3H3VI

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 13
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h3vI00
4LUOA 4BA1I 2NVQH 4R4TA 4DV7L 3PO2H 4DR6Q 3GTOH 1I6HH 2HT1A 3PF5A 1L0WA 4P75A 2WFWA 3ERSX 2R6GA 1K8GA 4XIGS 3HKSA 3PSIA 1YJ9A 1SMXA 2DGYA 1TXYA 1VQPA 2Q2UA 3CCSA 3S1MH 2VZAA 4GN3B 4JCVE 1R9TH 1LUZA 4A3JH 5JJKA 3HOUH 3J81j 1FVIA 1YHAA 1OXXK 5IWAL 3DLLA 1IBMQ 2ZJRA 1XNQL 1WCMG 2R7ZH 4YWLA 4YHHQ 2AWNA 2B3GA 2WAQE 4B3SQ 2JA8G 3MXNB 4IFDG 5IP7G 4JI5Q 5BR8Q 1PH1A 1W3SA 3S1RH 3J7ZC 5ELNA 4B3TQ 4JI4L 4LF5Q 1C9OA 5C0XG 3E9IA 4DV1Q 1JT8A 3CF5A 3CMEA 1GD7A 5GQOA 4IPCA 3AYHB 1Q86C 3J80i 2UXDL 3PIOA 1NE3A 1E24A 4IO9A 2Z6KC 1C7YA 2UXBQ 4L5QA 2RCNA 3ZJYC 1G6PA 2EQSA 3CCLA 3Q8DA 1QVGA 3UDGA 2K5HA 3S1NH 2YTXA 4A3IG 4P72A 1O7IA 3J81c 3PIPA 3L2PA 2MO1A 1PHJA 1Z47A 3KF6A 3GD7A 1VQIA 1Y1WH 3FKIG 1YBYA 2YU9H 4IOAA 1AE2A 1IXRA 1V1QA 1PH6A 1VQAA 1A62A 1J6QA 1YITA 1A0IA 4JI8Q 4GOPA 2JJQA 1L2FA 1VQJA 1BBUA 1MKHA 2B29A 4LFAQ 4GKJL 4X65L 5M5WH 3K80C 2MNAA 4DV2Q 3T1HL 1QZGA 3I2ZA 1X65A 2KHIA 1QVCA 2CQOA 2JEAI 4GLVB 1VCIA 4A3KG 1V43A 4DR1Q 3CCUA 1IBLQ 1LYLA 1BKBA 1JE5A 1KRSA 1QUQB 4A3BH 1TWCH 2KENA 2OTLA 2OQKA 2UUAL 3PUWA 4DR5Q 1HNXQ 3ER0A 1D7QA 4QL5A 1EFWA 1PYBA 1NJIC 4JV5Q 1J5EL 3KLWA 4LF6Q 4LUVA 1NMFA 3AFPA 1B7YB 4JI6L 2ZTCA 1ASYA 4LFCQ 1P8LA 3F8TA 4A3FG 2UUBQ 3U4VA 3U58A 1WFQA 4JI2L 3NBHB 1UWVA 3RLFA 3HOVG 5E7NA 2K52A 5JEAG 1SROA 1TWFH 3M7NA 2ATWA 2B63H 1YJWA 2N49A 1HZBA 3W5OA 3A0JA 3L7ZC 4DV0L 2VL6A 1YZ6A 3CC4A 4K0KL 1RIPA 1VQHA 3TQYA 4A76A 2UUCQ 4P74A 2PQAB 4APVA 4BXXG 3KYHC 3CQZH 2IX1A 4YWKA 4LUZA 1YEZA 2K75A 1N9WA 4A93G 4OWTB 3JAMi 4BY7G 2OTJA 3H3VH 3CC7A 1OXVA 1XMQL 4B3RQ 1K83H 4DV6Q 2QGQA 1B70B 2F4VL 1WCMH 4GNXA 1Q7YC 4QGUA 4DV3Q 2CCZA 2JA8H 1OXTA 5IE8A 4GKKQ 4LFBL 4LF9Q 5IT9c 1VQ9A 1HH2P 1I50H 1N34Q 1N33Q 2JA6G 4HIMA 1JB7A 3VDYA 4B3MQ 2GVAA 4JI0Q 3RR5A 1CKNB 4DUZQ 1PYSB 4HJAA 2ZM6L 2UXCL 2JE6I 3CCVA 4P71A 2PQAA 1EOVA 4RMFA 3HOZG 1XNRL 4JBJA 1AE3A 1Q12A 4YWMA 2HIXA 3PV0A 1I3QH 4IPHA 4UP9A 4BA2I 4FDBA 2VQFL 3GTLH 2AHOB 3IRBA 4GOPC 2ZTEA 2Q2IA 3OW2A 1IBKQ 1VQKA 4LF7Q 3KJPA 4A3IH 1FJGQ 1KC8C 3S2HH 1GVPA 2I5HA 3TS2A 1S3OA 1XMOL 3I56A 4RG1A 3T1YL 4XTCS 3GTJH 3K7AH 3FKIH 4JI3Q 1Q1BA 4DR6L 3U50C 3M4OH 3S16H 4OO1I 1NBWA 4J15A 1VQCA 2WB1G 2AMCB 4OX9Q 4KHPQ 1SE8A 1X3GA 4JBKA 4JOIA 1X3FA 1EUJA 1VQOA 4NXNL 2N8NA 1KXLA 1XTDA 1YI2A 2R93G 2IY5B 3W1GA 1L1OA 2A19A 1HNZQ 2NN6I 4X64Q 3KOJA 4A3KH 1OXSC 1IBML 1N32Q 5C4JH 1Z9FA 3I4NG 2ZJPA 1WYDA 4YHHL 4GLAC 1FGUA 1NTGA 2PI2E 3FHWA 3PUVA 3J80c 4NXMQ 4A3GG 1EQRA 4JI5L 4GN5A 5BR8L 2BA0A 3ULPA 2ALYB 2VUMH 1UE5A 4B3TL 4LF5L 2KHJA 2ZJQA 1Y1VG 1Q1EA 1LTLA 3ICEA 2PMZE 1H95A 4DK3C 1C0AA 2BH8A 2UXBL 1VQNA 4GLXA 1I5FA 4A3FH 1TWHH 5JJIA 4DV4L 1N36Q 3UDIA 3D0FA 3OTOQ 1WI5A 3HOVH 1KHIA 1IZ6A 2RF4A 2YTYA 4POFA 4X66Q 2YTVA 2ZTDA 1V9PA 2CWPA 3G48A 3HKZG 1FL0A 3CCRA 4EX5A 2V1CC 1VQMA 2C35B 3AQQA 4GNXC 3K81C 3KDFB 4JI1L 5C4XG 1G51A 4JI4Q 4O2DA 4BXXH 3M9BA 5AJ3Q 4BBSG 3CP0A 1OXUA 1X56A 4R4IA 3WWVA 5LMNW 4A3MH 4JI8L 1E3PA 5IP9G 4PMWA 4A75A 1HR0Q 1LM0A 4HIDA 4LFAL 5M3MH 1YIJA 4QJFA 3ULLA 4A93H 1HZ9A 1PA6A 1E22A 4DV2L 2NVXH 2OWOA 3I7FA 2JK8A 4A3CG 4JYAQ 4QQBX 4QY7A 4DV5L 3CMAA 2Q2TA 1Y14B 1GKHA 2F52A 1PH4A 2BA1A 2Q2HA 3HOYG 3CCJA 1Q81C 5IY0A 3STBD 1EQQA 1VQFA 2VY3A 2K14A 3G4SA 4AQYL 2E5LQ 2I0QA 1M1KC 1VQ6A 4X62Q 1IBLL 2JA6H 3F2CA 3HFZB 4A3EG 3A5UA 1VQ8A 3S1QH 1BBWA 3EBEA 4C3JH 4DR5L 