3H3VI

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vI00
3UDGA 2VY3A 5C4XH 2K4KA 2F52A 4DR2Q 1BBUA 5K36G 4GS3A 1P16A 1VQCA 3KLWA 1IBML 4NXML 4X65Q 3CC4A 4GN5A 2Q2HA 3IRBA 1PH9A 4PZ7A 3A74A 2HT1A 3KFUA 3GTPH 2PNHA 1BBWA 4KHZA 4QJFA 5E7NA 5JEAJ 4JCVE 4ME3A 4P75A 1YEZA 4JI6Q 5HY6A 1HZBA 1TWGH 1Y1WH 3H0GG 2NN6G 4A3IG 4YHHL 4YWMA 2A8VA 1MJEA 4QQBX 2CCZA 4LW1A 5JJKA 1EUJA 4QL5A 4Y52H 3HOZH 3CW2C 3J81j 4OX9Q 3UDXA 2N3SA 4DR7Q 4IOAA 1XPRA 4A3DH 4L5TA 3WWVA 3L2PA 3STBD 5M3MG 1IBMQ 3PF5A 4BY1H 3ER0A 2AHOB 4YWKA 3HOYG 4A3FH 3TS2A 1RIPA 1T9HA 2B63H 1E22A 1YHAA 3KOJA 1NMGA 1EIYB 2VQFQ 3HOUH 4BY7H 4B3RQ 3HKZE 3CCRA 2UUAL 2MFIA 2JA8H 4JI6L 3HOYH 1E7ZA 1KL9A 3GTMH 2E8GA 4AH6A 4HIDA 4WJ3M 4BY1G 2MQHA 5M3MH 4DR7L 2YV5A 1NMFA 2XTIA 1A0IA 4GLXA 2H5XA 4JBKA 5FJ8G 4LF9Q 3S1QH 3FKIH 4R4CA 4LF5L 2B3GA 5FLXc 3E0EA 1AE3A 3CQZH 2MO0A 2UUAQ 5C4XG 3CMEA 3RZDH 2GVBA 3RR5A 4YY3Q 2IX1A 4JV5Q 2K14A 3AFQA 3S24A 1IZ6A 2MNAA 4NPSA 2YTVA 4JBJA 2C35B 4OWXB 4DV4L 1Y1WG 5IYDG 1SFOH 4AQYQ 1K83H 4DV1L 3I4MG 1VQJA 3K81C 2JA5G 4UPAA 5LMUQ 2F3IA 3FKIG 1XJVA 2UU9Q 3GTKH 4DV0L 4GN4B 3J81c 1WI5A 1N8RC 2KBNA 2UUCL 1VQ5A 1HNWQ 4JI7Q 2PMZE 4IJHA 1EQQA 5JJIA 4GNXB 4A3MH 2GVAA 1FGUA 2XGTA 1L1OC 3KJPA 3J7A5 2ZTEA 3STBC 1VQ6A 3RLFA 5IP9H 1SRUA 3HOUG 1UEBA 2ZTCA 4YHHQ 3OW2A 1UE7A 3U4VA 4LF8Q 3CCSA 2GN5A 1KXLA 2FXQA 1G51A 2K75A 3S14H 1TWHH 3B6YA 4JBWA 3GTJH 1AE2A 3T1HQ 4JOIA 1TWAH 1C7YA 3CP0A 1JB7A 4P73A 2R6GA 3TREA 4YCWA 4HIKA 1VQPA 1VQLA 4NXMQ 1VQFA 3ERSX 3HOZG 1M90C 1YHQA 1OXVA 3GO5A 3RN2A 3JAMi 1VQ9A 3S16H 3UDFA 2UU9L 2AKWB 1HR0L 4JI0L 2VS1A 3M9BA 3CCJA 4GLVB 3PO2G 1JE5A 4YWLA 1TXYA 3NELA 2OTLA 4HJ8A 5GAEC 3UDIA 3HOXG 3J80i 1XMQL 4DUYQ 1DGSA 4JI2Q 3CCQA 4X64Q 4B3ML 4DV5L 1HNZQ 3HOXH 3PUYA 1A8VA 1S40A 3G48A 2WFWA 4B3RL 3A5UA 5IY0A 4IFDI 2F4VL 4JYAQ 4DV2L 1ASYA 1CUKA 4HJ5A 3PO3H 4O2DA 4L5QA 3HFZB 3L7ZC 3VDYA 1GM5A 4POGA 5FLMH 3HKSA 4IFDJ 2N78A 2R93H 1PYSB 1YBYA 3ULLA 4JI5Q 3KYHC 2I5LX 1XTDA 5C44G 4A3KH 1HNXL 4LWCA 1EIFA 4LF6Q 1YZ6A 1E24A 1IXRA 3AFPA 4DK3C 1VQMA 1XNRQ 1PH1A 1KD1C 2E5LL 5M5WH 2ZM6L 3CPWA 4DV6L 3E9HA 2N8NA 5H1SE 3HOVG 1WCMH 2RHSB 4A93H 4A3FG 4TQUS 4LF4L 3HOWG 3GTGH 4IOCA 5M3FG 4UP8A 5IYBG 1WOCA 2VUMH 1G6PA 4IO9A 4A76A 1CSQA 1HJPA 1B8AA 1SR3A 2OQ0A 3A0JA 1X9NA 2K52A 4A3DG 3BJUA 2UXBQ 1PHJA 1Q86C 3PUZA 4K0KQ 1EFWA 2NVTH 4A3BH 2ATWA 4R1JA 2BH2A 2L15A 1IBLL 2K5NA 4JI5L 4JI0Q 3KF6A 4DR3L 4LF4Q 2HIXA 5IYDH 1N36L 4DV2Q 4O0AA 1MKHA 4LFCL 5M5YH 2E2HH 4C3JH 4JI3Q 2PI2A 4LUZA 1HH2P 1FL0A 4AIMA 2KENA 3UE1A 2ID0A 3PIOA 3S2HH 2KCMA 3PCOB 1K8AC 3H0GH 1SLJA 4XTCS 4GOPB 2AWOA 1QUQA 5AJ3Q 2EXDA 4A3IH 1PH3A 4B3MQ 5IP7G 1ASZA 1VQDA 2ZJPA 2ZJRA 1X54A 1XMQQ 3W1BA 4X6AH 5JJLA 1P8LA 1JMCA 1Y1VG 1XNQL 4X62Q 3BZCA 4C3HH 1YITA 2VQEQ 4BBRH 1GVPA 4IPHA 4DNIA 1FJGQ 5M5XH 4HJ7A 2VZAA 4GOPA 2B63G 1J5EL 1YVCA 1HNZL 1QZHA 1GD7A 4LF6L 1L1OB 3BU2A 1WJJA 4DV0Q 2CKZB 1Q8KA 2NVYH 1UE5A 1I94L 2JA9A 2R7ZH 1L2FA 4MZ9A 1PV4A 2NVQH 1N33Q 2IHEA 5J3BA 1KC8C 1A63A 3T1YL 1A62A 2UXDL 1YJNA 2JJQA 3H3VH 4GKKQ 1HR0Q 3MXNB 2JQOA 4LFBL 4YY3L 1PYBA 1VQHA 1Q1EA 2KHIA 1CKOA 2MO1A 3CCUA 1HNWL 3D0FA 4LF9L 5ELNA 2YU9H 4R4OA 2JA6G 4JI2L 2NZHA 1FVIA 1Z9FA 2NZOA 4A3LH 1E3PA 1KHIA 2VL6A 2Q2UA 2YYZA 3KDFA 3ULJA 2BH8A 1PH8A 4J15A 4JI4Q 3F2CA 2IY5B 1OXXK 1YNXA 2JA7G 4JI8L 1X55A 2JE6I 5IE8A 1D7QA 3AQQA 3NBHB 2RCNA 4LF7L 5LMNL 4NXNQ 2LSSA 1C0AA 4DV3Q 3PV0A 1XMOL 2WP8J 4DAYB 1C9OA 1Q82C 1Y1VH 4RG1A 1K8GA 1SE8A 3D31A 2UUCQ 4C2MH 5FLMG 1IBKQ 1L1OA 3SGIA 4HJ9A 1GKHA 1V9PA 2D0PA 2N49A 4OONA 4XIGS 5LMUL 3I56A 1GO3E 4OXPA 3CF5A 1Q7YC 1U5KA 3M4PA 2R92G 2HIVA 4DR1Q 3CC2A 1VQEA 4B3TQ 3M85A 4A3JH 1VQKA 2R7DA 4LF8L 3RZOH 4JOIC 1R9TH 3CXCA 3EN2A 1NY4A 4BXXG 2HHHQ 2JA7H 1CKNB 4MNOA 4LFAQ 4PMWA 3PGZA 2QEXA 4B3TL 4NB3A 1U0LA 1WFQA 1LM0A 4LF5Q 4A3CG 2WB1E 3EBEA 3I4OA 4A3LG 2E2JH 1XPOA 2I0QA 4OX9L 2BA0A 2VUMG 4X65L 4DKAC 4JC0A 4AQYL 4OWWB 2JEAI 1W3SA 5C3EG 4DV4Q 3G71A 4A3GG 4BXXH 4GKJQ 1X3FA 1V1QA 4DR2L 1YJ9A 4RMFA 1K9MC 4LFAL 2VQFL 1XMOQ 3I4NG 2IX0A 4PZ6A 5C4JH 1PH6A 3Q8DA 1PFSA 1QVFA 3F2DA 1TWFH 4A3GH 1X56A 1MJCA 4GOPC 1VQ7A 5GAGC 4DR5L 4A3EH 3U4ZA 1MIUA 1I3QH 2OQKA 3K8AA 3I7FA 1E1TA 1VQAA 2PQAA 3DLLA 4GLAC 1CSPA 4AYBE 1UE6A 2HQLA 1N9WA 4LUOA 4A4IA 1Q12A 3GD7A 4C3IH 1JT8A 4WJ4A 2VW9A 4BA2I 4LFBQ 4QIWE 4BBRG 2KHJA 1OTCA 4GKKL 1B7YB 2CWAA 4IFDG 4LF7Q 1O7IA 3PUXA 4AYBG 1X3EA 3JC66 3CMAA 4GKJL 1PA6A 4JI8Q 2LXKA 3G4SA 3FHWA 4UY8C 4JI4L 1OXTA 3J7ZC 1Q46A 1N33L 1H95A 5IWAL 4GN3B 5IP7H 3L0OA 3PIPA 4UP7A 5HGQA 3M7NA 3CCVA 1X3GA 1Y14B 4B3SQ 2Y0SG 3PO2H 3FP9A 1JJ2A 2A19A 4A3EG 5IYCG 1W2BA 1KAWA 1Q81C 2E2IH 3PUVA 4OO1G 2RF4A 4IPDA 2ZJQA 2HHHL 2WAQE 4R4TA 2YTYA 3GTQH 4HIMA 4DV3L 1YIJA 3GTOH 1TWCH 5LMNQ 2VQEL 2EIFA 4DR1L 4P71A 1UWVA 4DR6Q 3K7AH 5C3EH 1YHBA 1K3RA 4DUZQ 5GQOA 3OTOQ 5IYBH 2B29A 4Y7NH 2I5MX 2OWOA 2JA8G 1IBKL 5AJ3L 3MEFA 1M1KC 1WCMG 3TEHB 1G291 4POFA 4BY7G 1Q1BA 1VS0A 1VQBA 4UP9A 5C0XI 1OXSC 1KRSA 4KLKA 4JI3L 3F2BA 1VQ8A 3AEVA 2ALYB 1N36Q 2JK8A 4DR4Q 3J80c 5C44H 1HZ9A 4NXNL 1L0WA 3EIVA 2OTJA 2D62A 3KF6B 5BR8L 5JEAG 1EWIA 5IYCH 4X62L 4A75A 4A3JG 4L5RC 4FDBA 4QGUA 2UXBL 3CPFA 2R7FA 3M3YH 3UE0A 4DV7L 1I94Q 4BA1I 3JAMc 3F1ZA 3KJOA 1VQNA 2R7ZG 1PH7A 5ELOA 2UUBL 4HJAA 4QY7A 4EQ5A 3H3VI 5DLQE 4JI1L 2ZTDA 3PSIA 3TQYA 1JJCB 3CD6A 1SN8A 2K50A 3RLOA 2UXCL 4IPCA 4DR3Q 4R4IA 1IYJB 5FJ8H 3ZJYC 3LGJA 1Z47A 3T1YQ 3CCLA 2CFMA 4K0KL 3ULPA 4OWTB 1N34L 3S17H 2VNUD 2UXDQ 3TS0A 3NEMA 1EQRA 3K7UC 2WB1G 4PZ8A 5C0XJ 4GNXC 5M3FH 1PVOA 1V43A 2LXJA 2CWPA 4DK6C 1K73C 3HOWH 1N32L 1J6QA 4YCVA 3HOVH 1J5EQ 3GDEA 3CCMA 3CAMA 3CCEA 2UXCQ 3J81i 3S2DH 1LYLA 2E5LQ 1NBWA 4LFCQ 4EX5A 1LTLA 1PH5A 1FJGL 4X66L 2K5HA 1IL2A 3BZKA 4KHPL 4A3KG 2ASBA 1HNXQ 1IBLQ 1S3OA 3PF4A 4X64L 2R93G 4L5SA 4LNQA 2I5HA 1YI2A 1QVGA 1XNQQ 3GTLH 4A3BG 2K5VA 2BA1A 2Z6KA 3H15A 1E1OA 4H02A 2DGYA 1YJWA 1QUQB 3E9IA 1PH4A 1X6OA 4R4QA 3PO3G 1NTGA 1I50H 1WYDA 2KCTA 1RL2A 1UE1A 4KI0A 5IP9G 3S1RH 3K80C 5GAHC 4A3MG 4KHPQ 4TVAB 2Z6KC 2NN6I 1EOVA 4X66Q 2EQSA 3KDFB 3RN5A 2NVXH 2CQOA 2ZM6Q 3HKZG 3KF8B 3W5OA 4DV6Q 1PH2A 3S15H 3S1MH 3M4OH 2Z0SA 3F8TA 1B70B 1NJIC 4JG2A 2UUBQ 1I6HH 1LUZA 1HZCA 3I2ZA 1SMXA 3T1HL 2JA5H 4DV7Q 5EAYA 1CKNA 4DUZL 3I4MH 1I5FA 2AMCB 4P72A 5GADC 4IPGA 4DR6L 4BBSG 3OYYA 4DAMA 1XPUA 3M4QA 3A5ZB 1BVSA 2RHQB 5C0XG 5IT9c 2ES2A 4APVA 4JBMA 2IHFA 4DPGA 1D8LA 2Q2IA 2PQAB 1HR0W 1JJGA 5GROA 1SROA 1VQOA 4HIOA 3I4NH 1NE3A 3CC7A 1XNRL 4BBSH 4MTNA 3G6EA 2V1CC 4DV5Q 1KQSA 1S72A 4B3SL 4IJLA 1KRTA 1N32Q 4P74A 2D0OA 2Y0SE 4DUYL 3U58A 1VQ4A 3U50C 1N34Q 1VQGA 2QA4A 4LUVA 3RNUA 2JA6H 1VQIA 4ALPA 3ICEA 1BKBA 2DUDA 3K0XA 4GNXA 4A3CH 4JV5L 1QVCA 4DR4L 2PI2E 2YTXA 1KIXA 2AWNA 2Q2TA 2OCEA 3NENA 2A1AA 2F4VQ 4JYAL 4A93G 1OXUA 3RLNA 4JI7L 3W1GA 4YCUA 1VCIA 1AH9A 2IT1A 4JI1Q 3S1NH 3PUWA 2R92H 3TRZA 3AYHB 3OTOL 1CKMA 1K0RA 4DR5Q 1HZAA 5IWAQ 1EYGA 4OO1I 2WAQG 4DV1Q 3DM3A 2JEBI 5LMNW 5BR8Q 1QZGA 4PG3A 2QGQA 1X65A 3I55A
chains in the Genus database with same CATH superfamily
1TS2A 4RGTA 3NP8A 4C3JB 3J80E 3M7GA 1D6EC 2EZVA 1P16A 1IHZA 1LV9A 2EYMA 4NXML 3CC4A 1PH9A 1QJOA 2O5JC 5DEHA 4PZ7A 4P75A 2JSOA 1SSOA 4KY5A 5HY6A 1D1KA 3URYA 2WINB 1S5FD 2QEJC 2E76C 2CCZA 4QQBX 5JJKA 4OGQC 3HOZH 1ZKOA 1QWYA 1F9SA 5E1FA 4RGMA 3UDXA 4DR7Q 1XPRA 4A3DH 3WWVA 1RODA 5CMDA 2AHOB 1RIPA 1T9HA 2B63H 3KOJA 4BY7H 1JCKB 3HOUH 3HKZE 2F0OA 2A6HC 2MFIA 3HOYH 4X3TA 3DWQA 2E8GA 4AH6A 5IIFA 4BY1G 2JN4A 3QIAA 1V1OA 2EXZA 1HFGA 2B3GA 1A2TA 2UUAQ 3CMEA 3E0JA 3RR5A 2EE1A 5J1ZA 3D8GA 3AFQA 2B8FA 2LFNA 2RDHA 2XNAC 2YTVA 4JBJA 2LKVA 2IWHA 3VYTA 5IYDG 1VQJA 3K81C 1XJVA 4KHVA 1QG7A 3FEWX 4GN4B 1N8RC 3UI2A 1ICFB 2F4IA 4GNXB 4KMUC 2XSCA 1EY6A 4TRDA 1SRUA 1SYBA 4KY7A 4FNFA 1KXLA 3NQTA 3S14H 3FKIB 1TWHH 2L12A 1I3QB 4ZK9B 1VQFA 3HOZG 1M90C 3GO5A 3JAMi 3S16H 3C3LA 5KIXA 1STEA 5BN5A 4GLVB 3ND9A 3PO2G 2B2TA 1SMYD 1V1PB 1K3BC 4HJ8A 1EIGA 1DGSA 2JYOA 1HNZQ 1GUOA 3PUYA 4PV1C 2K33A 2L5TA 4C1NK 1EZ6A 2QCPX 4B3RL 3A5UA 3TP6A 4IFDI 4DV2L 1IKLA 1WTVA 1WVLA 4RCOA 4N8X1 5L37A 4NMZA 3DWPA 4DK1A 1GM5A 1XYIA 5KRUA 1L0YB 3HKSA 2R93H 3ULLA 1STNA 1C8CA 4A3KH 4KKTA 1Y8PB 2F0IA 2GA4B 1YNNC 1YZ6A 1E24A 1IXRA 4DK3C 1VQMA 4A3MB 1TIID 3CQZB 2M00A 3Q6SA 1WCMH 2RHSB 3V05A 5J39A 4KY6A 3K5NA 4LF4L 3S1QB 4IOCA 4UP8A 3RZOB 1CTMA 1B8AA 1SR3A 3NE5B 4DN4M 5J22A 4K0KQ 2F0HA 1BUVT 4A3BH 1NR2A 1NAPA 4KKUA 2L15A 2K5NA 3BVMA 4DR3L 3KF8A 1N36L 4Z9CB 4EQPA 1D1IA 1SE4A 1C0AA 2KENA 3R2IA 2KCMA 1PH3A 4B3MQ 2EXDA 2AUJD 4RFBA 1XMQQ 3W1BA 4X6AH 3TBIB 1JMCA 2R7ZB 4V190 4QB4A 1EU4A 1YITA 4H44C 1EEFD 2KCCA 3KUPA 2R61A 1FJGQ 2A69D 4F88A 1T5XD 4RKBA 1J5EL 4KTAA 1YVCA 1QZHA 2WIIB 3SEBA 3R8BA 1UEAB 2NVQH 4DK0A 5FKAC 2IHEA 4IN3A 2J7ZA 3GV3A 1GUGA 2JJQA 3MXGA 3MXNB 4LJZC 1F9PA 1PYBA 1Q1EA 3SK6A 1HNWL 1PLFA 4JI2L 4B9WA 1Q90A 2NZOA 4A3LH 2DY7A 3BDLA 3S1NB 5EJWA 1D7QA 1RKNA 1I6HB 5LMNL 3T56B 3BYYB 3EJIA 4HEDA 3M4OB 1C9OA 1I4RA 3HGBA 3M4YA 1VDZA 4RG1A 1SE8A 1BR9A 3D31A 3IL8A 4CKEA 1T5EA 3OWEB 5EBCA 3T53B 1EQTA 4XIGS 2EYJA 1B4OA 2A6ED 1U5KA 1F2MA 4DR1Q 4B3TQ 1VQEA 4XT3B 2OXPA 1VQKA 1NR4A 2EY2A 3C1FA 1FGBD 3EN2A 3MZ5A 1CKNB 4LFAQ 1PFBA 3PGZA 4M1UB 3EBEA 4A3LG 2MHVA 4LK1C 3VR2A 1H9KA 2EYOA 1SNMA 3ZYYX 5D65A 4OWWB 1W3SA 3G71A 1YJ9A 2AQ1B 4RMFA 5EPKA 3FRPB 4UHVA 1LT4D 5JJZA 1VMCA 1CI3M 1EL0A 1PFSA 1I4QA 3MHBA 4L63B 4A3GH 3BG3A 3HOXB 