Z A;  4OHJ A;  5IWA Q;  1FYC A;  2EJF C;  2DUD A;  5EKL A;  3STB D;  5J3B A;  3I8Z A;  1VQ5 A;  3UDX A;  5FO7 B;  3E6Z X;  4DV1 L;  1II3 A;  1TS3 A;  1V1P A;  3OYY A;  1DON A;  1WD0 A;  2L12 A;  2EXD A;  4HMJ A;  2D62 A;  1VF5 C;  3CHB D;  5CMD A;  1HPC A;  4LF5 L;  2UU9 L;  2HQL A;  1AZQ A;  1FGB D;  2UUA Q;  1LTG D;  3OHX C;  4TVA B;  4C2M H;  4A3M G;  1G2T A;  2G5D A;  3BDO A;  1SYC A;  2PZU A;  1K8G A;  1JIC A;  3KBX A;  2B2W A;  2WFW A;  3AYH B;  1FL0 A;  2NN6 H;  3PF4 A;  3ND9 A;  4L8J A;  5DM6 3;  4DUY L;  1GHJ A;  1MKH A;  1NJI C;  3SE0 A;  1WTR A;  4RGM A;  1LT4 D;  1Q86 C;  3A7L A;  4DR5 Q;  1H9S B;  5EQ0 A;  4DN4 M;  4KD3 A;  1HXY D;  1STY A;  2PNH A;  4R8N A;  2EYJ A;  1YJ9 A;  3CKI B;  4A3M H;  3S16 B;  1B4O A;  3BJU A;  1LTB D;  1FVI A;  3PV0 A;  2AQ3 B;  3A0J A;  2I5L X;  1AW7 A;  3J7A F;  4DV3 L;  1L0Y B;  1J9O A;  4R4Q A;  3S14 H;  1KLU D;  3CW2 C;  3E0J A;  3H6M A;  1E3P A;  3J80 c;  4DV4 Q;  2RF4 A;  1Q12 A;  1RTN A;  1HNW Q;  1TY0 A;  1PRT D;  3V96 A;  4K6D A;  2ZTD A;  2Z6B A;  3DWQ A;  4XT3 B;  4F87 A;  1BBX C;  2QDB A;  4UP7 A;  1I6H H;  1LT3 D;  4CJ1 B;  2PI2 E;  2E2J B;  4A3K G;  2BH8 A;  5F2D A;  5EKI A;  4IPC A;  1M1K C;  2E2I B;  1DOM A;  3A8I E;  3C46 A;  5IGB A;  1DOK A;  1UAP A;  2HUG A;  4U68 A;  1EY6 A;  4WOR A;  2AQ1 B;  1A3V A;  1D2B A;  4H44 C;  5I2X A;  2MO1 A;  4FF3 A;  5BN4 A;  4M8A A;  4YY3 Q;  3L3O C;  3GTG H;  4B3T Q;  1SEB D;  3LWU A;  4LF7 L;  4H0L C;  1QVG A;  1YIJ A;  1SMX A;  2RVL A;  3SVM A;  4TKO B;  1STE A;  1WFQ A;  3MXN B;  1BVS A;  3UDG A;  3TP7 A;  5D3D A;  3TDQ A;  2SOB A;  1EZ8 A;  4HR7 B;  4R9W A;  3TBI B;  1V9P A;  4PQX A;  1CKO A;  1QIL A;  1DM0 B;  1X56 A;  1HA6 A;  4YCU A;  2ENB A;  4G7H C;  1LYL A;  1W2B A;  2UXB L;  1IYV A;  2NN6 I;  1SNO A;  3A5U A;  1MGS A;  1S5F D;  3MHB A;  3A56 A;  4IPH A;  5IYC G;  2LSS A;  4JPB W;  1IW7 C;  3C1F A;  5KNB A;  2BE5 D;  4K8I A;  3S1R B;  4RMF A;  1F9P A;  4ILW A;  1G8Z D;  3HOY B;  1VQO A;  4TRD A;  1AN8 A;  3QO2 A;  1PRT