1XPRA 1HNXL 4LF8Q 3GTPH 2VUMG 3HOZH 1KL9A 5C3EG 4GKJQ 4JV5L 2IHFA 1KD1C 3F2BA 1GM5A 2VNUD 3RZDH 3K7UC 1UE7A 1Q8KA 4H02A 2HHHQ 2UUBL 4C3IH 5H1SE 4JOIC 1JMCA 2JA9A 1ASZA 5IYDG 3PF4A 2QEXA 4PZ6A 3B6YA 3F1ZA 1L1OC 2LXKA 3OYYA 2IX0A 2R7FA 1PH3A 2OQ0A 1YHQA 2A8VA 2WB1E 5IYCG 2DUDA 3TS0A 3JAMc 5C0XI 2VQEL 2JA7G 2NZHA 2Z0SA 3J7A5 3CCMA 2UUCL 1QUQA 4UY8C 2N78A 4OO1G 5LMUQ 1JJ2A 5LMNL 3BZCA 2K4KA 4UP8A 3PO3G 1HNWQ 1JJGA 3M4PA 3A5ZB 4JC0A 4A3MG 1XJVA 1PH7A 2UU9Q 4BY7H 1SRUA 2R93H 1I94Q 1MJEA 5M3MG 2LXJA 1YVCA 3E0EA 4QIWE 4YY3Q 3GTKH 4B3RL 4WJ4A 3DM3A 1PH2A 3S14H 4POGA 4YCVA 4JI2Q 1W2BA 2PNHA 3I4NH 3UDXA 3HOXG 3L0OA 4C2MH 4DV3L 1K9MC 1K73C 3I55A 4JBMA 4LF9L 4GN4B 4IPGA 2A1AA 3RLNA 5GAHC 4A3GH 1TWGH 5ELOA 2OCEA 4DR2Q 1N34L 1Q82C 3CPFA 4JI0L 1N33L 4K0KQ 4DUZL 1Y1VH 2R7DA 3CW2C 2B63G 2NVTH 3H0GG 1PFSA 5K36G 3BU2A 3K0XA 1EYGA 2QA4A 5HY6A 4Y52H 1CKMA 3KF8B 4MTNA 2D0PA 1XMQQ 2L15A 2H5XA 3A74A 4ALPA 3CAMA 2EXDA 4DR4Q 3HKZE 4LF7L 1FJGL 1E7ZA 2N3SA 3H15A 5GADC 3S15H 1K8AC 2IHEA 3K8AA 3I4MG 2K5VA 2Y0SG 4LF4Q 3M3YH 3CCEA 2KCTA 2JA5G 4BY1G 4JI3L 5C4XH 3CPWA 2XGTA 4YCUA 5J3BA 4DR7Q 4IOCA 4TQUS 5IYBG 4BBSH 4EQ5A 2ZM6Q 4DUYQ 1MJCA 2JEBI 4JBWA 4P73A 1CKNA 3TEHB 5IP9H 3CCQA 1PV4A 1XPUA 2R92G 4PZ7A 1HR0W 4OX9L 4L5SA 3CD6A 4Y7NH 1YHBA 1UE1A 4X6AH 1XNRQ 4A3CH 1NY4A 1YJNA 4IFDJ 4A4IA 3PUYA 1VQ4A 5C0XJ 1KQSA 1M90C 3CC2A 4DR3Q 4PG3A 3HOYH 3HOWG 2E2JH 3M4QA 1VS0A 4A3DG 1CKOA 1P16A 5JJLA 1K3RA 1MIUA 3G71A 2K5NA 1T9HA 4UP7A 4HIKA 4HJ8A 4MNOA 4A3EH 4B3SL 3LGJA 4DV7Q 4NXML 1Q46A 1PVOA 5HGQA 1X9NA 1CUKA 3CXCA 5C3EH 4DV1L 4C3HH 2CWAA 2D62A 3GTGH 4NXNQ 1SR3A 1UEBA 4BBRG 4MZ9A 2FXQA 2WP8J 3FP9A 3ULJA 1N36L 5C44G 3OTOL 5IYDH 4A3LG 2YYZA 3TRZA 2E2IH 4X66L 5IWAQ 1XNQQ 1QZHA 1AH9A 1WJJA 3KF6B 4AYBG 5IYCH 1OTCA 2VW9A 2JA7H 1HZCA 4R4QA 4NB3A 4GS3A 5GAEC 4KHZA 5FLXc 5AJ3L 1G291 1U0LA 3RN2A 4GOPB 1EWIA 3PO3H 1X6OA 3G6EA 1CSQA 4R4OA 3U4ZA 2MO0A 4OONA 1HR0L 2UXDQ 1VQGA 5FJ8G 1PH9A 4R1JA 1DGSA 4OXPA 1PH8A 3KJOA 4DV4Q 4JYAL 5FLMG 3S17H 3PGZA 3HOXH 1SLJA 2D0OA 3RNUA 4IJHA 2I5LX 2AWOA 2GN5A 4L5TA 4OWXB 4DK6C 1K0RA 1U5KA 2E2HH 4HJ7A 4DR1L 2E5LL 3I4OA 2K50A 4X62L 2VS1A 2PI2A 5M3FG 1SN8A 4IPDA 2NZOA 4KLKA 4JI1Q 1VQDA 1X3EA 3PO2G 4JG2A 3H0GH 3KDFA 3BZKA 5JEAJ 3J81i 1E1TA 4LF8L 2KCMA 2MQHA 2F3IA 3PCOB 3RLOA 4LF6L 1VQBA 1UE6A 4X65Q 3MEFA 3H3VI 1N8RC 3T1HQ 2HHHL 3S2DH 3E9HA 4DV5Q 3PUZA 2Y0SE 4LFCL 3AFQA 4WJ3M 2IT1A 5M5XH 1HZAA 3GTMH 3I4MH 4A3JG 3GDEA 5M5YH 3HOUG 3EN2A 4NPSA 2JA5H 2CFMA 4UPAA 4AQYQ 1VQLA 1A8VA 3M85A 4BY1H 4IFDI 1X54A 1S40A 2R7ZG 3RZOH 5IYBH 1E1OA 2KBNA 1IYJB 4YCWA 2UUAQ 3PUXA 2WAQG 2R92H 5LMUL 3JC66 2HQLA 2ASBA 4DAMA 1X55A 1J5EQ 1HNWL 2RHSB 1KAWA 2LSSA 1RL2A 2UU9L 4JI6Q 1I94L 1VQ5A 1VQ7A 3HOWH 4YY3L 3NENA 4DV6L 4GNXB 2GVBA 4LWCA 1S72A 4A3DH 4JI7Q 1B8AA 3GO5A 2NN6G 3NEMA 2AKWB 2ID0A 4DNIA 2YV5A 4LNQA 4OWWB 5GROA 4GKKL 4DV0Q 4HJ9A 1GO3E 4DAYB 1QVFA 1CSPA 4DR2L 4AH6A 2VQEQ 4B3ML 4JI7L 2Z6KA 2EIFA 1Y1WG 1KIXA 2CKZB 2I5MX 5LMNQ 1D8LA 4ME3A 4LW1A 1NMGA 1PH5A 1A63A 4BBRH 1VQEA 4PZ8A 1KRTA 4AIMA 5C44H 3W1BA 4A3LH 5DLQE 1IBKL 4DR4L 3TREA 3KFUA 4AYBE 4HJ5A 2F4VQ 2ES2A 4L5RC 1EIFA 3BJUA 3NELA 3UDFA 3D31A 4LF4L 3GTQH 4LFBQ 1JJCB 5IP7H 1XPOA 2E8GA 4O0AA 1EIYB 1WOCA 2XTIA 4DR7L 5GAGC 1YNXA 4TVAB 1TWAH 4IJLA 3SGIA 1IL2A 4DUYL 4A3BG 2UXCQ 3UE0A 2NVYH 2HIVA 3AEVA 5EAYA 2RHQB 3STBC 5FJ8H 1BVSA 4HIOA 4KHPL 2JQOA 4DKAC 1L1OB 4DPGA 3EIVA 5FLMH 2VQFQ 2BH2A 3S24A 1HNZL 2MFIA 4DR3L 4X64L 3UE1A 3F2DA 1SFOH 1N32L 1XMOQ 4R4CA 5M3FH 3RN5A 3T1YQ 1HJPA 4KI0A
