3H3VI

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vI00
1YIJA 3S16H 2MFIA 2YTVA 1R9TH 4XIGS 4AH6A 3K81C 4DV3L 1Y1WG 2E5LL 2ATWA 4A3DH 4LW1A 3S15H 2OWOA 3UE0A 4LF4Q 4JV5Q 4LWCA 3DLLA 4DR2L 2VS1A 2Y0SE 4GOPB 4OX9L 1HNZQ 3GDEA 1CUKA 1N36Q 2PNHA 4AQYQ 2VQEQ 4GN4B 1JB7A 4OX9Q 3G4SA 3RZOH 1GKHA 5IYBG 2HIXA 5GADC 1FGUA 1QVFA 4PZ8A 2JA5H 1I94Q 3LGJA 4B3TL 3S1MH 4A3GG 2UU9L 4BBSG 4IJLA 3T1HL 1H95A 1X54A 1N32Q 3ERSX 4LF6L 4X66Q 4KI0A 4DUYQ 2R7ZG 3HOWH 1P16A 4JYAL 2GVAA 1VQ8A 4QIWE 2UXCL 1G6PA 4JI0L 4HIKA 3M4PA 1G291 1N33Q 1CSQA 2QEXA 1YBYA 2JEAI 2UXBL 3PF5A 3CD6A 3G71A 3J7ZC 4YWKA 2F4VL 1CKNA 1PH8A 2Y0SG 1N33L 5C44G 4DUZL 4GN3B 2JA7G 5LMUQ 1X55A 3J81c 2HHHQ 3H3VH 1TXYA 1EOVA 1VCIA 4DR7L 3GTLH 1UE5A 1C7YA 4BA2I 1YVCA 3PO2G 1L0WA 3PO3H 2PQAB 5AJ3Q 4C2MH 1TWGH 1UE7A 2Q2UA 3ULLA 1WCMH 2WB1E 1Q82C 4YHHQ 3KF6A 3NENA 3A0JA 4BY7H 4LFBL 2Q2HA 3KOJA 4B3RQ 4WJ3M 1GVPA 3CXCA 1IYJB 1V9PA 1LUZA 3AFPA 4HJAA 3S1QH 4IOCA 3IRBA 4DR5L 3S17H 4YWLA 2RHQB 4DV4L 1UEBA 1GM5A 1OTCA 4X64Q 1PA6A 1QVCA 2N8NA 4A3EG 1IBLQ 2YTXA 4B3SL 1YI2A 1VQ9A 1N9WA 3CCLA 1BVSA 4GN5A 4KLKA 1Y14B 1J5EQ 5JEAG 2JK8A 1CSPA 4DV5Q 1VQPA 1IBML 1Z47A 5BR8Q 5IY0A 4A3MG 3HOZG 3S24A 4R4IA 4NXNQ 3I7FA 2N78A 1KRSA 1EUJA 2B3GA 3U4VA 4MTNA 3W1GA 1N34L 1OXTA 4YCUA 3I4NH 1X65A 4Y52H 1WI5A 3CPFA 2F4VQ 2WAQG 2CWPA 1E22A 3NELA 2XTIA 3PUXA 3RLNA 3CCRA 4IOAA 1IXRA 1BKBA 3GTKH 2VZAA 1XMQL 1J5EL 1HZCA 5ELNA 4HJ8A 2WP8J 1K83H 5C4XH 5FJ8H 1KL9A 1Y1VH 4NB3A 4HIOA 4ALPA 4JI7Q 4LF5L 4LF9Q 2UUAL 3TS2A 1VQAA 1OXSC 2I5LX 2ID0A 5M3MH 1Q81C 3CCVA 2K14A 5LMNQ 3ULJA 3RZDH 3L2PA 4RMFA 4EX5A 5M3MG 4A3BG 4JBMA 3UDGA 4IFDJ 5FLMH 4P72A 1ASZA 3M7NA 4P71A 1JJCB 3CCJA 4IPHA 4LF7L 3CCUA 1GO3E 4L5TA 4DR2Q 2JJQA 4A3KG 4J15A 2VY3A 1C0AA 5GAEC 3UE1A 4K0KQ 2Z6KC 2K5HA 4KHZA 4BA1I 3TEHB 2JA5G 3FKIH 4BBRH 3H3VI 1AH9A 3S1NH 4DR4L 3HOYH 3F2CA 4B3ML 1S72A 3K7AH 3KDFB 4JOIA 4LUZA 1E1TA 5GQOA 4DAMA 1X9NA 3F8TA 3J80c 3I4NG 2R93H 4X6AH 1VQKA 1HNWL 1X6OA 4LFCQ 1N32L 1HNZL 3HOYG 3PV0A 1B7YB 1VQBA 4R1JA 3CC2A 1L1OB 3UDXA 3I55A 5JJLA 2GVBA 1JMCA 4DV7L 1HR0L 1LM0A 2PMZE 1YZ6A 1PYSB 1TWAH 1VQFA 3E0EA 3CC4A 3CP0A 3AFQA 1WFQA 2KHJA 1UE6A 1XTDA 4A3EH 4A93G 1K0RA 4P73A 4DR3Q 1K8GA 5FLMG 1VQMA 3M3YH 3PIOA 1C9OA 1X56A 2KCMA 4DR6L 1Q12A 3Q8DA 2UUBQ 2GN5A 2FXQA 3OTOL 3TREA 2Q2IA 2R93G 2ZM6L 3M9BA 2PI2E 1YNXA 1QZHA 4LFAQ 4PZ6A 1KAWA 1EQRA 1WCMG 4X66L 3GD7A 3S1RH 1PVOA 1PH5A 3PSIA 3RN2A 4TVAB 2I0QA 1NBWA 4A3FH 4DNIA 1X3GA 3CF5A 1XPRA 2E2HH 3PO2H 1KD1C 4O2DA 3JAMc 1PH1A 2E5LQ 3RLOA 3PF4A 3M4OH 2CQOA 4YY3L 1EQQA 4DV6Q 1OXUA 3E9HA 4QL5A 4YHHL 5LMUL 1UE1A 2MO1A 4TQUS 4DKAC 5M5XH 1VQ7A 4B3MQ 1KXLA 4WJ4A 4OO1I 2VL6A 3L7ZC 4QJFA 3I56A 1YHQA 3H15A 3CQZH 1EIYB 3RR5A 2Q2TA 1XNQQ 4GKKL 1Y1VG 4JBKA 2K50A 1EYGA 2R92H 1VQIA 3NBHB 4R4OA 3U4ZA 4A3LH 1OXVA 1X3EA 1YEZA 4OXPA 1JJ2A 3TRZA 1E7ZA 1T9HA 3ZJYC 1RL2A 4LF6Q 3AEVA 5C3EH 4XTCS 3OYYA 4JI2L 2JA9A 5ELOA 2VQFQ 2BA1A 3CCMA 3GTGH 5IP7G 2YU9H 2JQOA 5IP7H 4YCWA 4FDBA 1GD7A 4MNOA 4DK3C 1HZBA 4DV2L 4A3MH 1QVGA 3FKIG 4BBRG 1X3FA 5C3EG 1HR0W 1N8RC 4GNXC 4IFDI 4KHPQ 4POGA 3KJPA 2ZJQA 1CKMA 2H5XA 3JC66 4JI3L 2MNAA 4A93H 4UP7A 3BZKA 4JI2Q 1J6QA 5LMNL 4OWTB 4C3HH 2KCTA 5M5YH 3A5UA 2AMCB 2DUDA 1YJ9A 4A3BH 1PH2A 2AWNA 4JI1L 3G6EA 2I5MX 4LFAL 4RG1A 3I4MG 1Z9FA 1SLJA 2QA4A 4PG3A 1EFWA 4DV3Q 5FJ8G 1VQJA 3S2DH 4DR5Q 4QGUA 5AJ3L 1AE2A 3EN2A 4ME3A 3CPWA 1VQ5A 1SR3A 1IBMQ 4JCVE 2NZHA 2KENA 3ER0A 3F2DA 1VQOA 3AYHB 4A3FG 4A3JH 1E1OA 1WYDA 3CCSA 4A3KH 1PV4A 3A5ZB 4JI4L 1W3SA 4OWXB 1AE3A 2LXJA 2A1AA 2B63G 2NVXH 4MZ9A 3M85A 4JI5L 2L15A 4GOPC 4UP8A 2WAQE 4LUVA 1WOCA 2Z6KA 4DV1L 1VS0A 4LFBQ 3HOXH 2IT1A 4GNXB 3D31A 1VQCA 3MEFA 3OW2A 1N34Q 1KC8C 4LF7Q 3HOZH 1A63A 1KHIA 1HNWQ 4JOIC 4A3DG 4JC0A 4P75A 3HFZB 3HKZE 4L5QA 3KF6B 4AYBG 1S40A 3GTPH 3T1YL 3HOWG 4A3IH 5C0XJ 1NE3A 3RNUA 1O7IA 2DGYA 3KFUA 4JI8L 3WWVA 2A8VA 2LXKA 5IYCG 1Q1BA 2VQEL 1VQNA 4GLAC 1IZ6A 4C3JH 1QUQB 4DK6C 3A74A 3CCEA 4DV1Q 1S3OA 4HJ9A 4X65L 2K4KA 5C0XI 4GKJL 1Q86C 2UXDQ 2OCEA 5M3FG 3GTMH 4BY7G 1YJWA 2IY5B 4K0KL 4GLVB 2IHFA 2NN6I 1G51A 1EIFA 2CWAA 4DUYL 1JJGA 3E9IA 1PFSA 3W1BA 2YV5A 4JI8Q 5IYDG 2KHIA 4LF5Q 3BJUA 4AIMA 5LMNW 4OWWB 2RHSB 2D62A 3K7UC 2R92G 3J80i 1ASYA 1BBWA 3PIPA 4HIMA 2R6GA 4IPGA 5C44H 1Q46A 1WJJA 4PZ7A 2B29A 2HHHL 2OTJA 3PGZA 1XMOQ 2NVQH 2C35B 2EQSA 1U0LA 1IBLL 1NJIC 2BH8A 2F52A 4QY7A 4LF9L 2JA8G 2VUMH 2CKZB 3GTJH 1PH7A 5IWAL 1K8AC 3HOUG 3GO5A 3STBC 1CKOA 1VQDA 2CCZA 1TWHH 3K0XA 4DV4Q 4HJ7A 1P8LA 1KRTA 1I94L 4LNQA 2R7ZH 2N3SA 5BR8L 1SMXA 1D8LA 5H1SE 4EQ5A 1KIXA 3PO3G 4QQBX 4Y7NH 1Q1EA 2QGQA 1XJVA 4AYBE 1EWIA 4PMWA 2ZTDA 1UWVA 5E7NA 3TS0A 4A75A 1VQ6A 1I5FA 3SGIA 4DR3L 4L5RC 4C3IH 1LYLA 4IJHA 4R4CA 1IBKQ 3FP9A 4LF8L 3DM3A 2E2JH 2ES2A 2VQFL 3CCQA 2UUBL 2WFWA 2NVTH 3HOVH 4X65Q 1FJGQ 4O0AA 1IBKL 4A4IA 2K52A 2XGTA 4DAYB 3PUWA 4X62L 3W5OA 2JA6G 2ZTEA 1Y1WH 1XPUA 4UY8C 3PUZA 4R4TA 2AKWB 2RCNA 3RN5A 3T1HQ 5DLQE 2OQ0A 1PH6A 1YITA 3PUVA 4A3GH 3U58A 2UXDL 4GNXA 1FL0A 1KQSA 1JE5A 3U50C 4DV0Q 3ULPA 4OONA 2F3IA 1K9MC 4JI6Q 4JI7L 3CW2C 1MJCA 2BA0A 2IX0A 1N36L 4DR7Q 2NZOA 5IYCH 4HIDA 4JBWA 5IT9c 4X62Q 1M1KC 1L2FA 1VQHA 2E2IH 3VDYA 1XNRQ 1HJPA 3NEMA 3L0OA 2EXDA 4A3IG 5GAHC 3CC7A 2PI2A 1I50H 5JJKA 3UDIA 5IP9G 5IWAQ 4GOPA 4A76A 2OQKA 2KBNA 4B3RL 1B70B 2ALYB 2LSSA 2K5VA 1U5KA 4APVA 2R7FA 2ASBA 2NN6G 3HOXG 4LFCL 5JEAJ 3HKSA 1A62A 3BU2A 4UPAA 3KJOA 4DR1Q 3ICEA 4DV5L 1L1OA 1XNQL 5FLXc 3KDFA 2HQLA 2B63H 3KF8B 5JJIA 2JEBI 4NPSA 2JE6I 4A3CG 4P74A 1E24A 3I4OA 2VW9A 1MKHA 3I2ZA 3EIVA 4GLXA 2UUCL 5HGQA 4DV6L 3STBD 4BY1H 3GTOH 1A8VA 1SN8A 4A3JG 5C4XG 5IP9H 4DV2Q 1B8AA 1FJGL 2HT1A 3S14H 2UUCQ 1PYBA 2UU9Q 1V43A 2UXBQ 3AQQA 4BBSH 2MO0A 1A0IA 2EIFA 4UP9A 5C4JH 3T1YQ 2VUMG 3K80C 3HKZG 4BXXH 4JYAQ 3BZCA 2R7DA 2CFMA 2A19A 3MXNB 4R4QA 5GROA 1NMFA 2UUAQ 1SROA 1PH3A 3G48A 1M90C 4LF4L 2D0PA 3OTOQ 2OTLA 1MIUA 4JG2A 1I3QH 2PQAA 1Q8KA 4X64L 1E3PA 3H0GH 3KLWA 1XMQQ 4GKKQ 2MQHA 4IO9A 3K8AA 3J7A5 4JI0Q 1QUQA 5C0XG 4YCVA 4B3SQ 2BH2A 1L1OC 3B6YA 2D0OA 3HOVG 2NVYH 1RIPA 1LTLA 1BBUA 1CKNB 3D0FA 4JV5L 4JBJA 1PH9A 1SFOH 3J81j 3EBEA 2ZM6Q 5K36G 4DR4Q 3RLFA 2IHEA 1QZGA 1K3RA 4IPDA 1HNXQ 4BXXG 1I6HH 2N49A 3CAMA 5IE8A 1JT8A 5M5WH 3GTQH 4JI1Q 3CMEA 1VQEA 1MJEA 2IX1A 2YYZA 4IPCA 1HNXL 2I5HA 4GS3A 1IL2A 2K5NA 4A3LG 4B3TQ 4NXML 3JAMi 5EAYA 3HOUH 5HY6A 2HIVA 2K75A 4BY1G 2JA6H 4GKJQ 1VQLA 1NTGA 3UDFA 4JI3Q 3H0GG 3KYHC 4LF8Q 1XPOA 1PHJA 2JA8H 4A3CH 1NMGA 1YJNA 2UXCQ 4LUOA 2ZJRA 4HJ5A 3CMAA 1XMOL 4JI4Q 2JA7H 4DR6Q 3S2HH 1Q7YC 1HZ9A 1D7QA 2YTYA 1FVIA 3M4QA 4L5SA 1TWFH 2ZTCA 2E8GA 4YWMA 5J3BA 4JI5Q 1HH2P 1SE8A 4DR1L 1V1QA 1K73C 5IYDH 1TWCH 4NXMQ 2AWOA 3PCOB 5GAGC 3FHWA 1PH4A 3F1ZA 1DGSA 4YY3Q 2VNUD 2Z0SA 3J81i 1YHAA 3TQYA 4JI6L 3F2BA 4POFA 4DV7Q 1HR0Q 4NXNL 4DPGA 5M3FH 4DUZQ 1SRUA 2ZJPA 2RF4A 1VQ4A 2AHOB 3I4MH 1VQGA 1YHBA 4OO1G 1OXXK 1W2BA 1XNRL 5IYBH 1NY4A 3PUYA 4AQYL 2WB1G 4IFDG 1HZAA 2V1CC 4KHPL 4DV0L 4H02A
chains in the Genus database with same CATH superfamily
3DEPA 3NE5B 1R9TH 3HEJA 4AH6A 4HMJA 2R93B 4JV5Q 4LF4Q 1B3QA 3MA2B 1HFGA 3S1NB 2Y0SE 1DYQA 1I4PA 2TSSA 1CUKA 1LACA 1N36Q 4AQYQ 2MJ8A 3CU7A 1JB7A 2B2YA 1MGSA 3RZOH 5IGDA 5IYBG 3V96A 1QVFA 1AEXA 4IJLA 4FF4A 3ERSX 4LF6L 4QCLA 2XN9C 1EZ6A 2R7ZG 1P16A 1E2VA 2GVAA 1G6PA 3MHBA 3M4PA 1G291 1RODA 1N33Q 1YBYA 1Q3LA 5D65A 1SYCA 4UAIA 2EYFA 1I6VC 1DZ1A 2EY2A 3GTKB 1JCKB 1S4ZA 2B2VA 3CKIB 5LMUQ 2F0KA 1RF2D 1EU4A 1SSOA 4BA2I 2VB3X 1F2YA 4QMGA 1YVCA 3I4NB 2SNSA 1WCMH 3QR8A 2L4NA 1FNWA 4BY7H 2BDNA 2Q2HA 2R61A 1LUZA 1CQVA 4HJAA 4IOCA 4DV4L 1UEBA 2KECA 1PA6A 4HN7A 4A3EG 2XNAC 5M5XB 1ZKOA 4B3SL 1EY5A 3KBXA 3PQIA 1CM9A 1VQPA 5IY0A 4NXNQ 3I7FA 3W1GA 2B3GA 2XSCA 2FMCA 3U4VA 1N34L 1JE4A 1JOKA 4Y52H 1PTOF 2F4VQ 4NP5A 1EY9A 2XTIA 3KF8A 5KIXA 3CCRA 2VZAA 4HJ8A 4ID6A 3HP3A 1K83H 1WD0A 5FJ8H 4ALPA 4NB3A 3TS2A 1OXSC 3HOWB 4RGOS 4RMFA 5M3MG 4A3BG 2PPBC 4JBMA 3UDGA 4IFDJ 2PO4A 4ILWA 4KK7A 5EPKA 1F9SA 2Z1CA 4QB4A 4LF7L 4L5TA 1K8OA 1AN8A 2F0WA 3J7AV 1KNAA 4KHZA 1A15A 3HOYH 4OHJA 4BBRB 4KY5A 5C5MA 3DEOA 2K05A 4JOIA 5I9OA 1SDFA 3F8TA 4A3JB 4KKSA 1X6OA 1QCBD 4LFCQ 3EVQA 3PV0A 1CQFA 3I55A 3NWSA 3UDXA 5JJLA 1JMCA 4PQXA 4OL7A 2PMZE 1YZ6A 3CC4A 1WFQA 1UE6A 2ZXOA 5FLMG 5M5YB 3PIOA 4TKOB 3SK4A 4OGQC 2A69D 3OTOL 4I7AA 4HSPA 1EL0A 2Q2IA 1SE2A 1Y1WB 2G9HD 1DD2A 3SEBA 1YNXA 1QZHA 1TS5A 1EQRA 3EJIA 1HHVA 3GD7A 3S1RH 1PH5A 2EVBA 2B2VC 5L37A 3RN2A 4A3FH 1X3GA 4DAYA 2ZXRA 3FEWX 1KABA 3JAMc 3X3NA 4BWGB 3QOLA 1LT4D 3KUPA 2JA6B 2X69A 4YY3L 1O7YA 1OXUA 2NWGA 4YHHL 5NUCA 1IW7C 2A5HA 4WJ4A 2VL6A 4QJFA 3I56A 3CQZH 3H6MA 4KN7C 1XNQQ 3FMCA 4JVZA 3L3OC 4PMCA 1EYGA 2R92H 2KCCA 3NBHB 4HSVA 1YEZA 2IPKD 5DM63 4RHRA 4KKUA 1BXTA 1RL2A 1SBBB 4XTCS 1G91A 2JA9A 5EGTA 5IP7G 5JVH3 4YCWA 1CT1D 1GD7A 1IW7D 4MNOA 1HZBA 4DK3C 4A3MH 1EZ8A 4BBRG 1T5XD 2Z4HA 5C3EG 1HR0W 2DNCA 4KHPQ 1SYEA 2IX3A 2ZJQA 1CKMA 3JC66 4JI3L 4A93H 4R8NA 3BZKA 4KV6A 2PNRC 1SYFA 2ZT9C 2DUDA 4A3BH 4J6HA 2KEEA 1FD7D 4LFAL 1A2UA 1J8IA 2EDGA 3R3OA 4DV3Q 2J7ZA 1VQJA 5FJ8G 1UAPA 5DAUA 2AQ2B 1SR3A 4FXKC 4JCVE 2NTSA 1PZKD 2NZHA 4RAUC 2A74C 4A3JH 4F7XA 5KNBA 4JI4L 1CTMA 2B2TC 2NVXB 4CDFC 2B63G 4KKTA 4MZ9A 2NVXH 4GOPC 4C1NI 4UP8A 5JPNC 2RDFA 2WAQE 1FR3A 2Z6KA 1I50B 1VS0A 3HOZH 1GHJA 3MEFA 3OW2A 1KC8C 3FDTA 3C3LA 3SDZA 2I46A 4AYBG 4A3IH 1ICFB 1NE3A 1SAPA 3RNUA 4FXGC 