F;  5J1Z A;  4DV2 L;  2K03 A;  3M3Y H;  5GRO A;  4DV5 L;  3E9I A;  4LFB L;  3M7N A;  2C35 B;  1EWC A;  1ML0 D;  1BCP D;  3PIP A;  1D6E C;  3BVZ A;  4IUR A;  1PRT B;  3W1B A;  3K80 C;  5JPM C;  3HOU B;  4OO1 G;  3CCJ A;  1SDF A;  3O13 A;  4LUZ A;  4P71 A;  4A3J G;  1DZ1 A;  4IFD J;  1ILQ A;  1W3S A;  2K5Q A;  4GZY C;  4WRD A;  4NXN Q;  3EBE A;  3K59 A;  3HG9 A;  4Y52 H;  1EIH A;  5K36 H;  3EQL C;  2I5H A;  1V1Q A;  2I0Q A;  2E8G A;  4BBS G;  4G7Z C;  2PQA A;  1M8A A;  2ZTE A;  2FFK B;  2WB1 B;  2VL6 A;  1N32 Q;  1Z9F A;  2B63 B;  4A3D G;  2CQA A;  3K5O A;  1VMC A;  1C8C A;  1I94 L;  4OO1 H;  3BVG A;  1D1K A;  1LO5 D;  1UE1 A;  3FKI B;  2O5J C;  3S2H B;  4EQP A;  1STB A;  3I72 A;  1E2W A;  1VQ4 A;  2F0I A;  3M85 A;  1I50 H;  3BZC A;  5IP9 G;  2VUM B;  3C1E A;  3Q8D A;  2IPK D;  1M4V A;  4BBS H;  5C3X A;  5T1G A;  2ICE C;  3G7L A;  1S40 A;  4RGO S;  1QVF A;  4F8M A;  1M90 C;  3AMU A;  1IBK L;  1B8A A;  1NTG A;  1PXU A;  2K28 A;  3KLS A;  2RSN A;  3KF8 A;  1PMR A;  3VR6 A;  4O42 A;  2ATW A;  5FK9 C;  4ME3 A;  2AUK A;  3OOC A;  3MA2 B;  2A6E C;  4IOC A;  1PRT C;  2DJG C;  1N9W A;  3CU7 A;  5IP9 H;  2PMZ B;  1ESF A;  2RHQ B;  3GTP H;  2BH2 A;  4O1N A;  1HTP A;  4KKS A;  5AJ3 L;  1I4P A;  1D8L A;  5T1I A;  1RF2 D;  2NWG A;  1F2Y A;  4X64 Q;  2X69 A;  2HD3 A;  3ER0 A;  4P75 A;  2EZV A;  1BCP F;  2F1M A;  3I4M H;  4JV5 Q;  1I4H A;  1OXU A;  3X3N A;  2JN4 A;  2CH4 A;  5D3I B;  1IBL L;  4DK0 A;  2NYZ D;  2BDO A;  1XMO Q;  2NUC A;  1BCP B;  4HJ8 A;  5FLX E;  1O7Y A;  4K5X A;  3HRZ C;  2K52 A;  1YIT A;  4X65 Q;  4AQY Q;  2MPM A;  4XIG S;  4NB3 A;  4HID A;  4IOA A;  3K58 A;  3J7A 5;  3P7J A;  1H9M A;  2A6H D;  1NMG A;  1PFB A;  2NTS A;  4MN3 A;  4A3M B;  4IFD G;  2CWA A;  5DLQ E;  1K0S A;  2K32 A;  3S15 H;  3BYY B;  1W6J A;  3RMH A;  3CCL A;  2R92 H;  4LF6 L;  4QGU A;  2WKD A;  1IKL A;  1H9J A;  1S5E D;  2B2Y A;  3M4Q A;  3OSO A;  4DA2 A;  5C6A A;  1N36 Q;  5HGT A;  3JAM i;  2E5L Q;  1X54 A;  2RHS B;  3QOJ A;  5FJ8 G;  1Q8I A;  4IUU A;  