chains in the Genus database with same CATH superfamily
4LUOA 4R4TA 2NTTA 3DHQA 4P75A 2WFWA 4CHTB 4TKOB 4OL7A 4A3IB 1SMXA 2DGYA 1EY7A 1VQPA 1XTCD 3CCSA 1SFOB 4UAIA 1LUZA 3M4YA 2JN4A 4ILWA 2F0IA 1YHAA 1OXXK 3VR3A 1YNJD 5EPLA 2ZJRA 1IBMQ 3GTOB 4YHHQ 3WDNA 2ICIA 2WAQE 4B3SQ 3MXNB 5ELCA 2A6EC 3FEWX 5BR8Q 3S1RH 3J7ZC 4IZ8A 2KUMA 4B3TQ 4LF5Q 1C9OA 2NB0A 1JT8A 3CF5A 1GD7A 5E3FA 3AYHB 1TT2A 3QOJA 4A3JB 3HOUB 1H9KA 2UXBQ 2RDHA 3CCLA 3Q22A 4JPBW 1TVXA 3UDGA 1AW7A 3R2TA 2YTXA 5D65A 1O7IA 2WAQB 5KEEA 2MO1A 3W3AA 5CV4A 4IOAA 1YBYA 4C1NI 5A2QL 2Z4HA 3K6OA 4JI8Q 1VQJA 1BBUA 1CA5A 2F0TA 3T4AC 2MNAA 4DV2Q 4FXGC 3S1NB 5J22A 4IUNA 4XYQA 3D8GA 4ZUIA 4HCEA 4A3KG 2YU9B 5KYLA 2EY6A 5JVH3 1LYLA 1IBLQ 1PZID 1BKBA 2B2WA 1JE5A 2ICEC 2JSOA 1SSOA 2N88A 1LLRD 1HFNA 3CRKC 3KLWA 3NWSA 5CV8A 5KNCA 3F8TA 4A3FG 1WFQA 4JI2L 1UWVA 5E7NA 5JEAG 4Q5VA 3K5MA 3MEHA 4A3BB 3TMEA 1EOTA 3BG3A 3KLSX 2PQAB 3KYHC 4YWKA 4LUZA 1YEZA 4A93G 4DXFA 1V1PB 3TBIB 1LV9A 5G3LF 3Q0AA 1C48A 2F4VL 4WFN3 4GNXA 1Q7YC 1PYWD 4LFBL 4ID6A 3LWUA 4HIMA 2GVAA 2I46A 2L0CA 5E1FA 3SK5A 2ZM6L 4C56C 3P1HA 3MAQA 1JWUD 1I4QA 4RMFA 1XNRL 4YWMA 4IPHA 1ET6A 2VQFL 3MFGA 3IRBA 3I8ZA 2ZTEA 3J81E 4GOPC 1IBKQ 2ZXPA 1VQKA 2BOSA 4C3IG 1PTOD 1G2TA 1IL8A 3HGBA 2I5HA 3TS2A 2L5TA 2G9DA 5EQ0A 3I56A 3GTJH 4JI3Q 4DR6L 2K5DA 3M4OH 4FXDA 1WD0A 1VQCA 1I3QB 1SNOA 5I6YA 4OX9Q 1QE6A 1X3FA 4K2KA 1BCPF 4NXNL 4QF4A 4CJ0B 2IY5B 2EE1A 3M3YB 2ZXOA 1EFID 2AQ2B 1PDQA 4A3KH 1STAA 1OXSC 3EQLC 3L9AX 4H0LC 1N32Q 5C4JH 2ZJPA 1PFBA 1I6VC 1NTGA 3PUVA 4RKBA 1CK1A 4JI5L 3KBXA 1Q90A 1DONA 1AN8A 2PMZE 1PRTD 3T13A 4DK3C 1H95A 2F0OA 5CMDA 4A3FH 5JJIA 1LT3D 4DV4L 4B9XA 4RCOA 4A3EB 1WI5A 5JEAH 4O1NA 4L6TB 4X66Q 4POFA 1NNXA 2YTVA 3G48A 4Q0FA 2CWPA 3BDCA 4RA8A 4XQNA 4P2CB 1G51A 4O2DA 4PNYA 4BBSG 5LMNW 3WWVA 4A93H 1TWHB 1E3PA 4A75A 1LM0A 1D1KA 3I7FA 2JK8A 4QQBX 4QY7A 4DV5L 1GKHA 2F52A 2BA1A 2Q2HA 1Q81C 2K14A 1VQ6A 4ODGA 4QMGA 4N8X1 1VQ8A 1W6KA 4DR5L 3NXWA 1KL9A 3RD4A 4C3HG 2VNUD 3K7UC 4H02A 5D14A 4S3SA 4C3IH 5H1SE 1EEID 2KOLA 1RODA 1JMCA 5IYDG 2F03A 3B6YA 5D3IB 3S1QB 1Y8OB 2R7FA 1PH3A 1YHQA 1NR2A 2V4DA 3HOZB 3TS0A 3JAMc 3K5LA 2JA7G 4UY8C 4OO1G 3MWYW 1BXTA 5LMNL 3BZCA 3PO3G 3A5ZB 4K8IA 3GTKH 4QIWE 2KVMA 2KA7A 1PH2A 3S14H 4POGA 1W2BA 3EJIA 2J0TD 4JI2Q 2PNHA 3E3XA 1LTTD 2O4XA 1XWEA 4C2MH 3VR4A 1S5DD 1U4RA 3LWEA 4LF9L 3RLNA 1HCZA 2A1AA 5GAHC 1N34L 1HQMC 3CKIB 4B08A 4JVZA 1EYGA 4X3SA 1F9RA 1O7YA 1DM0B 2D0PA 1BCPB 3I4NB 2L15A 2F4IA 3CAMA 4ALPA 2CH4A 4XQQA 2KCCA 1E7ZA 4OHJA 2PZUA 3OPOA 4PMCA 2Z8LA 2DY7A 2Y0SG 1Y1VB 3CPWA 3C1EA 2XGTA 4DR7Q 4IOCA 4BBSH 4KN7C 2R3ZA 2AUKA 2ZM6Q 1LABA 4F7XA 1M4VA 1CKNA 1PV4A 1RKNA 1XPUA 3CD6A 4PZ7A 1WTWA 4FO2A 1HR0W 3BVMA 1SJHD 3FRPB 4Y7NH 1XNRQ 1NY4A 1YJNA 2JXMB 4A4IA 2KECA 4CKEA 3S15B 3PIP3 1KQSA 1M90C 4PG3A 1VS0A 3FDTA 1MIUA 4F8MA 4G7OC 4HJ8A 3LGJA 1K28A 2XVSA 1EY4A 1Q46A 3NQTA 5HGQA 4OGQC 1I4XA 4C3HH 3I73A 3NSWA 1E2VA 2LY7A 3GTGH 4NXNQ 1A2UA 4N9TA 3DUZA 4BBRG 1UUPA 1QB5D 4MZ9A 2FXQA 4NKLA 1N36L 5IYDH 2YYZA 3TRZA 3PO2B 1AH9A 1HTLD 1Y8PB 2K28A 1OTCA 2H1EA 2VW9A 2JA7H 3A54A 5IGGA 4NB3A 3QJYA 4OO1H 2F1MA 2KHSA 3A8KE 5AJ3L 3PO3H 5EGTA 1CSQA 1HR0L 3J80L 1PH9A 4G57A 1PH8A 4DV4Q 3GQBA 5FLMG 2WKCA 4DK6C 4FF1A 4DR1L 4CGYB 4X62L 2VS1A 2IL8A 2B2TC 4KLKA 1ZYRD 4JG2A 4ZLTF 1RTNA 3KDFA 1E1TA 4LF8L 2OT2A 2KCMA 2MQHA 3I90A 