5M3FB 4IFDH 3J81E 3MXPA 5E4WC 1JWUD 3RD4A 4X65L 1C8CA 3GTMH 3K58A 1JORA 2IY5B 5CGKA 3PIP3 1U4MA 5ELFA 2NVTB 4Q5VA 1G51A 2F0GA 1PFSA 3S2HB 4JI8Q 5IYDG 2X6LA 1XX8A 5EBCA 3U9OA 1BBWA 3PIPA 4HIMA 3DWAA 1YNND 3HOUB 3RMHA 1B50A 3K5NA 4PZ7A 2K5QA 3MXNA 1XMOQ 2C35B 1U0LA 1IBLL 4K8JA 3WDNA 5CORA 5IWAL 3HOUG 1PYWD 5IT9L 4X6AH 3ZYYX 2R7ZH 1RDPD 1K28A 1GXDC 1D8LA 5H1SE 2D2CC 1FGBD 3PO3G 3M4OB 2XRSD 4J1MA 5KNCA 3J80E 4DR3L 3SGIA 3IFDA 4CBVA 4C3IH 4LF8L 4CHTB 4CGYB 2FMMA 3DM3A 5F2DA 1I3QB 1RD9D 1W6JA 1QG7A 3PUWA 3Q0AA 2BOSA 4UY8C 1V1PA 2EJGC 3O13A 5DLQE 4ZUIA 4BBSB 1QB5D 2F1MA 1ENCA 2A6HC 3PUVA 4A3GH 3MVVA 5K5PA 3TBIB 3PMFA 3U50C 2B39A 4DV0Q 3ITPA 1KDCA 1VF7A 4RWSC 1BOSA 3D6WA 2ICIA 4HIDA 4X62Q 1XNRQ 2EY5A 3KLSA 3CC7A 4NDXA 3J81L 3UDIA 2OQKA 3VYUA 1U5KA 3ERQA 3K57A 1LTTD 1LTGD 3R93A 1G6ZA 5C3WA 4HMIA 4ZK9B 4M8AA 1GJXA 2JE6I 4A3CG 1EQVA 1E24A 3I4OA 2VW9A 2E2IB 3GTOH 3BS1A 1A8VA 1SN8A 2KA7A 3IAYA 1B53A 3E0JA 1S5BD 2UXBQ 4NW2A 2Z9HA 3ONAB 2IL8A 3TP6A 1A0IA 3J7AF 1E2WA 4IURA 2EY6A 3K80C 4BXXH 3BZCA 3T56B 1HTLD 2A68D 5BN4A 3G48A 5I6WA 2D0PA 4F8MA 1XMQQ 4GKKQ 1A6XA 4F88A 1QUQA 1SJHD 2O4XA 3WOFA 4B3SQ 1EIGA 2KHSA 3B6YA 2D0OA 2NVYH 3DWQA 1RIPA 1LTLA 3GP7A 1K3BC 1KTKA 4DR4Q 2E74C 5CBEE 3NK9A 4IPDA 1HNXQ 2N49A 1ML0D 3CQZB 2F0QA 4JI1Q 1H9SA 5FO8B 3JAMi 5C44B 3HOUH 1F2LA 1M4VA 5HY6A 4XT3B 1H9JA 2I07B 4LF8Q 1NMGA 4X3TA 4HJ5A 3CMAA 3Q23A 4ZKCB 1H9SB 1FVIA 3M4QA 5J3BA 4JI5Q 4MTKA 4N8FA 5IYDH 5GAGC 1NSNS 2HCCA 4LMQD 4YY3Q 1IKMA 3J81i 2WKCA 1I4XA 4DPGA 1VQ4A 1VQGA 1BBXC 5IYBH 4KTAA 1F2ZA 1TWAB 1NY4A 5I4DA 2WB1G 4RKLA 5C6AA 3K0YA 1I4HA 1F9PA 2VXWA 1O78A 1YIJA 3HOZB 4PNYA 1JWSD 2MFIA 2ATWA 2WB1B 4A3DH 4LWCA 3DLLA 4DR2L 2V4DA 4L8JA 2VS1A 4R8IA 4GOPB 1LTBD 1YNNC 2VQEQ 2H4OA 4DA2A 1LTAD 4OX9Q 3G4SA 2E75C 4KY6A 1EYCA 3VYRA 4PZ8A 2JA5H 1II3A 1H95A 4A3GG 4ZRZA 3T1HL 1V1OA 1N32Q 4X66Q 4KI0A 2NBFA 3M7GA 1VQ8A 4DFAA 4HIKA 1FNUA 1TQOA 2QEXA 2X6GA 4RCNA 2UXBL 1D6EC 2TMPA 3G71A 3J7ZC 5CV9A 2F4VL 5C44G 4DUZL 5C5LA 4TRDA 3J81c 3I91A 4CDCC 1G2SA 2QEJC 1UE5A 2QF7A 2E2JB 3PO2G 2PZTA 2PQAB 2YU9B 1TWGH 2JA7B 3GTGB 1CK1A 1FYCA 2WB1E 3I8ZA 5CYUA 2B2YC 2JA8B 4WJ3M 3CXCA 1IYJB 1LV9A 3FPUB 4YWLA 1GM5A 1TIID 4IUNA 1EY0A 5M5WB 2AQ3B 3EROA 3L9AX 1Z6HA 2YTXA 2L9HA 1T5EA 1CI3M 1SEBD 1IYUA 4GN5A 1B44D 4HCEA 2J4XA 3S24A 2N78A 4A3FB 1BCPD 1OXTA 4S3SA 4UDUC 4PV1C 3D8GA 1E22A 4M1UB 3RLNA 1IXRA 1BKBA 1ET6A 2EE1A 1J5EL 2F03A 1HZCA 2WP8J 5DNFA 5C4XH 2EYPA 1Y1VH 2EXZA 4HIOA 1VQAA 3PIO3 5M3MH 1Q81C 3BVGA 3RZDH 1PFNA 3H94A 4EX5A 1EY8A 5FLMH 1ASZA 1JJCB 3DWPA 1PRTD 3CCUA 4DR2Q 4IUUA 4A3KG 4J15A 1C0AA 4UHVA 2Z6KC 3BDLA 4K0KQ 5FLXE 3TEHB 1PFMA 3GV6A 3HOYB 3F2CA 3FKIB 2EYHA 2M2LA 5T1IA 3K7AH 3KDFB 4A3KB 4LUZA 1E1TA 3I4NG 3J80c 1PTOC 1WTRA 3HOYG 5IGGA 4R1JA 3CC2A 1ESRA 2FINB 3NXWA 1VQFA 1GUGA 4A93G 1K0RA 2F0MA 3NP8A 1TY2A 3MEHA 1VQMA 1K8GA 3M3YH 1CZWA 1C9OA 2UUBQ 4QF4A 4A93B 5M9OA 3TREA 1HA5A 1EYAA 3M9BA 1QE6A 1EEFD 1WCMG 2O5IC 1E2ZA 4TVAB 5HGTA 1AW7A 4DNIA 3CF5A 2K03A 2F0LA 1JR0D 1PH1A 4XYQA 3A8IE 3RLOA 2E5LQ 3PF4A 2HUGA 1VQ7A 3D6CA 4OO1I 1YHQA 4GKKL 1EFID 1X3EA 4HAEA 4OXPA 1JJ2A 1T9HA 5C3EH 4JI2L 3OWFA 2BA1A 2K33A 4K5XA 5KGUA 1SXTA 3JAME 4RFBA 1MI2A 4MIUA 4R9WA 3LWUA 1QVGA 3FKIG 1BCPB 1X3FA 2AQ1B 4GNXC 4IFDI 1EWCA 2K04A 1KLUD 2H1EA 5EBDA 4JI2Q 4HR7B 1YNJD 4H0LC 4C3HH 1SE3A 3JAML 4ZQ3A 1X32A 2I5MX 2PZWA 1SLJA 1EFWA 3OHXC 1VQ5A 1AE2A 1RTNA 4C1NK 1IBMQ 1JC7A 1EIHA 2B63B 2KENA 3F2DA 2LMCB 3AYHB 1E1OA 3TMEA 1WYDA 2EYLA 3A5ZB 4OWXB 1S5DD 1EY4A 3VYSA 4B9WA 3M85A 1D1IA 2L15A 4JI5L 3S15B 1PFBA 2JYOA 4LUVA 5FOBB 1WOCA 4DV1L 2F0JA 3S16B 1GUOA 2DJGC 3HOXH 3QOJA 4GNXB 1VQCA 3S2DB 3SK6A 4GZYC 4P75A 3HFZB 1LT3D 3HKZE 4L5QA 3HOWG 2CQAA 1EYDA 5C0XJ 4A3GB 3FPPA 2A8VA 5A2QE 5IYCG 1Q1BA 1PRTB 1QUQB 3MFYA 4DV1Q 1B3AA 5E4XA 4GKJL 4ZYSA 1Q86C 2OCEA 1GUSA 5AFWA 4K0KL 4GLVB 2RSOA 2CWAA 1JJGA 3E9IA 4XQQA 2RQXA 3A7LA 4N8X1 4AIMA 5LMNW 3K7UC 3J80i 2Q8RE 1ASYA 5CBAE 2HDMA 3BG3A 4U68A 1Q46A 1WJJA 2B29A 2HHHL 3PGZA 4IN3A 2EQSA 1NJIC 3GTQB 1VMCA 1BNZA 2VUMB 1TVXA 4CKCA 1VQDA 3HKZB 2CCZA 1KRTA 4H44C 1I94L 1WTVA 1VF5C 4QQBX 4ZUJA 4Y7NH 3H3VC 4AYBE 1VQ6A 3TS0A 4L63B 4A75A 5I9PA 1BQQT 1MSGA 3BZDB 2FHTA 1LYLA 4IJHA 1IBKQ 3H91A 5FKAC 2KJXA 2CH4A 3S1RB 2NVTH 1CA5A 4X65Q 4O0AA 4HTHA 2XGTA 5C0XH 2JA6G 2ZTEA 3T13A 1SMYD 3C46A 1PH6A 3U58A 1FL0A 2F3IA 4JI7L 3CHBD 2BA0A 3CW2C 2IX0A 4OO1H 4JBWA 1M1KC 2JA5B 3L0OA 3K6OA 4A3IG 1I50H 2F0OA 5JJKA 1LO5D 2L11A 2LSSA 2K5VA 2ASBA 2R7FA 1LTID 2B8FA 5CMDA 4K5WA 3HKSA 4IALA 4DR1Q 1L1OA 1XNQL 1ILQA 2MHVA 3KDFA 2B63H 3KF8B 5IGFA 2QKIC 2NYZD 2P5ZX 5JJIA 4P74A 2UUCL 1MKHA 3I2ZA 1FNVA 3SE0A 1LLRD 4EGVA 5C4ZA 4A3JG 3I73A 5C4XG 1K8MA 1B8AA 2RBMA 3C1FA 3MXGA 2HT1A 1V43A 1HQMC 4BBSH 2VUMG 5EPLA 5C4XB 2OT2A 2CFMA 1X3PA 5IT9E 4KJNA 2A19A 2JP1A 3MXNB 1NMFA 4O1NA 1TWCB 1M90C 5JPMC 2F0HA 1B1ZA 4LF4L 4K14A 2VB2X 2OTLA 4JG2A 1Q8KA 3KLWA 2K01A 3D4DA 3TZUA 4YCVA 2BH2A 2WIIB 3HOVG 4DAPA 3D0FA 4JV5L 1BCPC 3J81j 3U9SA 2IHEA 1QZGA 2M9VA 2B2WC 1H9RA 3CAMA 3OMCA 1JT8A 5M5WH 1MJEA 1XTCD 3S17B 4IPCA 1ENFA 1HNXL 2I5HA 3VR6A 2HQEA 1NAPA 2K32A 2KCNA 2HIVA 5I2XA 4DF7A 4GKJQ 3UDFA 3H0GG 1XPOA 2UXCQ 2DY8A 4LUOA 1XMOL 1AZPA 3I72A 4JI4Q 1Q7YC 2EYMA 3QO2A 4C3IG 2YTYA 4L5SA 2E8GA 3Q22A 4OEMB 4YWMA 2QCPX 4DR1L 1TWCH 4NXMQ 1D5MC 2AWOA 2XWBB 3PCOB 5BN3A 1DGSA 1Q90A 2Z0SA 1F9RA 3TQYA 4CJ0B 3IKJA 4NXNL 4NMZA 4DUZQ 1SRUA 2ZJPA 2RF4A 2AHOB 3I4MH 1YHBA 1RJTA 1OXXK 1W2BA 5CV4A 1BO0A 3A7AB 4Q0FA 1HZAA 1XJVA 2E76C 4K2KA 1ESFA 1KDAA 1Y1WG 2E5LL 3DHQA 1PZID 4LW1A 3S15H 2OWOA 1C48A 3KLRA 5TSSA 3UE0A 1DJRD 2CW0D 4OX9L 5IOCA 1HNZQ 3GDEA 3T51B 4JK1C 2IWHA 1TU2B 2QW7A 1SNPA 4PMBA 4LJZC 4X3KA 2PZUA 1J9OA 1GKHA 2HIXA 1FGUA 3NBIA 4EVOA 1WTWA 3LGJA 2RVLA 4B3TL 3S1MH 2UU9L 4BBSG 4K5VA 2MGSA 2F0SA 1QWYA 4I65A 3RZDB 4DUYQ 5FLXL 2N55A 3VR5A 4QIWE 3T16A 2UXCL 3WOEA 1Y1VB 5BN5A 3LX0A 2JEAI 4B9XA 1K83B 3PF5A 2G9DA 3CD6A 4IUQA 4OIJA 5CR3A 4YWKA 1PH8A 2Y0SG 4GN3B 2JA7G 1X55A 1STGA 4H13C 3H3VH 1PTOH 1EOVA 3GTLH 1B2TA 2Y0SB 4F87A 2KOLA 5AJ3Q 3NWTA 1WTQA 3A54A 2Q2UA 3ULLA 4YHHQ 3NENA 3A0JA 5JVG3 4LFBL 3KOJA 4Y7NB 1GVPA 1BUVT 3W3AA 3AFPA 1ZXTA 4HCSA 3S1QH 4WJWA 3IRBA 4DR5L 2RHQB 3BYTB 1OTCA 5JEAH 4X64Q 5KEEA 1QVCA 2N8NA 3X3MA 3SXHA 1YI2A 1NR4A 2F0IA 1VQ9A 5LL6S 3CCLA 1BVSA 5JEAG 1CSPA 4DV5Q 3HOZG 5BR8Q 4A3MG 3KK7A 3K5LA 5A35A 1KRSA 1EUJA 1C4QA 4MTNA 1O7ZA 4YCUA 3I4NH 1X65A 3IL8A 3NTHA 1WI5A 4MN3A 1U4LA 3CPFA 4HEDA 3A55A 3NELA 3K59A 1L0YB 1WTHA 1M8AA 3GTKH 1XMQL 5ELNA 5EQ0A 2CH4W 1LTRD 3SVMA 4LF5L 1BDOA 2I5LX 2ID0A 3CCVA 2K14A 3TP8A 3P1HA 4ME5A 3ULJA 1BR9A 5LMNQ 3S14B 2F3VA 5IGCA 5KRUA 1PDQA 5E1FA 3KBGA 1GUNA 2HCIA 4BY1B 4P72A 3M7NA 2LKVA 2ENBA 4IPHA 1KLGD 1KAAA 2JJQA 4V190 1DOMA 2K5WA 1MHWC 2F0EA 1LABA 2K5HA 3K7AB 4BBRH 1AH9A 4DR4L 1H9MA 4B3ML 1S72A 2L0CA 5ELEA 5D3IB 1R4PB 2R93H 1UEAB 1ILPA 1VQKA 3AMUA 1HNZL 1GOZA 1VQBA 1A3VA 2KUMA 1PYSB 3Q24A 2B2WA 3AFQA 2KHJA 4P73A 4G57A 1SMYC 2MUYA 1X56A 4P2CB 3Q8DA 1A2TA 2GN5A 2FXQA 2EPBA 2R93G 1VDZA 2ZM6L 2HDLA 2PI2E 3M4YA 1HQRD 4C56C 4LFAQ 1A3UA 1BCPF 1KAWA 1XXGA 1TT2A 4X66L 4LAAA 2OEOA 1PRTC 3OIPA 1XPRA 3PO2H 2E2HH 1KD1C 4O2DA 3C2PA 3F2UA 4XQJA 3HRZC 3D4WA 2GA4B 3M4OH 5EPJA 3E9HA 4QL5A 1HXYD 1UE1A 5ELBA 4TQUS 5LL6X 1RTOA 1PMRA 3AU7A 3EQLC 3L7ZC 4O42A 1VQIA 2QDBA 3T4AC 1E7ZA 3ZJYC 3AEVA 4FXDA 4BY7B 3OYYA 4ABNA 3N6RA 4FP5D 3CCMA 3GTGH 1I4RA 2PW5A 2K7VA 2JQOA 2D5DA 1PTOD 1JB3A 4FDBA 2EY1A 4DNTB 2K1BA 4IZ8A 4DV2L 1V1PB 2JN4A 2K6AA 3GTMB 3DM1A 4ODGA 2J0TD 4POGA 3KJPA 1SYGA 1AP0A 2H5XA 2MNAA 3K5MA 4UP7A 1DCZA 1O80A 5C4HA 5LMNL 1K0SA 4FNFA 2KCTA 5M5YH 4J8QA 3A5UA 1LTSD 1JOQA 2B2TA 5I2YA 1O7LA 1SNDA 1Z9FA 1SNOA 4RGTA 2QA4A 5T1GA 3E3XA 1PXUA 3S1MB 3CPWA 3EN2A 4ME3A 4XDXA 4L6TB 3ER0A 1VQOA 1SJED 1CA6A 1SNMA 1SNCA 4A3KH 1PV4A 3C1EA 4G7ZC 1W3SA 2LXJA 1DONA 2F3WA 2A73B 3HS0C 2DN8A 4TSSA 2IT1A 3D31A 4FO2A 1Y8PB 1A63A 1KHIA 5J22A 2B2UA 4FF3A 4A3DG 4JC0A 3LNNA 3P7JA 1S40A 1CFMA 1AFPA 5M3MB 1IL8A 2EJFC 1O7IA 2DGYA 2QILA 4JI8L 3WWVA 3HZXA 4WFN3 4GLAC 1IZ6A 1MBYA 4C3JH 3CCEA 3A74A 1S3OA 4ZAIA 5C0XI 2UXDQ 2FFKB 4BY7G 1YJWA 4EQOA 4NKLA 2IHFA 2NN6I 4DUYL 1EIFA 1R4QB 3W1BA 2YV5A 1Y8NB 3BJUA 2R92G 1ZEQX 1S5ED 2L5TA 3K5OA 3QIAA 1D5ZC 1STBA 2OTJA 4FF2A 2RA4A 4LF9L 2JA8G 2F52A 4QY7A 1ONLA 1WTPA 4N9TA 2CKZB 1TY0A 3GTJH 1PH7A 3FRPB 1K8AC 1UUPA 3GO5A 1I6HB 4CJ1B 5EJWA 1TWHH 4DV4Q 4HJ7A 1STAA 1TKWB 2N3SA 1SMXA 1SFOB 4EQ5A 1Q1EA 1EWIA 4PMWA 3BVMA 5E7NA 2WAQB 2DJFC 1I5FA 1WCMB 5KNDA 3VA7A 5ISRA 4KY7A 3OIQA 3MTSA 3UI2A 2E2JH 2ES2A 2UUBL 3OWEB 3V2TA 2EYJA 1IBKL 4A4IA 3DXJC 4DAYB 4X62L 3W5OA 4MHEA 1Y1WH 1L0XB 5EKLA 1PZJD 4R4TA 4C3JB 2AKWB 2RCNA 3RN5A 3T1HQ 2AUJD 1TS3A 3CRKC 2OQ0A 4E6IA 2O2LD 3ND8A 2BDOA 1EY6A 3NQIA 2UXDL 4GNXA 3W2DA 1KQSA 1JE5A 3ULPA 4A3IB 4OONA 3VYTA 1N36L 5IYCH 4U673 5IT9c 2E2IH 3VDYA 1LT6D 1HJPA 2A6ED 3NEMA 3P75A 4IUVA 3HOXB 5A2QL 5D3DA 3RZOB 1NCVA 5JOBA 4GOPA 5JAVA 4A76A 2KBNA 3VR4A 3HOXG 4WRDA 1V8QA 5JEAJ 1A62A 3KJOA 3ICEA 4DV5L 1R9TB 2HQLA 1SYBA 2JEBI 4GLXA 3OSOA 5HGQA 4DV6L 3STBD 4BY1H 2G5DA 4QUFA 1ET9A 1FJGL 1EU3A 3S14H 2UUCQ 1PYBA 3TP5A 2BCOA 2K5DA 2EYOA 1TS2A 3QJYA 3R2IA 2MO0A 4UP9A 2EIFA 4DK0A 3HKZG 4JYAQ 5IGBA 2R7DA 2JSOA 2WV6D 3EFXD 2PCFB 4QIWB 5GROA 1BF4A 3OTOQ 3N52A 3HOVB 4X64L 3NUCA 1E3PA 2KVMA 1U9RA 4JI0Q 2F0VA 2SEBD 3MFGA 