5A2QE 1G2TA 4L6TB 5TSSA 1JE4A 1JQYD 1VQAA 4ZYSA 5BN4A 3EVQA 4AYBE 1UE6A 1N9WA 2RKSA 4A4IA 1SXTA 3K5LA 4OEMB 5M5WB 4C3IH 2VW9A 1GUTA 4JW0A 4LFBQ 3HOVB 2CWAA 1AZQA 1O7IA 1I50B 1PA6A 1JICA 3EQLC 3PMFA 1ML0D 3FHWA 5IGCA 3G4SA 1Z6HA 2K32A 1Q46A 1WTQA 1LABA 1N33L 1ET9A 3S17B 3PIPA 5K5PA 1TWAB 5EGTA 2ICEC 3A55A 1SE2A 4ZUJA 5IOCA 1KAWA 2E2IH 2HHHL 1GHKA 4OIKA 4HIMA 4DV3L 1F77A 5LMNQ 3DMUA 1U4PA 3HOWB 2R93B 5IGGA 3OOCA 4ZQ3A 3NXWA 4DUZQ 1X3PA 1E2ZA 2F0PA 3TP5A 4K6DA 4Y7NH 4U68A 2I5MX 1QE6A 1WCMG 5AFWA 1TU2B 3I70A 4BY7G 1TWFB 1YNJC 3F2BA 4UP9A 3FDTA 4JI3L 1VQ8A 1EY5A 4I65A 1HZ9A 3CKIB 4ZLTF 1ENFA 4MHEA 3G6JB 1EWIA 1I4HA 5IYCH 4X62L 2EYPA 2PQEA 4Q0FA 2QW7A 3K6OA 2UUBL 5C4ZA 1HTLD 2BE5C 4V0BA 3CD6A 5CORA 2NN6H 3RLOA 2UXCL 5I2YA 1Y1WB 5FJ8H 3LGJA 3KLSX 2CFMA 3ULPA 1F2ZA 1TWHB 3NEMA 3K7UC 5C0XJ 5M3FH 1K73C 1KAAA 1N32L 1JOKA 1II3A 1NUCA 1PTOD 3GDEA 1J5EQ 2VXWA 4K14A 1NBWA 3SK5A 1LTLA 1PH5A 5CV5A 2K5HA 3BZKA 3E3XA 2ASBA 1HNXQ 5CV8A 3PF4A 2R93G 4X64L 1LACA 1CQVA 4LNQA 4A3BG 4HR7B 1SYDA 5E3FA 2AQ3B 1E1OA 2DGYA 1SAPA 1S4ZA 4KI0A 1NTGA 1I50H 1RL2A 5CV7A 1H9SA 5GAHC 3OW7A 1EOVA 3KDFB 3RN5A 2PNRC 3D3RA 3W5OA 3S15H 4WRDA 4H0LC 1JB3A 2KVMA 2UUBQ 1SMXA 2DJFC 2AMCB 4P72A 3H6MA 4DR6L 4DAMA 2F0EA 2RHQB 3N52A 4BY7B 4JBMA 2PQAB 1E0BA 1SROA 4RKLA 4HIOA 2F03A 1NE3A 1XNRL 4BBSH 3NBIA 3G6EA 1CA5A 4B3SL 2D0OA 1F9RA 3X3MA 4DUYL 1VQ4A 2NVQB 2EDGA 4JK1C 1BKBA 2RBMA 2YTXA 1KIXA 1KNAA 5LHY1 1OXUA 4QUCA 3DHQA 4HMJA 1AH9A 1HA5A 4JI1Q 1WTXA 2P5ZX 3S9WA 1FNVA 3AYHB 1DJRD 1EYGA 2Y0SB 1JR0D 5BR8Q 4PG3A 3GP7A 3UDGA 2XVSA 1EEID 4DR2Q 3MXUA 4GS3A 2B2YA 1VQCA 5I4DA 1IBML 1SEBD 4GN5A 3TMEA 5FLXL 2HT1A 3KFUA 1BBWA 2YU9B 3C2PA 4ME3A 4E6IA 1YEZA 4JI6Q 1HZBA 1MJEA 1MGSA 1MI2A 1KLUD 4C3JG 1VMPA 3SHLA 5IT9E 4AYBB 4QL5A 3I4MB 2KCNA 3EA6A 3J81j 3DEOA 1TR5A 2N3SA 4IOAA 2RQXA 3L2PA 3STBD 1IBMQ 5EPJA 4BY1H 4YWKA 1AZPA 3HOYG 1E22A 3OPOA 2VQFQ 4ZUIA 3S16B 3CCRA 5I6WA 1PZID 1E7ZA 3GTMH 2MPMA 2MQHA 5M3MH 2YV5A 3BYTB 2JA5B 3K5OA 1SNOA 4C1NI 3FKIH 1B3QA 5DAUA 5FLXc 4XT1B 1J9OA 4CKCA 2MO0A 2EY1A 3J7AV 3S1MB 2XWBB 4YY3Q 2SEBD 5KNDA 4HAEA 2K14A 4PQXA 4JV5Q 3S24A 3I73A 4F8MA 1FR3A 4OWXB 1ENCA 4AQYQ 4DV1L 3K57A 1QILA 2HQEA 2F3IA 2EJFC 4Y7NB 3PO3B 2V4DA 2UUCL 3FPUB 4ZCKA 5FOBB 4U673 1A3VA 1EQQA 5FO8B 5JJIA 4A3MH 1E2WA 3KJPA 2ZTEA 4F87A 3RLFA 4TKOB 5IP9H 1LTSD 5CV4A 4YHHQ 3OW2A 5ELCA 2LMCB 3CCSA 3T51B 2GN5A 2K75A 1G51A 2EJGC 5KNBA 1C7YA 3T1HQ 1SJHD 3TP8A 2R6GA 3C46A 4YCWA 1VQLA 1EY8A 3ERSX 3KBGA 1PFMA 3U9OA 2HDLA 1SMYC 2L11A 4G57A 3UDFA 2UU9L 4XDXA 4JI0L 2VS1A 3M9BA 4IUTA 5KEEA 1FD7D 1DOMA 4ABNA 3NELA 5GAEC 3UDIA 3J80i 3QG1A 1PRTF 4A3DB 3LWUA 3K59A 3O13A 1ILPA 1TWCB 4B3ML 4IFDH 1M8AA 3G48A 2Z4IA 5JPNC 1ZYRC 2F4VL 1CUKA 3HFZB 3VDYA 4G7ZC 2XWJB 5FLMH 1SNCA 1PYSB 1YBYA 2JXMB 2DJGC 2I5LX 3DUZA 4C2MB 1HNXL 4OO1I 2VB2X 1RCVD 1PH1A 1KD1C 2E5LL 2ZM6L 4MN3A 3K0YA 1K0SA 3Q0AA 3GTGH 2F0DA 3FVQA 2I46A 4IO9A 3BVZA 3LNNA 1CSQA 4RHSA 4DU9A 4A76A 5HGTA 3IFDA 3A0JA 1X9NA 2K52A 2SOBA 1M4VA 3I3CA 3PUZA 1EY4A 1EFWA 4N8FA 4R1JA 2ATWA 2BH2A 1IBLL 2RSOA 4JI5L 5IYDH 3KF6A 2HIXA 4O0AA 4LFCL 4JI3Q 4C3JH 4FXDA 1HH2P 1ONLA 3PIOA 4JI5Q 4GOPB 4XTCS 1QUQA 1ESFA 1VQDA 5C0XH 2ZJPA 1BF4A 4DNRB 4J6HA 1PDQA 2A73B 2A69C 2VQEQ 2AQ2B 4DNIA 3R3OA 3L3OC 2B63G 4IUUA 4DGZA 4LF6L 1L1OB 3BU2A 1WJJA 2JA6B 2CKZB 5DNFA 1Q8KA 2F3VA 4HSPA 5KNCA 3SVMA 1CZGA 4F7XA 1A62A 1HR0Q 2DNCA 2JQOA 1FNWA 4YY3L 1KDCA 2TSSA 2NYZD 2Z4HA 1CQFA 2G9HD 1VQHA 2MO1A 3CCUA 3IFTA 2L1BA 1STBA 2YU9H 4R4OA 3CHBD 2F3WA 1BCPC 1E3PA 1KHIA 2B2UC 1LT3D 4JI4Q 2IY5B 2CW0C 1HQMC 3TSSA 4FO2A 1GUNA 3NBHB 4A93B 1XMOL 3QOLA 3TDQA 2PW5A 4ZAIA 4OO1H 4IUQA 1Y1VH 2KECA 4G7HC 4C2MH 1IBKQ 3SGIA 1CA6A 4DAVA 2D0PA 2N49A 4OONA 2M9VA 2B8GA 2HIVA 3CC2A 3M85A 4A3JH 3RZOH 3W3AA 5A35A 1NY4A 4MNOA 4PMWA 4B3TL 1AN8A 1EZ8A 2WB1E 3X3NA 2BCOA 4FXKC 2WV6D 2I0QA 2NB0A 2VUMG 4KJOA 1B44D 2K04A 5M5XB 4BXXH 1X3FA 4LFAL 3D6CA 1G8ZD 2SDFA 1U4RA 3J7AF 2SNMA 1EIHA 1QVFA 3MWYW 4FP5D 1MJCA 2E75C 3TZDA 2DN8A 1Q3LA 2OQKA 4RWSC 1PTOF 2KHSA 3ND8A 3SR1A 3S15B 4ZKBB 1TT2A 4BA2I 1A3TA 4N9PA 4GKKL 2DNEA 4LF7Q 1K8MA 2LY7A 3MVVA 3PUXA 1S5BD 5HURA 4JI8Q 5ISRA 1VF5C 1OXTA 2CHBD 4GN3B 2F0UA 3L0OA 4HSVA 2B2VC 5HGQA 2HCIA 3VYUA 3M7NA 1Y14B 1PRTD 5IYCG 1W2BA 3F2UA 3PUVA 2ZJQA 3HKZB 4R4TA 3GTQH 1YIJA 3GTOH 5JVG3 4XXEA 2K5DA 2KOLA 1O7YA 4P71A 4DR6Q 3K7AH 5C3EH 1YHBA 2K5WA 1K3RA 5E4WC 4HCEA 1DONA 2OWOA 2JA8G 1IBKL 4POFA 3I8ZA 1VQBA 3MFYA 3BDCA 4WJWA 2JK8A 3WDNA 1L0WA 3RUZA 5BR8L 4A75A 2BE5D 4QGUA 1EQVA 3CPFA 2ENBA 1U4LA 3A7LA 3M3YH 3UE0A 2QILA 1TVXA 5C5MA 4BA1I 3JAMc 3F1ZA 1I94Q 2R7ZG 2K28A 1HFNA 4JI1L 2A68C 3TQYA 2PO4A 4XYQA 4DR3Q 3VA7A 1XX8A 1Z47A 2VNUD 1CHPD 4OWTB 4BY1B 3S17H 3MFGA 2WB1G 3MXPA 3HOWH 4KN7C 1J6QA 4X3UA 4YCVA 4DF7A 3S2DH 3P75A 1WTPA 1IL8A 4EX5A 2KQ3A 2RA4A 4X66L 1R9TB 1KABA 3SK4A 1S3OA 1IBLQ 3FMCA 1DYQA 3A8JE 1YI2A 1XNQQ 3GTLH 3H94A 4XQNA 3H15A 4H02A 1SFOB 2JA8B 1X6OA 4R4QA 3EROA 1UE1A 2B2WC 2K6AA 4KHPQ 1I4PA 2Z6KC 1B9MA 4EVOA 3RZDB 3H3VI 4DV6Q 3HKZG 1PZJD 3G7LA 3BDOA 1B70B 1NJIC 2JP1A 4DV7Q 3NBHA 4IALA 3V2TA 4DUZL 1I5FA 5FO9B 5GADC 1BCPB 1NCVA 3KLRA 1XPUA 5C5LA 2ES2A 3QOJA 4X3KA 4DPGA 2Q2IA 3R2TA 1HR0W 1VQOA 5IGEA 3I4NH 3CC7A 1EYCA 3T4AC 1STAA 1ZXTA 1KQSA 1S72A 1GOZA 1KRTA 1A3UA 3I90A 2Y0SE 2O5IC 2QKIC 3U58A 2F1MA 3U50C 1VQGA 2EYHA 1VQIA 3ICEA 2ZXPA 5C4XB 4GNXA 5D3IB 5KGUA 4IUPA 4JYAL 4A93G 4IQZA 4CJ1B 3MC0B 3RLNA 4EGVA 1ICWA 2IT1A 3S1NH 3PUWA 2R92H 3HEJA 5JVH3 4XQJA 1K0RA 5IWAQ 3Q22A 2WAQG 4OIJA 1O78A 2F0SA 5LMNW 2F0LA 3GTLB 2C9OA 1QZGA 1RD9D 3TS0A 2RSNA 3L9AX 5C4XH 1RDPD 2K4KA 1TS3A 1BBUA 5M5YB 1BBXC 3J80L 3KLWA 3DEPA 3NTHA 4X65Q 5IGFA 4FF2A 2NBFA 1TKWB 1VF7A 4KHZA 5JEAJ 5CC4A 4JCVE 5K36H 1TWGH 2ZXRA 3H0GG 5F2DA 4A3IG 4YHHL 2A8VA 1JWMD 1WTOA 2WACA 4RCNA 2NWGA 5IGDA 3NQIA 4OX9Q 4DXGA 5IODA 3M3YB 2F0NA 5CV9A 3PF5A 2KEEA 3DXJC 1BCPD 1LTID 4A3FH 2BDNA 2JA8H 1KL9A 1EFID 4IUNA 4HIDA 4WJ3M 1F9QA 3KBXA 2K7VA 2XTIA 3D4DA 1D2BA 5FJ8G 4LF9Q 4R4CA 1LT5D 1AE3A 3E0EA 4FF3A 1EWHA 5C4XG 3RZDH 4NDXA 2IX1A 1H9MA 1CT1D 1IZ6A 3AMUA 3AU7A 1TY2A 1RF2D 4NPSA 1Y1WG 3I4MG 1XXGA 2JA5G 1C4QA 4LAAA 1HRJA 1WI5A 2KBNA 5JPMC 4QUFA 3P7JA 5I9PA 1PRTB 2F0VA 4JI7Q 2MP1A 1HPCA 4IJHA 1WTWA 2GVAA 1FGUA 2XGTA 1L1OC 3J7A5 3K58A 1RJTA 4HN7A 1L0XB 1UE7A 4LF8Q 3VR6A 2A5HA 1RHPA 3B6YA 1O7ZA 1TWAH 2ZT9C 3CP0A 4FF1A 1UNSA 4HIKA 1VQPA 5C44B 2PCFB 1YHQA 1KDBA 1OXVA 4PMBA 3RN2A 4I7ZC 1K28A 2TMPA 3NSWA 1HR0L 1PZKD 2PZWA 3P20A 1YNJD 3CCJA 1JE5A 3I4LA 1TXYA 1STYA 1XWEA 2KEDA 4FF4A 5IT9L 4DUYQ 1ZYRD 4JI2Q 3CCQA 2OT2A 2L0CA 4A3EB 3HOXH 3GTOB 1A8VA 1S40A 3D4WA 5C4HA 5I6YA 1EY0A 1TS4A 5FLXE 3PO3H 4A3FB 1LLRD 2Q8RE 4K2LA 4O2DA 4OHJA 4L5QA 4DAPA 4A3JB 2HCCA 4POGA 2F0WA 2Q8TA 4CJ2C 4R8NA 2N78A 3ONAB 3KYHC 2PMZB 4LWCA 4YIJA 1XNRQ 1X3QA 3HZXA 2AUKA 3E9HA 2N8NA 5H1SE 3HOVG 4A93H 1QNUA 4TQUS 1WOCA 2VUMH 1SBBB 1HJPA 4A3DG 4Q5VA 1PHJA 3CU7A 1Q86C 4K5VA 3H91A 1TY0A 4ULLA 5M5YH 2E2HH 4LUZA 2PI2A 1FL0A 4AIMA 3WOFA 3S2HH 2ID0A 2AWOA 5AJ3Q 5IP7G 3A56A 2ZJRA 1X54A 2KJXA 5JJLA 1P8LA 1Y1VG 2K03A 4C3HH 4BBRH 1GVPA 4M8AA 1DCZA 4IPHA 2CVRA 2FMCA 1ENAA 2H4OA 4HJ7A 1GXDC 3V96A 3P1HA 1A6XA 2A6EC 5D3DA 2PPBC 4RHRA 2NVYH 2R7ZH 2JA9A 1L2FA 2L9HA 4MZ9A 2WAQB 5J3BA 3NTKA 5JEAH 3H3VH 4GKKQ 2OEOA 2Z8LA 2IX3A 3D0FA 4LF9L 5ELNA 2CW0D 2JA6G 2BOSA 1Z9FA 2YYZA 3KDFA 1PH8A 1S5ED 2RVLA 4J15A 3ERQA 2JA7G 4JI8L 2NTTA 1NSNS 2RCNA 5EBDA 4LF7L 4NXNQ 4DV3Q 3PV0A 3J81E 3KK7A 4DAYB 1BCPF 1GUSA 1Q82C 1SNQA 2UUCQ 1LTGD 4A3BB 1H9SB 4HJ9A 2NVTB 1V9PA 2D5DA 5LMUL 4OXPA 3Q23A 4BBSB 1U4MA 3CF5A 3M4PA 4KV6A 1SYEA 4LF8L 4JOIC 4EQNA 5CV6A 2FHTA 1KDAA 2F0KA 2HHHQ 2JA7H 4UAIA 4NB3A 1U0LA 1WFQA 1LM0A 2B2YC 4LF5Q 4A3CG 5C3XA 2E2JH 4P2CB 2NVYB 1XPOA 1STHA 2G5DA 4X65L 4DKAC 2JEAI 4KKSA 4OL7A 3NWSA 5C3EG 2A6HD 2VQFL 2M2LA 1XMOQ 2E2DC 3I4NG 1J8IA 4BBRB 1CZWA 1ET6A 1IW7C 5JOBA 3F2DA 2EY6A 2EPBA 3OMGA 5T1IA 4GOPC 1VQ7A 1WTHA 3U4ZA 1U9RA 1I3QH 3K8AA 2PW7A 2XRQD 3I7FA 3DLLA 4GLAC 2HQLA 4X3SA 4DAYA 3S14B 3S2HB 4LUOA 5ELEA 1HUMA 1Q12A 4UDUC 1JT8A 4WJ4A 5C6AA 4QIWE 2KHJA 2MGSA 1OTCA 1B7YB 3GTQB 4IFDG 1K8OA 2LXKA 4UY8C 4JI4L 3J7ZC 1RTNA 3T16A 4RH6A 2XN9C 5CYUA 2VUMB 1CHQD 3CCVA 1X3GA 2Y0SG 2L4NA 1JJ2A 2A19A 2IL8A 5ELDA 4OO1G 4IPDA 2YTYA 1HXYD 2K01A 5A2QL 2VQEL 1LTAD 4DR1L 1UWVA 3D6WA 1S5CD 4RGOS 1B3AA 3LWEA 3OTOQ 5IYBH 2B29A 2N88A 4HTHA 1SYGA 1M1KC 4XYOA 3TEHB 3GTKB 1G291 1Q1BA 1VS0A 5C0XI 3GTMB 3AEVA 1OXSC 1KRSA 3HOUB 4K2KA 3J80c 5LL6S 5C44H 2WKCA 4NXNL 3NPPA 1DOKA 2LS01 3EIVA 2D62A 5JEAG 3ITPA 4A3JG 2NUCA 3MTSA 4KJNA 3WOEA 2UXBL 1HUNA 1TS5A 2A74C 3OIPA 1B1ZA 1PH7A 5ELOA 3PSIA 3TP7A 4WORA 2F0FA 3HOYB 1O80A 2K50A 4DA2A 4ODGA 2PYKA 4R4IA 1IYJB 3CCLA 5FK9C 4C3HG 1Y69U 3OHXC 1E2VA 1EQRA 4JVZA 4PZ8A 3JAML 1PVOA 1STGA 2KUMA 2CWPA 1AEXA 1LTTD 3HOZB 3HOVH 3H3VC 1ESRA 3CAMA 3J81i 1LYLA 2E5LQ 3NUCA 1FJGL 1IL2A 4CHTB 2IW3A 1AW7A 4CDCC 2FINB 4L5SA 2I5HA 1QVGA 3VA5A 1KNEA 5CBEE 2R3ZA 2RDGA 1HTPA 4CGYB 1Q8IA 2PZTA 1PH4A 3PO3G 2C5CA 1WYDA 2KCTA 1X32A 3K80C 4TVAB 2UU9Q 2NVXH 2EQSA 4WFN3 2CQOA 3S1MH 5KYLA 1EYDA 1BXTA 4RA8A 1LUZA 1HZCA 3I2ZA 5EPLA 4ME5A 3T1HL 5EAYA 4ZRZA 1CKNA 5DM63 3MAQA 1IYUA 1F2LA 3OYYA 2NTSA 4KK7A 1WD1A 3A5ZB 4G7OC 1BVSA 5C0XG 3A7AB 4APVA 1MBYA 1V8QA 2IHFA 3DWAA 5KYIA 1JJGA 5GROA 3EFXD 4MTKA 2D2CC 4IJLA 4CDDC 4P74A 3IAYA 