3IKJA 2F0QA 1UE6A 4X65Q 3S2DH 4DV5Q 2EVBA 1EU4A 2RVLA 4O42A 4WJ3M 1HZAA 3LX0A 2SNSA 4A3JG 1SDFA 3HOUG 1STEA 2CFMA 3W2DA 1VQLA 1S40A 4R8IA 1J9OA 2KBNA 2WAQG 1PRTF 3OHXC 3PQIA 3GTMB 1LTID 2MUYA 1I94L 3FMCA 2JA5B 1JCKB 4GNXB 1S72A 3RZOB 3GO5A 1S5BD 1S5CD 4KV6A 2YV5A 1LO5D 4GKKL 2R92B 2Z4IA 1QVFA 4DR2L 4ZK9B 4B3ML 4JI7L 1STYA 3H91A 1Y1WG 3V05A 2CKZB 5LMNQ 2PNRC 4ME3A 3NK9A 1NMGA 4LW1A 1PH5A 4BBRH 4A3DB 4PZ8A 1KRTA 1BOSA 4AIMA 2MPMA 3BDOA 4U68A 2B63B 4ZYSA 4AYBE 4IUPA 2FJ2A 5NUCA 3UDFA 3TZUA 5BN4A 4I65A 3QB3A 3CQZB 1WOCA 5CORA 2Q8TA 5C0XH 1YNNC 4A3BG 2FMMA 2RSNA 1JC7A 3AEVA 5EAYA 3STBC 5C4HA 4HIOA 1STBA 5FLMH 3J7AF 4AYBB 3GTQB 3DWQA 3DMUA 1HNZL 5I6WA 4X64L 1W6JA 4IALA 3F2DA 2BCOA 1SFOH 1K8OA 1ZEQX 3RN5A 1HJPA 1CZWA 3DM1A 5JOBA 4RKLA 3GTOH 5J39A 1PXUA 1TXYA 3IFDA 2Q2UA 2PW5A 2VZAA 4A3JH 1BF4A 3HOUH 5JJKA 1DYQA 3TP5A 1G6ZA 1PTOB 3FKIB 3DWAA 2NVQB 5IWAL 1XNQL 5FKAC 1WTQA 3SEBA 2Z9HA 1SMYD 2B3GA 4QUCA 2EPBA 4L63B 4CDFC 5IP7G 5KNBA 2L11A 4JI4L 1BUVT 2K32A 3E9IA 4DXGA 1SXTA 4ZRZA 3OW7A 3S1MB 4IPCA 1R9TB 2B8FA 1FNWA 4L5QA 2EYJA 3MTSA 3Q8DA 2R7ZB 4LK1C 2EDGA 1SYGA 2K5HA 3S1NH 4P72A 3L2PA 3PIPA 1QOHA 3K5OA 3GD7A 1JOQA 1Y1WH 4R9WA 2F0MA 2YU9H 1CTMA 1AE2A 1A6XA 1V1QA 2H4OA 2NUCA 1PH6A 4FF2A 4NDXA 2DN8A 1A0IA 1WTHA 1JOOA 3K59A 4GOPA 1L2FA 1PRTB 1MKHA 3SR1A 3K80C 4OIKA 2KHIA 2F0GA 2CQOA 2MP1A 5DM63 3P20A 5IODA 5EBCA 4K14A 5D3DA 4DR1Q 2Q8RE 1ILPA 3WOFA 4DNRB 4A3BH 2UUAL 1HNXQ 3ER0A 1PFMA 5ELFA 1QNKA 5M5WB 1D7QA 1PYBA 4JV5Q 1NMFA 3AFPA 1JQYD 2ZTCA 1ASYA 1MGSA 1P8LA 2B39A 2JA6B 5C5LA 4LAAA 3RLFA 2N49A 5EKLA 3W5OA 3OIQA 2ENBA 3A0JA 3L7ZC 3R93A 1YZ6A 4A76A 2O2LD 5FOBB 4APVA 1WD1A 1N9WA 3OOCA 4IUQA 1EWCA 1TY0A 2SDFA 3H3VH 1XMQL 2MHVA 4IN3A 5JVG3 1TWFB 4B3RQ 2QGQA 1KAAA 3A7LA 1XYIA 4QGUA 1TS4A 1S5ED 4GKKQ 1VQ9A 3KLSA 4IUTA 1HH2P 5I2XA 1JB7A 4B3MQ 4JI0Q 2J4XA 4JI7Q 2E74C 1CKNB 2UXCL 3CCVA 1EOVA 1QWYA 1K83B 2X6LA 3HOZG 3NQIA 1Q12A 2PYKA 1WCMB 1I3QH 2JA8B 1KDAA 3EFXD 3NBIA 3KJPA 4Z9CB 1KC8C 3DEPA 1GVPA 4RG1A 4DN4M 3T1YL 4I7AA 5KRUA 2A68C 2B2YC 5CR3A 4RGTA 2JP1A 5I4DA 2LFNA 3S16H 1GJXA 1NBWA 4RGMA 1SNPA 2RQXA 2M2LA 1PMRA 4QB4A 1IKLA 4JBKA 1X3GA 3QO2A 1VQOA 2K7VA 1XTDA 1YI2A 3S2HB 2R93G 4M8AA 2K33A 1HNZQ 4X64Q 3KOJA 2D2CC 3K7AB 3SK8A 1F2LA 1LTSD 1IHZA 3D4DA 1Z9FA 3I4NG 5EKKA 4C1NK 1U4LA 4NXMQ 3FHWA 1CM9A 3HG9A 3J80c 3SXHA 3PMFA 5JPMC 3ULPA 1Y1VG 1Q1EA 3ICEA 2K04A 1LT4D 1TWHH 4DGZA 5EPKA 3J7AV 3T51B 2K1BA 1LTBD 2VUMB 3CCRA 1VQMA 3AQQA 3KDFB 4JI1L 4UHVA 5C4XG 3MXGA 4JI4Q 2F0HA 3CP0A 2QDLA 4R4IA 5IP9G 2B2UC 3F2UA 4LFAL 3VR6A 1CHPD 4QJFA 3HOVB 1HZ9A 1SYCA 2G5DA 3KLRA 4CBVA 4JYAQ 3MC0B 1Y14B 5IT9E 1PH4A 3CCJA 2D9UA 1VQFA 3G4SA 3VYSA 2E5LQ 2I0QA 1HFGA 4A3MB 3MXUA 1PZKD 3S1QH 3EBEA 5M3MB 1XPRA 1B44D 3HOZH 2A73B 2FMCA 4XYOA 3UI2A 1UE7A 2UUBL 3H3VC 4JOIC 2JA9A 1D5ZC 2CHBD 1SE4A 2LXKA 3GTPB 1DXMA 2DUDA 4XT1B 5CV7A 2VQEL 1EY5A 2NWGA 2NZHA 2UUCL 1QUQA 2XWBB 1F9QA 1VF5C 2N78A 1SNCA 4CJ1B 5LMUQ 3RZDB 3BVZA 2K4KA 1HNWQ 1JJGA 1RHPA 4JC0A 3ONAB 2R93H 3I4MB 2R61A 2B2VC 4EQPA 2G9HD 2A6HC 3DM3A 4YCVA 1HQRD 3I4NH 4DV3L 3A8JE 1GXDC 2CQAA 4JBMA 4IPGA 3T16A 1N33L 4DUZL 1Y1VH 3BDLA 2R7DA 5E4WC 4RFBA 1KTKA 1JB3A 4Y52H 4B9WA 1XMQQ 1TKWB 1CZGA 1A15A 2K01A 4DR4Q 3HKZE 4LF7L 1FJGL 2N3SA 1U4PA 2B2TA 5GADC 1WTPA 1K8AC 3S15H 2QDBA 1TWGB 2IHEA 2WACA 3K8AA 2EZVA 4LF4Q 2KCTA 2JA5G 4IUUA 5C4XH 4YCUA 5J3BA 4TQUS 3IL8A 5IYBG 3PIO3 3EVQA 4ZUJA 5IP9H 2R92G 3HKZB 