3CPW A;  2BDN A;  3F2D A;  4OO1 I;  4BY7 G;  4DUZ L;  3J81 j;  1VQN A;  3H3V H;  1FR3 A;  1I6H B;  4KHP Q;  4UY8 C;  3OIP A;  2BE5 C;  4LF8 Q;  3PO3 G;  3LWE A;  4JBJ A;  3H94 A;  4CBV A;  1EQR A;  4OWT B;  5FO8 B;  4K0K L;  5J39 A;  5LL6 X;  1Q7Y C;  3M7G A;  1XNQ Q;  4V19 0;  1JOK A;  3NTH A;  1TS5 A;  4KV6 A;  2A69 C;  3RNU A;  5FJ8 H;  4RH6 A;  1BCP C;  5BN5 A;  3S24 A;  1KL9 A;  3FPP A;  5KYL A;  3SK4 A;  3LNN A;  2O5I C;  4RHR A;  3EN2 A;  1IBM Q;  1IYJ B;  1X3Q A;  4BY7 H;  3BZD B;  2PYK A;  3GO5 A;  3M4O B;  4DR2 L;  4YWM A;  4POF A;  2HIX A;  4A3K B;  1CHP D;  3KLS X;  4K5V A;  1MJC A;  2UUC L;  1N34 L;  1GO3 E;  5EAY A;  2YTY A;  1FJG Q;  1CHQ D;  4M1U B;  4A3L G;  1QNU A;  1GUW A;  4LF9 L;  4A75 A;  1Z47 A;  4BBR G;  1G6P A;  1PH8 A;  4U67 3;  2LS0 1;  2CQO A;  1W6K A;  2DNE A;  3CP0 A;  4LAA A;  2R7Z G;  1EU3 A;  3FMC A;  2I5M X;  3OWE B;  2PW7 A;  5C44 G;  1PYS B;  2XWB B;  1WD1 A;  3GTO B;  1ZXT A;  2K50 A;  3S1M B;  4XQJ A;  1S3O A;  1YNN C;  2K5D A;  4DF7 A;  2OCE A;  2JA7 B;  1VQA A;  4HCE A;  2L1B A;  3SR1 A;  2TSS A;  4OIK A;  1HRJ A;  2K01 A;  1C0A A;  3S9W A;  4V0B A;  2NVY B;  5CBA E;  3AFP A;  1YHQ A;  3GTJ B;  1I5F A;  4L5T A;  4R1J A;  4JI8 L;  2KCC A;  5ELO A;  3IAY A;  1VQM A;  2XGT A;  1MI2 A;  5C3E G;  4ZLT F;  5C44 H;  3M3Y B;  1D1I A;  5FOB B;  3BZK A;  4MTN A;  3HS0 C;  4RCN A;  2XN9 C;  3BG3 A;  3HFZ B;  4J1M A;  5E4W C;  3TP8 A;  3MXN A;  3NWT A;  1HR0 W;  4RKB A;  1YVC A;  1CZG A;  3J7A V;  4NMZ A;  1RD9 D;  1IL8 A;  3NQI A;  3S16 H;  2F3I A;  2B8G A;  3I91 A;  1QG7 A;  3H91 A;  3W1G A;  3DM3 A;  2IWH A;  1PTO D;  2J7Z A;  1MD2 D;  3NQT A;  1ROD A;  1GOZ A;  2HT1 A;  1U4P A;  1ASZ A;  4DR5 L;  2N55 A;  5KYI A;  1X32 A;  4MHE A;  4C3J G;  1KTK A;  1VF7 A;  5C0X H;  1CI3 M;  1RJT A;  4X3T A;  1RDP D;  4A3J B;  2L4N A;  4A3C G;  4X3K A;  4AYB G;  5G3L F;  2EPB A;  3VA7 A;  4POG A;  4DV4 L;  2F0P A;  5ELE A;  2E2I H;  1HNW L;  1HA5 A;  4X66 Q;  2A6H C;  3PSI A;  1A6X A; 