1L1OC 4JBJA 2ZM6Q 3FVQA 5K36G 1WTOA 3RLFA 4C3JG 1K3RA 1I6HH 4G7OC 5IE8A 3SR1A 2PMZB 2IX1A 1JICA 1IL2A 4GS3A 4A3LG 2K5NA 2WKDA 5J39A 1E0BA 5IODA 4DU9A 1H9KA 3R2TA 1YNJC 1QJOA 2K75A 2JA6H 1IYVA 2K28A 5CV6A 3KYHC 2NVYB 2HD3A 2JA8H 1YJNA 4XXEA 4DR6Q 1TWGB 3A8JE 2JA7H 1D7QA 3GTLB 2BE5C 3E5SA 5IGEA 1PTOB 2NN6H 3S9WA 1EQTA 1K73C 5IIFA 4KMUC 5CV5A 3FHWA 2RCFA 2EOTA 3A8KE 5ELCA 2VNUD 1EOTA 1YHAA 1HA6A 3F2BA 5C4JB 4DV7Q 1HR0Q 4RHSA 1JOOA 4G4KA 3TN2A 2LY7A 4OO1G 1XNRL 2E2DC 4IFDG 2V1CC 4KHPL 4DV0L 4H02A 1RHPA 1TR5A 2OXPA 3S16H 2YTVA 2Z6BA 3E6ZX 4XIGS 4ZKBB 5LHY1 5KYIA 3K81C 4DV3L 4KD3A 3J80L 2PNHA 4DN4M 4GN4B 5FK9C 4LK1C 2KQ3A 2IW3A 5GADC 3OW7A 1I94Q 4IQZA 1X54A 2NZ1D 3HOWH 3NTKA 4JYAL 1S5FD 2SNMA 4ZLTF 4A3BB 4JI0L 1CSQA 2XIWA 3MWYW 3OOCA 4C3HB 3CRLC 5I6YA 2F0TA 1NNXA 1CKNA 1N33L 1HTPA 3MC0B 2HHHQ 2N88A 1TXYA 1VCIA 4DR7L 1C7YA 1L0WA 3PO3H 4C2MH 1UE7A 4FF1A 1RKNA 2RKSA 1Q82C 3KF6A 5C3EB 4B3RQ 1SYDA 1V9PA 1WVLA 1TWHB 3S17H 2R92B 2B8GA 1KDBA 4WORA 2C5CA 1QILA 3QB3A 1IBLQ 3S1QB 1N9WA 1WD1A 3TP7A 5FO7B 4KLKA 1J5EQ 1Y14B 1IBML 2JK8A 1Z47A 2DNEA 4R4IA 4EQPA 2F4IA 1Z7TA 2F0DA 1F77A 2WAQG 2CWPA 5E3FA 3PUXA 4FYDA 4JW0A 2F0NA 4IOAA 2NTTA 3AB9A 4K2LA 1TS4A 2XVSA 4JI7Q 1KL9A 3BDCA 4LF9Q 3M3YB 2UUAL 1EWHA 3T53B 4AYBB 3DMUA 3L2PA 3OPOA 3GTOB 4KD4A 4C3HG 4P71A 3MAQA 4RGMA 3CCJA 5DEHA 1JQYD 4RH6A 1GO3E 2VY3A 4IUPA 5GAEC 4BS9A 3UE1A 4BA1I 3H3VI 2JA5G 3FKIH 3DUZA 3IFTA 3MXUA 3S1NH 2WACA 5EKIA 1G2TA 2B2UC 4H7BA 4DAMA 4RKBA 5GQOA 1X9NA 2L55A 1HNWL 1GUTA 1N32L 3H09A 4I7ZC 1B7YB 5D14A 3NPPA 3OMGA 1DOLA 1L1OB 2GVBA 3EA6A 2NUCA 4DV7L 1HR0L 1LM0A 4XT1B 1TWAH 3E0EA 3CP0A 4A3EH 1XTDA 2MPMA 3I4MB 4DR3Q 1GHKA 4K8IA 3SHLA 3HGBA 2KCMA 3TDQA 1CHPD 1Q12A 1D5XC 5CV7A 2SDFA 3I90A 5G3LD 4A3MB 4PZ6A 1RCVD 1HFNA 1HUNA 1PVOA 3PSIA 2I0QA 1NBWA 4CDDC 2L1BA 4QUCA 1SNQA 4ZCKA 4DK1A 1PRTF 2CQOA 1EQQA 4DV6Q 5LMUL 2MO1A 4DKAC 4B3MQ 5M5XH 1KXLA 3HG9A 1EIYB 3H15A 2Q2TA 3RR5A 1Y1VG 4JBKA 3VR2A 2K50A 4JPBW 3KLSX 1WTXA 4R4OA 3U4ZA 4A3LH 1OXVA 2Q8TA 1HPCA 3TRZA 4LF6Q 1EY7A 5ELOA 2VQFQ 2OF1A 5K36H 3PO2B 1DXMA 2A68C 2YU9H 3SK5A 5IP7H 3I4LA 1QNUA 3H0GB 4EQNA 2IJ0A 3QWNA 1N8RC 2QDLA 4KHVA 1STYA 1B9MA 5DM73 1J6QA 4RA8A 2CW0C 4OWTB 1STEA 2AMCB 4CDEC 1YJ9A 1XYIA 1PH2A 4DNRB 2AWNA 4JI1L 3G6EA 1D1KA 4RG1A 3I4MG 2WINB 1STHA 4PG3A 3S2DH 4DR5Q 4QGUA 5AJ3L 3P20A 2R3ZA 4A3FG 3CCSA 1AE3A 2RSNA 5JJZA 2A1AA 4K6DA 4A3DB 4B08A 4LFBQ 4RGNA 4DR6L 4LF7Q 1N34Q 1HNWQ 4JOIC 1QNKA 3KF6B 3GTPH 1MD2D 3T1YL 1CHQD 1EEID 1G8ZD 1I4GA 2O5JC 2EZVA 4DGZA 3KFUA 2LXKA 3VR3A 3BVZA 2VQEL 1VQNA 1VMPA 4KN4C 4DK6C 4HJ9A 2K4KA 5M3FG 2CHBD 3D3RA 4Z9CB 2RDHA 3I3CA 2Q8IB 1PLFA 2M00A 4C3IB 4LF5Q 3URYA 2KHIA 3LWEA 2C9OA 3VA5A 4OWWB 2RHSB 4XYOA 2D62A 1UNSA 2R6GA 4IPGA 5C44H 5COYA 5HURA 4K6LA 1ICWA 1U4RA 2NVQH 4XQNA 2BH8A 4CKEA 2XRQD 1I4QA 3GTJB 2VUMH 1DM0B 1CKOA 3STBC 3K0XA 2NVQB 1P8LA 4LNQA 5BR8L 2Z4IA 1KIXA 4DXGA 2QGQA 1S5CD 2ZTDA 1UWVA 2NB0A 3TSSA 4L5RC 2E2HB 4R4CA 3FP9A 3PO3B 4DXFA 2VQFL 3NQTA 3CCQA 2WFWA 3HOVH 3GQBA 1FJGQ 3G7LA 2K52A 1Q8IA 1X3QA 1LT5D 2D9UA 1XPUA 3D4RA 2F0PA 4N9PA 3PUZA 3V05A 4FVMA 1YITA 5CC4A 4OIKA 1AZQA 4X3SA 4JI6Q 1K9MC 3NHHA 1MJCA 4DR7Q 2NZOA 2XWJB 4DAVA 1ENAA 1L2FA 1VQHA 2BE5D 2KEDA 4KJOA 2EXDA 5GAHC 2PI2A 1A3TA 1B4OA 5IP9G 3Q6SA 3NTIA 3R8BA 5C3XA 5IWAQ 4B3RL 1B70B 2ALYB 4APVA 1SE4A 2NN6G 3RUZA 4LFCL 4CJ2C 5J1ZA 2LFNA 1D2BA 2A6HD 3BDOA 3BU2A 4UPAA 2L12A 5FLXc 1ZYRC 4NPSA 4ULLA 1HCZA 3EIVA 2F0UA 3BYYB 2MP1A 5IP9H 1KNEA 4DV2Q 4YIJA 5G3LF 2UU9Q 1OO9B 3AQQA 1STNA 2FJ2A 2Z8LA 5C4JH 3T1YQ 1F2MA 4R4QA 2EJMA 2UUAQ 1SROA 1PH3A 1GUWA 1MIUA 1I3QH 1TWFB 2PQAA 5KYLA 3H0GH 1QOHA 2MQHA 4IO9A 3K8AA 4CKBA 1CZGA 1DOKA 3J7A5 5C0XG 3I70A 1BBUA 1CKNB 5EKKA 3ND9A 1PH9A 1SFOH 2ICEC 3EBEA 1Y8OB 1IHZA 2RDGA 2R7ZB 4BXXG 5CV8A 2PW7A 2SOBA 2A6EC 3GTQH 3CMEA 1VQEA 1MSHA 2YYZA 2CVRA 2LS01 3GV3A 2PQEA 4B3TQ 4NXML 1HRJA 5EAYA 1F9QA 3G6JB 4BY1G 4V0BA 2JXMB 1NR2A 1NTGA 1VQLA 2AUKA 4JI3Q 1JWMD 1PHJA 4A3CH 3A56A 2F0FA 3TZDA 2ZJRA 3J7YW 2PYKA 3S2HH 2A69C 4C2MB 1ZYRD 1HZ9A 1W6KA 1TWFH 2ZTCA 1HUMA 1U4PA 1HH2P 1SE8A 1V1QA 5FO9B 1B9NA 1NUCA 2DY7A 1PH4A 3F1ZA 4OELB 4G7HC 4JI6L 3NBHA 4IUTA 4POFA 2ZXPA 4X3UA 5M3FH 1IKLA 4A3EB 3QG1A 3NSWA 1XWEA 3MZ5A 3GTPB 3PUYA 4AQYL 5ELDA 3SK8A 4RCOA 1Y69U
chains in the Genus database with same CATH topology
1YIJA 3S16H 2MFIA 2YTVA 1R9TH 4XIGS 4AH6A 3K81C 4DV3L 1Y1WG 2E5LL 2ATWA 4A3DH 4LW1A 3S15H 2OWOA 3UE0A 4LF4Q 4JV5Q 4LWCA 3DLLA 4DR2L 2VS1A 2Y0SE 4GOPB 4OX9L 1HNZQ 3GDEA 1CUKA 1N36Q 2PNHA 4AQYQ 2VQEQ 4GN4B 1JB7A 4OX9Q 3G4SA 3RZOH 1GKHA 5IYBG 2HIXA 5GADC 1FGUA 1QVFA 4PZ8A 2JA5H 1I94Q 3LGJA 4B3TL 3S1MH 4A3GG 2UU9L 4BBSG 4IJLA 3T1HL 1H95A 1X54A 1N32Q 3ERSX 4LF6L 4X66Q 4KI0A 4DUYQ 2R7ZG 3HOWH 1P16A 4JYAL 2GVAA 1VQ8A 4QIWE 2UXCL 1G6PA 4JI0L 4HIKA 3M4PA 1G291 1N33Q 1CSQA 2QEXA 1YBYA 2JEAI 2UXBL 3PF5A 3CD6A 3G71A 3J7ZC 4YWKA 2F4VL 1CKNA 1PH8A 2Y0SG 1N33L 5C44G 4DUZL 4GN3B 2JA7G 5LMUQ 1X55A 3J81c 2HHHQ 3H3VH 1TXYA 1EOVA 1VCIA 4DR7L 3GTLH 1UE5A 1C7YA 4BA2I 1YVCA 3PO2G 1L0WA 3PO3H 2PQAB 5AJ3Q 4C2MH 1TWGH 1UE7A 2Q2UA 3ULLA 1WCMH 2WB1E 1Q82C 4YHHQ 3KF6A 3NENA 3A0JA 4BY7H 4LFBL 2Q2HA 3KOJA 4B3RQ 4WJ3M 1GVPA 3CXCA 1IYJB 1V9PA 1LUZA 3AFPA 4HJAA 3S1QH 4IOCA 3IRBA 4DR5L 3S17H 4YWLA 2RHQB 4DV4L 1UEBA 1GM5A 1OTCA 4X64Q 1PA6A 1QVCA 2N8NA 4A3EG 1IBLQ 2YTXA 4B3SL 1YI2A 1VQ9A 1N9WA 3CCLA 1BVSA 4GN5A 4KLKA 1Y14B 1J5EQ 5JEAG 2JK8A 1CSPA 4DV5Q 1VQPA 1IBML 1Z47A 5BR8Q 5IY0A 4A3MG 3HOZG 3S24A 4R4IA 4NXNQ 3I7FA 2N78A 1KRSA 1EUJA 2B3GA 3U4VA 4MTNA 3W1GA 1N34L 1OXTA 4YCUA 3I4NH 1X65A 4Y52H 1WI5A 3CPFA 2F4VQ 2WAQG 2CWPA 1E22A 3NELA 2XTIA 3PUXA 3RLNA 3CCRA 4IOAA 1IXRA 1BKBA 3GTKH 2VZAA 1XMQL 1J5EL 1HZCA 5ELNA 4HJ8A 2WP8J 1K83H 5C4XH 5FJ8H 1KL9A 1Y1VH 4NB3A 4HIOA 4ALPA 4JI7Q 4LF5L 4LF9Q 2UUAL 3TS2A 1VQAA 1OXSC 2I5LX 2ID0A 5M3MH 1Q81C 3CCVA 2K14A 5LMNQ 3ULJA 3RZDH 3L2PA 4RMFA 4EX5A 5M3MG 4A3BG 4JBMA 3UDGA 4IFDJ 5FLMH 4P72A 1ASZA 3M7NA 4P71A 1JJCB 3CCJA 4IPHA 4LF7L 3CCUA 1GO3E 4L5TA 4DR2Q 2JJQA 4A3KG 4J15A 2VY3A 1C0AA 5GAEC 3UE1A 4K0KQ 2Z6KC 2K5HA 4KHZA 4BA1I 3TEHB 2JA5G 3FKIH 4BBRH 3H3VI 1AH9A 3S1NH 4DR4L 3HOYH 3F2CA 4B3ML 1S72A 3K7AH 3KDFB 4JOIA 4LUZA 1E1TA 5GQOA 4DAMA 1X9NA 3F8TA 3J80c 3I4NG 2R93H 4X6AH 1VQKA 1HNWL 1X6OA 4LFCQ 1N32L 1HNZL 3HOYG 3PV0A 1B7YB 1VQBA 4R1JA 3CC2A 1L1OB 3UDXA 3I55A 5JJLA 2GVBA 1JMCA 4DV7L 1HR0L 1LM0A 2PMZE 1YZ6A 1PYSB 1TWAH 1VQFA 3E0EA 3CC4A 3CP0A 3AFQA 1WFQA 2KHJA 1UE6A 1XTDA 4A3EH 4A93G 1K0RA 4P73A 4DR3Q 1K8GA 5FLMG 1VQMA 3M3YH 3PIOA 1C9OA 1X56A 2KCMA 4DR6L 1Q12A 3Q8DA 2UUBQ 2GN5A 2FXQA 3OTOL 3TREA 2Q2IA 2R93G 2ZM6L 3M9BA 2PI2E 1YNXA 1QZHA 4LFAQ 4PZ6A 1KAWA 1EQRA 1WCMG 4X66L 3GD7A 3S1RH 1PVOA 1PH5A 3PSIA 3RN2A 4TVAB 2I0QA 1NBWA 4A3FH 4DNIA 1X3GA 3CF5A 1XPRA 2E2HH 3PO2H 1KD1C 4O2DA 3JAMc 1PH1A 2E5LQ 3RLOA 3PF4A 3M4OH 2CQOA 4YY3L 1EQQA 4DV6Q 1OXUA 3E9HA 4QL5A 4YHHL 5LMUL 1UE1A 2MO1A 4TQUS 4DKAC 5M5XH 1VQ7A 4B3MQ 1KXLA 4WJ4A 4OO1I 2VL6A 3L7ZC 4QJFA 3I56A 1YHQA 3H15A 3CQZH 1EIYB 3RR5A 2Q2TA 1XNQQ 4GKKL 1Y1VG 4JBKA 2K50A 1EYGA 2R92H 1VQIA 3NBHB 4R4OA 3U4ZA 4A3LH 1OXVA 1X3EA 1YEZA 4OXPA 1JJ2A 3TRZA 1E7ZA 1T9HA 3ZJYC 1RL2A 4LF6Q 3AEVA 5C3EH 4XTCS 3OYYA 4JI2L 2JA9A 5ELOA 2VQFQ 2BA1A 3CCMA 3GTGH 5IP7G 2YU9H 2JQOA 5IP7H 4YCWA 4FDBA 1GD7A 4MNOA 4DK3C 1HZBA 4DV2L 4A3MH 1QVGA 3FKIG 4BBRG 1X3FA 5C3EG 1HR0W 1N8RC 4GNXC 4IFDI 4KHPQ 4POGA 3KJPA 2ZJQA 1CKMA 2H5XA 3JC66 4JI3L 2MNAA 4A93H 4UP7A 3BZKA 4JI2Q 1J6QA 5LMNL 4OWTB 4C3HH 2KCTA 5M5YH 3A5UA 2AMCB 2DUDA 1YJ9A 4A3BH 1PH2A 2AWNA 4JI1L 3G6EA 2I5MX 4LFAL 4RG1A 3I4MG 1Z9FA 1SLJA 2QA4A 4PG3A 1EFWA 4DV3Q 5FJ8G 1VQJA 3S2DH 4DR5Q 4QGUA 5AJ3L 1AE2A 3EN2A 4ME3A 3CPWA 1VQ5A 1SR3A 1IBMQ 4JCVE 2NZHA 2KENA 3ER0A 3F2DA 1VQOA 3AYHB 4A3FG 4A3JH 1E1OA 1WYDA 3CCSA 4A3KH 1PV4A 3A5ZB 4JI4L 1W3SA 4OWXB 1AE3A 2LXJA 2A1AA 2B63G 2NVXH 4MZ9A 3M85A 4JI5L 2L15A 4GOPC 4UP8A 2WAQE 4LUVA 1WOCA 2Z6KA 4DV1L 1VS0A 4LFBQ 3HOXH 2IT1A 4GNXB 3D31A 1VQCA 3MEFA 3OW2A 1N34Q 1KC8C 4LF7Q 3HOZH 1A63A 1KHIA 1HNWQ 4JOIC 4A3DG 4JC0A 4P75A 3HFZB 3HKZE 4L5QA 3KF6B 4AYBG 1S40A 3GTPH 3T1YL 3HOWG 4A3IH 5C0XJ 1NE3A 3RNUA 1O7IA 2DGYA 3KFUA 4JI8L 3WWVA 2A8VA 2LXKA 5IYCG 1Q1BA 2VQEL 1VQNA 4GLAC 1IZ6A 4C3JH 1QUQB 4DK6C 3A74A 3CCEA 4DV1Q 1S3OA 4HJ9A 4X65L 2K4KA 5C0XI 4GKJL 1Q86C 2UXDQ 2OCEA 5M3FG 3GTMH 4BY7G 1YJWA 2IY5B 4K0KL 4GLVB 2IHFA 2NN6I 1G51A 1EIFA 2CWAA 4DUYL 1JJGA 3E9IA 1PFSA 3W1BA 2YV5A 4JI8Q 5IYDG 2KHIA 4LF5Q 3BJUA 4AIMA 5LMNW 4OWWB 2RHSB 2D62A 3K7UC 2R92G 3J80i 1ASYA 1BBWA 3PIPA 4HIMA 2R6GA 4IPGA 5C44H 1Q46A 1WJJA 4PZ7A 2B29A 2HHHL 2OTJA 3PGZA 1XMOQ 2NVQH 2C35B 2EQSA 1U0LA 1IBLL 1NJIC 2BH8A 2F52A 4QY7A 4LF9L 2JA8G 2VUMH 2CKZB 3GTJH 1PH7A 5IWAL 1K8AC 3HOUG 3GO5A 3STBC 1CKOA 1VQDA 2CCZA 1TWHH 3K0XA 4DV4Q 4HJ7A 1P8LA 1KRTA 1I94L 4LNQA 2R7ZH 2N3SA 5BR8L 1SMXA 1D8LA 5H1SE 4EQ5A 1KIXA 3PO3G 4QQBX 4Y7NH 1Q1EA 2QGQA 1XJVA 4AYBE 1EWIA 4PMWA 2ZTDA 1UWVA 5E7NA 3TS0A 4A75A 1VQ6A 1I5FA 3SGIA 4DR3L 4L5RC 4C3IH 1LYLA 4IJHA 4R4CA 1IBKQ 3FP9A 4LF8L 3DM3A 2E2JH 2ES2A 2VQFL 3CCQA 2UUBL 2WFWA 2NVTH 3HOVH 4X65Q 1FJGQ 4O0AA 1IBKL 4A4IA 2K52A 2XGTA 4DAYB 3PUWA 4X62L 3W5OA 2JA6G 2ZTEA 1Y1WH 1XPUA 4UY8C 3PUZA 4R4TA 2AKWB 2RCNA 3RN5A 3T1HQ 5DLQE 2OQ0A 1PH6A 1YITA 3PUVA 4A3GH 3U58A 2UXDL 4GNXA 1FL0A 1KQSA 1JE5A 3U50C 4DV0Q 3ULPA 4OONA 2F3IA 1K9MC 