3E6ZX 4BS9A 3A8IE 2F0GA 1N34Q 2B2WA 3CRKC 2QA4A 4LUVA 1BNZA 1PFNA 4OELB 4J8QA 4ALPA 2NZ1D 3K0XA 4A3CH 4JV5L 2PI2E 2OCEA 2E2HB 1ZEQX 3T13A 2IPKD 5NUCA 4YCUA 3S1RB 1EY9A 4C3HB 1R4PB 2J0TD 1SYFA 3OTOL 1DXMA 4DR5Q 4DV1Q 1UAPA 3DM3A 2JEBI 4CBVA 2K1BA 3RNUA 2E74C 3I55A 2VY3A 1DD2A 2CH4W 2F52A 5K36G 1DZ1A 2J4XA 1LO5D 4I7AA 2Q2HA 3IRBA 1AP0A 1NNXA 3A74A 4NP5A 3GTPH 2PNHA 3N6RA 4QJFA 5E7NA 4N9TA 3OMCA 1Y1WH 3DM1A 2NN6G 1B2TA 2XIWA 4KD4A 4YWMA 3GTGB 1A15A 1IYVA 4NW2A 1RTOA 1JORA 4LW1A 2Z6BA 1EUJA 4CJ0B 1MSGA 1HHVA 1EYAA 4Y52H 4FYDA 4KD3A 4DFAA 1TQOA 3CW2C 4QCLA 5CBAE 3HP3A 2F0MA 5C3WA 4L5TA 1I4GA 5M3MG 4IURA 3ER0A 3TS2A 1YHAA 1NMGA 1EIYB 2UUAL 1QCBD 4JI6L 2VB3X 1HQRD 4HMIA 5CGKA 4ZKCB 4DR7L 4K8IA 1NMFA 4IUVA 1A0IA 4GLXA 2H5XA 3OWFA 4JBKA 5DM73 3S1QH 3VR4A 3VYRA 2I07B 4LF5L 5BN3A 3CQZH 1Z7TA 2EOTA 1BDOA 2GVBA 1GJXA 2MJ8A 3QB3A 5G3LD 2MNAA 1AFPA 4G4KA 3LX0A 5IGBA 4ILWA 2C35B 4DV4L 1SFOH 3A8KE 1K83H 1WD0A 2DY8A 4ID6A 4UPAA 2EJMA 5LMUQ 3FKIG 3TZUA 3GTKH 4DV0L 4H7BA 2WB1B 4FVMA 4PMCA 3J81c 3VR3A 1VQ5A 4H13C 4RAUC 1HNWQ 3H09A 2PMZE 1G6ZA 3S2DB 3SDZA 4QF4A 3STBC 1VQ6A 3HOUG 3HG9A 1UEBA 1Y8OB 2ZTCA 4QMGA 4EQOA 1SDFA 1MHWC 3U4VA 4C3IB 5M9OA 5M3FB 1HA6A 2X6LA 2FXQA 4JBWA 2FJ2A 3GTJH 1AE2A 4JOIA 2K5QA 1B50A 3SXHA 1JB7A 4P73A 3TREA 3E5SA 1PXUA 1I4XA 3JAME 4NXMQ 1C48A 3PIP3 1W6JA 1VQ9A 2AKWB 2HUGA 5E4XA 4BWGB 4YWLA 2OTLA 4K6LA 3A54A 3HOXG 3NWTA 1XMQL 2X6GA 2F0JA 4X64Q 5M3MB 2FMMA 3IKJA 1PMRA 4DV5L 2WFWA 3MA2B 5IY0A 1FYCA 4JYAQ 1ASYA 2KA7A 4HJ5A 2B39A 3L7ZC 1TWGB 2IJ0A 3GTJB 2SNSA 4B9XA 4IFDJ 5C44G 1XTDA 4LF6Q 1EIFA 3AFPA 1LTRD 5M5WH 3CPWA 4DV6L 5FO7B 4A3FG 3HOWG 5M3FG 5IYBG 1G6PA 1F2YA 2OQ0A 3BJUA 2UXBQ 1D5XC 2NVTH 5LL6X 1D5MC 4LF4Q 4JI0Q 3BZDB 4DV2Q 1MKHA 2B2UA 3D4RA 2Q8IB 4B3RQ 3UE1A 3PCOB 1K8AC 1EU3A 1SLJA 3H0GH 3I91A 4XQQA 4A3IH 1WTRA 1G91A 1ASZA 1R4QB 1XNQL 1SNPA 4X62Q 2L55A 5CR3A 3BZCA 2R92B 1S5DD 1LTBD 3QJYA 1O7LA 2XRSD 3NTIA 2N55A 2PZUA 5M5XH 2VZAA 1CFMA 4GOPA 1HNZL 1GD7A 2EYFA 2X69A 2K05A 3NK9A 4DV0Q 5EQ0A 1I94L 1UE5A 2OF1A 1G2SA 4C56C 1PV4A 3AB9A 1Y1VB 1N33Q 1KC8C 1A63A 3T1YL 2UXDL 1YJNA 4NKLA 3GV6A 3H0GB 3BS1A 4A3IB 3J7YW 1MSHA 4LFBL 2B2VA 5ELBA 2KHIA 1CKOA 1JOOA 1DOLA 1QOHA 2NZHA 1FVIA 1Y8NB 3GQBA 2VL6A 2Q2UA 3KLSA 3R93A 3ULJA 2BH8A 3RMHA 3F2CA 1OXXK 1YNXA 1X55A 2JE6I 5IE8A 3AQQA 2LSSA 2WP8J 1H9RA 4DNTB 3RD4A 1JWUD 5EKKA 1K8GA 5JAVA 3Q24A 5FLMG 3FPPA 1L1OA 1I6VC 1GKHA 4GZYC 3I56A 1GO3E 4B08A 1JC7A 1Q7YC 4K5WA 2R92G 1GHJA 1W6KA 2R7DA 1R9TH 3QR8A 3CXCA 4MIUA 4PNYA 4BXXG 4CDEC 2QEXA 1CK1A 1XTCD 3CRLC 3I4OA 5G3LF 5I9OA 4OX9L 2BA0A 1B9NA 4JC0A 4AQYL 4DV4Q 2O2LD 4A3GG 1BO0A 3MXNA 4DR2L 1V1QA 1K9MC 1IW7D 4GKJQ 2D9UA 2IX0A 4PZ6A 4CDFC 3PQIA 5C4JH 3U9SA 3Q8DA 1PH6A 4K5XA 5COYA 3SK8A 1TWFH 1X56A 4K8JA 1KTKA 5GAGC 4DR5L 4A3EH 1MIUA 4QIWB 1QB5D 1E1TA 2PQAA 1CSPA 3K7AB 1KLGD 5C3EB 1JOQA 3GD7A 2EY5A 3K5MA 4BBRG 4J1MA 3HRZC 4A3KB 4AYBG 1X3EA 3JC66 3CMAA 4GKJL 1MD2D 4C3IG 1SJED 1H95A 2A68D 5IWAL 5IP7H 4UP7A 3PIO3 4B3SQ 2EYLA 1PTOH 3PO2H 3FP9A 2G9DA 1EOTA 1K83B 1SYCA 1WCMB 4A3EG 2HDMA 1Q81C 5T1GA 2RF4A 2WAQE 1TWCH 1GUWA 2F0QA 2MUYA 2EIFA 2E2IB 1JWSD 1CM9A 1V1PA 1YNND 5GQOA 4FXGC 1FNUA 1SE3A 2O4XA 4S3SA 5AJ3L 3MEFA 3QWNA 4A3GB 3OSOA 4KLKA 2CQAA 2ALYB 1N36Q 1H9JA 4DR4Q 2B63B 1HCZA 2WKDA 4RGNA 2OTJA 3KF6B 4L5RC 4FDBA 1A2UA 2RDFA 2R7FA 4DV7L 3KJOA 1VQNA 4HJAA 4QY7A 4EQ5A 1QNKA 5DLQE 2ZTDA 1ILQA 5EKLA 1JJCB 1SN8A 2F0TA 4IPCA 1PRTC 4CKBA 1PTOB 3PO2B 3HS0C 1SNDA 2Z9HA 3ZJYC 3T1YQ 2UXDQ 4K0KL 3NHHA 1N34L 3QO2A 5I2XA 4GNXC 3TN2A 2RCFA 2LXJA 1V43A 4DK6C 1DM0B 1BQQT 4TSSA 3CCMA 3CCEA 2UXCQ 2Z1CA 4R9WA 4O42A 4R8IA 4LFCQ 2H1EA 4KHPL 4A3KG 1PTOC 4LMQD 1B53A 3MEHA 4JPBW 1IKMA 2K5VA 2BA1A 2BDOA 2Z6KA 1LT6D 3GTPB 1YJWA 1QUQB 3E9IA 5C4JB 5IP9G 3S1RH 4KN4C 4A3MG 2NN6I 4X66Q 2QF7A 2ZM6Q 3KF8B 1PH2A 1D5ZC 3M4OH 2Z0SA 2CH4A 2ICIA 1BOSA 3F8TA 4JG2A 1I6HH 5ELFA 2JA5H 3I4MH 2EVBA 2E2JB 4IPGA 4BBSG 3J81L 3M4QA 3VR5A 2JA7B 5IT9c 4O1NA 1PYWD 1D8LA 4IZ8A 5D14A 4HCSA 4L8JA 1UUPA 4MTNA 4DV5Q 2V1CC 2QDLA 1N32Q 4DXFA 5EKIA 3W2DA 2QDBA 2JA6H 3C1EA 1EWCA 3BVGA 2HD3A 3VYSA 2DUDA 3I72A 1QVCA 4DR4L 2Q2TA 2AWNA 3OIQA 3NENA 2F4VQ 2A1AA 3I4NB 4JI7L 2FFKB 3W1GA 2NVXB 1OO9B 2B2TC 1VCIA 2ZXOA 3SE0A 3TRZA 1CKMA 1HZAA 1EY7A 2QGQA 1X65A
chains in the Genus database with same CATH topology
3UDGA 2VY3A 5C4XH 2K4KA 2F52A 4DR2Q 1BBUA 5K36G 4GS3A 1P16A 1VQCA 3KLWA 1IBML 4NXML 4X65Q 3CC4A 4GN5A 2Q2HA 3IRBA 1PH9A 4PZ7A 3A74A 2HT1A 3KFUA 3GTPH 2PNHA 1BBWA 4KHZA 4QJFA 5E7NA 5JEAJ 4JCVE 4ME3A 4P75A 1YEZA 4JI6Q 5HY6A 1HZBA 1TWGH 1Y1WH 3H0GG 2NN6G 4A3IG 4YHHL 4YWMA 2A8VA 1MJEA 4QQBX 2CCZA 4LW1A 5JJKA 1EUJA 4QL5A 4Y52H 3HOZH 3CW2C 3J81j 4OX9Q 3UDXA 2N3SA 4DR7Q 4IOAA 1XPRA 4A3DH 4L5TA 3WWVA 3L2PA 3STBD 5M3MG 1IBMQ 3PF5A 4BY1H 3ER0A 2AHOB 4YWKA 3HOYG 4A3FH 3TS2A 1RIPA 1T9HA 2B63H 1E22A 1YHAA 3KOJA 1NMGA 1EIYB 2VQFQ 3HOUH 4BY7H 4B3RQ 3HKZE 3CCRA 2UUAL 2MFIA 2JA8H 4JI6L 3HOYH 1E7ZA 1KL9A 3GTMH 2E8GA 4AH6A 4HIDA 4WJ3M 4BY1G 2MQHA 5M3MH 4DR7L 2YV5A 1NMFA 2XTIA 1A0IA 4GLXA 2H5XA 4JBKA 5FJ8G 4LF9Q 3S1QH 3FKIH 4R4CA 4LF5L 2B3GA 5FLXc 3E0EA 1AE3A 3CQZH 2MO0A 2UUAQ 5C4XG 3CMEA 3RZDH 2GVBA 3RR5A 4YY3Q 2IX1A 4JV5Q 2K14A 3AFQA 3S24A 1IZ6A 2MNAA 4NPSA 2YTVA 4JBJA 2C35B 4OWXB 4DV4L 1Y1WG 5IYDG 1SFOH 4AQYQ 1K83H 4DV1L 3I4MG 1VQJA 3K81C 2JA5G 4UPAA 5LMUQ 2F3IA 3FKIG 1XJVA 2UU9Q 3GTKH 4DV0L 4GN4B 3J81c 1WI5A 1N8RC 2KBNA 2UUCL 1VQ5A 1HNWQ 4JI7Q 2PMZE 4IJHA 1EQQA 5JJIA 4GNXB 4A3MH 2GVAA 1FGUA 2XGTA 1L1OC 3KJPA 3J7A5 2ZTEA 3STBC 1VQ6A 3RLFA 5IP9H 1SRUA 3HOUG 1UEBA 2ZTCA 4YHHQ 3OW2A 1UE7A 3U4VA 4LF8Q 3CCSA 2GN5A 1KXLA 2FXQA 1G51A 2K75A 3S14H 1TWHH 3B6YA 4JBWA 3GTJH 1AE2A 3T1HQ 4JOIA 1TWAH 1C7YA 3CP0A 1JB7A 4P73A 2R6GA 3TREA 4YCWA 4HIKA 1VQPA 1VQLA 4NXMQ 1VQFA 3ERSX 3HOZG 1M90C 1YHQA 1OXVA 3GO5A 3RN2A 3JAMi 1VQ9A 3S16H 3UDFA 2UU9L 2AKWB 1HR0L 4JI0L 2VS1A 3M9BA 3CCJA 4GLVB 3PO2G 1JE5A 4YWLA 1TXYA 3NELA 2OTLA 4HJ8A 5GAEC 3UDIA 3HOXG 3J80i 1XMQL 4DUYQ 1DGSA 4JI2Q 3CCQA 4X64Q 4B3ML 4DV5L 1HNZQ 3HOXH 3PUYA 1A8VA 1S40A 3G48A 2WFWA 4B3RL 3A5UA 5IY0A 4IFDI 2F4VL 4JYAQ 4DV2L 1ASYA 1CUKA 4HJ5A 3PO3H 4O2DA 4L5QA 3HFZB 3L7ZC 3VDYA 1GM5A 4POGA 5FLMH 3HKSA 4IFDJ 2N78A 2R93H 1PYSB 1YBYA 3ULLA 4JI5Q 3KYHC 2I5LX 1XTDA 5C44G 4A3KH 1HNXL 4LWCA 1EIFA 4LF6Q 1YZ6A 1E24A 1IXRA 3AFPA 4DK3C 1VQMA 1XNRQ 1PH1A 1KD1C 2E5LL 5M5WH 2ZM6L 3CPWA 4DV6L 3E9HA 2N8NA 5H1SE 3HOVG 1WCMH 2RHSB 4A93H 4A3FG 4TQUS 4LF4L 3HOWG 3GTGH 4IOCA 5M3FG 4UP8A 5IYBG 1WOCA 2VUMH 1G6PA 4IO9A 4A76A 1CSQA 1HJPA 1B8AA 1SR3A 2OQ0A 3A0JA 1X9NA 2K52A 4A3DG 3BJUA 2UXBQ 1PHJA 1Q86C 3PUZA 4K0KQ 1EFWA 2NVTH 4A3BH 2ATWA 4R1JA 2BH2A 2L15A 1IBLL 2K5NA 4JI5L 4JI0Q 3KF6A 4DR3L 4LF4Q 2HIXA 5IYDH 1N36L 4DV2Q 4O0AA 1MKHA 4LFCL 5M5YH 2E2HH 4C3JH 4JI3Q 2PI2A 4LUZA 1HH2P 1FL0A 4AIMA 2KENA 3UE1A 2ID0A 3PIOA 3S2HH 2KCMA 3PCOB 1K8AC 3H0GH 1SLJA 4XTCS 4GOPB 2AWOA 1QUQA 5AJ3Q 2EXDA 4A3IH 1PH3A 4B3MQ 5IP7G 1ASZA 1VQDA 2ZJPA 2ZJRA 1X54A 1XMQQ 3W1BA 4X6AH 5JJLA 1P8LA 1JMCA 1Y1VG 1XNQL 4X62Q 3BZCA 4C3HH 1YITA 2VQEQ 4BBRH 1GVPA 4IPHA 4DNIA 1FJGQ 5M5XH 4HJ7A 2VZAA 4GOPA 2B63G 1J5EL 1YVCA 1HNZL 1QZHA 1GD7A 4LF6L 1L1OB 3BU2A 1WJJA 4DV0Q 2CKZB 1Q8KA 2NVYH 1UE5A 1I94L 2JA9A 2R7ZH 1L2FA 4MZ9A 1PV4A 2NVQH 1N33Q 2IHEA 5J3BA 1KC8C 1A63A 3T1YL 1A62A 2UXDL 1YJNA 2JJQA 3H3VH 4GKKQ 1HR0Q 3MXNB 2JQOA 4LFBL 4YY3L 1PYBA 1VQHA 1Q1EA 2KHIA 1CKOA 2MO1A 3CCUA 1HNWL 3D0FA 4LF9L 5ELNA 2YU9H 4R4OA 2JA6G 4JI2L 2NZHA 1FVIA 1Z9FA 2NZOA 4A3LH 1E3PA 1KHIA 2VL6A 2Q2UA 2YYZA 3KDFA 3ULJA 2BH8A 1PH8A 4J15A 4JI4Q 3F2CA 2IY5B 1OXXK 1YNXA 2JA7G 4JI8L 1X55A 2JE6I 5IE8A 1D7QA 3AQQA 3NBHB 2RCNA 4LF7L 5LMNL 4NXNQ 2LSSA 1C0AA 4DV3Q 3PV0A 1XMOL 2WP8J 4DAYB 1C9OA 1Q82C 1Y1VH 4RG1A 1K8GA 1SE8A 3D31A 2UUCQ 4C2MH 5FLMG 1IBKQ 1L1OA 3SGIA 4HJ9A 1GKHA 1V9PA 2D0PA 2N49A 4OONA 4XIGS 5LMUL 3I56A 1GO3E 4OXPA 3CF5A 1Q7YC 1U5KA 3M4PA 2R92G 2HIVA 4DR1Q 3CC2A 1VQEA 4B3TQ 3M85A 4A3JH 1VQKA 2R7DA 4LF8L 3RZOH 4JOIC 1R9TH 3CXCA 3EN2A 1NY4A 4BXXG 2HHHQ 2JA7H 1CKNB 4MNOA 4LFAQ 4PMWA 3PGZA 2QEXA 4B3TL 4NB3A 1U0LA 1WFQA 1LM0A 4LF5Q 4A3CG 2WB1E 3EBEA 3I4OA 4A3LG 2E2JH 1XPOA 2I0QA 4OX9L 2BA0A 2VUMG 4X65L 4DKAC 4JC0A 4AQYL 4OWWB 2JEAI 1W3SA 5C3EG 4DV4Q 3G71A 4A3GG 4BXXH 4GKJQ 1X3FA 1V1QA 4DR2L 1YJ9A 4RMFA 1K9MC 4LFAL 2VQFL 1XMOQ 3I4NG 2IX0A 4PZ6A 5C4JH 1PH6A 3Q8DA 1PFSA 1QVFA 3F2DA 1TWFH 4A3GH 1X56A 1MJCA 4GOPC 1VQ7A 5GAGC 4DR5L 4A3EH 3U4ZA 1MIUA 1I3QH 2OQKA 3K8AA 3I7FA 1E1TA 1VQAA 2PQAA 3DLLA 4GLAC 1CSPA 4AYBE 1UE6A 2HQLA 1N9WA 4LUOA 4A4IA 1Q12A 3GD7A 4C3IH 1JT8A 4WJ4A 2VW9A 4BA2I 4LFBQ 4QIWE 4BBRG 2KHJA 1OTCA 4GKKL 1B7YB 2CWAA 4IFDG 4LF7Q 1O7IA 3PUXA 4AYBG 1X3EA 3JC66 3CMAA 4GKJL 1PA6A 4JI8Q 2LXKA 3G4SA 3FHWA 4UY8C 4JI4L 1OXTA 3J7ZC 1Q46A 1N33L 1H95A 5IWAL 4GN3B 5IP7H 3L0OA 3PIPA 4UP7A 5HGQA 3M7NA 3CCVA 1X3GA 1Y14B 4B3SQ 2Y0SG 3PO2H 3FP9A 1JJ2A 2A19A 4A3EG 5IYCG 1W2BA 1KAWA 1Q81C 2E2IH 3PUVA 4OO1G 2RF4A 4IPDA 2ZJQA 2HHHL 2WAQE 4R4TA 2YTYA 3GTQH 4HIMA 4DV3L 1YIJA 3GTOH 1TWCH 5LMNQ 2VQEL 2EIFA 4DR1L 4P71A 1UWVA 4DR6Q 3K7AH 5C3EH 1YHBA 1K3RA 4DUZQ 5GQOA 3OTOQ 5IYBH 2B29A 4Y7NH 2I5MX 2OWOA 2JA8G 1IBKL 5AJ3L 3MEFA 1M1KC 1WCMG 3TEHB 1G291 4POFA 4BY7G 1Q1BA 1VS0A 1VQBA 4UP9A 5C0XI 1OXSC 1KRSA 4KLKA 4JI3L 3F2BA 1VQ8A 3AEVA 2ALYB 1N36Q 2JK8A 4DR4Q 3J80c 5C44H 1HZ9A 4NXNL 1L0WA 3EIVA 