#chains in the Genus database with same CATH homology
 1WYD A;  3PO2 G;  3M4P A;  1GKH A;  3CCM A;  3STB D;  5IP7 H;  5FLX c;  4A76 A;  5J3B A;  1VQ5 A;  1JT8 A;  4HIM A;  3UDX A;  1PH4 A;  1EIY B;  4R4O A;  4JI6 L;  2OQK A;  4DV1 L;  1K0R A;  5LMU Q;  4A3B G;  1LUZ A;  3I4O A;  4QJF A;  4YWK A;  3OYY A;  1CKN A;  1MIU A;  1HR0 Q;  1CSP A;  1X3F A;  1XTD A;  3ICE A;  1HH2 P;  2EXD A;  3S1Q H;  1UEB A;  2D62 A;  4LWC A;  3HOZ H;  1K83 H;  2KEN A;  1PH2 A;  4DNI A;  1LM0 A;  2RCN A;  3CCR A;  4JI3 Q;  5K36 G;  2ID0 A;  4LF5 L;  3GDE A;  2UU9 L;  2ZM6 Q;  2HQL A;  4QY7 A;  1J5E L;  4GOP A;  1UE6 A;  4OX9 L;  2NVT H;  2K5N A;  1HZ9 A;  5E7N A;  2UUA Q;  2XTI A;  4TVA B;  4GLA C;  1Q1B A;  4C2M H;  4A3M G;  1N8R C;  3PO2 H;  1EQQ A;  4YY3 L;  1K8G A;  1Y14 B;  2WFW A;  2AWN A;  3AYH B;  4DR7 Q;  2NVX H;  1FL0 A;  3PF4 A;  4A3B H;  3GD7 A;  1VQB A;  2R93 G;  2EQS A;  3PO3 H;  1YJW A;  5IT9 c;  3TRZ A;  4JG2 A;  1UWV A;  5ELN A;  1S72 A;  4DUY L;  3CCS A;  4WJ3 M;  1LTL A;  4GOP C;  1MKH A;  1NJI C;  1IL2 A;  1TWC H;  4LF7 Q;  2UXC L;  1Q86 C;  4DR5 Q;  4NXM L;  2OQ0 A;  3RLO A;  1SR3 A;  2EIF A;  3J81 c;  4JBM A;  1UE7 A;  5HY6 A;  1EOV A;  2PNH A;  1PV4 A;  2ES2 A;  1JJG A;  2PQA B;  1YJ9 A;  4A3M H;  3KF6 B;  2R7F A;  3BJU A;  1UE5 A;  5BR8 L;  5LMN L;  3U4Z A;  1JE5 A;  2R6G A;  2VS1 A;  1FVI A;  3PV0 A;  3A0J A;  4O0A A;  4IO9 A;  2I5L X;  1VQK A;  2OTL A;  3S1R H;  1JB7 A;  1KQS A;  4O2D A;  4DV3 L;  3HOY H;  4BA1 I;  2R93 H;  4R4Q A;  4OXP A;  1Q81 C;  3S14 H;  4X66 L;  5IWA L;  1YEZ A;  2N3S A;  3CW2 C;  1K8A C;  1WI5 A;  4LUV A;  1E3P A;  4AH6 A;  2VNU D;  3J80 c;  4DV4 Q;  2RF4 A;  1Q12 A;  2GN5 A;  2R7D A;  1BKB A;  2NVQ H;  1HNW Q;  3H0G G;  2UXD Q;  4HJ5 A;  1PH6 A;  2UXB Q;  1KC8 C;  1L1O A;  2ZTD A;  2MNA A;  2VQF L;  2OTJ A;  4A3L H;  4A3I G;  2VQE Q;  2Q2T A;  3J81 i;  4JI6 Q;  4GN3 B;  4UP7 A;  1I6H H;  4BBR H;  2Z0S A;  3HOU H;  1JJ2 A;  2PI2 E;  4X62 L;  3S17 H;  2R7Z H;  4YWL A;  4A3K G;  5GAD C;  2BH8 A;  5C4J H;  3I4M G;  4IPC A;  