4JI6Q 4JI7L 3CW2C 1MJCA 2BA0A 2IX0A 1N36L 4DR7Q 2NZOA 5IYCH 4HIDA 4JBWA 5IT9c 4X62Q 1M1KC 1L2FA 1VQHA 2E2IH 3VDYA 1XNRQ 1HJPA 3NEMA 3L0OA 2EXDA 4A3IG 5GAHC 3CC7A 2PI2A 1I50H 5JJKA 3UDIA 5IP9G 5IWAQ 4GOPA 4A76A 2OQKA 2KBNA 4B3RL 1B70B 2ALYB 2LSSA 2K5VA 1U5KA 4APVA 2R7FA 2ASBA 2NN6G 3HOXG 4LFCL 5JEAJ 3HKSA 1A62A 3BU2A 4UPAA 3KJOA 4DR1Q 3ICEA 4DV5L 1L1OA 1XNQL 5FLXc 3KDFA 2HQLA 2B63H 3KF8B 5JJIA 2JEBI 4NPSA 2JE6I 4A3CG 4P74A 1E24A 3I4OA 2VW9A 1MKHA 3I2ZA 3EIVA 4GLXA 2UUCL 5HGQA 4DV6L 3STBD 4BY1H 3GTOH 1A8VA 1SN8A 4A3JG 5C4XG 5IP9H 4DV2Q 1B8AA 1FJGL 2HT1A 3S14H 2UUCQ 1PYBA 2UU9Q 1V43A 2UXBQ 3AQQA 4BBSH 2MO0A 1A0IA 2EIFA 4UP9A 5C4JH 3T1YQ 2VUMG 3K80C 3HKZG 4BXXH 4JYAQ 3BZCA 2R7DA 2CFMA 2A19A 3MXNB 4R4QA 5GROA 1NMFA 2UUAQ 1SROA 1PH3A 3G48A 1M90C 4LF4L 2D0PA 3OTOQ 2OTLA 1MIUA 4JG2A 1I3QH 2PQAA 1Q8KA 4X64L 1E3PA 3H0GH 3KLWA 1XMQQ 4GKKQ 2MQHA 4IO9A 3K8AA 3J7A5 4JI0Q 1QUQA 5C0XG 4YCVA 4B3SQ 2BH2A 1L1OC 3B6YA 2D0OA 3HOVG 2NVYH 1RIPA 1LTLA 1BBUA 1CKNB 3D0FA 4JV5L 4JBJA 1PH9A 1SFOH 3J81j 3EBEA 2ZM6Q 5K36G 4DR4Q 3RLFA 2IHEA 1QZGA 1K3RA 4IPDA 1HNXQ 4BXXG 1I6HH 2N49A 3CAMA 5IE8A 1JT8A 5M5WH 3GTQH 4JI1Q 3CMEA 1VQEA 1MJEA 2IX1A 2YYZA 4IPCA 1HNXL 2I5HA 4GS3A 1IL2A 2K5NA 4A3LG 4B3TQ 4NXML 3JAMi 5EAYA 3HOUH 5HY6A 2HIVA 2K75A 4BY1G 2JA6H 4GKJQ 1VQLA 1NTGA 3UDFA 4JI3Q 3H0GG 3KYHC 4LF8Q 1XPOA 1PHJA 2JA8H 4A3CH 1NMGA 1YJNA 2UXCQ 4LUOA 2ZJRA 4HJ5A 3CMAA 1XMOL 4JI4Q 2JA7H 4DR6Q 3S2HH 1Q7YC 1HZ9A 1D7QA 2YTYA 1FVIA 3M4QA 4L5SA 1TWFH 2ZTCA 2E8GA 4YWMA 5J3BA 4JI5Q 1HH2P 1SE8A 4DR1L 1V1QA 1K73C 5IYDH 1TWCH 4NXMQ 2AWOA 3PCOB 5GAGC 3FHWA 1PH4A 3F1ZA 1DGSA 4YY3Q 2VNUD 2Z0SA 3J81i 1YHAA 3TQYA 4JI6L 3F2BA 4POFA 4DV7Q 1HR0Q 4NXNL 4DPGA 5M3FH 4DUZQ 1SRUA 2ZJPA 2RF4A 1VQ4A 2AHOB 3I4MH 1VQGA 1YHBA 4OO1G 1OXXK 1W2BA 1XNRL 5IYBH 1NY4A 3PUYA 4AQYL 2WB1G 4IFDG 1HZAA 2V1CC 4KHPL 4DV0L 4H02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ A;  3S16 H;  2MFI A;  2YTV A;  1R9T H;  4XIG S;  4AH6 A;  3K81 C;  4DV3 L;  1Y1W G;  2E5L L;  2ATW A;  4A3D H;  4LW1 A;  3S15 H;  2OWO A;  3UE0 A;  4LF4 Q;  4JV5 Q;  4LWC A;  3DLL A;  4DR2 L;  2VS1 A;  2Y0S E;  4GOP B;  4OX9 L;  1HNZ Q;  3GDE A;  1CUK A;  1N36 Q;  2PNH A;  4AQY Q;  2VQE Q;  4GN4 B;  1JB7 A;  4OX9 Q;  3G4S A;  3RZO H;  1GKH A;  5IYB G;  2HIX A;  5GAD C;  1FGU A;  1QVF A;  4PZ8 A;  2JA5 H;  1I94 Q;  3LGJ A;  4B3T L;  3S1M H;  4A3G G;  2UU9 L;  4BBS G;  4IJL A;  3T1H L;  1H95 A;  1X54 A;  1N32 Q;  3ERS X;  4LF6 L;  4X66 Q;  4KI0 A;  4DUY Q;  2R7Z G;  3HOW H;  1P16 A;  4JYA L;  2GVA A;  1VQ8 A;  4QIW E;  2UXC L;  1G6P A;  4JI0 L;  4HIK A;  3M4P A;  1G29 1;  1N33 Q;  1CSQ A;  2QEX A;  1YBY A;  2JEA I;  2UXB L;  3PF5 A;  3CD6 A;  3G71 A;  3J7Z C;  4YWK A;  2F4V L;  1CKN A;  1PH8 A;  2Y0S G;  1N33 L;  5C44 G;  4DUZ L;  4GN3 B;  2JA7 G;  5LMU Q;  1X55 A;  3J81 c;  2HHH Q;  3H3V H;  1TXY A;  1EOV A;  1VCI A;  4DR7 L;  3GTL H;  1UE5 A;  1C7Y A;  4BA2 I;  1YVC A;  3PO2 G;  1L0W A;  3PO3 H;  2PQA B;  5AJ3 Q;  4C2M H;  1TWG H;  1UE7 A;  2Q2U A;  3ULL A;  1WCM H;  2WB1 E;  1Q82 C;  4YHH Q;  3KF6 A;  3NEN A;  3A0J A;  4BY7 H;  4LFB L;  2Q2H A;  3KOJ A;  4B3R Q;  4WJ3 M;  1GVP A;  3CXC A;  1IYJ B;  1V9P A;  1LUZ A;  3AFP A;  4HJA A;  3S1Q H;  4IOC A;  3IRB A;  4DR5 L;  3S17 H;  4YWL A;  2RHQ B;  4DV4 L;  1UEB A;  1GM5 A;  1OTC A;  4X64 Q;  1PA6 A;  1QVC A;  2N8N A;  4A3E G;  1IBL Q;  2YTX A;  4B3S L;  1YI2 A;  1VQ9 A;  1N9W A;  3CCL A;  1BVS A;  4GN5 A;  4KLK A;  1Y14 B;  1J5E Q;  5JEA G;  2JK8 A;  1CSP A;  4DV5 Q;  1VQP A;  1IBM L;  1Z47 A;  5BR8 Q;  5IY0 A;  4A3M G;  3HOZ G;  3S24 A;  4R4I A;  4NXN Q;  3I7F A;  2N78 A;  1KRS A;  1EUJ A;  2B3G A;  3U4V A;  4MTN A;  3W1G A;  1N34 L;  1OXT A;  4YCU A;  3I4N H;  1X65 A;  4Y52 H;  1WI5 A;  3CPF A;  2F4V Q;  2WAQ G;  2CWP A;  1E22 A;  3NEL A;  2XTI A;  3PUX A;  3RLN A;  3CCR A;  4IOA A;  1IXR A;  1BKB A;  3GTK H;  2VZA A;  1XMQ L;  1J5E L;  1HZC A;  5ELN A;  4HJ8 A;  2WP8 J;  1K83 H;  5C4X H;  5FJ8 H;  1KL9 A;  1Y1V H;  4NB3 A;  4HIO A;  4ALP A;  4JI7 Q;  4LF5 L;  4LF9 Q;  2UUA L;  3TS2 A;  1VQA A;  1OXS C;  2I5L X;  2ID0 A;  5M3M H;  1Q81 C;  3CCV A;  2K14 A;  5LMN Q;  3ULJ A;  3RZD H;  3L2P A;  4RMF A;  4EX5 A;  5M3M G;  4A3B G;  4JBM A;  3UDG A;  4IFD J;  5FLM H;  4P72 A;  1ASZ A;  3M7N A;  4P71 A;  1JJC B;  3CCJ A;  4IPH A;  4LF7 L;  3CCU A;  1GO3 E;  4L5T A;  4DR2 Q;  2JJQ A;  4A3K G;  4J15 A;  2VY3 A;  1C0A A;  5GAE C;  3UE1 A;  4K0K Q;  2Z6K C;  2K5H A;  4KHZ A;  4BA1 I;  3TEH B;  2JA5 G;  3FKI H;  4BBR H;  3H3V I;  1AH9 A;  3S1N H;  4DR4 L;  3HOY H;  3F2C A;  4B3M L;  1S72 A;  3K7A H;  3KDF B;  4JOI A;  4LUZ A;  1E1T A;  5GQO A;  4DAM A;  1X9N A;  3F8T A;  3J80 c;  3I4N G;  2R93 H;  4X6A H;  1VQK A;  1HNW L;  1X6O A;  4LFC Q;  1N32 L;  1HNZ L;  3HOY G;  3PV0 A;  1B7Y B;  1VQB A;  4R1J A;  3CC2 A;  1L1O B;  3UDX A;  3I55 A;  5JJL A;  2GVB A;  1JMC A;  4DV7 L;  1HR0 L;  1LM0 A;  2PMZ E;  1YZ6 A;  1PYS B;  1TWA H;  1VQF A;  3E0E A;  3CC4 A;  3CP0 A;  3AFQ A;  1WFQ A;  2KHJ A;  1UE6 A;  1XTD A;  4A3E H;  4A93 G;  1K0R A;  4P73 A;  4DR3 Q;  1K8G A;  5FLM G;  1VQM A;  3M3Y H;  3PIO A;  1C9O A;  1X56 A;  2KCM A;  4DR6 L;  1Q12 A;  3Q8D A;  2UUB Q;  2GN5 A;  2FXQ A;  3OTO L;  3TRE A;  2Q2I A;  2R93 G;  2ZM6 L;  3M9B A;  2PI2 E;  1YNX A;  1QZH A;  4LFA Q;  4PZ6 A;  1KAW A;  1EQR A;  1WCM G;  4X66 L;  3GD7 A;  3S1R H;  1PVO A;  1PH5 A;  3PSI A;  3RN2 A;  4TVA B;  2I0Q A;  1NBW A;  4A3F H;  4DNI A;  1X3G A;  3CF5 A;  1XPR A;  2E2H H;  3PO2 H;  1KD1 C;  4O2D A;  3JAM c;  1PH1 A;  2E5L Q;  3RLO A;  3PF4 A;  3M4O H;  2CQO A;  4YY3 L;  1EQQ A;  4DV6 Q;  1OXU A;  3E9H A;  4QL5 A;  4YHH L;  5LMU L;  1UE1 A;  2MO1 A;  4TQU S;  4DKA C;  5M5X H;  1VQ7 A;  4B3M Q;  1KXL A;  4WJ4 A;  4OO1 I;  2VL6 A;  3L7Z C;  4QJF A;  3I56 A;  1YHQ A;  3H15 A;  3CQZ H;  1EIY B;  3RR5 A;  2Q2T A;  1XNQ Q;  4GKK L;  1Y1V G;  4JBK A;  2K50 A;  1EYG A;  2R92 H;  1VQI A;  3NBH B;  4R4O A;  3U4Z A;  4A3L H;  1OXV A;  1X3E A;  1YEZ A;  4OXP A;  1JJ2 A;  3TRZ A;  1E7Z A;  1T9H A;  3ZJY C;  1RL2 A;  4LF6 Q;  3AEV A;  5C3E H;  4XTC S;  3OYY A;  4JI2 L;  2JA9 A;  5ELO A;  2VQF Q;  2BA1 A;  3CCM A;  3GTG H;  5IP7 G;  2YU9 H;  2JQO A;  5IP7 H;  4YCW A;  4FDB A;  1GD7 A;  4MNO A;  4DK3 C;  1HZB A;  4DV2 L;  4A3M H;  1QVG A;  3FKI G;  4BBR G;  1X3F A;  5C3E G;  1HR0 W;  1N8R C;  4GNX C;  4IFD I;  4KHP Q;  4POG A;  3KJP A;  2ZJQ A;  1CKM A;  2H5X A;  3JC6 6;  4JI3 L;  2MNA A;  4A93 H;  4UP7 A;  3BZK A;  4JI2 Q;  1J6Q A;  5LMN L;  4OWT B;  4C3H H;  2KCT A;  5M5Y H;  3A5U A;  2AMC B;  2DUD A;  1YJ9 A;  4A3B H;  1PH2 A;  2AWN A;  4JI1 L;  3G6E A;  2I5M X;  4LFA L;  4RG1 A;  3I4M G;  1Z9F A;  1SLJ A;  2QA4 A;  4PG3 A;  1EFW A;  4DV3 Q;  5FJ8 G;  1VQJ A;  3S2D H;  4DR5 Q;  4QGU A;  5AJ3 L;  1AE2 A;  3EN2 A;  4ME3 A;  3CPW A;  1VQ5 A;  1SR3 A;  1IBM Q;  4JCV E;  2NZH A;  2KEN A;  3ER0 A;  3F2D A;  1VQO A;  3AYH B;  4A3F G;  4A3J H;  1E1O A;  1WYD A;  3CCS A;  4A3K H;  1PV4 A;  3A5Z B;  4JI4 L;  1W3S A;  4OWX B;  1AE3 A;  2LXJ A;  2A1A A;  2B63 G;  2NVX H;  4MZ9 A;  3M85 A;  4JI5 L;  2L15 A;  4GOP C;  4UP8 A;  2WAQ E;  4LUV A;  1WOC A;  2Z6K A;  4DV1 L;  1VS0 A;  4LFB Q;  3HOX H;  2IT1 A;  4GNX B;  3D31 A;  1VQC A;  3MEF A;  3OW2 A;  1N34 Q;  1KC8 C;  4LF7 Q;  3HOZ H;  1A63 A;  1KHI A;  1HNW Q;  4JOI C;  4A3D G;  4JC0 A;  4P75 A;  3HFZ B;  3HKZ E;  4L5Q A;  3KF6 B;  4AYB G;  1S40 A;  3GTP H;  3T1Y L;  3HOW G;  4A3I H;  5C0X J;  1NE3 A;  3RNU A;  1O7I A;  2DGY A;  3KFU A;  4JI8 L;  3WWV A;  2A8V A;  2LXK A;  5IYC G;  1Q1B A;  2VQE L;  1VQN A;  4GLA C;  1IZ6 A;  4C3J H;  1QUQ B;  4DK6 C;  3A74 A;  3CCE A;  4DV1 Q;  1S3O A;  4HJ9 A;  4X65 L;  2K4K A;  5C0X I;  4GKJ L;  1Q86 C;  2UXD Q;  2OCE A;  5M3F G;  3GTM H;  4BY7 G;  1YJW A;  2IY5 B;  4K0K L;  4GLV B;  2IHF A;  2NN6 I;  1G51 A;  1EIF A;  2CWA A;  4DUY L;  1JJG A;  3E9I A;  1PFS A;  3W1B A;  2YV5 A;  4JI8 Q;  5IYD G;  2KHI A;  4LF5 Q;  3BJU A;  4AIM A;  5LMN W;  4OWW B;  2RHS B;  2D62 A;  3K7U C;  2R92 G;  3J80 i;  1ASY A;  1BBW A;  3PIP A;  4HIM A;  2R6G A;  4IPG A;  5C44 H;  1Q46 A;  1WJJ A;  4PZ7 A;  2B29 A;  2HHH L;  2OTJ A;  3PGZ A;  1XMO Q;  2NVQ H;  2C35 B;  2EQS A;  1U0L A;  1IBL L;  1NJI C;  2BH8 A;  2F52 A;  4QY7 A;  4LF9 L;  2JA8 G;  2VUM H;  2CKZ B;  3GTJ H;  1PH7 A;  5IWA L;  1K8A C;  3HOU G;  3GO5 A;  3STB C;  1CKO A;  1VQD A;  2CCZ A;  1TWH H;  3K0X A;  4DV4 Q;  4HJ7 A;  1P8L A;  1KRT A;  1I94 L;  4LNQ A;  2R7Z H;  2N3S A;  5BR8 L;  1SMX A;  1D8L A;  5H1S E;  4EQ5 A;  1KIX A;  3PO3 G;  4QQB X;  4Y7N H;  1Q1E A;  2QGQ A;  1XJV A;  4AYB E;  1EWI A;  4PMW A;  2ZTD A;  1UWV A;  5E7N A;  3TS0 A;  4A75 A;  1VQ6 A;  1I5F A;  3SGI A;  4DR3 L;  4L5R C;  4C3I H;  1LYL A;  4IJH A;  4R4C A;  1IBK Q;  3FP9 A;  4LF8 L;  3DM3 A;  2E2J H;  2ES2 A;  2VQF L;  3CCQ A;  2UUB L;  2WFW A;  2NVT H;  3HOV H;  4X65 Q;  1FJG Q;  4O0A A;  1IBK L;  4A4I A;  2K52 A;  2XGT A;  4DAY B;  3PUW A;  4X62 L;  3W5O A;  2JA6 G;  2ZTE A;  1Y1W H;  1XPU A;  4UY8 C;  3PUZ A;  4R4T A;  2AKW B;  2RCN A;  3RN5 A;  3T1H Q;  5DLQ E;  2OQ0 A;  1PH6 A;  1YIT A;  3PUV A;  4A3G H;  3U58 A;  2UXD L;  4GNX A;  