2OTJA 2D62A 3KF6B 5BR8L 5JEAG 1EWIA 5IYCH 4X62L 4A75A 4A3JG 4L5RC 4FDBA 4QGUA 2UXBL 3CPFA 2R7FA 3M3YH 3UE0A 4DV7L 1I94Q 4BA1I 3JAMc 3F1ZA 3KJOA 1VQNA 2R7ZG 1PH7A 5ELOA 2UUBL 4HJAA 4QY7A 4EQ5A 3H3VI 5DLQE 4JI1L 2ZTDA 3PSIA 3TQYA 1JJCB 3CD6A 1SN8A 2K50A 3RLOA 2UXCL 4IPCA 4DR3Q 4R4IA 1IYJB 5FJ8H 3ZJYC 3LGJA 1Z47A 3T1YQ 3CCLA 2CFMA 4K0KL 3ULPA 4OWTB 1N34L 3S17H 2VNUD 2UXDQ 3TS0A 3NEMA 1EQRA 3K7UC 2WB1G 4PZ8A 5C0XJ 4GNXC 5M3FH 1PVOA 1V43A 2LXJA 2CWPA 4DK6C 1K73C 3HOWH 1N32L 1J6QA 4YCVA 3HOVH 1J5EQ 3GDEA 3CCMA 3CAMA 3CCEA 2UXCQ 3J81i 3S2DH 1LYLA 2E5LQ 1NBWA 4LFCQ 4EX5A 1LTLA 1PH5A 1FJGL 4X66L 2K5HA 1IL2A 3BZKA 4KHPL 4A3KG 2ASBA 1HNXQ 1IBLQ 1S3OA 3PF4A 4X64L 2R93G 4L5SA 4LNQA 2I5HA 1YI2A 1QVGA 1XNQQ 3GTLH 4A3BG 2K5VA 2BA1A 2Z6KA 3H15A 1E1OA 4H02A 2DGYA 1YJWA 1QUQB 3E9IA 1PH4A 1X6OA 4R4QA 3PO3G 1NTGA 1I50H 1WYDA 2KCTA 1RL2A 1UE1A 4KI0A 5IP9G 3S1RH 3K80C 5GAHC 4A3MG 4KHPQ 4TVAB 2Z6KC 2NN6I 1EOVA 4X66Q 2EQSA 3KDFB 3RN5A 2NVXH 2CQOA 2ZM6Q 3HKZG 3KF8B 3W5OA 4DV6Q 1PH2A 3S15H 3S1MH 3M4OH 2Z0SA 3F8TA 1B70B 1NJIC 4JG2A 2UUBQ 1I6HH 1LUZA 1HZCA 3I2ZA 1SMXA 3T1HL 2JA5H 4DV7Q 5EAYA 1CKNA 4DUZL 3I4MH 1I5FA 2AMCB 4P72A 5GADC 4IPGA 4DR6L 4BBSG 3OYYA 4DAMA 1XPUA 3M4QA 3A5ZB 1BVSA 2RHQB 5C0XG 5IT9c 2ES2A 4APVA 4JBMA 2IHFA 4DPGA 1D8LA 2Q2IA 2PQAB 1HR0W 1JJGA 5GROA 1SROA 1VQOA 4HIOA 3I4NH 1NE3A 3CC7A 1XNRL 4BBSH 4MTNA 3G6EA 2V1CC 4DV5Q 1KQSA 1S72A 4B3SL 4IJLA 1KRTA 1N32Q 4P74A 2D0OA 2Y0SE 4DUYL 3U58A 1VQ4A 3U50C 1N34Q 1VQGA 2QA4A 4LUVA 3RNUA 2JA6H 1VQIA 4ALPA 3ICEA 1BKBA 2DUDA 3K0XA 4GNXA 4A3CH 4JV5L 1QVCA 4DR4L 2PI2E 2YTXA 1KIXA 2AWNA 2Q2TA 2OCEA 3NENA 2A1AA 2F4VQ 4JYAL 4A93G 1OXUA 3RLNA 4JI7L 3W1GA 4YCUA 1VCIA 1AH9A 2IT1A 4JI1Q 3S1NH 3PUWA 2R92H 3TRZA 3AYHB 3OTOL 1CKMA 1K0RA 4DR5Q 1HZAA 5IWAQ 1EYGA 4OO1I 2WAQG 4DV1Q 3DM3A 2JEBI 5LMNW 5BR8Q 1QZGA 4PG3A 2QGQA 1X65A 3I55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDG A;  2VY3 A;  5C4X H;  2K4K A;  2F52 A;  4DR2 Q;  1BBU A;  5K36 G;  4GS3 A;  1P16 A;  1VQC A;  3KLW A;  1IBM L;  4NXM L;  4X65 Q;  3CC4 A;  4GN5 A;  2Q2H A;  3IRB A;  1PH9 A;  4PZ7 A;  3A74 A;  2HT1 A;  3KFU A;  3GTP H;  2PNH A;  1BBW A;  4KHZ A;  4QJF A;  5E7N A;  5JEA J;  4JCV E;  4ME3 A;  4P75 A;  1YEZ A;  4JI6 Q;  5HY6 A;  1HZB A;  1TWG H;  1Y1W H;  3H0G G;  2NN6 G;  4A3I G;  4YHH L;  4YWM A;  2A8V A;  1MJE A;  4QQB X;  2CCZ A;  4LW1 A;  5JJK A;  1EUJ A;  4QL5 A;  4Y52 H;  3HOZ H;  3CW2 C;  3J81 j;  4OX9 Q;  3UDX A;  2N3S A;  4DR7 Q;  4IOA A;  1XPR A;  4A3D H;  4L5T A;  3WWV A;  3L2P A;  3STB D;  5M3M G;  1IBM Q;  3PF5 A;  4BY1 H;  3ER0 A;  2AHO B;  4YWK A;  3HOY G;  4A3F H;  3TS2 A;  1RIP A;  1T9H A;  2B63 H;  1E22 A;  1YHA A;  3KOJ A;  1NMG A;  1EIY B;  2VQF Q;  3HOU H;  4BY7 H;  4B3R Q;  3HKZ E;  3CCR A;  2UUA L;  2MFI A;  2JA8 H;  4JI6 L;  3HOY H;  1E7Z A;  1KL9 A;  3GTM H;  2E8G A;  4AH6 A;  4HID A;  4WJ3 M;  4BY1 G;  2MQH A;  5M3M H;  4DR7 L;  2YV5 A;  1NMF A;  2XTI A;  1A0I A;  4GLX A;  2H5X A;  4JBK A;  5FJ8 G;  4LF9 Q;  3S1Q H;  3FKI H;  4R4C A;  4LF5 L;  2B3G A;  5FLX c;  3E0E A;  1AE3 A;  3CQZ H;  2MO0 A;  2UUA Q;  5C4X G;  3CME A;  3RZD H;  2GVB A;  3RR5 A;  4YY3 Q;  2IX1 A;  4JV5 Q;  2K14 A;  3AFQ A;  3S24 A;  1IZ6 A;  2MNA A;  4NPS A;  2YTV A;  4JBJ A;  2C35 B;  4OWX B;  4DV4 L;  1Y1W G;  5IYD G;  1SFO H;  4AQY Q;  1K83 H;  4DV1 L;  3I4M G;  1VQJ A;  3K81 C;  2JA5 G;  4UPA A;  5LMU Q;  2F3I A;  3FKI G;  1XJV A;  2UU9 Q;  3GTK H;  4DV0 L;  4GN4 B;  3J81 c;  1WI5 A;  1N8R C;  2KBN A;  2UUC L;  1VQ5 A;  1HNW Q;  4JI7 Q;  2PMZ E;  4IJH A;  1EQQ A;  5JJI A;  4GNX B;  4A3M H;  2GVA A;  1FGU A;  2XGT A;  1L1O C;  3KJP A;  3J7A 5;  2ZTE A;  3STB C;  1VQ6 A;  3RLF A;  5IP9 H;  1SRU A;  3HOU G;  1UEB A;  2ZTC A;  4YHH Q;  3OW2 A;  1UE7 A;  3U4V A;  4LF8 Q;  3CCS A;  2GN5 A;  1KXL A;  2FXQ A;  1G51 A;  2K75 A;  3S14 H;  1TWH H;  3B6Y A;  4JBW A;  3GTJ H;  1AE2 A;  3T1H Q;  4JOI A;  1TWA H;  1C7Y A;  3CP0 A;  1JB7 A;  4P73 A;  2R6G A;  3TRE A;  4YCW A;  4HIK A;  1VQP A;  1VQL A;  4NXM Q;  1VQF A;  3ERS X;  3HOZ G;  1M90 C;  1YHQ A;  1OXV A;  3GO5 A;  3RN2 A;  3JAM i;  1VQ9 A;  3S16 H;  3UDF A;  2UU9 L;  2AKW B;  1HR0 L;  4JI0 L;  2VS1 A;  3M9B A;  3CCJ A;  4GLV B;  3PO2 G;  1JE5 A;  4YWL A;  1TXY A;  3NEL A;  2OTL A;  4HJ8 A;  5GAE C;  3UDI A;  3HOX G;  3J80 i;  1XMQ L;  4DUY Q;  1DGS A;  4JI2 Q;  3CCQ A;  4X64 Q;  4B3M L;  4DV5 L;  1HNZ Q;  3HOX H;  3PUY A;  1A8V A;  1S40 A;  3G48 A;  2WFW A;  4B3R L;  3A5U A;  5IY0 A;  4IFD I;  2F4V L;  4JYA Q;  4DV2 L;  1ASY A;  1CUK A;  4HJ5 A;  3PO3 H;  4O2D A;  4L5Q A;  3HFZ B;  3L7Z C;  3VDY A;  1GM5 A;  4POG A;  5FLM H;  3HKS A;  4IFD J;  2N78 A;  2R93 H;  1PYS B;  1YBY A;  3ULL A;  4JI5 Q;  3KYH C;  2I5L X;  1XTD A;  5C44 G;  4A3K H;  1HNX L;  4LWC A;  1EIF A;  4LF6 Q;  1YZ6 A;  1E24 A;  1IXR A;  3AFP A;  4DK3 C;  1VQM A;  1XNR Q;  1PH1 A;  1KD1 C;  2E5L L;  5M5W H;  2ZM6 L;  3CPW A;  4DV6 L;  3E9H A;  2N8N A;  5H1S E;  3HOV G;  1WCM H;  2RHS B;  4A93 H;  4A3F G;  4TQU S;  4LF4 L;  3HOW G;  3GTG H;  4IOC A;  5M3F G;  4UP8 A;  5IYB G;  1WOC A;  2VUM H;  1G6P A;  4IO9 A;  4A76 A;  1CSQ A;  1HJP A;  1B8A A;  1SR3 A;  2OQ0 A;  3A0J A;  1X9N A;  2K52 A;  4A3D G;  3BJU A;  2UXB Q;  1PHJ A;  1Q86 C;  3PUZ A;  4K0K Q;  1EFW A;  2NVT H;  4A3B H;  2ATW A;  4R1J A;  2BH2 A;  2L15 A;  1IBL L;  2K5N A;  4JI5 L;  4JI0 Q;  3KF6 A;  4DR3 L;  4LF4 Q;  2HIX A;  5IYD H;  1N36 L;  4DV2 Q;  4O0A A;  1MKH A;  4LFC L;  5M5Y H;  2E2H H;  4C3J H;  4JI3 Q;  2PI2 A;  4LUZ A;  1HH2 P;  1FL0 A;  4AIM A;  2KEN A;  3UE1 A;  2ID0 A;  3PIO A;  3S2H H;  2KCM A;  3PCO B;  1K8A C;  3H0G H;  1SLJ A;  4XTC S;  4GOP B;  2AWO A;  1QUQ A;  5AJ3 Q;  2EXD A;  4A3I H;  1PH3 A;  4B3M Q;  5IP7 G;  1ASZ A;  1VQD A;  2ZJP A;  2ZJR A;  1X54 A;  1XMQ Q;  3W1B A;  4X6A H;  5JJL A;  1P8L A;  1JMC A;  1Y1V G;  1XNQ L;  4X62 Q;  3BZC A;  4C3H H;  1YIT A;  2VQE Q;  4BBR H;  1GVP A;  4IPH A;  4DNI A;  1FJG Q;  5M5X H;  4HJ7 A;  2VZA A;  4GOP A;  2B63 G;  1J5E L;  1YVC A;  1HNZ L;  1QZH A;  1GD7 A;  4LF6 L;  1L1O B;  3BU2 A;  1WJJ A;  4DV0 Q;  2CKZ B;  1Q8K A;  2NVY H;  1UE5 A;  1I94 L;  2JA9 A;  2R7Z H;  1L2F A;  4MZ9 A;  1PV4 A;  2NVQ H;  1N33 Q;  2IHE A;  5J3B A;  1KC8 C;  1A63 A;  3T1Y L;  1A62 A;  2UXD L;  1YJN A;  2JJQ A;  3H3V H;  4GKK Q;  1HR0 Q;  3MXN B;  2JQO A;  4LFB L;  4YY3 L;  1PYB A;  1VQH A;  1Q1E A;  2KHI A;  1CKO A;  2MO1 A;  3CCU A;  1HNW L;  3D0F A;  4LF9 L;  5ELN A;  2YU9 H;  4R4O A;  2JA6 G;  4JI2 L;  2NZH A;  1FVI A;  1Z9F A;  2NZO A;  4A3L H;  1E3P A;  1KHI A;  2VL6 A;  2Q2U A;  2YYZ A;  3KDF A;  3ULJ A;  2BH8 A;  1PH8 A;  4J15 A;  4JI4 Q;  3F2C A;  2IY5 B;  1OXX K;  1YNX A;  2JA7 G;  4JI8 L;  1X55 A;  2JE6 I;  5IE8 A;  1D7Q A;  3AQQ A;  3NBH B;  2RCN A;  4LF7 L;  5LMN L;  4NXN Q;  2LSS A;  1C0A A;  4DV3 Q;  3PV0 A;  1XMO L;  2WP8 J;  4DAY B;  1C9O A;  1Q82 C;  1Y1V H;  4RG1 A;  1K8G A;  1SE8 A;  3D31 A;  2UUC Q;  4C2M H;  5FLM G;  1IBK Q;  1L1O A;  3SGI A;  4HJ9 A;  1GKH A;  1V9P A;  2D0P A;  2N49 A;  4OON A;  4XIG S;  5LMU L;  3I56 A;  1GO3 E;  4OXP A;  3CF5 A;  1Q7Y C;  1U5K A;  3M4P A;  2R92 G;  2HIV A;  4DR1 Q;  3CC2 A;  1VQE A;  4B3T Q;  3M85 A;  4A3J H;  1VQK A;  2R7D A;  4LF8 L;  3RZO H;  4JOI C;  1R9T H;  3CXC A;  3EN2 A;  1NY4 A;  4BXX G;  2HHH Q;  2JA7 H;  1CKN B;  4MNO A;  4LFA Q;  4PMW A;  3PGZ A;  2QEX A;  4B3T L;  4NB3 A;  1U0L A;  1WFQ A;  1LM0 A;  4LF5 Q;  4A3C G;  2WB1 E;  3EBE A;  3I4O A;  4A3L G;  2E2J H;  1XPO A;  2I0Q A;  4OX9 L;  2BA0 A;  2VUM G;  4X65 L;  4DKA C;  4JC0 A;  4AQY L;  4OWW B;  2JEA I;  1W3S A;  5C3E G;  4DV4 Q;  3G71 A;  4A3G G;  4BXX H;  4GKJ Q;  1X3F A;  1V1Q A;  4DR2 L;  1YJ9 A;  4RMF A;  1K9M C;  4LFA L;  2VQF L;  1XMO Q;  3I4N G;  2IX0 A;  4PZ6 A;  5C4J H;  1PH6 A;  3Q8D A;  1PFS A;  1QVF A;  3F2D A;  1TWF H;  4A3G H;  1X56 A;  1MJC A;  4GOP C;  1VQ7 A;  5GAG C;  4DR5 L;  4A3E H;  3U4Z A;  1MIU A;  1I3Q H;  2OQK A;  3K8A A;  3I7F A;  1E1T A;  1VQA A;  2PQA A;  3DLL A;  4GLA C;  1CSP A;  4AYB E;  1UE6 A;  2HQL A;  1N9W A;  4LUO A;  4A4I A;  1Q12 A;  3GD7 A;  4C3I H;  1JT8 A;  4WJ4 A;  2VW9 A;  4BA2 I;  4LFB Q;  4QIW E;  4BBR G;  2KHJ A;  1OTC A;  4GKK L;  1B7Y B;  2CWA A;  4IFD G;  4LF7 Q;  1O7I A;  3PUX A;  4AYB G;  1X3E A;  3JC6 6;  3CMA A;  4GKJ L;  1PA6 A;  4JI8 Q;  2LXK A;  3G4S A;  3FHW A;  4UY8 C;  4JI4 L;  1OXT A;  3J7Z C;  1Q46 A;  1N33 L;  1H95 A;  5IWA L;  4GN3 B;  5IP7 H;  3L0O A;  3PIP A;  4UP7 A;  5HGQ A;  3M7N A;  3CCV A;  1X3G A;  1Y14 B;  4B3S Q;  2Y0S G;  3PO2 H;  3FP9 A;  1JJ2 A;  2A19 A;  4A3E G;  5IYC G;  1W2B A;  1KAW A;  1Q81 C;  2E2I H;  3PUV A;  4OO1 G;  2RF4 A;  4IPD A;  2ZJQ A;  2HHH L;  2WAQ E;  4R4T A;  2YTY A;  3GTQ H;  4HIM A;  4DV3 L;  1YIJ A;  3GTO H;  1TWC H;  5LMN Q;  2VQE L;  2EIF A;  4DR1 L;  4P71 A;  1UWV A;  4DR6 Q;  3K7A H;  5C3E H;  1YHB A;  1K3R A;  4DUZ Q;  5GQO A;  3OTO Q;  5IYB H;  2B29 A;  4Y7N H;  2I5M X;  2OWO A;  2JA8 G;  1IBK L;  5AJ3 L;  3MEF A;  1M1K C;  1WCM G;  3TEH B;  1G29 1;  4POF A;  4BY7 G;  1Q1B A;  1VS0 A;  1VQB A;  4UP9 A;  5C0X I;  1OXS C;  1KRS A;  4KLK A;  4JI3 L;  3F2B A;  1VQ8 A;  3AEV A;  2ALY