1M1K C;  4BA2 I;  1RIP A;  1KXL A;  3I2Z A;  4MZ9 A;  1YZ6 A;  1EFW A;  1VQC A;  3FP9 A;  2LXK A;  2N49 A;  4HJ7 A;  3RN2 A;  1XMQ L;  2UUA L;  3UDF A;  5C0X I;  4LF5 Q;  3K0X A;  4FDB A;  4DV5 Q;  3PCO B;  5IYD G;  1J5E Q;  4LFB Q;  4OX9 Q;  2VUM G;  1KRS A;  3EIV A;  4DAY B;  1SRU A;  2MO1 A;  1TWG H;  4JOI C;  5IY0 A;  1X3G A;  4LF4 L;  4DR6 L;  2Z6K C;  3KDF B;  4YY3 Q;  4A93 G;  4DR3 Q;  3HOW G;  2NZH A;  4XTC S;  3GTG H;  4B3T Q;  3CCV A;  3D0F A;  4A4I A;  5GAH C;  2BA0 A;  4LF7 L;  2E2H H;  1QVG A;  2IHE A;  3FKI H;  1YIJ A;  1HNX Q;  1HNZ Q;  1SMX A;  5C3E H;  1FGU A;  4DUY Q;  2IX1 A;  3S2H H;  3TEH B;  3GTM H;  4IFD I;  4B3M Q;  1SN8 A;  1G29 1;  1WFQ A;  2ASB A;  1MJE A;  2CCZ A;  3MXN B;  1K9M C;  1BVS A;  3S1N H;  3CCE A;  5IYD H;  1PFS A;  3T1Y Q;  2VUM H;  5JJK A;  3CD6 A;  4QL5 A;  3UDG A;  2R92 G;  3RR5 A;  3K81 C;  1CKM A;  2Y0S G;  4DPG A;  4OWX B;  3HOX G;  4GKK L;  1V9P A;  1Q82 C;  4A93 H;  3PUX A;  1CKO A;  3HOW H;  1SE8 A;  1I94 Q;  1X56 A;  2JE6 I;  5M3F G;  1WCM H;  2IHF A;  3HKZ E;  4YCU A;  4DV3 Q;  1LYL A;  1A0I A;  1U0L A;  4GLV B;  1W2B A;  2UXD L;  3KJO A;  4OON A;  2UXB L;  4R4C A;  2NN6 I;  4UP9 A;  1ASY A;  1XPR A;  2WB1 E;  1C7Y A;  1VQ7 A;  3A5U A;  3OW2 A;  2VQE L;  1K3R A;  1L0W A;  4C3J H;  3U4V A;  2KCM A;  4IPH A;  5IYC G;  1XJV A;  2LSS A;  2VQF Q;  3T1H L;  2D0O A;  5M5Y H;  4HIK A;  2F4V Q;  2V1C C;  4RMF A;  1Q8K A;  3CC4 A;  4PZ8 A;  1VQO A;  4GN5 A;  5C0X J;  3HOX H;  4GNX B;  3PUV A;  4X62 Q;  2YTV A;  4AIM A;  3OTO Q;  4DV2 L;  2HIV A;  4A3C H;  1J6Q A;  5M3F H;  1E1O A;  3M3Y H;  2JEB I;  5GRO A;  4DV5 L;  3E9I A;  3S2D H;  4LFB L;  4JI5 L;  3M7N A;  2Q2H A;  2C35 B;  3NEL A;  1XMQ Q;  1N33 L;  4C3I H;  1H95 A;  3PIP A;  3CXC A;  3CCQ A;  2JK8 A;  3AFQ A;  4A3G G;  1VQH A;  3CPF A;  5IE8 A;  3W1B A;  2CKZ B;  4DR3 L;  3K80 C;  1O7I A;  4OO1 G;  1AE3 A;  3CCJ A;  4LUZ A;  3K8A A;  4P71 A;  4B3T L;  4LF4 Q;  4JOI A;  4LFC Q;  4DR6 Q;  1CSQ A;  2Z6K A;  4A3J G;  2JQO A;  4IFD