5C0XJ 2VB3X 3CC2A 4A3DG 5F2DA 2K5NA 1T9HA 4UP7A 4HIKA 4MNOA 3BZDB 1PVOA 1CUKA 3NP8A 3TDQA 1RJTA 3HOYB 2EYPA 1STNA 2C9OA 4CDCC 1TQOA 3OTOL 5DNFA 4A3LG 1Q8IA 2VXWA 2E2IH 1KLUD 3E5SA 4AYBG 3GV3A 5C3EB 1IW7C 4NP5A 3NWTA 2N55A 1B9MA 2Z6BA 2IWHA 4GOPB 2XNAC 1SE3A 4KN4C 2HCCA 1VQGA 2FINB 1SNMA 3I3CA 4R1JA 1TU2B 1I4HA 3PGZA 1SLJA 1JWMD 4OWXB 4HJ7A 1XXGA 2PI2A 1SN8A 4IPDA 2NZOA 3TP6A 4JI1Q 1BBXC 3R8BA 3BZKA 2NYZD 2RSOA 1BDOA 4RH6A 4LF6L 1VQBA 3HOXB 3MEFA 4EVOA 1N8RC 2HHHL 1LTAD 2IT1A 3C46A 3GTMH 3TSSA 3GDEA 3EN2A 2JA5H 3TN2A 1AFPA 4IFDI 2R7ZG 3RZOH 5IYBH 1E1OA 5KYIA 3PUXA 2R92H 4FNFA 1O7ZA 1X55A 1CQVA 2UU9L 5M5YB 5M9OA 4YY3L 1CHQD 4BY1B 1LT5D 4A3DH 1B8AA 2NN6G 2ID0A 1RTOA 2XN9C 3R3OA 4DNIA 4OWWB 4K5VA 4HJ9A 4XT3B 4XQJA 5J1ZA 2VQEQ 4OEMB 5CYUA 3K5NA 4ABNA 1KIXA 2DJFC 1FD7D 1A63A 4HSVA 3A8IE 4MIUA 3ERQA 3W1BA 2A69C 4A3LH 5ELDA 2M9VA 2F4VQ 1MSHA 2ES2A 5DEHA 1PZJD 3A55A 1M8AA 1SAPA 3D31A 5CV6A 5FLXE 3GTQH 4LFBQ 4HMIA 1EIYB 1DCZA 1EU3A 2OXPA 4IJLA 4KTAA 3SGIA 1IL2A 2L12A 4DUYL 2HIVA 1NSNS 4KY7A 2RHQB 4KHPL 5C5MA 5CV9A 4DPGA 3EIVA 2BH2A 3KF8A 2VQFQ 5IIFA 2MFIA 4DR3L 5COYA 3UE1A 3GV6A 1RCVD 1PTOH 2K03A 1JE4A 2NVYB 4DV7L 2NVQH 4DR6Q 1I6HH 2HT1A 1EQTA 3D6CA 3PF5A 1K8GA 4XIGS 3SVMA 3PSIA 3DEOA 2RCFA 4ZKBB 3S1MH 2IPKD 4JCVE 2A68D 1R9TH 1K0SA 1UNSA 3GTJB 1FVIA 3EROA 2HD3A 1H9JA 4RGOS 3K58A 1WCMG 2R7ZH 4YWLA 2JA8G 5JJZA 4JI5Q 2BDNA 5C0XG 3CMEA 5EPJA 5GQOA 2E75C 2UXDL 3PIOA 1NE3A 1E24A 4IO9A 2Z6KC 1C7YA 1EL0A 3OMGA 4KKUA 3ZJYC 2NN6H 1F2YA 2A6ED 4A3IG 2KJXA 5EKIA 3J81c 1PHJA 4MN3A 1B1ZA 1GHJA 1VQIA 2PZTA 2F3WA 4OELB 1IXRA 2XRQD 1VQAA 2PCFB 1A62A 1J6QA 4E6IA 2QILA 4GKJL 1GUGA 2GA4B 5M5WH 3T1HL 1QZGA 1QVCA 2B2YA 2WINB 1VCIA 4YIJA 2AUJD 2TMPA 3Q6SA 4ZAIA 1SNQA 4DAVA 1QUQB 2KENA 4MTKA 1BNZA 2OTLA 1B53A 4DR5Q 4KK7A 1EFWA 4HTHA 3BVGA 5JPNC 1DZ1A 1J5EL 4LF6Q 4CKCA 4JI6L 4H13C 1HPCA 4BWGB 2WV6D 5IGCA 3U4VA 5HURA 4GZYC 2F0SA 3HOVG 2XIWA 1TWFH 5BN3A 1TWCB 2HDMA 4IUVA 2ATWA 4N9PA 1ENFA 1HZBA 4CJ2C 1TS5A 4DV0L 3E6ZX 3CC4A 4K0KL 1RIPA 1F9PA 1HUNA 1JWSD 4BXXG 2IX1A 2K6AA 4OWTB 3JAMi 4V190 5KNDA 5TSSA 1E2ZA 1K83H 1H9SA 1D5XC 1WCMH 1E0BA 3SDZA 2PW7A 2CCZA 3VR2A 2JA8H 1EY6A 3QWNA 5IGFA 4LF9Q 4XXEA 4K5XA 2MJ8A 1N34Q 2B2UA 5DAUA 5HGTA 1TR5A 1PTOC 3VDYA 3RR5A 4HJAA 2JE6I 2PQAA 2K5QA 3VA7A 1AE3A 3PV0A 4UP9A 1FYCA 4FDBA 5BN5A 2KQ3A 3GP7A 4A3IH 3S2HH 1I50B 4G7HC 3IFTA 1S3OA 1XMOL 1NUCA 3K7AH 1Q1BA 4QUFA 4KD4A 4DK0A 4BS9A 2EY2A 4J15A 2L55A 2JYOA 3VYUA 2AMCB 3GTLB 4KHPQ 1D1IA 5CGKA 4JOIA 2N8NA 1EYAA 5FO8B 2A19A 1B3QA 2F0NA 4U673 4QCLA 1IBML 4BBSB 1WYDA 4YHHL 2F0UA 3G6JB 4KY5A 2SOBA 2LKVA 2PI2E 1ICFB 2QKIC 5BR8L 2ALYB 2VUMH 1UE5A 4B3TL 2F0PA 4LF5L 2KHJA 4CDDC 2ZJQA 2B2VA 2P5ZX 1LTLA 4ZQ3A 1C0AA 2UXBL 1U4MA 1SYFA 1N36Q 3UDIA 3NHHA 3D0FA 5LL6X 1EZ6A 3HOVH 1KHIA 1IZ6A 1D5MC 2YTYA 2DNCA 2ZTDA 3HKZG 1FL0A 2V1CC 3MFYA 2C35B 5E4XA 1NR4A 5I9PA 2F3VA 4C3HB 1AZQA 4BXXH 3M9BA 5AJ3Q 4L8JA 4A3MH 2EJMA 4JI8L 1HR0Q 2IJ0A 4PMWA 3HZXA 3QR8A 1ESFA 1V1OA 5M3MH 1YIJA 4HAEA 1PA6A 1E22A 4DV2L 2OWOA 3Q24A 3D4WA 3NUCA 3CMAA 2Q2TA 1SYDA 1BO0A 3HOYG 4V0BA 1EQQA 1FNVA 1KNEA 4R8NA 2F0KA 4AQYL 4X62Q 1IBLL 2SNMA 3HFZB 3PO3B 4A3EG 2BE5C 3G7LA 4BY7B 3A5UA 4ME5A 1BBWA 4LF8Q 3GTPH 2NVXB 5C3EG 4KJNA 4GKJQ 2HUGA 2IHFA 1GHKA 1GM5A 3RZDH 4PQXA 1SJED 1ASZA 2MGSA 3PF4A 2QEXA 4PZ6A 2AQ1B 3OYYA 1L1OC 4C3JB 2A8VA 1Y8NB 2WB1E 5IYCG 1WTXA 4WORA 3J7A5 3CCMA 2EJGC 1TY2A 1JJ2A 4K6LA 3M4PA 