B;  1N36 Q;  2JK8 A;  4DR4 Q;  3J80 c;  5C44 H;  1HZ9 A;  4NXN L;  1L0W A;  3EIV A;  2OTJ A;  2D62 A;  3KF6 B;  5BR8 L;  5JEA G;  1EWI A;  5IYC H;  4X62 L;  4A75 A;  4A3J G;  4L5R C;  4FDB A;  4QGU A;  2UXB L;  3CPF A;  2R7F A;  3M3Y H;  3UE0 A;  4DV7 L;  1I94 Q;  4BA1 I;  3JAM c;  3F1Z A;  3KJO A;  1VQN A;  2R7Z G;  1PH7 A;  5ELO A;  2UUB L;  4HJA A;  4QY7 A;  4EQ5 A;  3H3V I;  5DLQ E;  4JI1 L;  2ZTD A;  3PSI A;  3TQY A;  1JJC B;  3CD6 A;  1SN8 A;  2K50 A;  3RLO A;  2UXC L;  4IPC A;  4DR3 Q;  4R4I A;  1IYJ B;  5FJ8 H;  3ZJY C;  3LGJ A;  1Z47 A;  3T1Y Q;  3CCL A;  2CFM A;  4K0K L;  3ULP A;  4OWT B;  1N34 L;  3S17 H;  2VNU D;  2UXD Q;  3TS0 A;  3NEM A;  1EQR A;  3K7U C;  2WB1 G;  4PZ8 A;  5C0X J;  4GNX C;  5M3F H;  1PVO A;  1V43 A;  2LXJ A;  2CWP A;  4DK6 C;  1K73 C;  3HOW H;  1N32 L;  1J6Q A;  4YCV A;  3HOV H;  1J5E Q;  3GDE A;  3CCM A;  3CAM A;  3CCE A;  2UXC Q;  3J81 i;  3S2D H;  1LYL A;  2E5L Q;  1NBW A;  4LFC Q;  4EX5 A;  1LTL A;  1PH5 A;  1FJG L;  4X66 L;  2K5H A;  1IL2 A;  3BZK A;  4KHP L;  4A3K G;  2ASB A;  1HNX Q;  1IBL Q;  1S3O A;  3PF4 A;  4X64 L;  2R93 G;  4L5S A;  4LNQ A;  2I5H A;  1YI2 A;  1QVG A;  1XNQ Q;  3GTL H;  4A3B G;  2K5V A;  2BA1 A;  2Z6K A;  3H15 A;  1E1O A;  4H02 A;  2DGY A;  1YJW A;  1QUQ B;  3E9I A;  1PH4 A;  1X6O A;  4R4Q A;  3PO3 G;  1NTG A;  1I50 H;  1WYD A;  2KCT A;  1RL2 A;  1UE1 A;  4KI0 A;  5IP9 G;  3S1R H;  3K80 C;  5GAH C;  4A3M G;  4KHP Q;  4TVA B;  2Z6K C;  2NN6 I;  1EOV A;  4X66 Q;  2EQS A;  3KDF B;  3RN5 A;  2NVX H;  2CQO A;  2ZM6 Q;  3HKZ G;  3KF8 B;  3W5O A;  4DV6 Q;  1PH2 A;  3S15 H;  3S1M H;  3M4O H;  2Z0S A;  3F8T A;  1B70 B;  1NJI C;  4JG2 A;  2UUB Q;  1I6H H;  1LUZ A;  1HZC A;  3I2Z A;  1SMX A;  3T1H L;  2JA5 H;  4DV7 Q;  5EAY A;  1CKN A;  4DUZ L;  3I4M H;  1I5F A;  2AMC B;  4P72 A;  5GAD C;  4IPG A;  4DR6 L;  4BBS G;  3OYY A;  4DAM A;  1XPU A;  3M4Q A;  3A5Z B;  1BVS A;  2RHQ B;  5C0X G;  5IT9 c;  2ES2 A;  4APV A;  4JBM A;  2IHF A;  4DPG A;  1D8L A;  2Q2I A;  2PQA B;  1HR0 W;  1JJG A;  5GRO A;  1SRO A;  1VQO A;  4HIO A;  3I4N H;  1NE3 A;  3CC7 A;  1XNR L;  4BBS H;  4MTN A;  3G6E A;  2V1C C;  4DV5 Q;  1KQS A;  1S72 A;  4B3S L;  4IJL A;  1KRT A;  1N32 Q;  4P74 A;  2D0O A;  2Y0S E;  4DUY L;  3U58 A;  1VQ4 A;  3U50 C;  1N34 Q;  1VQG A;  2QA4 A;  4LUV A;  3RNU A;  2JA6 H;  1VQI A;  4ALP A;  3ICE A;  1BKB A;  2DUD A;  3K0X A;  4GNX A;  4A3C H;  4JV5 L;  1QVC A;  4DR4 L;  2PI2 E;  2YTX A;  1KIX A;  2AWN A;  2Q2T A;  2OCE A;  3NEN A;  2A1A A;  2F4V Q;  4JYA L;  4A93 G;  1OXU A;  3RLN A;  4JI7 L;  3W1G A;  4YCU A;  1VCI A;  1AH9 A;  2IT1 A;  4JI1 Q;  3S1N H;  3PUW A;  2R92 H;  3TRZ A;  3AYH B;  3OTO L;  1CKM A;  1K0R A;  4DR5 Q;  1HZA A;  5IWA Q;  1EYG A;  4OO1 I;  2WAQ G;  4DV1 Q;  3DM3 A;  2JEB I;  5LMN W;  5BR8 Q;  1QZG A;  4PG3 A;  2QGQ A;  1X65 A;  3I55 A; 
#chains in the Genus database with same CATH topology
 1TS2 A;  4RGT A;  3NP8 A;  4C3J B;  3J80 E;  3M7G A;  1D6E C;  2EZV A;  1P16 A;  1IHZ A;  1LV9 A;  2EYM A;  4NXM L;  3CC4 A;  1PH9 A;  1QJO A;  2O5J C;  5DEH A;  4PZ7 A;  4P75 A;  2JSO A;  1SSO A;  4KY5 A;  5HY6 A;  1D1K A;  3URY A;  2WIN B;  1S5F D;  2QEJ C;  2E76 C;  2CCZ A;  4QQB X;  5JJK A;  4OGQ C;  3HOZ H;  1ZKO A;  1QWY A;  1F9S A;  5E1F A;  4RGM A;  3UDX A;  4DR7 Q;  1XPR A;  4A3D H;  3WWV A;  1ROD A;  5CMD A;  2AHO B;  1RIP A;  1T9H A;  2B63 H;  3KOJ A;  4BY7 H;  1JCK B;  3HOU H;  3HKZ E;  2F0O A;  2A6H C;  2MFI A;  3HOY H;  4X3T A;  3DWQ A;  2E8G A;  4AH6 A;  5IIF A;  4BY1 G;  2JN4 A;  3QIA A;  1V1O A;  2EXZ A;  1HFG A;  2B3G A;  1A2T A;  2UUA Q;  3CME A;  3E0J A;  3RR5 A;  2EE1 A;  5J1Z A;  3D8G A;  3AFQ A;  2B8F A;  2LFN A;  2RDH A;  2XNA C;  2YTV A;  4JBJ A;  2LKV A;  2IWH A;  3VYT A;  5IYD G;  1VQJ A;  3K81 C;  1XJV A;  4KHV A;  1QG7 A;  3FEW X;  4GN4 B;  1N8R C;  3UI2 A;  1ICF B;  2F4I A;  4GNX B;  4KMU C;  2XSC A;  1EY6 A;  4TRD A;  1SRU A;  1SYB A;  4KY7 A;  4FNF A;  1KXL A;  3NQT A;  3S14 H;  3FKI B;  1TWH H;  2L12 A;  1I3Q B;  4ZK9 B;  1VQF A;  3HOZ G;  1M90 C;  3GO5 A;  3JAM i;  3S16 H;  3C3L A;  5KIX A;  1STE A;  5BN5 A;  4GLV B;  3ND9 A;  3PO2 G;  2B2T A;  1SMY D;  1V1P B;  1K3B C;  4HJ8 A;  1EIG A;  1DGS A;  2JYO A;  1HNZ Q;  1GUO A;  3PUY A;  4PV1 C;  2K33 A;  2L5T A;  4C1N K;  1EZ6 A;  2QCP X;  4B3R L;  3A5U A;  3TP6 A;  4IFD I;  4DV2 L;  1IKL A;  1WTV A;  1WVL A;  4RCO A;  4N8X 1;  5L37 A;  4NMZ A;  3DWP A;  4DK1 A;  1GM5 A;  1XYI A;  5KRU A;  1L0Y B;  3HKS A;  2R93 H;  3ULL A;  1STN A;  1C8C A;  4A3K H;  4KKT A;  1Y8P B;  2F0I A;  2GA4 B;  1YNN C;  1YZ6 A;  1E24 A;  1IXR A;  4DK3 C;  1VQM A;  4A3M B;  1TII D;  3CQZ B;  2M00 A;  3Q6S A;  1WCM H;  2RHS B;  3V05 A;  5J39 A;  4KY6 A;  3K5N A;  4LF4 L;  3S1Q B;  4IOC A;  4UP8 A;  3RZO B;  1CTM A;  1B8A A;  1SR3 A;  3NE5 B;  4DN4 M;  5J22 A;  4K0K Q;  2F0H A;  1BUV T;  4A3B H;  1NR2 A;  1NAP A;  4KKU A;  2L15 A;  2K5N A;  3BVM A;  4DR3 L;  3KF8 A;  1N36 L;  4Z9C B;  4EQP A;  1D1I A;  1SE4 A;  1C0A A;  2KEN A;  3R2I A;  2KCM A;  1PH3 A;  4B3M Q;  2EXD A;  2AUJ D;  4RFB A;  1XMQ Q;  3W1B A;  4X6A H;  3TBI B;  1JMC A;  2R7Z B;  4V19 0;  4QB4 A;  1EU4 A;  1YIT A;  4H44 C;  1EEF D;  2KCC A;  3KUP A;  2R61 A;  1FJG Q;  2A69 D;  4F88 A;  1T5X D;  4RKB A;  1J5E L;  4KTA A;  1YVC A;  1QZH A;  2WII B;  3SEB A;  3R8B A;  1UEA B;  2NVQ H;  4DK0 A;  5FKA C;  2IHE A;  4IN3 A;  2J7Z A;  3GV3 A;  1GUG A;  2JJQ A;  3MXG A;  3MXN B;  4LJZ C;  1F9P A;  1PYB A;  1Q1E A;  3SK6 A;  1HNW L;  1PLF A;  4JI2 L;  4B9W A;  1Q90 A;  2NZO A;  4A3L H;  2DY7 A;  3BDL A;  3S1N B;  5EJW A;  1D7Q A;  1RKN A;  1I6H B;  5LMN L;  3T56 B;  3BYY B;  3EJI A;  4HED A;  3M4O B;  1C9O A;  1I4R A;  3HGB A;  3M4Y A;  1VDZ A;  4RG1 A;  1SE8 A;  1BR9 A;  3D31 A;  3IL8 A;  4CKE A;  1T5E A;  3OWE B;  5EBC A;  3T53 B;  1EQT A;  4XIG S;  2EYJ A;  1B4O A;  2A6E D;  1U5K A;  1F2M A;  4DR1 Q;  4B3T Q;  1VQE A;  4XT3 B;  2OXP A;  1VQK A;  1NR4 A;  2EY2 A;  3C1F A;  1FGB D;  3EN2 A;  3MZ5 A;  1CKN B;  4LFA Q;  1PFB A;  3PGZ A;  4M1U B;  3EBE A;  4A3L G;  2MHV A;  4LK1 C;  3VR2 A;  1H9K A;  2EYO A;  1SNM A;  3ZYY X;  5D65 A;  4OWW B;  1W3S A;  3G71 A;  1YJ9 A;  2AQ1 B;  4RMF A;  5EPK A;  3FRP B;  4UHV A;  1LT4 D;  5JJZ A;  1VMC A;  1CI3 M;  1EL0 A;  1PFS A;  1I4Q A;  3MHB A;  4L63 B;  4A3G H;  3BG3 A;  3HOX B;  5A2Q E;  1G2T A;  4L6T B;  5TSS A;  1JE4 A;  1JQY D;  1VQA A;  4ZYS A;  5BN4 A;  3EVQ A;  4AYB E;  1UE6 A;  1N9W A;  2RKS A;  4A4I A;  1SXT A;  3K5L A;  4OEM B;  5M5W B;  4C3I H;  2VW9 A;  1GUT A;  4JW0 A;  4LFB Q;  3HOV B;  2CWA A;  1AZQ A;  1O7I A;  1I50 B;  1PA6 A;  1JIC A;  3EQL C;  3PMF A;  1ML0 D;  3FHW A;  5IGC A;  3G4S A;  1Z6H A;  2K32 A;  1Q46 A;  1WTQ A;  1LAB A;  1N33 L;  1ET9 A;  3S17 B;  3PIP A;  5K5P A;  1TWA B;  5EGT A;  2ICE C;  3A55 A;  1SE2 A;  4ZUJ A;  5IOC A;  1KAW A;  2E2I H;  2HHH L;  1GHK A;  4OIK A;  4HIM A;  4DV3 L;  1F77 A;  5LMN Q;  3DMU A;  1U4P A;  3HOW B;  2R93 B;  5IGG A;  3OOC A;  4ZQ3 A;  3NXW A;  4DUZ Q;  1X3P A;  1E2Z A;  2F0P A;  3TP5 A;  4K6D A;  4Y7N H;  4U68 A;  2I5M X;  1QE6 A;  1WCM G;  5AFW A;  1TU2 B;  3I70 A;  4BY7 G;  1TWF B;  1YNJ C;  3F2B A;  4UP9 A;  3FDT A;  4JI3 L;  1VQ8 A;  1EY5 A;  4I65 A;  1HZ9 A;  3CKI B;  4ZLT F;  1ENF A;  4MHE A;  3G6J B;  1EWI A;  1I4H A;  5IYC H;  4X62 L;  2EYP A;  2PQE A;  4Q0F A;  2QW7 A;  3K6O A;  2UUB L;  5C4Z A;  1HTL D;  2BE5 C;  4V0B A;  3CD6 A;  5COR A;  2NN6 H;  3RLO A;  2UXC L;  5I2Y A;  1Y1W B;  5FJ8 H;  3LGJ A;  3KLS X;  2CFM A;  3ULP A;  1F2Z A;  1TWH B;  3NEM A;  3K7U C;  5C0X J;  5M3F H;  1K73 C;  1KAA A;  1N32 L;  1JOK A;  1II3 A;  1NUC A;  1PTO D;  3GDE A;  1J5E Q;  2VXW A;  4K14 A;  1NBW A;  3SK5 A;  1LTL A;  1PH5 A;  5CV5 A;  2K5H A;  3BZK A;  3E3X A;  2ASB A;  1HNX Q;  5CV8 A;  3PF4 A;  2R93 G;  4X64 L;  1LAC A;  1CQV A;  4LNQ A;  4A3B G;  4HR7 B;  1SYD A;  5E3F A;  2AQ3 B;  1E1O A;  2DGY A;  1SAP A;  1S4Z A;  4KI0 A;  1NTG A;  1I50 H;  1RL2 A;  5CV7 A;  1H9S A;  5GAH C;  3OW7 A;  1EOV A;  3KDF B;  3RN5 A;  2PNR C;  3D3R A;  3W5O A;  3S15 H;  4WRD A;  4H0L C;  1JB3 A;  2KVM A;  2UUB Q;  1SMX A;  2DJF C;  2AMC B;  4P72 A;  3H6M A;  4DR6 L;  4DAM A;  2F0E A;  2RHQ B;  3N52 A;  4BY7 B;  4JBM A;  2PQA B;  1E0B A;  1SRO A;  4RKL A;  4HIO A;  2F03 A;  1NE3 A;  1XNR L;  4BBS H;  3NBI A;  3G6E A;  1CA5 A;  4B3S L;  2D0O A;  1F9R A;  3X3M A;  4DUY L;  1VQ4 A;  2NVQ B;  2EDG A;  4JK1 C;  1BKB A;  2RBM A;  2YTX A;  1KIX A;  1KNA A;  5LHY 1;  1OXU A;  4QUC A;  3DHQ A;  4HMJ A;  1AH9 A;  1HA5 A;  4JI1 Q;  1WTX A;  2P5Z X;  3S9W A;  1FNV A;  3AYH B;  1DJR D;  1EYG A;  2Y0S B;  1JR0 D;  5BR8 Q;  4PG3 A;  3GP7 A;  3UDG A;  2XVS A;  1EEI D;  4DR2 Q;  3MXU A;  4GS3 A;  2B2Y A;  1VQC A;  5I4D A;  1IBM L;  1SEB D;  4GN5 A;  3TME A;  5FLX L;  2HT1 A;  3KFU A;  1BBW A;  2YU9 B;  3C2P A;  4ME3 A;  4E6I A;  1YEZ A;  4JI6 Q;  1HZB A;  1MJE A;  1MGS A;  1MI2 A;  1KLU D;  4C3J G;  1VMP A;  3SHL A;  5IT9 E;  4AYB B;  4QL5 A;  3I4M B;  2KCN A;  3EA6 A;  3J81 j;  3DEO A;  1TR5 A;  2N3S A;  4IOA A;  2RQX A;  3L2P A;  3STB D;  1IBM Q;  5EPJ A;  4BY1 H;  4YWK A;  1AZP A;  3HOY G;  