1FL0 A;  1KQS A;  1JE5 A;  3U50 C;  4DV0 Q;  3ULP A;  4OON A;  2F3I A;  1K9M C;  4JI6 Q;  4JI7 L;  3CW2 C;  1MJC A;  2BA0 A;  2IX0 A;  1N36 L;  4DR7 Q;  2NZO A;  5IYC H;  4HID A;  4JBW A;  5IT9 c;  4X62 Q;  1M1K C;  1L2F A;  1VQH A;  2E2I H;  3VDY A;  1XNR Q;  1HJP A;  3NEM A;  3L0O A;  2EXD A;  4A3I G;  5GAH C;  3CC7 A;  2PI2 A;  1I50 H;  5JJK A;  3UDI A;  5IP9 G;  5IWA Q;  4GOP A;  4A76 A;  2OQK A;  2KBN A;  4B3R L;  1B70 B;  2ALY B;  2LSS A;  2K5V A;  1U5K A;  4APV A;  2R7F A;  2ASB A;  2NN6 G;  3HOX G;  4LFC L;  5JEA J;  3HKS A;  1A62 A;  3BU2 A;  4UPA A;  3KJO A;  4DR1 Q;  3ICE A;  4DV5 L;  1L1O A;  1XNQ L;  5FLX c;  3KDF A;  2HQL A;  2B63 H;  3KF8 B;  5JJI A;  2JEB I;  4NPS A;  2JE6 I;  4A3C G;  4P74 A;  1E24 A;  3I4O A;  2VW9 A;  1MKH A;  3I2Z A;  3EIV A;  4GLX A;  2UUC L;  5HGQ A;  4DV6 L;  3STB D;  4BY1 H;  3GTO H;  1A8V A;  1SN8 A;  4A3J G;  5C4X G;  5IP9 H;  4DV2 Q;  1B8A A;  1FJG L;  2HT1 A;  3S14 H;  2UUC Q;  1PYB A;  2UU9 Q;  1V43 A;  2UXB Q;  3AQQ A;  4BBS H;  2MO0 A;  1A0I A;  2EIF A;  4UP9 A;  5C4J H;  3T1Y Q;  2VUM G;  3K80 C;  3HKZ G;  4BXX H;  4JYA Q;  3BZC A;  2R7D A;  2CFM A;  2A19 A;  3MXN B;  4R4Q A;  5GRO A;  1NMF A;  2UUA Q;  1SRO A;  1PH3 A;  3G48 A;  1M90 C;  4LF4 L;  2D0P A;  3OTO Q;  2OTL A;  1MIU A;  4JG2 A;  1I3Q H;  2PQA A;  1Q8K A;  4X64 L;  1E3P A;  3H0G H;  3KLW A;  1XMQ Q;  4GKK Q;  2MQH A;  4IO9 A;  3K8A A;  3J7A 5;  4JI0 Q;  1QUQ A;  5C0X G;  4YCV A;  4B3S Q;  2BH2 A;  1L1O C;  3B6Y A;  2D0O A;  3HOV G;  2NVY H;  1RIP A;  1LTL A;  1BBU A;  1CKN B;  3D0F A;  4JV5 L;  4JBJ A;  1PH9 A;  1SFO H;  3J81 j;  3EBE A;  2ZM6 Q;  5K36 G;  4DR4 Q;  3RLF A;  2IHE A;  1QZG A;  1K3R A;  4IPD A;  1HNX Q;  4BXX G;  1I6H H;  2N49 A;  3CAM A;  5IE8 A;  1JT8 A;  5M5W H;  3GTQ H;  4JI1 Q;  3CME A;  1VQE A;  1MJE A;  2IX1 A;  2YYZ A;  4IPC A;  1HNX L;  2I5H A;  4GS3 A;  1IL2 A;  2K5N A;  4A3L G;  4B3T Q;  4NXM L;  3JAM i;  5EAY A;  3HOU H;  5HY6 A;  2HIV A;  2K75 A;  4BY1 G;  2JA6 H;  4GKJ Q;  1VQL A;  1NTG A;  3UDF A;  4JI3 Q;  3H0G G;  3KYH C;  4LF8 Q;  1XPO A;  1PHJ A;  2JA8 H;  4A3C H;  1NMG A;  1YJN A;  2UXC Q;  4LUO A;  2ZJR A;  4HJ5 A;  3CMA A;  1XMO L;  4JI4 Q;  2JA7 H;  4DR6 Q;  3S2H H;  1Q7Y C;  1HZ9 A;  1D7Q A;  2YTY A;  1FVI A;  3M4Q A;  4L5S A;  1TWF H;  2ZTC A;  2E8G A;  4YWM A;  5J3B A;  4JI5 Q;  1HH2 P;  1SE8 A;  4DR1 L;  1V1Q A;  1K73 C;  5IYD H;  1TWC H;  4NXM Q;  2AWO A;  3PCO B;  5GAG C;  3FHW A;  1PH4 A;  3F1Z A;  1DGS A;  4YY3 Q;  2VNU D;  2Z0S A;  3J81 i;  1YHA A;  3TQY A;  4JI6 L;  3F2B A;  4POF A;  4DV7 Q;  1HR0 Q;  4NXN L;  4DPG A;  5M3F H;  4DUZ Q;  1SRU A;  2ZJP A;  2RF4 A;  1VQ4 A;  2AHO B;  3I4M H;  1VQG A;  1YHB A;  4OO1 G;  1OXX K;  1W2B A;  1XNR L;  5IYB H;  1NY4 A;  3PUY A;  4AQY L;  2WB1 G;  4IFD G;  1HZA A;  2V1C C;  4KHP L;  4DV0 L;  4H02 A; 
#chains in the Genus database with same CATH topology
 3DEP A;  3NE5 B;  1R9T H;  3HEJ A;  4AH6 A;  4HMJ A;  2R93 B;  4JV5 Q;  4LF4 Q;  1B3Q A;  3MA2 B;  1HFG A;  3S1N B;  2Y0S E;  1DYQ A;  1I4P A;  2TSS A;  1CUK A;  1LAC A;  1N36 Q;  4AQY Q;  2MJ8 A;  3CU7 A;  1JB7 A;  2B2Y A;  1MGS A;  3RZO H;  5IGD A;  5IYB G;  3V96 A;  1QVF A;  1AEX A;  4IJL A;  4FF4 A;  3ERS X;  4LF6 L;  4QCL A;  2XN9 C;  1EZ6 A;  2R7Z G;  1P16 A;  1E2V A;  2GVA A;  1G6P A;  3MHB A;  3M4P A;  1G29 1;  1ROD A;  1N33 Q;  1YBY A;  1Q3L A;  5D65 A;  1SYC A;  4UAI A;  2EYF A;  1I6V C;  1DZ1 A;  2EY2 A;  3GTK B;  1JCK B;  1S4Z A;  2B2V A;  3CKI B;  5LMU Q;  2F0K A;  1RF2 D;  1EU4 A;  1SSO A;  4BA2 I;  2VB3 X;  1F2Y A;  4QMG A;  1YVC A;  3I4N B;  2SNS A;  1WCM H;  3QR8 A;  2L4N A;  1FNW A;  4BY7 H;  2BDN A;  2Q2H A;  2R61 A;  1LUZ A;  1CQV A;  4HJA A;  4IOC A;  4DV4 L;  1UEB A;  2KEC A;  1PA6 A;  4HN7 A;  4A3E G;  2XNA C;  5M5X B;  1ZKO A;  4B3S L;  1EY5 A;  3KBX A;  3PQI A;  1CM9 A;  1VQP A;  5IY0 A;  4NXN Q;  3I7F A;  3W1G A;  2B3G A;  2XSC A;  2FMC A;  3U4V A;  1N34 L;  1JE4 A;  1JOK A;  4Y52 H;  1PTO F;  2F4V Q;  4NP5 A;  1EY9 A;  2XTI A;  3KF8 A;  5KIX A;  3CCR A;  2VZA A;  4HJ8 A;  4ID6 A;  3HP3 A;  1K83 H;  1WD0 A;  5FJ8 H;  4ALP A;  4NB3 A;  3TS2 A;  1OXS C;  3HOW B;  4RGO S;  4RMF A;  5M3M G;  4A3B G;  2PPB C;  4JBM A;  3UDG A;  4IFD J;  2PO4 A;  4ILW A;  4KK7 A;  5EPK A;  1F9S A;  2Z1C A;  4QB4 A;  4LF7 L;  4L5T A;  1K8O A;  1AN8 A;  2F0W A;  3J7A V;  1KNA A;  4KHZ A;  1A15 A;  3HOY H;  4OHJ A;  4BBR B;  4KY5 A;  5C5M A;  3DEO A;  2K05 A;  4JOI A;  5I9O A;  1SDF A;  3F8T A;  4A3J B;  4KKS A;  1X6O A;  1QCB D;  4LFC Q;  3EVQ A;  3PV0 A;  1CQF A;  3I55 A;  3NWS A;  3UDX A;  5JJL A;  1JMC A;  4PQX A;  4OL7 A;  2PMZ E;  1YZ6 A;  3CC4 A;  1WFQ A;  1UE6 A;  2ZXO A;  5FLM G;  5M5Y B;  3PIO A;  4TKO B;  3SK4 A;  4OGQ C;  2A69 D;  3OTO L;  4I7A A;  4HSP A;  1EL0 A;  2Q2I A;  1SE2 A;  1Y1W B;  2G9H D;  1DD2 A;  3SEB A;  1YNX A;  1QZH A;  1TS5 A;  1EQR A;  3EJI A;  1HHV A;  3GD7 A;  3S1R H;  1PH5 A;  2EVB A;  2B2V C;  5L37 A;  3RN2 A;  4A3F H;  1X3G A;  4DAY A;  2ZXR A;  3FEW X;  1KAB A;  3JAM c;  3X3N A;  4BWG B;  3QOL A;  1LT4 D;  3KUP A;  2JA6 B;  2X69 A;  4YY3 L;  1O7Y A;  1OXU A;  2NWG A;  4YHH L;  5NUC A;  1IW7 C;  2A5H A;  4WJ4 A;  2VL6 A;  4QJF A;  3I56 A;  3CQZ H;  3H6M A;  4KN7 C;  1XNQ Q;  3FMC A;  4JVZ A;  3L3O C;  4PMC A;  1EYG A;  2R92 H;  2KCC A;  3NBH B;  4HSV A;  1YEZ A;  2IPK D;  5DM6 3;  4RHR A;  4KKU A;  1BXT A;  1RL2 A;  1SBB B;  4XTC S;  1G91 A;  2JA9 A;  5EGT A;  5IP7 G;  5JVH 3;  4YCW A;  1CT1 D;  1GD7 A;  1IW7 D;  4MNO A;  1HZB A;  4DK3 C;  4A3M H;  1EZ8 A;  4BBR G;  1T5X D;  2Z4H A;  5C3E G;  1HR0 W;  2DNC A;  4KHP Q;  1SYE A;  2IX3 A;  2ZJQ A;  1CKM A;  3JC6 6;  4JI3 L;  4A93 H;  4R8N A;  3BZK A;  4KV6 A;  2PNR C;  1SYF A;  2ZT9 C;  2DUD A;  4A3B H;  4J6H A;  2KEE A;  1FD7 D;  4LFA L;  1A2U A;  1J8I A;  2EDG A;  3R3O A;  4DV3 Q;  2J7Z A;  1VQJ A;  5FJ8 G;  1UAP A;  5DAU A;  2AQ2 B;  1SR3 A;  4FXK C;  4JCV E;  2NTS A;  1PZK D;  2NZH A;  4RAU C;  2A74 C;  4A3J H;  4F7X A;  5KNB A;  4JI4 L;  1CTM A;  2B2T C;  2NVX B;  4CDF C;  2B63 G;  4KKT A;  4MZ9 A;  2NVX H;  4GOP C;  4C1N I;  4UP8 A;  5JPN C;  2RDF A;  2WAQ E;  1FR3 A;  2Z6K A;  1I50 B;  1VS0 A;  3HOZ H;  1GHJ A;  3MEF A;  3OW2 A;  1KC8 C;  3FDT A;  3C3L A;  3SDZ A;  2I46 A;  4AYB G;  4A3I H;  1ICF B;  1NE3 A;  1SAP A;  3RNU A;  4FXG C;  5M3F B;  4IFD H;  3J81 E;  3MXP A;  5E4W C;  1JWU D;  3RD4 A;  4X65 L;  1C8C A;  3GTM H;  3K58 A;  1JOR A;  2IY5 B;  5CGK A;  3PIP 3;  1U4M A;  5ELF A;  2NVT B;  4Q5V A;  1G51 A;  2F0G A;  1PFS A;  3S2H B;  4JI8 Q;  5IYD G;  2X6L A;  1XX8 A;  5EBC A;  3U9O A;  1BBW A;  3PIP A;  4HIM A;  3DWA A;  1YNN D;  3HOU B;  3RMH A;  1B50 A;  3K5N A;  4PZ7 A;  2K5Q A;  3MXN A;  1XMO Q;  2C35 B;  1U0L A;  1IBL L;  4K8J A;  3WDN A;  5COR A;  5IWA L;  3HOU G;  1PYW D;  5IT9 L;  4X6A H;  3ZYY X;  2R7Z H;  1RDP D;  1K28 A;  1GXD C;  1D8L A;  5H1S E;  2D2C C;  1FGB D;  3PO3 G;  3M4O B;  2XRS D;  4J1M A;  5KNC A;  3J80 E;  4DR3 L;  3SGI A;  3IFD A;  4CBV A;  4C3I H;  4LF8 L;  4CHT B;  4CGY B;  2FMM A;  3DM3 A;  5F2D A;  1I3Q B;  1RD9 D;  1W6J A;  1QG7 A;  3PUW A;  3Q0A A;  2BOS A;  4UY8 C;  1V1P A;  2EJG C;  3O13 A;  5DLQ E;  4ZUI A;  4BBS B;  1QB5 D;  2F1M A;  1ENC A;  2A6H C;  3PUV A;  4A3G H;  3MVV A;  5K5P A;  3TBI B;  3PMF A;  3U50 C;  2B39 A;  4DV0 Q;  3ITP A;  1KDC A;  1VF7 A;  4RWS C;  1BOS A;  3D6W A;  2ICI A;  4HID A;  4X62 Q;  1XNR Q;  2EY5 A;  3KLS A;  3CC7 A;  4NDX A;  3J81 L;  3UDI A;  2OQK A;  3VYU A;  1U5K A;  3ERQ A;  3K57 A;  1LTT D;  1LTG D;  3R93 A;  1G6Z A;  5C3W A;  4HMI A;  4ZK9 B;  4M8A A;  1GJX A;  2JE6 I;  4A3C G;  1EQV A;  1E24 A;  3I4O A;  2VW9 A;  2E2I B;  3GTO H;  3BS1 A;  1A8V A;  1SN8 A;  2KA7 A;  3IAY A;  1B53 A;  3E0J A;  1S5B D;  2UXB Q;  4NW2 A;  2Z9H A;  3ONA B;  2IL8 A;  3TP6 A;  1A0I A;  3J7A F;  1E2W A;  4IUR A;  2EY6 A;  3K80 C;  4BXX H;  3BZC A;  3T56 B;  1HTL D;  2A68 D;  5BN4 A;  3G48 A;  5I6W A;  2D0P A;  4F8M A;  1XMQ Q;  4GKK Q;  1A6X A;  4F88 A;  1QUQ A;  1SJH D;  2O4X A;  3WOF A;  4B3S Q;  1EIG A;  2KHS A;  3B6Y A;  2D0O A;  2NVY H;  3DWQ A;  1RIP A;  1LTL A;  3GP7 A;  1K3B C;  1KTK A;  4DR4 Q;  2E74 C;  5CBE E;  3NK9 A;  4IPD A;  1HNX Q;  2N49 A;  1ML0 D;  3CQZ B;  2F0Q A;  4JI1 Q;  1H9S A;  5FO8 B;  3JAM i;  5C44 B;  3HOU H;  1F2L A;  1M4V A;  5HY6 A;  4XT3 B;  1H9J A;  2I07 B;  4LF8 Q;  1NMG A;  4X3T A;  4HJ5 A;  3CMA A;  3Q23 A;  4ZKC B;  1H9S B;  1FVI A;  3M4Q A;  5J3B A;  4JI5 Q;  4MTK A;  4N8F A;  5IYD H;  5GAG C;  1NSN S;  2HCC A;  4LMQ D;  4YY3 Q;  1IKM A;  3J81 i;  2WKC A;  1I4X A;  4DPG A;  1VQ4 A;  1VQG A;  1BBX C;  5IYB H;  4KTA A;  1F2Z A;  1TWA B;  1NY4 A;  5I4D A;  2WB1 G;  4RKL A;  5C6A A;  3K0Y A;  1I4H A;  1F9P A;  2VXW A;  1O78 A;  1YIJ A;  3HOZ B;  4PNY A;  1JWS D;  2MFI A;  2ATW A;  2WB1 B;  4A3D H;  4LWC A;  3DLL A;  4DR2 L;  2V4D A;  4L8J A;  2VS1 A;  4R8I A;  4GOP B;  1LTB D;  1YNN C;  2VQE Q;  2H4O A;  4DA2 A;  1LTA D;  4OX9 Q;  3G4S A;  2E75 C;  4KY6 A;  1EYC A;  3VYR A;  4PZ8 A;  2JA5 H;  1II3 A;  1H95 A;  4A3G G;  4ZRZ A;  3T1H L;  1V1O A;  1N32 Q;  4X66 Q;  4KI0 A;  2NBF A;  3M7G A;  