J;  4KHZ A;  3VDY A;  1W3S A;  1QVC A;  3NEN A;  4B3R L;  1HNX L;  3RLN A;  1HNZ L;  4JV5 L;  4NXN Q;  1P16 A;  2A19 A;  3EBE A;  2K4K A;  3GTQ H;  3I4N G;  4DAM A;  4B3M L;  3UDI A;  4Y52 H;  3UE1 A;  2I5H A;  1QZH A;  1V1Q A;  2ZTC A;  4GS3 A;  2H5X A;  4ALP A;  2E8G A;  2I0Q A;  3T1Y L;  4BBS G;  2PQA A;  3PUY A;  4P72 A;  1XNR L;  2ZTE A;  2VL6 A;  1N32 Q;  1Z9F A;  2WP8 J;  1X6O A;  3PUW A;  4LUO A;  4A3D G;  3AQQ A;  2JJQ A;  4PMW A;  1YHB A;  4X65 L;  1X3E A;  4IJH A;  2WAQ G;  3ULJ A;  4BXX G;  1I94 L;  3E9H A;  3CF5 A;  1PH5 A;  4AYB E;  1PA6 A;  4L5S A;  1UE1 A;  2AWO A;  3CQZ H;  3SGI A;  1I3Q H;  2UUB Q;  4GKJ Q;  4WJ4 A;  3CC2 A;  1VQ4 A;  3M85 A;  1I50 H;  1KAW A;  1HZC A;  3BZC A;  5IP9 G;  5JEA J;  4DR1 Q;  2DGY A;  3Q8D A;  2CWP A;  4P74 A;  4BBS H;  2F4V L;  3CCU A;  2F52 A;  1Q1E A;  1S40 A;  4A3E G;  1QVF A;  1M90 C;  3T1H Q;  4IJL A;  4UPA A;  1IBK L;  2Q2U A;  1B8A A;  1NTG A;  4LFA Q;  1G51 A;  1X65 A;  1SLJ A;  4YCW A;  3OTO L;  3CME A;  2JA5 G;  3PF5 A;  4JI7 L;  1VQI A;  1Y1V G;  4KI0 A;  4LF6 Q;  2YV5 A;  4TQU S;  2E5L L;  2ATW A;  2IX0 A;  4ME3 A;  4DV2 Q;  3CAM A;  3RN5 A;  4IOC A;  4IPD A;  3K7A H;  2MO0 A;  3HOV G;  5FLM G;  1AH9 A;  1N9W A;  3W5O A;  1XPU A;  4JI5 Q;  3L0O A;  3H0G H;  4KHP L;  1L1O B;  2JA9 A;  5IP9 H;  1N33 Q;  1OXS C;  1KD1 C;  1HZA A;  2BA1 A;  4LFC L;  5JJI A;  2RHQ B;  1HZB A;  3GTP H;  4H02 A;  4A3I H;  2BH2 A;  3HKS A;  4P73 A;  3U50 C;  3I7F A;  5AJ3 L;  3M4O H;  3GTL H;  1D8L A;  1T9H A;  4X64 Q;  4NXN L;  3J7Z C;  4JI1 Q;  3ER0 A;  4P75 A;  1XNQ L;  1NE3 A;  4GKK Q;  4A3K H;  4YHH Q;  3RLF A;  1E1T A;  4B3R Q;  3I4M H;  4JV5 Q;  4K0K Q;  1OXU A;  2A8V A;  2ALY B;  1U5K A;  2JA7 G;  1VCI A;  1Q46 A;  3E0E A;  4APV A;  5M3M G;  1D7Q A;  4JBK A;  3TS0 A;  3LGJ A;  1IBL L;  1IBM L;  3U58 A;  1N32 L;  5FLM H;  1XMO Q;  2D0P A;  2MFI A;  5C0X G;  4RG1 A;  4HJ8 A;  4HJA A;  1XNR Q;  3FHW A;  5IYB G;  4LW1 A;  1BBW A;  4C3H H;  3I55 A;  2QEX A;  1QUQ B;  4DV7 Q;  2K52 