1E22 A;  3OPO A;  2VQF Q;  4ZUI A;  3S16 B;  3CCR A;  5I6W A;  1PZI D;  1E7Z A;  3GTM H;  2MPM A;  2MQH A;  5M3M H;  2YV5 A;  3BYT B;  2JA5 B;  3K5O A;  1SNO A;  4C1N I;  3FKI H;  1B3Q A;  5DAU A;  5FLX c;  4XT1 B;  1J9O A;  4CKC A;  2MO0 A;  2EY1 A;  3J7A V;  3S1M B;  2XWB B;  4YY3 Q;  2SEB D;  5KND A;  4HAE A;  2K14 A;  4PQX A;  4JV5 Q;  3S24 A;  3I73 A;  4F8M A;  1FR3 A;  4OWX B;  1ENC A;  4AQY Q;  4DV1 L;  3K57 A;  1QIL A;  2HQE A;  2F3I A;  2EJF C;  4Y7N B;  3PO3 B;  2V4D A;  2UUC L;  3FPU B;  4ZCK A;  5FOB B;  4U67 3;  1A3V A;  1EQQ A;  5FO8 B;  5JJI A;  4A3M H;  1E2W A;  3KJP A;  2ZTE A;  4F87 A;  3RLF A;  4TKO B;  5IP9 H;  1LTS D;  5CV4 A;  4YHH Q;  3OW2 A;  5ELC A;  2LMC B;  3CCS A;  3T51 B;  2GN5 A;  2K75 A;  1G51 A;  2EJG C;  5KNB A;  1C7Y A;  3T1H Q;  1SJH D;  3TP8 A;  2R6G A;  3C46 A;  4YCW A;  1VQL A;  1EY8 A;  3ERS X;  3KBG A;  1PFM A;  3U9O A;  2HDL A;  1SMY C;  2L11 A;  4G57 A;  3UDF A;  2UU9 L;  4XDX A;  4JI0 L;  2VS1 A;  3M9B A;  4IUT A;  5KEE A;  1FD7 D;  1DOM A;  4ABN A;  3NEL A;  5GAE C;  3UDI A;  3J80 i;  3QG1 A;  1PRT F;  4A3D B;  3LWU A;  3K59 A;  3O13 A;  1ILP A;  1TWC B;  4B3M L;  4IFD H;  1M8A A;  3G48 A;  2Z4I A;  5JPN C;  1ZYR C;  2F4V L;  1CUK A;  3HFZ B;  3VDY A;  4G7Z C;  2XWJ B;  5FLM H;  1SNC A;  1PYS B;  1YBY A;  2JXM B;  2DJG C;  2I5L X;  3DUZ A;  4C2M B;  1HNX L;  4OO1 I;  2VB2 X;  1RCV D;  1PH1 A;  1KD1 C;  2E5L L;  2ZM6 L;  4MN3 A;  3K0Y A;  1K0S A;  3Q0A A;  3GTG H;  2F0D A;  3FVQ A;  2I46 A;  4IO9 A;  3BVZ A;  3LNN A;  1CSQ A;  4RHS A;  4DU9 A;  4A76 A;  5HGT A;  3IFD A;  3A0J A;  1X9N A;  2K52 A;  2SOB A;  1M4V A;  3I3C A;  3PUZ A;  1EY4 A;  1EFW A;  4N8F A;  4R1J A;  2ATW A;  2BH2 A;  1IBL L;  2RSO A;  4JI5 L;  5IYD H;  3KF6 A;  2HIX A;  4O0A A;  4LFC L;  4JI3 Q;  4C3J H;  4FXD A;  1HH2 P;  1ONL A;  3PIO A;  4JI5 Q;  4GOP B;  4XTC S;  1QUQ A;  1ESF A;  1VQD A;  5C0X H;  2ZJP A;  1BF4 A;  4DNR B;  4J6H A;  1PDQ A;  2A73 B;  2A69 C;  2VQE Q;  2AQ2 B;  4DNI A;  3R3O A;  3L3O C;  2B63 G;  4IUU A;  4DGZ A;  4LF6 L;  1L1O B;  3BU2 A;  1WJJ A;  2JA6 B;  2CKZ B;  5DNF A;  1Q8K A;  2F3V A;  4HSP A;  5KNC A;  3SVM A;  1CZG A;  4F7X A;  1A62 A;  1HR0 Q;  2DNC A;  2JQO A;  1FNW A;  4YY3 L;  1KDC A;  2TSS A;  2NYZ D;  2Z4H A;  1CQF A;  2G9H D;  1VQH A;  2MO1 A;  3CCU A;  3IFT A;  2L1B A;  1STB A;  2YU9 H;  4R4O A;  3CHB D;  2F3W A;  1BCP C;  1E3P A;  1KHI A;  2B2U C;  1LT3 D;  4JI4 Q;  2IY5 B;  2CW0 C;  1HQM C;  3TSS A;  4FO2 A;  1GUN A;  3NBH B;  4A93 B;  1XMO L;  3QOL A;  3TDQ A;  2PW5 A;  4ZAI A;  4OO1 H;  4IUQ A;  1Y1V H;  2KEC A;  4G7H C;  4C2M H;  1IBK Q;  3SGI A;  1CA6 A;  4DAV A;  2D0P A;  2N49 A;  4OON A;  2M9V A;  2B8G A;  2HIV A;  3CC2 A;  3M85 A;  4A3J H;  3RZO H;  3W3A A;  5A35 A;  1NY4 A;  4MNO A;  4PMW A;  4B3T L;  1AN8 A;  1EZ8 A;  2WB1 E;  3X3N A;  2BCO A;  4FXK C;  2WV6 D;  2I0Q A;  2NB0 A;  2VUM G;  4KJO A;  1B44 D;  2K04 A;  5M5X B;  4BXX H;  1X3F A;  4LFA L;  3D6C A;  1G8Z D;  2SDF A;  1U4R A;  3J7A F;  2SNM A;  1EIH A;  1QVF A;  3MWY W;  4FP5 D;  1MJC A;  2E75 C;  3TZD A;  2DN8 A;  1Q3L A;  2OQK A;  4RWS C;  1PTO F;  2KHS A;  3ND8 A;  3SR1 A;  3S15 B;  4ZKB B;  1TT2 A;  4BA2 I;  1A3T A;  4N9P A;  4GKK L;  2DNE A;  4LF7 Q;  1K8M A;  2LY7 A;  3MVV A;  3PUX A;  1S5B D;  5HUR A;  4JI8 Q;  5ISR A;  1VF5 C;  1OXT A;  2CHB D;  4GN3 B;  2F0U A;  3L0O A;  4HSV A;  2B2V C;  5HGQ A;  2HCI A;  3VYU A;  3M7N A;  1Y14 B;  1PRT D;  5IYC G;  1W2B A;  3F2U A;  3PUV A;  2ZJQ A;  3HKZ B;  4R4T A;  3GTQ H;  1YIJ A;  3GTO H;  5JVG 3;  4XXE A;  2K5D A;  2KOL A;  1O7Y A;  4P71 A;  4DR6 Q;  3K7A H;  5C3E H;  1YHB A;  2K5W A;  1K3R A;  5E4W C;  4HCE A;  1DON A;  2OWO A;  2JA8 G;  1IBK L;  4POF A;  3I8Z A;  1VQB A;  3MFY A;  3BDC A;  4WJW A;  2JK8 A;  3WDN A;  1L0W A;  3RUZ A;  5BR8 L;  4A75 A;  2BE5 D;  4QGU A;  1EQV A;  3CPF A;  2ENB A;  1U4L A;  3A7L A;  3M3Y H;  3UE0 A;  2QIL A;  1TVX A;  5C5M A;  4BA1 I;  3JAM c;  3F1Z A;  1I94 Q;  2R7Z G;  2K28 A;  1HFN A;  4JI1 L;  2A68 C;  3TQY A;  2PO4 A;  4XYQ A;  4DR3 Q;  3VA7 A;  1XX8 A;  1Z47 A;  2VNU D;  1CHP D;  4OWT B;  4BY1 B;  3S17 H;  3MFG A;  2WB1 G;  3MXP A;  3HOW H;  4KN7 C;  1J6Q A;  4X3U A;  4YCV A;  4DF7 A;  3S2D H;  3P75 A;  1WTP A;  1IL8 A;  4EX5 A;  2KQ3 A;  2RA4 A;  4X66 L;  1R9T B;  1KAB A;  3SK4 A;  1S3O A;  1IBL Q;  3FMC A;  1DYQ A;  3A8J E;  1YI2 A;  1XNQ Q;  3GTL H;  3H94 A;  4XQN A;  3H15 A;  4H02 A;  1SFO B;  2JA8 B;  1X6O A;  4R4Q A;  3ERO A;  1UE1 A;  2B2W C;  2K6A A;  4KHP Q;  1I4P A;  2Z6K C;  1B9M A;  4EVO A;  3RZD B;  3H3V I;  4DV6 Q;  3HKZ G;  1PZJ D;  3G7L A;  3BDO A;  1B70 B;  1NJI C;  2JP1 A;  4DV7 Q;  3NBH A;  4IAL A;  3V2T A;  4DUZ L;  1I5F A;  5FO9 B;  5GAD C;  1BCP B;  1NCV A;  3KLR A;  1XPU A;  5C5L A;  2ES2 A;  3QOJ A;  4X3K A;  4DPG A;  2Q2I A;  3R2T A;  1HR0 W;  1VQO A;  5IGE A;  3I4N H;  3CC7 A;  1EYC A;  3T4A C;  1STA A;  1ZXT A;  1KQS A;  1S72 A;  1GOZ A;  1KRT A;  1A3U A;  3I90 A;  2Y0S E;  2O5I C;  2QKI C;  3U58 A;  2F1M A;  3U50 C;  1VQG A;  2EYH A;  1VQI A;  3ICE A;  2ZXP A;  5C4X B;  4GNX A;  5D3I B;  5KGU A;  4IUP A;  4JYA L;  4A93 G;  4IQZ A;  4CJ1 B;  3MC0 B;  3RLN A;  4EGV A;  1ICW A;  2IT1 A;  3S1N H;  3PUW A;  2R92 H;  3HEJ A;  5JVH 3;  4XQJ A;  1K0R A;  5IWA Q;  3Q22 A;  2WAQ G;  4OIJ A;  1O78 A;  2F0S A;  5LMN W;  2F0L A;  3GTL B;  2C9O A;  1QZG A;  1RD9 D;  3TS0 A;  2RSN A;  3L9A X;  5C4X H;  1RDP D;  2K4K A;  1TS3 A;  1BBU A;  5M5Y B;  1BBX C;  3J80 L;  3KLW A;  3DEP A;  3NTH A;  4X65 Q;  5IGF A;  4FF2 A;  2NBF A;  1TKW B;  1VF7 A;  4KHZ A;  5JEA J;  5CC4 A;  4JCV E;  5K36 H;  1TWG H;  2ZXR A;  3H0G G;  5F2D A;  4A3I G;  4YHH L;  2A8V A;  1JWM D;  1WTO A;  2WAC A;  4RCN A;  2NWG A;  5IGD A;  3NQI A;  4OX9 Q;  4DXG A;  5IOD A;  3M3Y B;  2F0N A;  5CV9 A;  3PF5 A;  2KEE A;  3DXJ C;  1BCP D;  1LTI D;  4A3F H;  2BDN A;  2JA8 H;  1KL9 A;  1EFI D;  4IUN A;  4HID A;  4WJ3 M;  1F9Q A;  3KBX A;  2K7V A;  2XTI A;  3D4D A;  1D2B A;  5FJ8 G;  4LF9 Q;  4R4C A;  1LT5 D;  1AE3 A;  3E0E A;  4FF3 A;  1EWH A;  5C4X G;  3RZD H;  4NDX A;  2IX1 A;  1H9M A;  1CT1 D;  1IZ6 A;  3AMU A;  3AU7 A;  1TY2 A;  1RF2 D;  4NPS A;  1Y1W G;  3I4M G;  1XXG A;  2JA5 G;  1C4Q A;  4LAA A;  1HRJ A;  1WI5 A;  2KBN A;  5JPM C;  4QUF A;  3P7J A;  5I9P A;  1PRT B;  2F0V A;  4JI7 Q;  2MP1 A;  1HPC A;  4IJH A;  1WTW A;  2GVA A;  1FGU A;  2XGT A;  1L1O C;  3J7A 5;  3K58 A;  1RJT A;  4HN7 A;  1L0X B;  1UE7 A;  4LF8 Q;  3VR6 A;  2A5H A;  1RHP A;  3B6Y A;  1O7Z A;  1TWA H;  2ZT9 C;  3CP0 A;  4FF1 A;  1UNS A;  4HIK A;  1VQP A;  5C44 B;  2PCF B;  1YHQ A;  1KDB A;  1OXV A;  4PMB A;  3RN2 A;  4I7Z C;  1K28 A;  2TMP A;  3NSW A;  1HR0 L;  1PZK D;  2PZW A;  3P20 A;  1YNJ D;  3CCJ A;  1JE5 A;  3I4L A;  1TXY A;  1STY A;  1XWE A;  2KED A;  4FF4 A;  5IT9 L;  4DUY Q;  1ZYR D;  4JI2 Q;  3CCQ A;  2OT2 A;  2L0C A;  4A3E B;  3HOX H;  3GTO B;  1A8V A;  1S40 A;  3D4W A;  5C4H A;  5I6Y A;  1EY0 A;  1TS4 A;  5FLX E;  3PO3 H;  4A3F B;  1LLR D;  2Q8R E;  4K2L A;  4O2D A;  4OHJ A;  4L5Q A;  4DAP A;  4A3J B;  2HCC A;  4POG A;  2F0W A;  2Q8T A;  4CJ2 C;  4R8N A;  2N78 A;  3ONA B;  3KYH C;  2PMZ B;  4LWC A;  4YIJ A;  1XNR Q;  1X3Q A;  3HZX A;  2AUK A;  3E9H A;  2N8N A;  5H1S E;  3HOV G;  4A93 H;  1QNU A;  4TQU S;  1WOC A;  2VUM H;  1SBB B;  1HJP A;  4A3D G;  4Q5V A;  1PHJ A;  3CU7 A;  1Q86 C;  4K5V A;  3H91 A;  1TY0 A;  4ULL A;  5M5Y H;  2E2H H;  4LUZ A;  2PI2 A;  1FL0 A;  4AIM A;  3WOF A;  3S2H H;  2ID0 A;  2AWO A;  5AJ3 Q;  5IP7 G;  3A56 A;  2ZJR A;  1X54 A;  2KJX A;  5JJL A;  1P8L A;  1Y1V G;  2K03 A;  4C3H H;  4BBR H;  1GVP A;  4M8A A;  1DCZ A;  4IPH A;  2CVR A;  2FMC A;  1ENA A;  2H4O A;  4HJ7 A;  1GXD C;  3V96 A;  3P1H A;  1A6X A;  2A6E C;  5D3D A;  2PPB C;  4RHR A;  2NVY H;  2R7Z H;  2JA9 A;  1L2F A;  2L9H A;  4MZ9 A;  2WAQ B;  5J3B A;  3NTK A;  5JEA H;  3H3V H;  4GKK Q;  2OEO A;  2Z8L A;  2IX3 A;  3D0F A;  4LF9 L;  5ELN A;  2CW0 D;  2JA6 G;  2BOS A;  1Z9F A;  2YYZ A;  3KDF A;  1PH8 A;  1S5E D;  2RVL A;  4J15 A;  3ERQ A;  2JA7 G;  4JI8 L;  2NTT A;  1NSN S;  2RCN A;  5EBD A;  4LF7 L;  4NXN Q;  4DV3 Q;  3PV0 A;  3J81 E;  3KK7 A;  4DAY B;  1BCP F;  1GUS A;  1Q82 C;  1SNQ A;  2UUC Q;  1LTG D;  4A3B B;  1H9S B;  4HJ9 A;  2NVT B;  1V9P A;  2D5D A;  5LMU L;  4OXP A;  3Q23 A;  4BBS B;  1U4M A;  3CF5 A;  3M4P A;  4KV6 A;  1SYE A;  4LF8 L;  4JOI C;  4EQN A;  5CV6 A;  2FHT A;  1KDA A;  2F0K A;  2HHH Q;  2JA7 H;  4UAI A;  4NB3 A;  1U0L A;  1WFQ A;  1LM0 A;  2B2Y C;  4LF5 Q;  4A3C G;  5C3X A;  2E2J H;  4P2C B;  2NVY B;  1XPO A;  1STH A;  2G5D A;  4X65 L;  4DKA C;  2JEA I;  4KKS A;  4OL7 A;  3NWS A;  5C3E G;  2A6H D;  2VQF L;  2M2L A;  1XMO Q;  2E2D C;  3I4N G;  1J8I A;  4BBR B;  1CZW A;  1ET6 A;  1IW7 C;  5JOB A;  3F2D A;  2EY6 A;  2EPB A;  3OMG A;  5T1I A;  4GOP C;  1VQ7 A;  1WTH A;  3U4Z A;  1U9R A;  1I3Q H;  3K8A A;  2PW7 A;  2XRQ D;  3I7F A;  3DLL A;  4GLA C;  2HQL A;  4X3S A;  4DAY A;  3S14 B;  3S2H B;  4LUO A;  5ELE A;  1HUM A;  1Q12 A;  4UDU C;  1JT8 A;  4WJ4 A;  5C6A A;  4QIW E;  2KHJ A;  2MGS A;  1OTC A;  1B7Y B;  3GTQ B;  4IFD G;  1K8O A;  2LXK A;  4UY8 