1VQ8 A;  4DFA A;  4HIK A;  1FNU A;  1TQO A;  2QEX A;  2X6G A;  4RCN A;  2UXB L;  1D6E C;  2TMP A;  3G71 A;  3J7Z C;  5CV9 A;  2F4V L;  5C44 G;  4DUZ L;  5C5L A;  4TRD A;  3J81 c;  3I91 A;  4CDC C;  1G2S A;  2QEJ C;  1UE5 A;  2QF7 A;  2E2J B;  3PO2 G;  2PZT A;  2PQA B;  2YU9 B;  1TWG H;  2JA7 B;  3GTG B;  1CK1 A;  1FYC A;  2WB1 E;  3I8Z A;  5CYU A;  2B2Y C;  2JA8 B;  4WJ3 M;  3CXC A;  1IYJ B;  1LV9 A;  3FPU B;  4YWL A;  1GM5 A;  1TII D;  4IUN A;  1EY0 A;  5M5W B;  2AQ3 B;  3ERO A;  3L9A X;  1Z6H A;  2YTX A;  2L9H A;  1T5E A;  1CI3 M;  1SEB D;  1IYU A;  4GN5 A;  1B44 D;  4HCE A;  2J4X A;  3S24 A;  2N78 A;  4A3F B;  1BCP D;  1OXT A;  4S3S A;  4UDU C;  4PV1 C;  3D8G A;  1E22 A;  4M1U B;  3RLN A;  1IXR A;  1BKB A;  1ET6 A;  2EE1 A;  1J5E L;  2F03 A;  1HZC A;  2WP8 J;  5DNF A;  5C4X H;  2EYP A;  1Y1V H;  2EXZ A;  4HIO A;  1VQA A;  3PIO 3;  5M3M H;  1Q81 C;  3BVG A;  3RZD H;  1PFN A;  3H94 A;  4EX5 A;  1EY8 A;  5FLM H;  1ASZ A;  1JJC B;  3DWP A;  1PRT D;  3CCU A;  4DR2 Q;  4IUU A;  4A3K G;  4J15 A;  1C0A A;  4UHV A;  2Z6K C;  3BDL A;  4K0K Q;  5FLX E;  3TEH B;  1PFM A;  3GV6 A;  3HOY B;  3F2C A;  3FKI B;  2EYH A;  2M2L A;  5T1I A;  3K7A H;  3KDF B;  4A3K B;  4LUZ A;  1E1T A;  3I4N G;  3J80 c;  1PTO C;  1WTR A;  3HOY G;  5IGG A;  4R1J A;  3CC2 A;  1ESR A;  2FIN B;  3NXW A;  1VQF A;  1GUG A;  4A93 G;  1K0R A;  2F0M A;  3NP8 A;  1TY2 A;  3MEH A;  1VQM A;  1K8G A;  3M3Y H;  1CZW A;  1C9O A;  2UUB Q;  4QF4 A;  4A93 B;  5M9O A;  3TRE A;  1HA5 A;  1EYA A;  3M9B A;  1QE6 A;  1EEF D;  1WCM G;  2O5I C;  1E2Z A;  4TVA B;  5HGT A;  1AW7 A;  4DNI A;  3CF5 A;  2K03 A;  2F0L A;  1JR0 D;  1PH1 A;  4XYQ A;  3A8I E;  3RLO A;  2E5L Q;  3PF4 A;  2HUG A;  1VQ7 A;  3D6C A;  4OO1 I;  1YHQ A;  4GKK L;  1EFI D;  1X3E A;  4HAE A;  4OXP A;  1JJ2 A;  1T9H A;  5C3E H;  4JI2 L;  3OWF A;  2BA1 A;  2K33 A;  4K5X A;  5KGU A;  1SXT A;  3JAM E;  4RFB A;  1MI2 A;  4MIU A;  4R9W A;  3LWU A;  1QVG A;  3FKI G;  1BCP B;  1X3F A;  2AQ1 B;  4GNX C;  4IFD I;  1EWC A;  2K04 A;  1KLU D;  2H1E A;  5EBD A;  4JI2 Q;  4HR7 B;  1YNJ D;  4H0L C;  4C3H H;  1SE3 A;  3JAM L;  4ZQ3 A;  1X32 A;  2I5M X;  2PZW A;  1SLJ A;  1EFW A;  3OHX C;  1VQ5 A;  1AE2 A;  1RTN A;  4C1N K;  1IBM Q;  1JC7 A;  1EIH A;  2B63 B;  2KEN A;  3F2D A;  2LMC B;  3AYH B;  1E1O A;  3TME A;  1WYD A;  2EYL A;  3A5Z B;  4OWX B;  1S5D D;  1EY4 A;  3VYS A;  4B9W A;  3M85 A;  1D1I A;  2L15 A;  4JI5 L;  3S15 B;  1PFB A;  2JYO A;  4LUV A;  5FOB B;  1WOC A;  4DV1 L;  2F0J A;  3S16 B;  1GUO A;  2DJG C;  3HOX H;  3QOJ A;  4GNX B;  1VQC A;  3S2D B;  3SK6 A;  4GZY C;  4P75 A;  3HFZ B;  1LT3 D;  3HKZ E;  4L5Q A;  3HOW G;  2CQA A;  1EYD A;  5C0X J;  4A3G B;  3FPP A;  2A8V A;  5A2Q E;  5IYC G;  1Q1B A;  1PRT B;  1QUQ B;  3MFY A;  4DV1 Q;  1B3A A;  5E4X A;  4GKJ L;  4ZYS A;  1Q86 C;  2OCE A;  1GUS A;  5AFW A;  4K0K L;  4GLV B;  2RSO A;  2CWA A;  1JJG A;  3E9I A;  4XQQ A;  2RQX A;  3A7L A;  4N8X 1;  4AIM A;  5LMN W;  3K7U C;  3J80 i;  2Q8R E;  1ASY A;  5CBA E;  2HDM A;  3BG3 A;  4U68 A;  1Q46 A;  1WJJ A;  2B29 A;  2HHH L;  3PGZ A;  4IN3 A;  2EQS A;  1NJI C;  3GTQ B;  1VMC A;  1BNZ A;  2VUM B;  1TVX A;  4CKC A;  1VQD A;  3HKZ B;  2CCZ A;  1KRT A;  4H44 C;  1I94 L;  1WTV A;  1VF5 C;  4QQB X;  4ZUJ A;  4Y7N H;  3H3V C;  4AYB E;  1VQ6 A;  3TS0 A;  4L63 B;  4A75 A;  5I9P A;  1BQQ T;  1MSG A;  3BZD B;  2FHT A;  1LYL A;  4IJH A;  1IBK Q;  3H91 A;  5FKA C;  2KJX A;  2CH4 A;  3S1R B;  2NVT H;  1CA5 A;  4X65 Q;  4O0A A;  4HTH A;  2XGT A;  5C0X H;  2JA6 G;  2ZTE A;  3T13 A;  1SMY D;  3C46 A;  1PH6 A;  3U58 A;  1FL0 A;  2F3I A;  4JI7 L;  3CHB D;  2BA0 A;  3CW2 C;  2IX0 A;  4OO1 H;  4JBW A;  1M1K C;  2JA5 B;  3L0O A;  3K6O A;  4A3I G;  1I50 H;  2F0O A;  5JJK A;  1LO5 D;  2L11 A;  2LSS A;  2K5V A;  2ASB A;  2R7F A;  1LTI D;  2B8F A;  5CMD A;  4K5W A;  3HKS A;  4IAL A;  4DR1 Q;  1L1O A;  1XNQ L;  1ILQ A;  2MHV A;  3KDF A;  2B63 H;  3KF8 B;  5IGF A;  2QKI C;  2NYZ D;  2P5Z X;  5JJI A;  4P74 A;  2UUC L;  1MKH A;  3I2Z A;  1FNV A;  3SE0 A;  1LLR D;  4EGV A;  5C4Z A;  4A3J G;  3I73 A;  5C4X G;  1K8M A;  1B8A A;  2RBM A;  3C1F A;  3MXG A;  2HT1 A;  1V43 A;  1HQM C;  4BBS H;  2VUM G;  5EPL A;  5C4X B;  2OT2 A;  2CFM A;  1X3P A;  5IT9 E;  4KJN A;  2A19 A;  2JP1 A;  3MXN B;  1NMF A;  4O1N A;  1TWC B;  1M90 C;  5JPM C;  2F0H A;  1B1Z A;  4LF4 L;  4K14 A;  2VB2 X;  2OTL A;  4JG2 A;  1Q8K A;  3KLW A;  2K01 A;  3D4D A;  3TZU A;  4YCV A;  2BH2 A;  2WII B;  3HOV G;  4DAP A;  3D0F A;  4JV5 L;  1BCP C;  3J81 j;  3U9S A;  2IHE A;  1QZG A;  2M9V A;  2B2W C;  1H9R A;  3CAM A;  3OMC A;  1JT8 A;  5M5W H;  1MJE A;  1XTC D;  3S17 B;  4IPC A;  1ENF A;  1HNX L;  2I5H A;  3VR6 A;  2HQE A;  1NAP A;  2K32 A;  2KCN A;  2HIV A;  5I2X A;  4DF7 A;  4GKJ Q;  3UDF A;  3H0G G;  1XPO A;  2UXC Q;  2DY8 A;  4LUO A;  1XMO L;  1AZP A;  3I72 A;  4JI4 Q;  1Q7Y C;  2EYM A;  3QO2 A;  4C3I G;  2YTY A;  4L5S A;  2E8G A;  3Q22 A;  4OEM B;  4YWM A;  2QCP X;  4DR1 L;  1TWC H;  4NXM Q;  1D5M C;  2AWO A;  2XWB B;  3PCO B;  5BN3 A;  1DGS A;  1Q90 A;  2Z0S A;  1F9R A;  3TQY A;  4CJ0 B;  3IKJ A;  4NXN L;  4NMZ A;  4DUZ Q;  1SRU A;  2ZJP A;  2RF4 A;  2AHO B;  3I4M H;  1YHB A;  1RJT A;  1OXX K;  1W2B A;  5CV4 A;  1BO0 A;  3A7A B;  4Q0F A;  1HZA A;  1XJV A;  2E76 C;  4K2K A;  1ESF A;  1KDA A;  1Y1W G;  2E5L L;  3DHQ A;  1PZI D;  4LW1 A;  3S15 H;  2OWO A;  1C48 A;  3KLR A;  5TSS A;  3UE0 A;  1DJR D;  2CW0 D;  4OX9 L;  5IOC A;  1HNZ Q;  3GDE A;  3T51 B;  4JK1 C;  2IWH A;  1TU2 B;  2QW7 A;  1SNP A;  4PMB A;  4LJZ C;  4X3K A;  2PZU A;  1J9O A;  1GKH A;  2HIX A;  1FGU A;  3NBI A;  4EVO A;  1WTW A;  3LGJ A;  2RVL A;  4B3T L;  3S1M H;  2UU9 L;  4BBS G;  4K5V A;  2MGS A;  2F0S A;  1QWY A;  4I65 A;  3RZD B;  4DUY Q;  5FLX L;  2N55 A;  3VR5 A;  4QIW E;  3T16 A;  2UXC L;  3WOE A;  1Y1V B;  5BN5 A;  3LX0 A;  2JEA I;  4B9X A;  1K83 B;  3PF5 A;  2G9D A;  3CD6 A;  4IUQ A;  4OIJ A;  5CR3 A;  4YWK A;  1PH8 A;  2Y0S G;  4GN3 B;  2JA7 G;  1X55 A;  1STG A;  4H13 C;  3H3V H;  1PTO H;  1EOV A;  3GTL H;  1B2T A;  2Y0S B;  4F87 A;  2KOL A;  5AJ3 Q;  3NWT A;  1WTQ A;  3A54 A;  2Q2U A;  3ULL A;  4YHH Q;  3NEN A;  3A0J A;  5JVG 3;  4LFB L;  3KOJ A;  4Y7N B;  1GVP A;  1BUV T;  3W3A A;  3AFP A;  1ZXT A;  4HCS A;  3S1Q H;  4WJW A;  3IRB A;  4DR5 L;  2RHQ B;  3BYT B;  1OTC A;  5JEA H;  4X64 Q;  5KEE A;  1QVC A;  2N8N A;  3X3M A;  3SXH A;  1YI2 A;  1NR4 A;  2F0I A;  1VQ9 A;  5LL6 S;  3CCL A;  1BVS A;  5JEA G;  1CSP A;  4DV5 Q;  3HOZ G;  5BR8 Q;  4A3M G;  3KK7 A;  3K5L A;  5A35 A;  1KRS A;  1EUJ A;  1C4Q A;  4MTN A;  1O7Z A;  4YCU A;  3I4N H;  1X65 A;  3IL8 A;  3NTH A;  1WI5 A;  4MN3 A;  1U4L A;  3CPF A;  4HED A;  3A55 A;  3NEL A;  3K59 A;  1L0Y B;  1WTH A;  1M8A A;  3GTK H;  1XMQ L;  5ELN A;  5EQ0 A;  2CH4 W;  1LTR D;  3SVM A;  4LF5 L;  1BDO A;  2I5L X;  2ID0 A;  3CCV A;  2K14 A;  3TP8 A;  3P1H A;  4ME5 A;  3ULJ A;  1BR9 A;  5LMN Q;  3S14 B;  2F3V A;  5IGC A;  5KRU A;  1PDQ A;  5E1F A;  3KBG A;  1GUN A;  2HCI A;  4BY1 B;  4P72 A;  3M7N A;  2LKV A;  2ENB A;  4IPH A;  1KLG D;  1KAA A;  2JJQ A;  4V19 0;  1DOM A;  2K5W A;  1MHW C;  2F0E A;  1LAB A;  2K5H A;  3K7A B;  4BBR H;  1AH9 A;  4DR4 L;  1H9M A;  4B3M L;  1S72 A;  2L0C A;  5ELE A;  5D3I B;  1R4P B;  2R93 H;  1UEA B;  1ILP A;  1VQK A;  3AMU A;  1HNZ L;  1GOZ A;  1VQB A;  1A3V A;  2KUM A;  1PYS B;  3Q24 A;  2B2W A;  3AFQ A;  2KHJ A;  4P73 A;  4G57 A;  1SMY C;  2MUY A;  1X56 A;  4P2C B;  3Q8D A;  1A2T A;  2GN5 A;  2FXQ A;  2EPB A;  2R93 G;  1VDZ A;  2ZM6 L;  2HDL A;  2PI2 E;  3M4Y A;  1HQR D;  4C56 C;  4LFA Q;  1A3U A;  1BCP F;  1KAW A;  1XXG A;  1TT2 A;  4X66 L;  4LAA A;  2OEO A;  1PRT C;  3OIP A;  1XPR A;  3PO2 H;  2E2H H;  1KD1 C;  4O2D A;  3C2P A;  3F2U A;  4XQJ A;  3HRZ C;  3D4W A;  2GA4 B;  3M4O H;  5EPJ A;  3E9H A;  4QL5 A;  1HXY D;  1UE1 A;  5ELB A;  4TQU S;  5LL6 X;  1RTO A;  1PMR A;  3AU7 A;  3EQL C;  3L7Z C;  4O42 A;  1VQI A;  2QDB A;  3T4A C;  1E7Z A;  3ZJY C;  3AEV A;  4FXD A;  4BY7 B;  3OYY A;  4ABN A;  3N6R A;  4FP5 D;  3CCM A;  3GTG H;  1I4R A;  2PW5 A;  2K7V A;  2JQO A;  2D5D A;  1PTO D;  1JB3 A;  4FDB A;  2EY1 A;  4DNT B;  2K1B A;  4IZ8 A;  4DV2 L;  1V1P B;  2JN4 A;  2K6A A;  3GTM B;  3DM1 A;  4ODG A;  2J0T D;  4POG A;  3KJP A;  1SYG A;  1AP0 A;  2H5X A;  2MNA A;  3K5M A;  4UP7 A;  1DCZ A;  1O80 A;  5C4H A;  5LMN L;  1K0S A;  4FNF A;  2KCT A;  5M5Y H;  4J8Q A;  3A5U A;  1LTS D;  1JOQ A;  2B2T A;  5I2Y A;  1O7L A;  1SND A;  1Z9F A;  1SNO A;  4RGT A;  2QA4 A;  5T1G A;  3E3X A;  1PXU A;  3S1M B;  3CPW A;  3EN2 A;  4ME3 A;  4XDX A;  4L6T B;  3ER0 A;  1VQO A;  1SJE D;  1CA6 A;  1SNM A;  1SNC A;  4A3K H;  1PV4 A;  3C1E A;  4G7Z C;  1W3S A;  2LXJ A;  1DON A;  2F3W A;  2A73 B;  3HS0 C;  2DN8 A;  4TSS A;  2IT1 A;  3D31 A;  4FO2 A;  1Y8P B;  1A63 A;  1KHI A;  5J22 A;  2B2U A;  4FF3 A;  4A3D G;  4JC0 A;  3LNN A;  3P7J A;  1S40 A;  1CFM A;  1AFP A;  5M3M B;  1IL8 A;  2EJF C;  1O7I A;  2DGY A;  2QIL A;  4JI8 L;  3WWV A;  3HZX A;  4WFN 3;  4GLA C;  1IZ6 A;  1MBY A;  4C3J H;  3CCE A;  3A74 A;  1S3O A;  4ZAI A;  5C0X I;  2UXD Q;  2FFK B;  4BY7 G;  1YJW A;  4EQO A;  4NKL