A;  1PYB A;  1YIT A;  4JI0 Q;  1EUJ A;  4JI4 Q;  4X65 Q;  1VQE A;  4DR2 Q;  4AQY Q;  4A3F G;  4XIG S;  2PI2 A;  4NB3 A;  3H15 A;  4HID A;  4IOA A;  1X55 A;  1B7Y B;  2YYZ A;  2UUB L;  4GKJ L;  3G48 A;  1FJG L;  3ZJY C;  3H3V I;  3GTO H;  3F8T A;  1C9O A;  3JC6 6;  2AKW B;  2VY3 A;  3J7A 5;  1NMF A;  3DLL A;  4DR1 L;  3S1M H;  4DV6 Q;  2UUC Q;  1N34 Q;  1NMG A;  1EYG A;  1VQ6 A;  2JA7 H;  2FXQ A;  1JMC A;  4HIO A;  1QZG A;  5GAE C;  4IFD G;  2CWA A;  5DLQ E;  3CC7 A;  2N8N A;  4EQ5 A;  3S15 H;  2NVY H;  3B6Y A;  4GN4 B;  3CCL A;  4LFA L;  2JA6 G;  2R92 H;  4DR4 Q;  5IYB H;  3K7U C;  4IPG A;  4PZ7 A;  3GTJ H;  3MEF A;  4GNX A;  1A63 A;  4LF6 L;  4QGU A;  4JI2 Q;  3M4Q A;  4QIW E;  1N36 Q;  1IBK Q;  2E2J H;  4DKA C;  4A3F H;  5M5W H;  4BY1 G;  3JAM i;  3RZD H;  2E5L Q;  1X54 A;  2RHS B;  5FJ8 G;  2HHH L;  3CPW A;  1NBW A;  3STB C;  3F2D A;  4OO1 I;  4BY7 G;  1PH3 A;  2N78 A;  3J81 j;  4DUZ L;  4L5R C;  4L5Q A;  1VQN A;  3H3V H;  4KHP Q;  2NN6 G;  4UY8 C;  1YHA A;  4LF8 Q;  3ULL A;  5IYC H;  2A1A A;  4X64 L;  3PO3 G;  1BBU A;  4JI1 L;  3UE0 A;  4JBJ A;  1CKN B;  1PHJ A;  2JA6 H;  2K14 A;  4UP8 A;  3ULP A;  5AJ3 Q;  1EQR A;  4OWT B;  4JI8 Q;  4YHH L;  2QA4 A;  2K75 A;  4K0K L;  1CUK A;  1NY4 A;  5JEA G;  1Q7Y C;  3PGZ A;  1XNQ Q;  4JC0 A;  4JCV E;  4BY1 H;  1YBY A;  4JI7 Q;  2YU9 H;  4GOP B;  3RNU A;  5FJ8 H;  5HGQ A;  2PMZ E;  3S24 A;  1XMO L;  1KL9 A;  4JYA L;  2KBN A;  2GVB A;  3EN2 A;  3L2P A;  1IYJ B;  1IBM Q;  2Y0S E;  3KF6 A;  1IBL Q;  4BY7 H;  2IY5 B;  5JJL A;  4DV7 L;  3G6E A;  2ZJQ A;  4JI0 L;  4KLK A;  4A3G H;  1B70 B;  3GO5 A;  4DK6 C;  4JI4 L;  3IRB A;  4DR2 L;  2VZA A;  4AQY L;  1KIX A;  2K5V A;  1TWF H;  3HOY G;  4YWM A;  4POF A;  2HIX A;  3TS2 A;  4R4T A;  1XPO A;  1P8L A;  4A3J H;  1VQJ A;  1TWA H;  4X6A H;  4HJ9 A;  1MJC A;  4EX5 A;  1PH7 A;  4B3S L;  4DV6 L;  2UUC L;  1N34 L;  1GO3 E;  5EAY A;  2YTY A;  5H1S E;  2B29 A;  1R9T H;  1FJG Q;  3I4N H;  5C4X G;  1VQP A;  1A62 A;  1EIF A;  1Y1W G;  1WJJ A;  1OXT A;  