4X3KA 1I94Q 1MJEA 4WJ4A 1EY9A 3RMHA 3HOXG 3L0OA 4PMBA 3NBHA 1K9MC 5A35A 2WB1B 4TRDA 4GN4B 2PPBC 1QJOA 1TWGH 2OCEA 4K6DA 5ELOA 4DR2Q 3CPFA 1Q82C 4K0KQ 5CBAE 1FNUA 1IYVA 1PFSA 5K36G 3BU2A 1S4ZA 1MHWC 3K0XA 2E2DC 5HY6A 3KF8B 1DOLA 1X3QA 3QIAA 2EXDA 2XSCA 3AB9A 3H15A 4A3GB 3M3YH 1F2MA 4BY1G 2NVTB 2D5DA 4JI3L 2HDLA 1B2TA 1MJCA 5FO7B 3IAYA 2M00A 5IT9L 4OX9L 1E2WA 4X6AH 4IFDJ 3PUYA 1VQ4A 3HOYH 1RF2D 4H44C 3M4QA 1CKOA 1P16A 5IGEA 2A5HA 5JJLA 1K3RA 3G71A 2L1BA 4A3EH 1TS2A 4UDUC 1T5XD 3L3OC 3I72A 3RUZA 5C3EH 4KKSA 4DV1L 2D62A 4IQZA 2DJGC 1Z7TA 1SR3A 3FPPA 2E2JB 2WP8J 3FP9A 2BDOA 3KUPA 1KDCA 4X66L 5IWAQ 1XNQQ 1B4OA 2HCIA 3JAME 1O7LA 5KIXA 1QZHA 1GOZA 3C1FA 2O5IC 5IYCH 2EYMA 3QOLA 4GS3A 3DXJC 2EYHA 3RN2A 1EWIA 1X6OA 4RAUC 3MZ5A 4R4OA 3U4ZA 1KLGD 2AQ3B 1ZYRC 5FJ8G 1DGSA 4OXPA 1LT6D 3KJOA 2F0EA 3SHLA 3VR5A 1IYUA 3HOXH 2D0OA 3RNUA 4IJHA 2I5LX 4L5TA 5C3XA 1K0RA 1U5KA 3BYYB 2K5WA 3I4OA 3LNNA 3SK4A 1VQDA 1X3EA 3O13A 1HTPA 1QILA 3CRLC 4RWSC 3PO2G 1PLFA 5K36H 2EJFC 3J81L 4HMJA 2F3IA 3PCOB 3S17B 1BQQT 1H9RA 4I7ZC 1F77A 1FGBD 1GUSA 4HCSA 2E2HB 3MHBA 4LFCL 3AFQA 3D4RA 3OWEB 5M5YH 3VYTA 1Z6HA 4NPSA 1Y1WB 1RDPD 3AU7A 3H0GB 1A8VA 3M85A 4AQYQ 4BY1H 1X54A 1KDBA 2SEBD 3K57A 4M1UB 2UUAQ 1EYDA 4K8JA 3JC66 2HQLA 2ASBA 4IURA 4DAMA 2RHSB 5M5XB 2KCNA 1VQ5A 1DJRD 1VQ7A 1H9SB 4DV6L 2GVBA 4RHRA 3SK6A 2WKDA 1NAPA 3FVQA 4F87A 3NEMA 2AKWB 4LNQA 2EY1A 3ND8A 1GO3E 1CSPA 1UEAB 2RBMA 4AH6A 3ZYYX 2Z6KA 2DNEA 2F0DA 3HEJA 3HOWB 5A2QE 5DLQE 5JAVA 3TREA 3KFUA 2KEEA 1EYCA 1IKMA 3OMCA 4L5RC 1EIFA 3BJUA 1C8CA 1XPOA 3HRZC 4O0AA 4X3UA 1U9RA 2XTIA 3I4LA 4DR7L 3SE0A 2UXCQ 2RKSA 2NVYH 5C44B 1ML0D 5FJ8H 2TSSA 4EGVA 4DKAC 2J7ZA 4FXKC 4HEDA 4NW2A 1EIGA 1XX8A 2LMCB 1ENCA 1A3TA 1YNND 4X3TA 4R4CA 1SYEA 1TWAB 3T1YQ 4KI0A 3STBD 4BA1I 2B63G 1ESRA 3PO2H 1EZ8A 1L0WA 3NTKA 3ERSX 1SMYC 3BS1A 2R6GA 3HKSA 1YJ9A 3DWPA 3C2PA 2B8GA 4GN3B 1I4GA 5M3FB 1DOKA 2PQEA 1II3A 3J81j 3DLLA 3S16B 1FR3A 2AWNA 1RD9D 4IFDG 3D3RA 1PH1A 1W3SA 5ELNA 3A56A 1SYBA 4DV1Q 1WTRA 1Q86C 3E0JA 3J80i 1WTVA 2RCNA 1G6PA 3HP3A 2EQSA 1QVGA 2F0LA 3S1RB 1Z47A 1ILQA 3KF6A 1CI3M 3FKIG 1CQFA 1ONLA 1YITA 2PMZB 3M7GA 1D6EC 2JJQA 2B29A 2NZ1D 4LFAQ 4PV1C 3MA2B 3ND9A 1QCBD 4X65L 5FLXL 1HXYD 1ZKOA 3I2ZA 2LS01 1HHVA 1X65A 2I07B 2JEAI 4GLVB 1V43A 1BCPC 2QF7A 3CCUA 1ICWA 1KRSA 1TWCH 5CC4A 3NTHA 2OQKA 3PUWA 4N8FA 1LTGD 2CW0C 4OIJA 4QL5A 1NJIC 1NCVA 4XDXA 3OWFA 4LUVA 1B7YB 2EXZA 4LFCQ 2UUBQ 1EY8A 3TP8A 3U58A 2BE5D 1GUWA 4J1MA 1MBYA 3NBHB 3M7NA 2K52A 2ZXRA 1SROA 4JW0A 2B63H 1YJWA 3FPUB 1TIID 2VL6A 5T1GA 1VQHA 3H94A 3TQYA 2UUCQ 1EWHA 4P74A 2PO4A 3VA5A 3CQZH 2F0VA 2K75A 2OTJA 4K5WA 4BY7G 1AP0A 3N6RA 4DF7A 3CC7A 1OXVA 3ITPA 4DV6Q 1B70B 5L37A 4DV3Q 5IGDA 1OXTA 5IE8A 2EOTA 4IFDH 5IT9c 1EIHA 2WIIB 1H9MA 1I50H 3QG1A 1N33Q 1Q3LA 2JA6G 3C3LA 4DAYA 4DUZQ 2R93B 1PYSB 4ZKCB 5ISRA 4C3JG 4P71A 4KMUC 1EQVA 1VMCA 4JBJA 5IOCA 3EA6A 2HIXA 4QIWB 4CKBA 4BA2I 3K0YA 1ZXTA 4WRDA 3GTLH 1K3BC 2AHOB 4NMZA 3OW2A 2Q2IA 1FJGQ 1JOKA 4LF7Q 1GUNA 1A3VA 2QW7A 1X32A 5EJWA 5ELEA 4XTCS 3FKIH 3U50C 2A74C 4OO1I 1YNJC 1VDZA 2WB1G 4DU9A 3CU7A 1SE8A 2B2WC 1EUJA 1MD2D 4DA2A 1R4PB 2KEDA 1KXLA 3W1GA 1L1OA 2XWJB 3A7AB 3H09A 2NN6I 4DK1A 1CA6A 1HA6A 5C4XB 1G8ZD 1O78A 3OSOA 1G2SA 1L0XB 1SBBB 1VMPA 3M4OB 4GLAC 1FGUA 1UAPA 4KJOA 1WVLA 2ZT9C 4A3GG 5C3WA 1EQRA 4GN5A 1R4QB 2BA0A 2L4NA 4F88A 4LJZC 3TP7A 4RGNA 1SNDA 3I70A 3X3MA 2BH8A 4A3KB 1VQNA 4GLXA 1I5FA 5T1IA 5C4JB 