A;  2IHF A;  2NN6 I;  4DUY L;  1EIF A;  1R4Q B;  3W1B A;  2YV5 A;  1Y8N B;  3BJU A;  2R92 G;  1ZEQ X;  1S5E D;  2L5T A;  3K5O A;  3QIA A;  1D5Z C;  1STB A;  2OTJ A;  4FF2 A;  2RA4 A;  4LF9 L;  2JA8 G;  2F52 A;  4QY7 A;  1ONL A;  1WTP A;  4N9T A;  2CKZ B;  1TY0 A;  3GTJ H;  1PH7 A;  3FRP B;  1K8A C;  1UUP A;  3GO5 A;  1I6H B;  4CJ1 B;  5EJW A;  1TWH H;  4DV4 Q;  4HJ7 A;  1STA A;  1TKW B;  2N3S A;  1SMX A;  1SFO B;  4EQ5 A;  1Q1E A;  1EWI A;  4PMW A;  3BVM A;  5E7N A;  2WAQ B;  2DJF C;  1I5F A;  1WCM B;  5KND A;  3VA7 A;  5ISR A;  4KY7 A;  3OIQ A;  3MTS A;  3UI2 A;  2E2J H;  2ES2 A;  2UUB L;  3OWE B;  3V2T A;  2EYJ A;  1IBK L;  4A4I A;  3DXJ C;  4DAY B;  4X62 L;  3W5O A;  4MHE A;  1Y1W H;  1L0X B;  5EKL A;  1PZJ D;  4R4T A;  4C3J B;  2AKW B;  2RCN A;  3RN5 A;  3T1H Q;  2AUJ D;  1TS3 A;  3CRK C;  2OQ0 A;  4E6I A;  2O2L D;  3ND8 A;  2BDO A;  1EY6 A;  3NQI A;  2UXD L;  4GNX A;  3W2D A;  1KQS A;  1JE5 A;  3ULP A;  4A3I B;  4OON A;  3VYT A;  1N36 L;  5IYC H;  4U67 3;  5IT9 c;  2E2I H;  3VDY A;  1LT6 D;  1HJP A;  2A6E D;  3NEM A;  3P75 A;  4IUV A;  3HOX B;  5A2Q L;  5D3D A;  3RZO B;  1NCV A;  5JOB A;  4GOP A;  5JAV A;  4A76 A;  2KBN A;  3VR4 A;  3HOX G;  4WRD A;  1V8Q A;  5JEA J;  1A62 A;  3KJO A;  3ICE A;  4DV5 L;  1R9T B;  2HQL A;  1SYB A;  2JEB I;  4GLX A;  3OSO A;  5HGQ A;  4DV6 L;  3STB D;  4BY1 H;  2G5D A;  4QUF A;  1ET9 A;  1FJG L;  1EU3 A;  3S14 H;  2UUC Q;  1PYB A;  3TP5 A;  2BCO A;  2K5D A;  2EYO A;  1TS2 A;  3QJY A;  3R2I A;  2MO0 A;  4UP9 A;  2EIF A;  4DK0 A;  3HKZ G;  4JYA Q;  5IGB A;  2R7D A;  2JSO A;  2WV6 D;  3EFX D;  2PCF B;  4QIW B;  5GRO A;  1BF4 A;  3OTO Q;  3N52 A;  3HOV B;  4X64 L;  3NUC A;  1E3P A;  2KVM A;  1U9R A;  4JI0 Q;  2F0V A;  2SEB D;  3MFG A;  1L1O C;  4JBJ A;  2ZM6 Q;  3FVQ A;  5K36 G;  1WTO A;  3RLF A;  4C3J G;  1K3R A;  1I6H H;  4G7O C;  5IE8 A;  3SR1 A;  2PMZ B;  2IX1 A;  1JIC A;  1IL2 A;  4GS3 A;  4A3L G;  2K5N A;  2WKD A;  5J39 A;  1E0B A;  5IOD A;  4DU9 A;  1H9K A;  3R2T A;  1YNJ C;  1QJO A;  2K75 A;  2JA6 H;  1IYV A;  2K28 A;  5CV6 A;  3KYH C;  2NVY B;  2HD3 A;  2JA8 H;  1YJN A;  4XXE A;  4DR6 Q;  1TWG B;  3A8J E;  2JA7 H;  1D7Q A;  3GTL B;  2BE5 C;  3E5S A;  5IGE A;  1PTO B;  2NN6 H;  3S9W A;  1EQT A;  1K73 C;  5IIF A;  4KMU C;  5CV5 A;  3FHW A;  2RCF A;  2EOT A;  3A8K E;  5ELC A;  2VNU D;  1EOT A;  1YHA A;  1HA6 A;  3F2B A;  5C4J B;  4DV7 Q;  1HR0 Q;  4RHS A;  1JOO A;  4G4K A;  3TN2 A;  2LY7 A;  4OO1 G;  1XNR L;  2E2D C;  4IFD G;  2V1C C;  4KHP L;  4DV0 L;  4H02 A;  1RHP A;  1TR5 A;  2OXP A;  3S16 H;  2YTV A;  2Z6B A;  3E6Z X;  4XIG S;  4ZKB B;  5LHY 1;  5KYI A;  3K81 C;  4DV3 L;  4KD3 A;  3J80 L;  2PNH A;  4DN4 M;  4GN4 B;  5FK9 C;  4LK1 C;  2KQ3 A;  2IW3 A;  5GAD C;  3OW7 A;  1I94 Q;  4IQZ A;  1X54 A;  2NZ1 D;  3HOW H;  3NTK A;  4JYA L;  1S5F D;  2SNM A;  4ZLT F;  4A3B B;  4JI0 L;  1CSQ A;  2XIW A;  3MWY W;  3OOC A;  4C3H B;  3CRL C;  5I6Y A;  2F0T A;  1NNX A;  1CKN A;  1N33 L;  1HTP A;  3MC0 B;  2HHH Q;  2N88 A;  1TXY A;  1VCI A;  4DR7 L;  1C7Y A;  1L0W A;  3PO3 H;  4C2M H;  1UE7 A;  4FF1 A;  1RKN A;  2RKS A;  1Q82 C;  3KF6 A;  5C3E B;  4B3R Q;  1SYD A;  1V9P A;  1WVL A;  1TWH B;  3S17 H;  2R92 B;  2B8G A;  1KDB A;  4WOR A;  2C5C A;  1QIL A;  3QB3 A;  1IBL Q;  3S1Q B;  1N9W A;  1WD1 A;  3TP7 A;  5FO7 B;  4KLK A;  1J5E Q;  1Y14 B;  1IBM L;  2JK8 A;  1Z47 A;  2DNE A;  4R4I A;  4EQP A;  2F4I A;  1Z7T A;  2F0D A;  1F77 A;  2WAQ G;  2CWP A;  5E3F A;  3PUX A;  4FYD A;  4JW0 A;  2F0N A;  4IOA A;  2NTT A;  3AB9 A;  4K2L A;  1TS4 A;  2XVS A;  4JI7 Q;  1KL9 A;  3BDC A;  4LF9 Q;  3M3Y B;  2UUA L;  1EWH A;  3T53 B;  4AYB B;  3DMU A;  3L2P A;  3OPO A;  3GTO B;  4KD4 A;  4C3H G;  4P71 A;  3MAQ A;  4RGM A;  3CCJ A;  5DEH A;  1JQY D;  4RH6 A;  1GO3 E;  2VY3 A;  4IUP A;  5GAE C;  4BS9 A;  3UE1 A;  4BA1 I;  3H3V I;  2JA5 G;  3FKI H;  3DUZ A;  3IFT A;  3MXU A;  3S1N H;  2WAC A;  5EKI A;  1G2T A;  2B2U C;  4H7B A;  4DAM A;  4RKB A;  5GQO A;  1X9N A;  2L55 A;  1HNW L;  1GUT A;  1N32 L;  3H09 A;  4I7Z C;  1B7Y B;  5D14 A;  3NPP A;  3OMG A;  1DOL A;  1L1O B;  2GVB A;  3EA6 A;  2NUC A;  4DV7 L;  1HR0 L;  1LM0 A;  4XT1 B;  1TWA H;  3E0E A;  3CP0 A;  4A3E H;  1XTD A;  2MPM A;  3I4M B;  4DR3 Q;  1GHK A;  4K8I A;  3SHL A;  3HGB A;  2KCM A;  3TDQ A;  1CHP D;  1Q12 A;  1D5X C;  5CV7 A;  2SDF A;  3I90 A;  5G3L D;  4A3M B;  4PZ6 A;  1RCV D;  1HFN A;  1HUN A;  1PVO A;  3PSI A;  2I0Q A;  1NBW A;  4CDD C;  2L1B A;  4QUC A;  1SNQ A;  4ZCK A;  4DK1 A;  1PRT F;  2CQO A;  1EQQ A;  4DV6 Q;  5LMU L;  2MO1 A;  4DKA C;  4B3M Q;  5M5X H;  1KXL A;  3HG9 A;  1EIY B;  3H15 A;  2Q2T A;  3RR5 A;  1Y1V G;  4JBK A;  3VR2 A;  2K50 A;  4JPB W;  3KLS X;  1WTX A;  4R4O A;  3U4Z A;  4A3L H;  1OXV A;  2Q8T A;  1HPC A;  3TRZ A;  4LF6 Q;  1EY7 A;  5ELO A;  2VQF Q;  2OF1 A;  5K36 H;  3PO2 B;  1DXM A;  2A68 C;  2YU9 H;  3SK5 A;  5IP7 H;  3I4L A;  1QNU A;  3H0G B;  4EQN A;  2IJ0 A;  3QWN A;  1N8R C;  2QDL A;  4KHV A;  1STY A;  1B9M A;  5DM7 3;  1J6Q A;  4RA8 A;  2CW0 C;  4OWT B;  1STE A;  2AMC B;  4CDE C;  1YJ9 A;  1XYI A;  1PH2 A;  4DNR B;  2AWN A;  4JI1 L;  3G6E A;  1D1K A;  4RG1 A;  3I4M G;  2WIN B;  1STH A;  4PG3 A;  3S2D H;  4DR5 Q;  4QGU A;  5AJ3 L;  3P20 A;  2R3Z A;  4A3F G;  3CCS A;  1AE3 A;  2RSN A;  5JJZ A;  2A1A A;  4K6D A;  4A3D B;  4B08 A;  4LFB Q;  4RGN A;  4DR6 L;  4LF7 Q;  1N34 Q;  1HNW Q;  4JOI C;  1QNK A;  3KF6 B;  3GTP H;  1MD2 D;  3T1Y L;  1CHQ D;  1EEI D;  1G8Z D;  1I4G A;  2O5J C;  2EZV A;  4DGZ A;  3KFU A;  2LXK A;  3VR3 A;  3BVZ A;  2VQE L;  1VQN A;  1VMP A;  4KN4 C;  4DK6 C;  4HJ9 A;  2K4K A;  5M3F G;  2CHB D;  3D3R A;  4Z9C B;  2RDH A;  3I3C A;  2Q8I B;  1PLF A;  2M00 A;  4C3I B;  4LF5 Q;  3URY A;  2KHI A;  3LWE A;  2C9O A;  3VA5 A;  4OWW B;  2RHS B;  4XYO A;  2D62 A;  1UNS A;  2R6G A;  4IPG A;  5C44 H;  5COY A;  5HUR A;  4K6L A;  1ICW A;  1U4R A;  2NVQ H;  4XQN A;  2BH8 A;  4CKE A;  2XRQ D;  1I4Q A;  3GTJ B;  2VUM H;  1DM0 B;  1CKO A;  3STB C;  3K0X A;  2NVQ B;  1P8L A;  4LNQ A;  5BR8 L;  2Z4I A;  1KIX A;  4DXG A;  2QGQ A;  1S5C D;  2ZTD A;  1UWV A;  2NB0 A;  3TSS A;  4L5R C;  2E2H B;  4R4C A;  3FP9 A;  3PO3 B;  4DXF A;  2VQF L;  3NQT A;  3CCQ A;  2WFW A;  3HOV H;  3GQB A;  1FJG Q;  3G7L A;  2K52 A;  1Q8I A;  1X3Q A;  1LT5 D;  2D9U A;  1XPU A;  3D4R A;  2F0P A;  4N9P A;  3PUZ A;  3V05 A;  4FVM A;  1YIT A;  5CC4 A;  4OIK A;  1AZQ A;  4X3S A;  4JI6 Q;  1K9M C;  3NHH A;  1MJC A;  4DR7 Q;  2NZO A;  2XWJ B;  4DAV A;  1ENA A;  1L2F A;  1VQH A;  2BE5 D;  2KED A;  4KJO A;  2EXD A;  5GAH C;  2PI2 A;  1A3T A;  1B4O A;  5IP9 G;  3Q6S A;  3NTI A;  3R8B A;  5C3X A;  5IWA Q;  4B3R L;  1B70 B;  2ALY B;  4APV A;  1SE4 A;  2NN6 G;  3RUZ A;  4LFC L;  4CJ2 C;  5J1Z A;  2LFN A;  1D2B A;  2A6H D;  3BDO A;  3BU2 A;  4UPA A;  2L12 A;  5FLX c;  1ZYR C;  4NPS A;  4ULL A;  1HCZ A;  3EIV A;  2F0U A;  3BYY B;  2MP1 A;  5IP9 H;  1KNE A;  4DV2 Q;  4YIJ A;  5G3L F;  2UU9 Q;  1OO9 B;  3AQQ A;  1STN A;  2FJ2 A;  2Z8L A;  5C4J H;  3T1Y Q;  1F2M A;  4R4Q A;  2EJM A;  2UUA Q;  1SRO A;  1PH3 A;  1GUW A;  1MIU A;  1I3Q H;  1TWF B;  2PQA A;  5KYL A;  3H0G H;  1QOH A;  2MQH A;  4IO9 A;  3K8A A;  4CKB A;  1CZG A;  1DOK A;  3J7A 5;  5C0X G;  3I70 A;  1BBU A;  1CKN B;  5EKK A;  3ND9 A;  1PH9 A;  1SFO H;  2ICE C;  3EBE A;  1Y8O B;  1IHZ A;  2RDG A;  2R7Z B;  4BXX G;  5CV8 A;  2PW7 A;  2SOB A;  2A6E C;  3GTQ H;  3CME A;  1VQE A;  1MSH A;  2YYZ A;  2CVR A;  2LS0 1;  3GV3 A;  2PQE A;  4B3T Q;  4NXM L;  1HRJ A;  5EAY A;  1F9Q A;  3G6J B;  4BY1 G;  4V0B A;  2JXM B;  1NR2 A;  1NTG A;  1VQL A;  2AUK A;  4JI3 Q;  1JWM D;  1PHJ A;  4A3C H;  3A56 A;  2F0F A;  3TZD A;  2ZJR A;  3J7Y W;  2PYK A;  3S2H H;  2A69 C;  4C2M B;  1ZYR D;  1HZ9 A;  1W6K A;  1TWF H;  2ZTC A;  1HUM A;  1U4P A;  1HH2 P;  1SE8 A;  1V1Q A;  5FO9 B;  1B9N A;  1NUC A;  2DY7 A;  1PH4 A;  3F1Z A;  4OEL B;  4G7H C;  4JI6 L;  3NBH A;  4IUT A;  4POF A;  2ZXP A;  4X3U A;  5M3F H;  1IKL A;  4A3E B;  3QG1 A;  3NSW A;  1XWE A;  3MZ5 A;  3GTP B;  3PUY A;  4AQY L;  5ELD A;  3SK8 A;  4RCO A;  1Y69 U; 
#chains in the Genus database with same CATH homology