C;  4JI4 L;  3J7Z C;  1RTN A;  3T16 A;  4RH6 A;  2XN9 C;  5CYU A;  2VUM B;  1CHQ D;  3CCV A;  1X3G A;  2Y0S G;  2L4N A;  1JJ2 A;  2A19 A;  2IL8 A;  5ELD A;  4OO1 G;  4IPD A;  2YTY A;  1HXY D;  2K01 A;  5A2Q L;  2VQE L;  1LTA D;  4DR1 L;  1UWV A;  3D6W A;  1S5C D;  4RGO S;  1B3A A;  3LWE A;  3OTO Q;  5IYB H;  2B29 A;  2N88 A;  4HTH A;  1SYG A;  1M1K C;  4XYO A;  3TEH B;  3GTK B;  1G29 1;  1Q1B A;  1VS0 A;  5C0X I;  3GTM B;  3AEV A;  1OXS C;  1KRS A;  3HOU B;  4K2K A;  3J80 c;  5LL6 S;  5C44 H;  2WKC A;  4NXN L;  3NPP A;  1DOK A;  2LS0 1;  3EIV A;  2D62 A;  5JEA G;  3ITP A;  4A3J G;  2NUC A;  3MTS A;  4KJN A;  3WOE A;  2UXB L;  1HUN A;  1TS5 A;  2A74 C;  3OIP A;  1B1Z A;  1PH7 A;  5ELO A;  3PSI A;  3TP7 A;  4WOR A;  2F0F A;  3HOY B;  1O80 A;  2K50 A;  4DA2 A;  4ODG A;  2PYK A;  4R4I A;  1IYJ B;  3CCL A;  5FK9 C;  4C3H G;  1Y69 U;  3OHX C;  1E2V A;  1EQR A;  4JVZ A;  4PZ8 A;  3JAM L;  1PVO A;  1STG A;  2KUM A;  2CWP A;  1AEX A;  1LTT D;  3HOZ B;  3HOV H;  3H3V C;  1ESR A;  3CAM A;  3J81 i;  1LYL A;  2E5L Q;  3NUC A;  1FJG L;  1IL2 A;  4CHT B;  2IW3 A;  1AW7 A;  4CDC C;  2FIN B;  4L5S A;  2I5H A;  1QVG A;  3VA5 A;  1KNE A;  5CBE E;  2R3Z A;  2RDG A;  1HTP A;  4CGY B;  1Q8I A;  2PZT A;  1PH4 A;  3PO3 G;  2C5C A;  1WYD A;  2KCT A;  1X32 A;  3K80 C;  4TVA B;  2UU9 Q;  2NVX H;  2EQS A;  4WFN 3;  2CQO A;  3S1M H;  5KYL A;  1EYD A;  1BXT A;  4RA8 A;  1LUZ A;  1HZC A;  3I2Z A;  5EPL A;  4ME5 A;  3T1H L;  5EAY A;  4ZRZ A;  1CKN A;  5DM6 3;  3MAQ A;  1IYU A;  1F2L A;  3OYY A;  2NTS A;  4KK7 A;  1WD1 A;  3A5Z B;  4G7O C;  1BVS A;  5C0X G;  3A7A B;  4APV A;  1MBY A;  1V8Q A;  2IHF A;  3DWA A;  5KYI A;  1JJG A;  5GRO A;  3EFX D;  4MTK A;  2D2C C;  4IJL A;  4CDD C;  4P74 A;  3IAY A;  3E6Z X;  4BS9 A;  3A8I E;  2F0G A;  1N34 Q;  2B2W A;  3CRK C;  2QA4 A;  4LUV A;  1BNZ A;  1PFN A;  4OEL B;  4J8Q A;  4ALP A;  2NZ1 D;  3K0X A;  4A3C H;  4JV5 L;  2PI2 E;  2OCE A;  2E2H B;  1ZEQ X;  3T13 A;  2IPK D;  5NUC A;  4YCU A;  3S1R B;  1EY9 A;  4C3H B;  1R4P B;  2J0T D;  1SYF A;  3OTO L;  1DXM A;  4DR5 Q;  4DV1 Q;  1UAP A;  3DM3 A;  2JEB I;  4CBV A;  2K1B A;  3RNU A;  2E74 C;  3I55 A;  2VY3 A;  1DD2 A;  2CH4 W;  2F52 A;  5K36 G;  1DZ1 A;  2J4X A;  1LO5 D;  4I7A A;  2Q2H A;  3IRB A;  1AP0 A;  1NNX A;  3A74 A;  4NP5 A;  3GTP H;  2PNH A;  3N6R A;  4QJF A;  5E7N A;  4N9T A;  3OMC A;  1Y1W H;  3DM1 A;  2NN6 G;  1B2T A;  2XIW A;  4KD4 A;  4YWM A;  3GTG B;  1A15 A;  1IYV A;  4NW2 A;  1RTO A;  1JOR A;  4LW1 A;  2Z6B A;  1EUJ A;  4CJ0 B;  1MSG A;  1HHV A;  1EYA A;  4Y52 H;  4FYD A;  4KD3 A;  4DFA A;  1TQO A;  3CW2 C;  4QCL A;  5CBA E;  3HP3 A;  2F0M A;  5C3W A;  4L5T A;  1I4G A;  5M3M G;  4IUR A;  3ER0 A;  3TS2 A;  1YHA A;  1NMG A;  1EIY B;  2UUA L;  1QCB D;  4JI6 L;  2VB3 X;  1HQR D;  4HMI A;  5CGK A;  4ZKC B;  4DR7 L;  4K8I A;  1NMF A;  4IUV A;  1A0I A;  4GLX A;  2H5X A;  3OWF A;  4JBK A;  5DM7 3;  3S1Q H;  3VR4 A;  3VYR A;  2I07 B;  4LF5 L;  5BN3 A;  3CQZ H;  1Z7T A;  2EOT A;  1BDO A;  2GVB A;  1GJX A;  2MJ8 A;  3QB3 A;  5G3L D;  2MNA A;  1AFP A;  4G4K A;  3LX0 A;  5IGB A;  4ILW A;  2C35 B;  4DV4 L;  1SFO H;  3A8K E;  1K83 H;  1WD0 A;  2DY8 A;  4ID6 A;  4UPA A;  2EJM A;  5LMU Q;  3FKI G;  3TZU A;  3GTK H;  4DV0 L;  4H7B A;  2WB1 B;  4FVM A;  4PMC A;  3J81 c;  3VR3 A;  1VQ5 A;  4H13 C;  4RAU C;  1HNW Q;  3H09 A;  2PMZ E;  1G6Z A;  3S2D B;  3SDZ A;  4QF4 A;  3STB C;  1VQ6 A;  3HOU G;  3HG9 A;  1UEB A;  1Y8O B;  2ZTC A;  4QMG A;  4EQO A;  1SDF A;  1MHW C;  3U4V A;  4C3I B;  5M9O A;  5M3F B;  1HA6 A;  2X6L A;  2FXQ A;  4JBW A;  2FJ2 A;  3GTJ H;  1AE2 A;  4JOI A;  2K5Q A;  1B50 A;  3SXH A;  1JB7 A;  4P73 A;  3TRE A;  3E5S A;  1PXU A;  1I4X A;  3JAM E;  4NXM Q;  1C48 A;  3PIP 3;  1W6J A;  1VQ9 A;  2AKW B;  2HUG A;  5E4X A;  4BWG B;  4YWL A;  2OTL A;  4K6L A;  3A54 A;  3HOX G;  3NWT A;  1XMQ L;  2X6G A;  2F0J A;  4X64 Q;  5M3M B;  2FMM A;  3IKJ A;  1PMR A;  4DV5 L;  2WFW A;  3MA2 B;  5IY0 A;  1FYC A;  4JYA Q;  1ASY A;  2KA7 A;  4HJ5 A;  2B39 A;  3L7Z C;  1TWG B;  2IJ0 A;  3GTJ B;  2SNS A;  4B9X A;  4IFD J;  5C44 G;  1XTD A;  4LF6 Q;  1EIF A;  3AFP A;  1LTR D;  5M5W H;  3CPW A;  4DV6 L;  5FO7 B;  4A3F G;  3HOW G;  5M3F G;  5IYB G;  1G6P A;  1F2Y A;  2OQ0 A;  3BJU A;  2UXB Q;  1D5X C;  2NVT H;  5LL6 X;  1D5M C;  4LF4 Q;  4JI0 Q;  3BZD B;  4DV2 Q;  1MKH A;  2B2U A;  3D4R A;  2Q8I B;  4B3R Q;  3UE1 A;  3PCO B;  1K8A C;  1EU3 A;  1SLJ A;  3H0G H;  3I91 A;  4XQQ A;  4A3I H;  1WTR A;  1G91 A;  1ASZ A;  1R4Q B;  1XNQ L;  1SNP A;  4X62 Q;  2L55 A;  5CR3 A;  3BZC A;  2R92 B;  1S5D D;  1LTB D;  3QJY A;  1O7L A;  2XRS D;  3NTI A;  2N55 A;  2PZU A;  5M5X H;  2VZA A;  1CFM A;  4GOP A;  1HNZ L;  1GD7 A;  2EYF A;  2X69 A;  2K05 A;  3NK9 A;  4DV0 Q;  5EQ0 A;  1I94 L;  1UE5 A;  2OF1 A;  1G2S A;  4C56 C;  1PV4 A;  3AB9 A;  1Y1V B;  1N33 Q;  1KC8 C;  1A63 A;  3T1Y L;  2UXD L;  1YJN A;  4NKL A;  3GV6 A;  3H0G B;  3BS1 A;  4A3I B;  3J7Y W;  1MSH A;  4LFB L;  2B2V A;  5ELB A;  2KHI A;  1CKO A;  1JOO A;  1DOL A;  1QOH A;  2NZH A;  1FVI A;  1Y8N B;  3GQB A;  2VL6 A;  2Q2U A;  3KLS A;  3R93 A;  3ULJ A;  2BH8 A;  3RMH A;  3F2C A;  1OXX K;  1YNX A;  1X55 A;  2JE6 I;  5IE8 A;  3AQQ A;  2LSS A;  2WP8 J;  1H9R A;  4DNT B;  3RD4 A;  1JWU D;  5EKK A;  1K8G A;  5JAV A;  3Q24 A;  5FLM G;  3FPP A;  1L1O A;  1I6V C;  1GKH A;  4GZY C;  3I56 A;  1GO3 E;  4B08 A;  1JC7 A;  1Q7Y C;  4K5W A;  2R92 G;  1GHJ A;  1W6K A;  2R7D A;  1R9T H;  3QR8 A;  3CXC A;  4MIU A;  4PNY A;  4BXX G;  4CDE C;  2QEX A;  1CK1 A;  1XTC D;  3CRL C;  3I4O A;  5G3L F;  5I9O A;  4OX9 L;  2BA0 A;  1B9N A;  4JC0 A;  4AQY L;  4DV4 Q;  2O2L D;  4A3G G;  1BO0 A;  3MXN A;  4DR2 L;  1V1Q A;  1K9M C;  1IW7 D;  4GKJ Q;  2D9U A;  2IX0 A;  4PZ6 A;  4CDF C;  3PQI A;  5C4J H;  3U9S A;  3Q8D A;  1PH6 A;  4K5X A;  5COY A;  3SK8 A;  1TWF H;  1X56 A;  4K8J A;  1KTK A;  5GAG C;  4DR5 L;  4A3E H;  1MIU A;  4QIW B;  1QB5 D;  1E1T A;  2PQA A;  1CSP A;  3K7A B;  1KLG D;  5C3E B;  1JOQ A;  3GD7 A;  2EY5 A;  3K5M A;  4BBR G;  4J1M A;  3HRZ C;  4A3K B;  4AYB G;  1X3E A;  3JC6 6;  3CMA A;  4GKJ L;  1MD2 D;  4C3I G;  1SJE D;  1H95 A;  2A68 D;  5IWA L;  5IP7 H;  4UP7 A;  3PIO 3;  4B3S Q;  2EYL A;  1PTO H;  3PO2 H;  3FP9 A;  2G9D A;  1EOT A;  1K83 B;  1SYC A;  1WCM B;  4A3E G;  2HDM A;  1Q81 C;  5T1G A;  2RF4 A;  2WAQ E;  1TWC H;  1GUW A;  2F0Q A;  2MUY A;  2EIF A;  2E2I B;  1JWS D;  1CM9 A;  1V1P A;  1YNN D;  5GQO A;  4FXG C;  1FNU A;  1SE3 A;  2O4X A;  4S3S A;  5AJ3 L;  3MEF A;  3QWN A;  4A3G B;  3OSO A;  4KLK A;  2CQA A;  2ALY B;  1N36 Q;  1H9J A;  4DR4 Q;  2B63 B;  1HCZ A;  2WKD A;  4RGN A;  2OTJ A;  3KF6 B;  4L5R C;  4FDB A;  1A2U A;  2RDF A;  2R7F A;  4DV7 L;  3KJO A;  1VQN A;  4HJA A;  4QY7 A;  4EQ5 A;  1QNK A;  5DLQ E;  2ZTD A;  1ILQ A;  5EKL A;  1JJC B;  1SN8 A;  2F0T A;  4IPC A;  1PRT C;  4CKB A;  1PTO B;  3PO2 B;  3HS0 C;  1SND A;  2Z9H A;  3ZJY C;  3T1Y Q;  2UXD Q;  4K0K L;  3NHH A;  1N34 L;  3QO2 A;  5I2X A;  4GNX C;  3TN2 A;  2RCF A;  2LXJ A;  1V43 A;  4DK6 C;  1DM0 B;  1BQQ T;  4TSS A;  3CCM A;  3CCE A;  2UXC Q;  2Z1C A;  4R9W A;  4O42 A;  4R8I A;  4LFC Q;  2H1E A;  4KHP L;  4A3K G;  1PTO C;  4LMQ D;  1B53 A;  3MEH A;  4JPB W;  1IKM A;  2K5V A;  2BA1 A;  2BDO A;  2Z6K A;  1LT6 D;  3GTP B;  1YJW A;  1QUQ B;  3E9I A;  5C4J B;  5IP9 G;  3S1R H;  4KN4 C;  4A3M G;  2NN6 I;  4X66 Q;  2QF7 A;  2ZM6 Q;  3KF8 B;  1PH2 A;  1D5Z C;  3M4O H;  2Z0S A;  2CH4 A;  2ICI A;  1BOS A;  3F8T A;  4JG2 A;  1I6H H;  5ELF A;  2JA5 H;  3I4M H;  2EVB A;  2E2J B;  4IPG A;  4BBS G;  3J81 L;  3M4Q A;  3VR5 A;  2JA7 B;  5IT9 c;  4O1N A;  1PYW D;  1D8L A;  4IZ8 A;  5D14 A;  4HCS A;  4L8J A;  1UUP A;  4MTN A;  4DV5 Q;  2V1C C;  2QDL A;  1N32 Q;  4DXF A;  5EKI A;  3W2D A;  2QDB A;  2JA6 H;  3C1E A;  1EWC A;  3BVG A;  2HD3 A;  3VYS A;  2DUD A;  3I72 A;  1QVC A;  4DR4 L;  2Q2T A;  2AWN A;  3OIQ A;  3NEN A;  2F4V Q;  2A1A A;  3I4N B;  4JI7 L;  2FFK B;  3W1G A;  2NVX B;  1OO9 B;  2B2T C;  1VCI A;  2ZXO A;  3SE0 A;  3TRZ A;  1CKM A;  1HZA A;  1EY7 A;  2QGQ A;  1X65 A; 
#chains in the Genus database with same CATH homology