4G7ZC 1GUOA 1VF7A 3OTOQ 1I4PA 2RF4A 1V9PA 3P7JA 4EX5A 4EQOA 2RDGA 2F0FA 4GNXC 3K81C 3V96A 3MXNA 1STHA 1GUTA 1OXUA 1X56A 4A3FB 5KGUA 3MXPA 4BY7H 4HIDA 3ULLA 4J6HA 4A3CG 2E2IB 3KK7A 2NVXH 1K8MA 1PTOF 1HRJA 4ZCKA 1PFNA 1G91A 2EYLA 3WOEA 5IY0A 2CVRA 2VY3A 2XRSD 2Q8IB 1M1KC 2JA6H 3F2CA 4A93B 2EY5A 4CDEC 1DD2A 4C3JH 1AZPA 1HNXL 1L0YB 1LTRD 2VUMG 5K5PA 1B50A 4JV5L 1KD1C 3F2BA 1Q8KA 2HHHQ 2IW3A 2NTSA 4H7BA 4KY6A 2X6GA 4KD3A 3F1ZA 2IX0A 1B9NA 2EYFA 2OQ0A 3KBGA 1QNUA 5C0XI 2Z0SA 5AFWA 3V2TA 3X3NA 4UP8A 5CV5A 1XJVA 4C3IB 4A3MG 1PH7A 2UU9Q 1SRUA 5M3MG 2LXJA 1YVCA 3E0EA 4YY3Q 1O80A 4B3RL 1DOMA 4G4KA 3UDXA 3J80E 1ET9A 1ENAA 2DY8A 1K73C 3I55A 4A3GH 3U9OA 2F0JA 4JI0L 3CW2C 2CH4W 2NVTH 3H0GG 3U9SA 4FP5D 2A6HD 2IX3A 3GTKB 4WJWA 2QA4A 1CFMA 3S14B 1CKMA 4MTNA 5DM73 5CBEE 1V1PA 2H5XA 3OIPA 3A74A 4C2MB 1HA5A 2RDFA 5LL6S 4DFAA 2L9HA 2VB2X 3I4MG 2K5VA 3AMUA 5FK9C 3CCEA 1QG7A 3H6MA 1V8QA 1TS3A 1SE2A 4EQ5A 4DUYQ 2JEBI 4JBWA 4P73A 3TEHB 3CCQA 4L5SA 3N52A 1YHBA 1UE1A 4TSSA 4A3CH 5ELBA 4DR3Q 3HOWG 1PRTC 2E2JH 1A3UA 1EY0A 2OEOA 1AEXA 4B3SL 4DV7Q 4NXML 4FYDA 5I9OA 4Y7NB 5FO9B 1X9NA 1HUMA 3CXCA 4RHSA 1OO9B 2CWAA 1UEBA 1B3AA 3P75A 3ULJA 5I2YA 1MSGA 2OF1A 2C5CA 5C44G 3NE5B 1KABA 1I6HB 1D2BA 1WJJA 3KF6B 4KHVA 3MVVA 1HZCA 4R4QA 1A2TA 5GAEC 3GTGB 4KHZA 5FLXc 1G291 1U0LA 3TZDA 4KKTA 3G6EA 1MI2A 3NPPA 2MO0A 4OONA 2UXDQ 2F0WA 1JR0D 4JYAL 1JORA 2FFKB 1C4QA 1IW7D 2QEJC 3S17H 4MHEA 5G3LD 5IGBA 3I91A 1F9SA 4HN7A 2JA7B 2AWOA 2GN5A 2E2HH 4HR7B 2E5LL 2K50A 5M3FG 3D6WA 3J7YW 1T5EA 4EQNA 2QCPX 3H0GH 1X3PA 5JEAJ 3J81i 4ULLA 4RCNA 3RLOA 5C6AA 4FF4A 4JK1C 3H3VI 3T1HQ 3E9HA 1J8IA 2Z1CA 3PUZA 2Y0SE 5EBDA 5LHY1 5M5XH 3I4MH 4K2LA 2NBFA 4UPAA 3NTIA 1IYJB 4YCWA 3Q23A 1STGA 3BYTB 5LMUL 3CHBD 1I4RA 3S2DB 1J5EQ 1JICA 1HNWL 2LSSA 1KAWA 1RL2A 4JI6Q 1BCPD 2Y0SB 3HOWH 2EYOA 2K05A 3NENA 4LWCA 3T53B 1SEBD 2CW0D 5GROA 4LMQD 4DV0Q 4DAYB 1CT1D 2EIFA 4HSPA 2X69A 2I5MX 1D8LA 2RA4A 3JAML 1VQEA 1S5FD 2E76C 5C44H 1IBKL 4DR4L 4DAPA 1F2ZA 4HJ5A 3HS0C 4DNTB 3NELA 3URYA 2PZWA 4LF4L 5C4ZA 1JJCB 5IP7H 2E8GA 4J8QA 1KNAA 5GAGC 1YNXA 4TVAB 1TWAH 3T56B 1Y69U 4BBRB 1LACA 1EEFD 3UE0A 1WTOA 2A69D 2O5JC 1BVSA 3S9WA 3R2IA 4FVMA 2JQOA 1L1OB 3S24A 2FHTA 2HQEA 3VYRA 4FF3A 1N32L 1XMOQ 5M3FH 1BR9A
chains in the Genus database with same CATH topology
4LUOA 4BA1I 2NVQH 4R4TA 4DV7L 3PO2H 4DR6Q 3GTOH 1I6HH 2HT1A 3PF5A 1L0WA 4P75A 2WFWA 3ERSX 2R6GA 1K8GA 4XIGS 3HKSA 3PSIA 1YJ9A 1SMXA 2DGYA 1TXYA 1VQPA 2Q2UA 3CCSA 3S1MH 2VZAA 4GN3B 4JCVE 1R9TH 1LUZA 4A3JH 5JJKA 3HOUH 3J81j 1FVIA 1YHAA 1OXXK 5IWAL 3DLLA 1IBMQ 2ZJRA 1XNQL 1WCMG 2R7ZH 4YWLA 4YHHQ 2AWNA 2B3GA 2WAQE 4B3SQ 2JA8G 3MXNB 4IFDG 5IP7G 4JI5Q 5BR8Q 1PH1A 1W3SA 3S1RH 3J7ZC 5ELNA 4B3TQ 4JI4L 4LF5Q 1C9OA 5C0XG 3E9IA 4DV1Q 1JT8A 3CF5A 3CMEA 1GD7A 5GQOA 4IPCA 3AYHB 1Q86C 3J80i 2UXDL 3PIOA 1NE3A 1E24A 4IO9A 2Z6KC 1C7YA 2UXBQ 4L5QA 2RCNA 3ZJYC 1G6PA 2EQSA 3CCLA 3Q8DA 1QVGA 3UDGA 2K5HA 3S1NH 2YTXA 4A3IG 4P72A 1O7IA 3J81c 3PIPA 3L2PA 2MO1A 1PHJA 1Z47A 3KF6A 3GD7A 1VQIA 1Y1WH 3FKIG 1YBYA 2YU9H 4IOAA 1AE2A 1IXRA 1V1QA 1PH6A 1VQAA 1A62A 1J6QA 1YITA 1A0IA 4JI8Q 4GOPA 2JJQA 1L2FA 1VQJA 1BBUA 1MKHA 2B29A 4LFAQ 4GKJL 4X65L 5M5WH 3K80C 2MNAA 4DV2Q 3T1HL 1QZGA 3I2ZA 1X65A 2KHIA 1QVCA 2CQOA 2JEAI 4GLVB 1VCIA 4A3KG 1V43A 4DR1Q 3CCUA 1IBLQ 1LYLA 1BKBA 1JE5A 1KRSA 1QUQB 4A3BH 1TWCH 2KENA 2OTLA 2OQKA 2UUAL 3PUWA 4DR5Q 1HNXQ 3ER0A 1D7QA 4QL5A 1EFWA 1PYBA 1NJIC 