 1YIJ A;  3S16 H;  2MFI A;  2YTV A;  1R9T H;  4XIG S;  4AH6 A;  3K81 C;  4DV3 L;  1Y1W G;  2E5L L;  2ATW A;  4A3D H;  4LW1 A;  3S15 H;  2OWO A;  3UE0 A;  4LF4 Q;  4JV5 Q;  4LWC A;  3DLL A;  4DR2 L;  2VS1 A;  2Y0S E;  4GOP B;  4OX9 L;  1HNZ Q;  3GDE A;  1CUK A;  1N36 Q;  2PNH A;  4AQY Q;  2VQE Q;  4GN4 B;  1JB7 A;  4OX9 Q;  3G4S A;  3RZO H;  1GKH A;  5IYB G;  2HIX A;  5GAD C;  1FGU A;  1QVF A;  4PZ8 A;  2JA5 H;  1I94 Q;  3LGJ A;  4B3T L;  3S1M H;  4A3G G;  2UU9 L;  4BBS G;  4IJL A;  3T1H L;  1H95 A;  1X54 A;  1N32 Q;  3ERS X;  4LF6 L;  4X66 Q;  4KI0 A;  4DUY Q;  2R7Z G;  3HOW H;  1P16 A;  4JYA L;  2GVA A;  1VQ8 A;  4QIW E;  2UXC L;  1G6P A;  4JI0 L;  4HIK A;  3M4P A;  1G29 1;  1N33 Q;  1CSQ A;  2QEX A;  1YBY A;  2JEA I;  2UXB L;  3PF5 A;  3CD6 A;  3G71 A;  3J7Z C;  4YWK A;  2F4V L;  1CKN A;  1PH8 A;  2Y0S G;  1N33 L;  5C44 G;  4DUZ L;  4GN3 B;  2JA7 G;  5LMU Q;  1X55 A;  3J81 c;  2HHH Q;  3H3V H;  1TXY A;  1EOV A;  1VCI A;  4DR7 L;  3GTL H;  1UE5 A;  1C7Y A;  4BA2 I;  1YVC A;  3PO2 G;  1L0W A;  3PO3 H;  2PQA B;  5AJ3 Q;  4C2M H;  1TWG H;  1UE7 A;  2Q2U A;  3ULL A;  1WCM H;  2WB1 E;  1Q82 C;  4YHH Q;  3KF6 A;  3NEN A;  3A0J A;  4BY7 H;  4LFB L;  2Q2H A;  3KOJ A;  4B3R Q;  4WJ3 M;  1GVP A;  3CXC A;  1IYJ B;  1V9P A;  1LUZ A;  3AFP A;  4HJA A;  3S1Q H;  4IOC A;  3IRB A;  4DR5 L;  3S17 H;  4YWL A;  2RHQ B;  4DV4 L;  1UEB A;  1GM5 A;  1OTC A;  4X64 Q;  1PA6 A;  1QVC A;  2N8N A;  4A3E G;  1IBL Q;  2YTX A;  4B3S L;  1YI2 A;  1VQ9 A;  1N9W A;  3CCL A;  1BVS A;  4GN5 A;  4KLK A;  1Y14 B;  1J5E Q;  5JEA G;  2JK8 A;  1CSP A;  4DV5 Q;  1VQP A;  1IBM L;  1Z47 A;  5BR8 Q;  5IY0 A;  4A3M G;  3HOZ G;  3S24 A;  4R4I A;  4NXN Q;  3I7F A;  2N78 A;  1KRS A;  1EUJ A;  2B3G A;  3U4V A;  4MTN A;  3W1G A;  1N34 L;  1OXT A;  4YCU A;  3I4N H;  1X65 A;  4Y52 H;  1WI5 A;  3CPF A;  2F4V Q;  2WAQ G;  2CWP A;  1E22 A;  3NEL A;  2XTI A;  3PUX A;  3RLN A;  3CCR A;  4IOA A;  1IXR A;  1BKB A;  3GTK H;  2VZA A;  1XMQ L;  1J5E L;  1HZC A;  5ELN A;  4HJ8 A;  2WP8 J;  1K83 H;  5C4X H;  5FJ8 H;  1KL9 A;  1Y1V H;  4NB3 A;  4HIO A;  4ALP A;  4JI7 Q;  4LF5 L;  4LF9 Q;  2UUA L;  3TS2 A;  1VQA A;  1OXS C;  2I5L X;  2ID0 A;  5M3M H;  1Q81 C;  3CCV A;  2K14 A;  5LMN Q;  3ULJ A;  3RZD H;  3L2P A;  4RMF A;  4EX5 A;  5M3M G;  4A3B G;  4JBM A;  3UDG A;  4IFD J;  5FLM H;  4P72 A;  1ASZ A;  3M7N A;  4P71 A;  1JJC B;  3CCJ A;  4IPH A;  4LF7 L;  3CCU A;  1GO3 E;  4L5T A;  4DR2 Q;  2JJQ A;  4A3K G;  4J15 A;  2VY3 A;  1C0A A;  5GAE C;  3UE1 A;  4K0K Q;  2Z6K C;  2K5H A;  4KHZ A;  4BA1 I;  3TEH B;  2JA5 G;  3FKI H;  4BBR H;  3H3V I;  1AH9 A;  3S1N H;  4DR4 L;  3HOY H;  3F2C A;  4B3M L;  1S72 A;  3K7A H;  3KDF B;  4JOI A;  4LUZ A;  1E1T A;  5GQO A;  4DAM A;  1X9N A;  3F8T A;  3J80 c;  3I4N G;  2R93 H;  4X6A H;  1VQK A;  1HNW L;  1X6O A;  4LFC Q;  1N32 L;  1HNZ L;  3HOY G;  3PV0 A;  1B7Y B;  1VQB A;  4R1J A;  3CC2 A;  1L1O B;  3UDX A;  3I55 A;  5JJL A;  2GVB A;  1JMC A;  4DV7 L;  1HR0 L;  1LM0 A;  2PMZ E;  1YZ6 A;  1PYS B;  1TWA H;  1VQF A;  3E0E A;  3CC4 A;  3CP0 A;  3AFQ A;  1WFQ A;  2KHJ A;  1UE6 A;  1XTD A;  4A3E H;  4A93 G;  1K0R A;  4P73 A;  4DR3 Q;  1K8G A;  5FLM G;  1VQM A;  3M3Y H;  3PIO A;  1C9O A;  1X56 A;  2KCM A;  4DR6 L;  1Q12 A;  3Q8D A;  2UUB Q;  2GN5 A;  2FXQ A;  3OTO L;  3TRE A;  2Q2I A;  2R93 G;  2ZM6 L;  3M9B A;  2PI2 E;  1YNX A;  1QZH A;  4LFA Q;  4PZ6 A;  1KAW A;  1EQR A;  1WCM G;  4X66 L;  3GD7 A;  3S1R H;  1PVO A;  1PH5 A;  3PSI A;  3RN2 A;  4TVA B;  2I0Q A;  1NBW A;  4A3F H;  4DNI A;  1X3G A;  3CF5 A;  1XPR A;  2E2H H;  3PO2 H;  1KD1 C;  4O2D A;  3JAM c;  1PH1 A;  2E5L Q;  3RLO A;  3PF4 A;  3M4O H;  2CQO A;  4YY3 L;  1EQQ A;  4DV6 Q;  1OXU A;  3E9H A;  4QL5 A;  4YHH L;  5LMU L;  1UE1 A;  2MO1 A;  4TQU S;  4DKA C;  5M5X H;  1VQ7 A;  4B3M Q;  1KXL A;  4WJ4 A;  4OO1 I;  2VL6 A;  3L7Z C;  4QJF A;  3I56 A;  1YHQ A;  3H15 A;  3CQZ H;  1EIY B;  3RR5 A;  2Q2T A;  1XNQ Q;  4GKK L;  1Y1V G;  4JBK A;  2K50 A;  1EYG A;  2R92 H;  1VQI A;  3NBH B;  4R4O A;  3U4Z A;  4A3L H;  1OXV A;  1X3E A;  1YEZ A;  4OXP A;  1JJ2 A;  3TRZ A;  1E7Z A;  1T9H A;  3ZJY C;  1RL2 A;  4LF6 Q;  3AEV A;  5C3E H;  4XTC S;  3OYY A;  4JI2 L;  2JA9 A;  5ELO A;  2VQF Q;  2BA1 A;  3CCM A;  3GTG H;  5IP7 G;  2YU9 H;  2JQO A;  5IP7 H;  4YCW A;  4FDB A;  1GD7 A;  4MNO A;  4DK3 C;  1HZB A;  4DV2 L;  4A3M H;  1QVG A;  3FKI G;  4BBR G;  1X3F A;  5C3E G;  1HR0 W;  1N8R C;  4GNX C;  4IFD I;  4KHP Q;  4POG A;  3KJP A;  2ZJQ A;  1CKM A;  2H5X A;  3JC6 6;  4JI3 L;  2MNA A;  4A93 H;  4UP7 A;  3BZK A;  4JI2 Q;  1J6Q A;  5LMN L;  4OWT B;  4C3H H;  2KCT A;  5M5Y H;  3A5U A;  2AMC B;  2DUD A;  1YJ9 A;  4A3B H;  1PH2 A;  2AWN A;  4JI1 L;  3G6E A;  2I5M X;  4LFA L;  4RG1 A;  3I4M G;  1Z9F A;  1SLJ A;  2QA4 A;  4PG3 A;  1EFW A;  4DV3 Q;  5FJ8 G;  1VQJ A;  3S2D H;  4DR5 Q;  4QGU A;  5AJ3 L;  1AE2 A;  3EN2 A;  4ME3 A;  3CPW A;  1VQ5 A;  1SR3 A;  1IBM Q;  4JCV E;  2NZH A;  2KEN A;  3ER0 A;  3F2D A;  1VQO A;  3AYH B;  4A3F G;  4A3J H;  1E1O A;  1WYD A;  3CCS A;  4A3K H;  1PV4 A;  3A5Z B;  4JI4 L;  1W3S A;  4OWX B;  1AE3 A;  2LXJ A;  2A1A A;  2B63 G;  2NVX H;  4MZ9 A;  3M85 A;  4JI5 L;  2L15 A;  4GOP C;  4UP8 A;  2WAQ E;  4LUV A;  1WOC A;  2Z6K A;  4DV1 L;  1VS0 A;  4LFB Q;  3HOX H;  2IT1 A;  4GNX B;  3D31 A;  1VQC A;  3MEF A;  3OW2 A;  1N34 Q;  1KC8 C;  4LF7 Q;  3HOZ H;  1A63 A;  1KHI A;  1HNW Q;  4JOI C;  4A3D G;  4JC0 A;  4P75 A;  3HFZ B;  3HKZ E;  4L5Q A;  3KF6 B;  4AYB G;  1S40 A;  3GTP H;  3T1Y L;  3HOW G;  4A3I H;  5C0X J;  1NE3 A;  3RNU A;  1O7I A;  2DGY A;  3KFU A;  4JI8 L;  3WWV A;  2A8V A;  2LXK A;  5IYC G;  1Q1B A;  2VQE L;  1VQN A;  4GLA C;  1IZ6 A;  4C3J H;  1QUQ B;  4DK6 C;  3A74 A;  3CCE A;  4DV1 Q;  1S3O A;  4HJ9 A;  4X65 L;  2K4K A;  5C0X I;  4GKJ L;  1Q86 C;  2UXD Q;  2OCE A;  5M3F G;  3GTM H;  4BY7 G;  1YJW A;  2IY5 B;  4K0K L;  4GLV B;  2IHF A;  2NN6 I;  1G51 A;  1EIF A;  2CWA A;  4DUY L;  1JJG A;  3E9I A;  1PFS A;  3W1B A;  2YV5 A;  4JI8 Q;  5IYD G;  2KHI A;  4LF5 Q;  3BJU A;  4AIM A;  5LMN W;  4OWW B;  2RHS B;  2D62 A;  3K7U C;  2R92 G;  3J80 i;  1ASY A;  1BBW A;  3PIP A;  4HIM A;  2R6G A;  4IPG A;  5C44 H;  1Q46 A;  1WJJ A;  4PZ7 A;  2B29 A;  2HHH L;  2OTJ A;  3PGZ A;  1XMO Q;  2NVQ H;  2C35 B;  2EQS A;  1U0L A;  1IBL L;  1NJI C;  2BH8 A;  2F52 A;  4QY7 A;  4LF9 L;  2JA8 G;  2VUM H;  2CKZ B;  3GTJ H;  1PH7 A;  5IWA L;  1K8A C;  3HOU G;  3GO5 A;  3STB C;  1CKO A;  1VQD A;  2CCZ A;  1TWH H;  3K0X A;  4DV4 Q;  4HJ7 A;  1P8L A;  1KRT A;  1I94 L;  4LNQ A;  2R7Z H;  2N3S A;  5BR8 L;  1SMX A;  1D8L A;  5H1S E;  4EQ5 A;  1KIX A;  3PO3 G;  4QQB X;  4Y7N H;  1Q1E A;  2QGQ A;  1XJV A;  4AYB E;  1EWI A;  4PMW A;  2ZTD A;  1UWV A;  5E7N A;  3TS0 A;  4A75 A;  1VQ6 A;  1I5F A;  3SGI A;  4DR3 L;  4L5R C;  4C3I H;  1LYL A;  4IJH A;  4R4C A;  1IBK Q;  3FP9 A;  4LF8 L;  3DM3 A;  2E2J H;  2ES2 A;  2VQF L;  3CCQ A;  2UUB L;  2WFW A;  2NVT H;  3HOV H;  4X65 Q;  1FJG Q;  4O0A A;  1IBK L;  4A4I A;  2K52 A;  2XGT A;  4DAY B;  3PUW A;  4X62 L;  3W5O A;  2JA6 G;  2ZTE A;  1Y1W H;  1XPU A;  4UY8 C;  3PUZ A;  4R4T A;  2AKW B;  2RCN A;  3RN5 A;  3T1H Q;  5DLQ E;  2OQ0 A;  1PH6 A;  1YIT A;  3PUV A;  4A3G H;  3U58 A;  2UXD L;  4GNX A;  1FL0 A;  1KQS A;  1JE5 A;  3U50 C;  4DV0 Q;  3ULP A;  4OON A;  2F3I A;  1K9M C;  4JI6 Q;  4JI7 L;  3CW2 C;  1MJC A;  2BA0 A;  2IX0 A;  1N36 L;  4DR7 Q;  2NZO A;  5IYC H;  4HID A;  4JBW A;  5IT9 c;  4X62 Q;  1M1K C;  1L2F A;  1VQH A;  2E2I H;  3VDY A;  1XNR Q;  1HJP A;  3NEM A;  3L0O A;  2EXD A;  4A3I G;  5GAH C;  3CC7 A;  2PI2 A;  1I50 H;  5JJK A;  3UDI A;  5IP9 G;  5IWA Q;  4GOP A;  4A76 A;  2OQK A;  2KBN A;  4B3R L;  1B70 B;  2ALY B;  2LSS A;  2K5V A;  1U5K A;  4APV A;  2R7F A;  2ASB A;  2NN6 G;  3HOX G;  4LFC L;  5JEA J;  3HKS A;  1A62 A;  3BU2 A;  4UPA A;  3KJO A;  4DR1 Q;  3ICE A;  4DV5 L;  1L1O A;  1XNQ L;  5FLX c;  3KDF A;  2HQL A;  2B63 H;  3KF8 B;  5JJI A;  2JEB I;  4NPS A;  2JE6 I;  4A3C G;  4P74 A;  1E24 A;  3I4O A;  2VW9 A;  1MKH A;  3I2Z A;  3EIV A;  4GLX A;  2UUC L;  5HGQ A;  4DV6 L;  3STB D;  4BY1 H;  3GTO H;  1A8V A;  1SN8 A;  4A3J G;  5C4X G;  5IP9 H;  4DV2 Q;  1B8A A;  1FJG L;  2HT1 A;  3S14 H;  2UUC Q;  1PYB A;  2UU9 Q;  1V43 A;  2UXB Q;  3AQQ A;  4BBS H;  2MO0 A;  1A0I A;  2EIF A;  4UP9 A;  5C4J H;  3T1Y Q;  2VUM G;  3K80 C;  3HKZ G;  4BXX H;  4JYA Q;  3BZC A;  2R7D A;  2CFM A;  2A19 A;  3MXN B;  4R4Q A;  5GRO A;  1NMF A;  2UUA Q;  1SRO A;  1PH3 A;  3G48 A;  1M90 C;  4LF4 L;  2D0P A;  3OTO Q;  2OTL A;  1MIU A;  4JG2 A;  1I3Q H;  2PQA A;  1Q8K A;  4X64 L;  1E3P A;  3H0G H;  3KLW A;  1XMQ Q;  4GKK Q;  2MQH A;  4IO9 A;  3K8A A;  3J7A 5;  4JI0 Q;  1QUQ A;  5C0X G;  4YCV A;  4B3S Q;  2BH2 A;  1L1O C;  3B6Y A;  2D0O A;  3HOV G;  2NVY H;  1RIP A;  1LTL A;  1BBU A;  1CKN B;  3D0F A;  4JV5 L;  4JBJ A;  1PH9 A;  1SFO H;  3J81 j;  3EBE A;  2ZM6 Q;  5K36 G;  4DR4 Q;  3RLF A;  2IHE A;  1QZG A;  1K3R A;  4IPD A;  1HNX Q;  4BXX G;  1I6H H;  2N49 A;  3CAM A;  5IE8 A;  1JT8 A;  5M5W H;  3GTQ H;  4JI1 Q;  3CME A;  1VQE A;  1MJE A;  2IX1 A;  2YYZ A;  4IPC A;  1HNX L;  2I5H A;  4GS3 A;  1IL2 A;  2K5N A;  4A3L G;  4B3T Q;  4NXM L;  3JAM i;  5EAY A;  3HOU H;  5HY6 A;  2HIV A;  2K75 A;  4BY1 G;  2JA6 H;  4GKJ Q;  1VQL A;  1NTG A;  3UDF A;  4JI3 Q;  3H0G G;  3KYH C;  4LF8 Q;  1XPO A;  1PHJ A;  2JA8 H;  4A3C H;  1NMG A;  1YJN A;  2UXC Q;  4LUO A;  2ZJR A;  4HJ5 A;  3CMA A;  1XMO L;  4JI4 Q;  2JA7 H;  4DR6 Q;  3S2H H;  1Q7Y C;  1HZ9 A;  1D7Q A;  2YTY A;  1FVI A;  3M4Q A;  4L5S A;  1TWF H;  2ZTC A;  2E8G A;  4YWM A;  5J3B A;  4JI5 Q;  1HH2 P;  1SE8 A;  4DR1 L;  1V1Q A;  1K73 C;  5IYD H;  1TWC H;  4NXM Q;  2AWO A;  3PCO B;  5GAG C;  3FHW A;  1PH4 A;  3F1Z A;  1DGS A;  4YY3 Q;  2VNU D;  2Z0S A;  3J81 i;  1YHA A;  3TQY A;  4JI6 L;  3F2B A;  4POF A;  4DV7 Q;  1HR0 Q;  4NXN L;  4DPG A;  5M3F H;  4DUZ Q;  1SRU A;  2ZJP A;  2RF4 A;  1VQ4 A;  2AHO B;  3I4M H;  1VQG A;  1YHB A;  4OO1 G;  1OXX K;  1W2B A;  1XNR L;  5IYB H;  1NY4 A;  3PUY A;  4AQY L;  2WB1 G;  4IFD G;  1HZA A;  2V1C C;  4KHP L;  4DV0 L;  4H02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...