 3UDG A;  2VY3 A;  5C4X H;  2K4K A;  2F52 A;  4DR2 Q;  1BBU A;  5K36 G;  4GS3 A;  1P16 A;  1VQC A;  3KLW A;  1IBM L;  4NXM L;  4X65 Q;  3CC4 A;  4GN5 A;  2Q2H A;  3IRB A;  1PH9 A;  4PZ7 A;  3A74 A;  2HT1 A;  3KFU A;  3GTP H;  2PNH A;  1BBW A;  4KHZ A;  4QJF A;  5E7N A;  5JEA J;  4JCV E;  4ME3 A;  4P75 A;  1YEZ A;  4JI6 Q;  5HY6 A;  1HZB A;  1TWG H;  1Y1W H;  3H0G G;  2NN6 G;  4A3I G;  4YHH L;  4YWM A;  2A8V A;  1MJE A;  4QQB X;  2CCZ A;  4LW1 A;  5JJK A;  1EUJ A;  4QL5 A;  4Y52 H;  3HOZ H;  3CW2 C;  3J81 j;  4OX9 Q;  3UDX A;  2N3S A;  4DR7 Q;  4IOA A;  1XPR A;  4A3D H;  4L5T A;  3WWV A;  3L2P A;  3STB D;  5M3M G;  1IBM Q;  3PF5 A;  4BY1 H;  3ER0 A;  2AHO B;  4YWK A;  3HOY G;  4A3F H;  3TS2 A;  1RIP A;  1T9H A;  2B63 H;  1E22 A;  1YHA A;  3KOJ A;  1NMG A;  1EIY B;  2VQF Q;  3HOU H;  4BY7 H;  4B3R Q;  3HKZ E;  3CCR A;  2UUA L;  2MFI A;  2JA8 H;  4JI6 L;  3HOY H;  1E7Z A;  1KL9 A;  3GTM H;  2E8G A;  4AH6 A;  4HID A;  4WJ3 M;  4BY1 G;  2MQH A;  5M3M H;  4DR7 L;  2YV5 A;  1NMF A;  2XTI A;  1A0I A;  4GLX A;  2H5X A;  4JBK A;  5FJ8 G;  4LF9 Q;  3S1Q H;  3FKI H;  4R4C A;  4LF5 L;  2B3G A;  5FLX c;  3E0E A;  1AE3 A;  3CQZ H;  2MO0 A;  2UUA Q;  5C4X G;  3CME A;  3RZD H;  2GVB A;  3RR5 A;  4YY3 Q;  2IX1 A;  4JV5 Q;  2K14 A;  3AFQ A;  3S24 A;  1IZ6 A;  2MNA A;  4NPS A;  2YTV A;  4JBJ A;  2C35 B;  4OWX B;  4DV4 L;  1Y1W G;  5IYD G;  1SFO H;  4AQY Q;  1K83 H;  4DV1 L;  3I4M G;  1VQJ A;  3K81 C;  2JA5 G;  4UPA A;  5LMU Q;  2F3I A;  3FKI G;  1XJV A;  2UU9 Q;  3GTK H;  4DV0 L;  4GN4 B;  3J81 c;  1WI5 A;  1N8R C;  2KBN A;  2UUC L;  1VQ5 A;  1HNW Q;  4JI7 Q;  2PMZ E;  4IJH A;  1EQQ A;  5JJI A;  4GNX B;  4A3M H;  2GVA A;  1FGU A;  2XGT A;  1L1O C;  3KJP A;  3J7A 5;  2ZTE A;  3STB C;  1VQ6 A;  3RLF A;  5IP9 H;  1SRU A;  3HOU G;  1UEB A;  2ZTC A;  4YHH Q;  3OW2 A;  1UE7 A;  3U4V A;  4LF8 Q;  3CCS A;  2GN5 A;  1KXL A;  2FXQ A;  1G51 A;  2K75 A;  3S14 H;  1TWH H;  3B6Y A;  4JBW A;  3GTJ H;  1AE2 A;  3T1H Q;  4JOI A;  1TWA H;  1C7Y A;  3CP0 A;  1JB7 A;  4P73 A;  2R6G A;  3TRE A;  4YCW A;  4HIK A;  1VQP A;  1VQL A;  4NXM Q;  1VQF A;  3ERS X;  3HOZ G;  1M90 C;  1YHQ A;  1OXV A;  3GO5 A;  3RN2 A;  3JAM i;  1VQ9 A;  3S16 H;  3UDF A;  2UU9 L;  2AKW B;  1HR0 L;  4JI0 L;  2VS1 A;  3M9B A;  3CCJ A;  4GLV B;  3PO2 G;  1JE5 A;  4YWL A;  1TXY A;  3NEL A;  2OTL A;  4HJ8 A;  5GAE C;  3UDI A;  3HOX G;  3J80 i;  1XMQ L;  4DUY Q;  1DGS A;  4JI2 Q;  3CCQ A;  4X64 Q;  4B3M L;  4DV5 L;  1HNZ Q;  3HOX H;  3PUY A;  1A8V A;  1S40 A;  3G48 A;  2WFW A;  4B3R L;  3A5U A;  5IY0 A;  4IFD I;  2F4V L;  4JYA Q;  4DV2 L;  1ASY A;  1CUK A;  4HJ5 A;  3PO3 H;  4O2D A;  4L5Q A;  3HFZ B;  3L7Z C;  3VDY A;  1GM5 A;  4POG A;  5FLM H;  3HKS A;  4IFD J;  2N78 A;  2R93 H;  1PYS B;  1YBY A;  3ULL A;  4JI5 Q;  3KYH C;  2I5L X;  1XTD A;  5C44 G;  4A3K H;  1HNX L;  4LWC A;  1EIF A;  4LF6 Q;  1YZ6 A;  1E24 A;  1IXR A;  3AFP A;  4DK3 C;  1VQM A;  1XNR Q;  1PH1 A;  1KD1 C;  2E5L L;  5M5W H;  2ZM6 L;  3CPW A;  4DV6 L;  3E9H A;  2N8N A;  5H1S E;  3HOV G;  1WCM H;  2RHS B;  4A93 H;  4A3F G;  4TQU S;  4LF4 L;  3HOW G;  3GTG H;  4IOC A;  5M3F G;  4UP8 A;  5IYB G;  1WOC A;  2VUM H;  1G6P A;  4IO9 A;  4A76 A;  1CSQ A;  1HJP A;  1B8A A;  1SR3 A;  2OQ0 A;  3A0J A;  1X9N A;  2K52 A;  4A3D G;  3BJU A;  2UXB Q;  1PHJ A;  1Q86 C;  3PUZ A;  4K0K Q;  1EFW A;  2NVT H;  4A3B H;  2ATW A;  4R1J A;  2BH2 A;  2L15 A;  1IBL L;  2K5N A;  4JI5 L;  4JI0 Q;  3KF6 A;  4DR3 L;  4LF4 Q;  2HIX A;  5IYD H;  1N36 L;  4DV2 Q;  4O0A A;  1MKH A;  4LFC L;  5M5Y H;  2E2H H;  4C3J H;  4JI3 Q;  2PI2 A;  4LUZ A;  1HH2 P;  1FL0 A;  4AIM A;  2KEN A;  3UE1 A;  2ID0 A;  3PIO A;  3S2H H;  2KCM A;  3PCO B;  1K8A C;  3H0G H;  1SLJ A;  4XTC S;  4GOP B;  2AWO A;  1QUQ A;  5AJ3 Q;  2EXD A;  4A3I H;  1PH3 A;  4B3M Q;  5IP7 G;  1ASZ A;  1VQD A;  2ZJP A;  2ZJR A;  1X54 A;  1XMQ Q;  3W1B A;  4X6A H;  5JJL A;  1P8L A;  1JMC A;  1Y1V G;  1XNQ L;  4X62 Q;  3BZC A;  4C3H H;  1YIT A;  2VQE Q;  4BBR H;  1GVP A;  4IPH A;  4DNI A;  1FJG Q;  5M5X H;  4HJ7 A;  2VZA A;  4GOP A;  2B63 G;  1J5E L;  1YVC A;  1HNZ L;  1QZH A;  1GD7 A;  4LF6 L;  1L1O B;  3BU2 A;  1WJJ A;  4DV0 Q;  2CKZ B;  1Q8K A;  2NVY H;  1UE5 A;  1I94 L;  2JA9 A;  2R7Z H;  1L2F A;  4MZ9 A;  1PV4 A;  2NVQ H;  1N33 Q;  2IHE A;  5J3B A;  1KC8 C;  1A63 A;  3T1Y L;  1A62 A;  2UXD L;  1YJN A;  2JJQ A;  3H3V H;  4GKK Q;  1HR0 Q;  3MXN B;  2JQO A;  4LFB L;  4YY3 L;  1PYB A;  1VQH A;  1Q1E A;  2KHI A;  1CKO A;  2MO1 A;  3CCU A;  1HNW L;  3D0F A;  4LF9 L;  5ELN A;  2YU9 H;  4R4O A;  2JA6 G;  4JI2 L;  2NZH A;  1FVI A;  1Z9F A;  2NZO A;  4A3L H;  1E3P A;  1KHI A;  2VL6 A;  2Q2U A;  2YYZ A;  3KDF A;  3ULJ A;  2BH8 A;  1PH8 A;  4J15 A;  4JI4 Q;  3F2C A;  2IY5 B;  1OXX K;  1YNX A;  2JA7 G;  4JI8 L;  1X55 A;  2JE6 I;  5IE8 A;  1D7Q A;  3AQQ A;  3NBH B;  2RCN A;  4LF7 L;  5LMN L;  4NXN Q;  2LSS A;  1C0A A;  4DV3 Q;  3PV0 A;  1XMO L;  2WP8 J;  4DAY B;  1C9O A;  1Q82 C;  1Y1V H;  4RG1 A;  1K8G A;  1SE8 A;  3D31 A;  2UUC Q;  4C2M H;  5FLM G;  1IBK Q;  1L1O A;  3SGI A;  4HJ9 A;  1GKH A;  1V9P A;  2D0P A;  2N49 A;  4OON A;  4XIG S;  5LMU L;  3I56 A;  1GO3 E;  4OXP A;  3CF5 A;  1Q7Y C;  1U5K A;  3M4P A;  2R92 G;  2HIV A;  4DR1 Q;  3CC2 A;  1VQE A;  4B3T Q;  3M85 A;  4A3J H;  1VQK A;  2R7D A;  4LF8 L;  3RZO H;  4JOI C;  1R9T H;  3CXC A;  3EN2 A;  1NY4 A;  4BXX G;  2HHH Q;  2JA7 H;  1CKN B;  4MNO A;  4LFA Q;  4PMW A;  3PGZ A;  2QEX A;  4B3T L;  4NB3 A;  1U0L A;  1WFQ A;  1LM0 A;  4LF5 Q;  4A3C G;  2WB1 E;  3EBE A;  3I4O A;  4A3L G;  2E2J H;  1XPO A;  2I0Q A;  4OX9 L;  2BA0 A;  2VUM G;  4X65 L;  4DKA C;  4JC0 A;  4AQY L;  4OWW B;  2JEA I;  1W3S A;  5C3E G;  4DV4 Q;  3G71 A;  4A3G G;  4BXX H;  4GKJ Q;  1X3F A;  1V1Q A;  4DR2 L;  1YJ9 A;  4RMF A;  1K9M C;  4LFA L;  2VQF L;  1XMO Q;  3I4N G;  2IX0 A;  4PZ6 A;  5C4J H;  1PH6 A;  3Q8D A;  1PFS A;  1QVF A;  3F2D A;  1TWF H;  4A3G H;  1X56 A;  1MJC A;  4GOP C;  1VQ7 A;  5GAG C;  4DR5 L;  4A3E H;  3U4Z A;  1MIU A;  1I3Q H;  2OQK A;  3K8A A;  3I7F A;  1E1T A;  1VQA A;  2PQA A;  3DLL A;  4GLA C;  1CSP A;  4AYB E;  1UE6 A;  2HQL A;  1N9W A;  4LUO A;  4A4I A;  1Q12 A;  3GD7 A;  4C3I H;  1JT8 A;  4WJ4 A;  2VW9 A;  4BA2 I;  4LFB Q;  4QIW E;  4BBR G;  2KHJ A;  1OTC A;  4GKK L;  1B7Y B;  2CWA A;  4IFD G;  4LF7 Q;  1O7I A;  3PUX A;  4AYB G;  1X3E A;  3JC6 6;  3CMA A;  4GKJ L;  1PA6 A;  4JI8 Q;  2LXK A;  3G4S A;  3FHW A;  4UY8 C;  4JI4 L;  1OXT A;  3J7Z C;  1Q46 A;  1N33 L;  1H95 A;  5IWA L;  4GN3 B;  5IP7 H;  3L0O A;  3PIP A;  4UP7 A;  5HGQ A;  3M7N A;  3CCV A;  1X3G A;  1Y14 B;  4B3S Q;  2Y0S G;  3PO2 H;  3FP9 A;  1JJ2 A;  2A19 A;  4A3E G;  5IYC G;  1W2B A;  1KAW A;  1Q81 C;  2E2I H;  3PUV A;  4OO1 G;  2RF4 A;  4IPD A;  2ZJQ A;  2HHH L;  2WAQ E;  4R4T A;  2YTY A;  3GTQ H;  4HIM A;  4DV3 L;  1YIJ A;  3GTO H;  1TWC H;  5LMN Q;  2VQE L;  2EIF A;  4DR1 L;  4P71 A;  1UWV A;  4DR6 Q;  3K7A H;  5C3E H;  1YHB A;  1K3R A;  4DUZ Q;  5GQO A;  3OTO Q;  5IYB H;  2B29 A;  4Y7N H;  2I5M X;  2OWO A;  2JA8 G;  1IBK L;  5AJ3 L;  3MEF A;  1M1K C;  1WCM G;  3TEH B;  1G29 1;  4POF A;  4BY7 G;  1Q1B A;  1VS0 A;  1VQB A;  4UP9 A;  5C0X I;  1OXS C;  1KRS A;  4KLK A;  4JI3 L;  3F2B A;  1VQ8 A;  3AEV A;  2ALY B;  1N36 Q;  2JK8 A;  4DR4 Q;  3J80 c;  5C44 H;  1HZ9 A;  4NXN L;  1L0W A;  3EIV A;  2OTJ A;  2D62 A;  3KF6 B;  5BR8 L;  5JEA G;  1EWI A;  5IYC H;  4X62 L;  4A75 A;  4A3J G;  4L5R C;  4FDB A;  4QGU A;  2UXB L;  3CPF A;  2R7F A;  3M3Y H;  3UE0 A;  4DV7 L;  1I94 Q;  4BA1 I;  3JAM c;  3F1Z A;  3KJO A;  1VQN A;  2R7Z G;  1PH7 A;  5ELO A;  2UUB L;  4HJA A;  4QY7 A;  4EQ5 A;  3H3V I;  5DLQ E;  4JI1 L;  2ZTD A;  3PSI A;  3TQY A;  1JJC B;  3CD6 A;  1SN8 A;  2K50 A;  3RLO A;  2UXC L;  4IPC A;  4DR3 Q;  4R4I A;  1IYJ B;  5FJ8 H;  3ZJY C;  3LGJ A;  1Z47 A;  3T1Y Q;  3CCL A;  2CFM A;  4K0K L;  3ULP A;  4OWT B;  1N34 L;  3S17 H;  2VNU D;  2UXD Q;  3TS0 A;  3NEM A;  1EQR A;  3K7U C;  2WB1 G;  4PZ8 A;  5C0X J;  4GNX C;  5M3F H;  1PVO A;  1V43 A;  2LXJ A;  2CWP A;  4DK6 C;  1K73 C;  3HOW H;  1N32 L;  1J6Q A;  4YCV A;  3HOV H;  1J5E Q;  3GDE A;  3CCM A;  3CAM A;  3CCE A;  2UXC Q;  3J81 i;  3S2D H;  1LYL A;  2E5L Q;  1NBW A;  4LFC Q;  4EX5 A;  1LTL A;  1PH5 A;  1FJG L;  4X66 L;  2K5H A;  1IL2 A;  3BZK A;  4KHP L;  4A3K G;  2ASB A;  1HNX Q;  1IBL Q;  1S3O A;  3PF4 A;  4X64 L;  2R93 G;  4L5S A;  4LNQ A;  2I5H A;  1YI2 A;  1QVG A;  1XNQ Q;  3GTL H;  4A3B G;  2K5V A;  2BA1 A;  2Z6K A;  3H15 A;  1E1O A;  4H02 A;  2DGY A;  1YJW A;  1QUQ B;  3E9I A;  1PH4 A;  1X6O A;  4R4Q A;  3PO3 G;  1NTG A;  1I50 H;  1WYD A;  2KCT A;  1RL2 A;  1UE1 A;  4KI0 A;  5IP9 G;  3S1R H;  3K80 C;  5GAH C;  4A3M G;  4KHP Q;  4TVA B;  2Z6K C;  2NN6 I;  1EOV A;  4X66 Q;  2EQS A;  3KDF B;  3RN5 A;  2NVX H;  2CQO A;  2ZM6 Q;  3HKZ G;  3KF8 B;  3W5O A;  4DV6 Q;  1PH2 A;  3S15 H;  3S1M H;  3M4O H;  2Z0S A;  3F8T A;  1B70 B;  1NJI C;  4JG2 A;  2UUB Q;  1I6H H;  1LUZ A;  1HZC A;  3I2Z A;  1SMX A;  3T1H L;  2JA5 H;  4DV7 Q;  5EAY A;  1CKN A;  4DUZ L;  3I4M H;  1I5F A;  2AMC B;  4P72 A;  5GAD C;  4IPG A;  4DR6 L;  4BBS G;  3OYY A;  4DAM A;  1XPU A;  3M4Q A;  3A5Z B;  1BVS A;  2RHQ B;  5C0X G;  5IT9 c;  2ES2 A;  4APV A;  4JBM A;  2IHF A;  4DPG A;  1D8L A;  2Q2I A;  2PQA B;  1HR0 W;  1JJG A;  5GRO A;  1SRO A;  1VQO A;  4HIO A;  3I4N H;  1NE3 A;  3CC7 A;  1XNR L;  4BBS H;  4MTN A;  3G6E A;  2V1C C;  4DV5 Q;  1KQS A;  1S72 A;  4B3S L;  4IJL A;  1KRT A;  1N32 Q;  4P74 A;  2D0O A;  2Y0S E;  4DUY L;  3U58 A;  1VQ4 A;  3U50 C;  1N34 Q;  1VQG A;  2QA4 A;  4LUV A;  3RNU A;  2JA6 H;  1VQI A;  4ALP A;  3ICE A;  1BKB A;  2DUD A;  3K0X A;  4GNX A;  4A3C H;  4JV5 L;  1QVC A;  4DR4 L;  2PI2 E;  2YTX A;  1KIX A;  2AWN A;  2Q2T A;  2OCE A;  3NEN A;  2A1A A;  2F4V Q;  4JYA L;  4A93 G;  1OXU A;  3RLN A;  4JI7 L;  3W1G A;  4YCU A;  1VCI A;  1AH9 A;  2IT1 A;  4JI1 Q;  3S1N H;  3PUW A;  2R92 H;  3TRZ A;  3AYH B;  3OTO L;  1CKM A;  1K0R A;  4DR5 Q;  1HZA A;  5IWA Q;  1EYG A;  4OO1 I;  2WAQ G;  4DV1 Q;  3DM3 A;  2JEB I;  5LMN W;  5BR8 Q;  1QZG A;  4PG3 A;  2QGQ A;  1X65 A;  3I55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...