3KJP A;  4A3L G;  4LNQ A;  4LF9 L;  4DK3 C;  4NPS A;  4A75 A;  1Z47 A;  3ERS X;  4BBR G;  1G6P A;  1PH8 A;  1JJC B;  3CMA A;  2JA8 G;  4DR4 L;  3HOU G;  4GNX C;  3BU2 A;  3D31 A;  3KOJ A;  4DV0 Q;  1GD7 A;  2CQO A;  3CP0 A;  4JI2 L;  2R7Z G;  1K73 C;  2K5H A;  3F2C A;  1N36 L;  2I5M X;  1RL2 A;  4A3D H;  5C44 G;  3RZO H;  1L2F A;  2ZJR A;  3KFU A;  4BXX H;  1PYS B;  3L7Z C;  4JBW A;  1GVP A;  2K50 A;  3HKZ G;  1E22 A;  1S3O A;  1YJN A;  2IT1 A;  1OXV A;  2OCE A;  1VQA A;  5C4X H;  5M5X H;  3NBH B;  1AE2 A;  5LMN W;  3NEM A;  4YCV A;  1SFO H;  2HHH Q;  1KHI A;  1Y1W H;  1OXX K;  5LMU L;  2WB1 G;  1C0A A;  4LF8 L;  2AMC B;  2KHJ A;  4OWW B;  2B63 G;  4DUZ Q;  1SRO A;  3KDF A;  3AFP A;  2ZJP A;  1YHQ A;  1HR0 L;  4DV1 Q;  1I5F A;  2JA8 H;  4L5T A;  4R1J A;  4JI8 L;  4A3E H;  4J15 A;  5GAG C;  2VW9 A;  4MNO A;  5ELO A;  1VQ8 A;  1VQM A;  4JI3 L;  3FKI G;  2XGT A;  3KF8 B;  2JA5 H;  1E7Z A;  2LXJ A;  3KLW A;  5C3E G;  5C44 H;  2ZM6 L;  3AEV A;  2KCT A;  2KHI A;  2NZO A;  3A5Z B;  3BZK A;  4MTN A;  1Y1V H;  1E24 A;  2MQH A;  1KRT A;  1PH9 A;  1VQ9 A;  2OWO A;  2GVA A;  1EWI A;  2CFM A;  3HFZ B;  2UU9 Q;  3PIO A;  1OTC A;  1VQG A;  4PZ6 A;  1HR0 W;  1YVC A;  4Y7N H;  3J80 i;  3HOV H;  3I56 A;  2QGQ A;  3KYH C;  2YTX A;  4DR7 L;  3PUZ A;  4JYA Q;  2B3G A;  1YI2 A;  1V43 A;  2WAQ E;  2JEA I;  3S16 H;  1QUQ A;  2B63 H;  1DGS A;  3TQY A;  2F3I A;  3GTK H;  1WOC A;  1A8V A;  1YNX A;  1VQD A;  3JAM c;  1WCM G;  3W1G A;  1IZ6 A;  3DM3 A;  1VQL A;  1VQF A;  2HT1 A;  1ASZ A;  4DR5 L;  4GLX A;  3TRE A;  5IP7 G;  4B3S Q;  1TWH H;  2AHO B;  5GQO A;  4R4I A;  2UXC Q;  5M3M H;  4NXM Q;  1TXY A;  4DV0 L;  4PG3 A;  3G4S A;  4LF9 Q;  1IXR A;  3F1Z A;  3G71 A;  2Q2I A;  5BR8 Q;  5LMN Q;  1GM5 A;  3HOZ G;  1VS0 A;  4A3C G;  3F2B A;  1PH1 A;  3WWV A;  4AYB G;  1HJP A;  3A74 A;  4POG A;  4QQB X;  4DV4 L;  3M9B A;  2E2I H;  1HNW L;  1PVO A;  5IWA Q;  4X66 Q;  1X9N A;  3PSI A;  2L15 A;  1L1O C;  2DUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...