4JV5Q 1J5EL 3KLWA 4LF6Q 4LUVA 1NMFA 3AFPA 1B7YB 4JI6L 2ZTCA 1ASYA 4LFCQ 1P8LA 3F8TA 4A3FG 2UUBQ 3U4VA 3U58A 1WFQA 4JI2L 3NBHB 1UWVA 3RLFA 3HOVG 5E7NA 2K52A 5JEAG 1SROA 1TWFH 3M7NA 2ATWA 2B63H 1YJWA 2N49A 1HZBA 3W5OA 3A0JA 3L7ZC 4DV0L 2VL6A 1YZ6A 3CC4A 4K0KL 1RIPA 1VQHA 3TQYA 4A76A 2UUCQ 4P74A 2PQAB 4APVA 4BXXG 3KYHC 3CQZH 2IX1A 4YWKA 4LUZA 1YEZA 2K75A 1N9WA 4A93G 4OWTB 3JAMi 4BY7G 2OTJA 3H3VH 3CC7A 1OXVA 1XMQL 4B3RQ 1K83H 4DV6Q 2QGQA 1B70B 2F4VL 1WCMH 4GNXA 1Q7YC 4QGUA 4DV3Q 2CCZA 2JA8H 1OXTA 5IE8A 4GKKQ 4LFBL 4LF9Q 5IT9c 1VQ9A 1HH2P 1I50H 1N34Q 1N33Q 2JA6G 4HIMA 1JB7A 3VDYA 4B3MQ 2GVAA 4JI0Q 3RR5A 1CKNB 4DUZQ 1PYSB 4HJAA 2ZM6L 2UXCL 2JE6I 3CCVA 4P71A 2PQAA 1EOVA 4RMFA 3HOZG 1XNRL 4JBJA 1AE3A 1Q12A 4YWMA 2HIXA 3PV0A 1I3QH 4IPHA 4UP9A 4BA2I 4FDBA 2VQFL 3GTLH 2AHOB 3IRBA 4GOPC 2ZTEA 2Q2IA 3OW2A 1IBKQ 1VQKA 4LF7Q 3KJPA 4A3IH 1FJGQ 1KC8C 3S2HH 1GVPA 2I5HA 3TS2A 1S3OA 1XMOL 3I56A 4RG1A 3T1YL 4XTCS 3GTJH 3K7AH 3FKIH 4JI3Q 1Q1BA 4DR6L 3U50C 3M4OH 3S16H 4OO1I 1NBWA 4J15A 1VQCA 2WB1G 2AMCB 4OX9Q 4KHPQ 1SE8A 1X3GA 4JBKA 4JOIA 1X3FA 1EUJA 1VQOA 4NXNL 2N8NA 1KXLA 1XTDA 1YI2A 2R93G 2IY5B 3W1GA 1L1OA 2A19A 1HNZQ 2NN6I 4X64Q 3KOJA 4A3KH 1OXSC 1IBML 1N32Q 5C4JH 1Z9FA 3I4NG 2ZJPA 1WYDA 4YHHL 4GLAC 1FGUA 1NTGA 2PI2E 3FHWA 3PUVA 3J80c 4NXMQ 4A3GG 1EQRA 4JI5L 4GN5A 5BR8L 2BA0A 3ULPA 2ALYB 2VUMH 1UE5A 4B3TL 4LF5L 2KHJA 2ZJQA 1Y1VG 1Q1EA 1LTLA 3ICEA 2PMZE 1H95A 4DK3C 1C0AA 2BH8A 2UXBL 1VQNA 4GLXA 1I5FA 4A3FH 1TWHH 5JJIA 4DV4L 1N36Q 3UDIA 3D0FA 3OTOQ 1WI5A 3HOVH 1KHIA 1IZ6A 2RF4A 2YTYA 4POFA 4X66Q 2YTVA 2ZTDA 1V9PA 2CWPA 3G48A 3HKZG 1FL0A 3CCRA 4EX5A 2V1CC 1VQMA 2C35B 3AQQA 4GNXC 3K81C 3KDFB 4JI1L 5C4XG 1G51A 4JI4Q 4O2DA 4BXXH 3M9BA 5AJ3Q 4BBSG 3CP0A 1OXUA 1X56A 4R4IA 3WWVA 5LMNW 4A3MH 4JI8L 1E3PA 5IP9G 4PMWA 4A75A 1HR0Q 1LM0A 4HIDA 4LFAL 5M3MH 1YIJA 4QJFA 3ULLA 4A93H 1HZ9A 1PA6A 1E22A 4DV2L 2NVXH 2OWOA 3I7FA 2JK8A 4A3CG 4JYAQ 4QQBX 4QY7A 4DV5L 3CMAA 2Q2TA 1Y14B 1GKHA 2F52A 1PH4A 2BA1A 2Q2HA 3HOYG 3CCJA 1Q81C 5IY0A 3STBD 1EQQA 1VQFA 2VY3A 2K14A 3G4SA 4AQYL 2E5LQ 2I0QA 1M1KC 1VQ6A 4X62Q 1IBLL 2JA6H 3F2CA 3HFZB 4A3EG 3A5UA 1VQ8A 3S1QH 1BBWA 3EBEA 4C3JH 4DR5L 1XPRA 1HNXL 4LF8Q 3GTPH 2VUMG 3HOZH 1KL9A 5C3EG 4GKJQ 4JV5L 2IHFA 1KD1C 3F2BA 1GM5A 2VNUD 3RZDH 3K7UC 1UE7A 1Q8KA 4H02A 2HHHQ 2UUBL 4C3IH 5H1SE 4JOIC 1JMCA 2JA9A 1ASZA 5IYDG 3PF4A 2QEXA 4PZ6A 3B6YA 3F1ZA 1L1OC 2LXKA 3OYYA 2IX0A 2R7FA 1PH3A 2OQ0A 1YHQA 2A8VA 2WB1E 5IYCG 2DUDA 3TS0A 3JAMc 5C0XI 2VQEL 2JA7G 2NZHA 2Z0SA 3J7A5 3CCMA 2UUCL 1QUQA 4UY8C 2N78A 4OO1G 5LMUQ 1JJ2A 5LMNL 3BZCA 2K4KA 4UP8A 3PO3G 1HNWQ 1JJGA 3M4PA 3A5ZB 4JC0A 4A3MG 1XJVA 1PH7A 2UU9Q 4BY7H 1SRUA 2R93H 1I94Q 1MJEA 5M3MG 2LXJA 1YVCA 3E0EA 4QIWE 4YY3Q 3GTKH 4B3RL 4WJ4A 3DM3A 1PH2A 3S14H 4POGA 4YCVA 4JI2Q 1W2BA 2PNHA 3I4NH 3UDXA 3HOXG 3L0OA 4C2MH 4DV3L 1K9MC 1K73C 3I55A 4JBMA 4LF9L 4GN4B 4IPGA 2A1AA 3RLNA 5GAHC 4A3GH 1TWGH 5ELOA 2OCEA 4DR2Q 1N34L 1Q82C 3CPFA 4JI0L 1N33L 4K0KQ 4DUZL 1Y1VH 2R7DA 3CW2C 2B63G 2NVTH 3H0GG 1PFSA 5K36G 3BU2A 3K0XA 1EYGA 2QA4A 5HY6A 4Y52H 1CKMA 3KF8B 4MTNA 2D0PA 1XMQQ 2L15A 2H5XA 3A74A 4ALPA 3CAMA 2EXDA 4DR4Q 3HKZE 4LF7L 1FJGL 1E7ZA 2N3SA 3H15A 5GADC 3S15H 1K8AC 2IHEA 3K8AA 3I4MG 2K5VA 2Y0SG 4LF4Q 3M3YH 3CCEA 2KCTA 2JA5G 4BY1G 4JI3L 5C4XH 3CPWA 2XGTA 4YCUA 5J3BA 4DR7Q 4IOCA 4TQUS 5IYBG 4BBSH 4EQ5A 2ZM6Q 4DUYQ 1MJCA 2JEBI 4JBWA 4P73A 1CKNA 3TEHB 5IP9H 3CCQA 1PV4A 1XPUA 2R92G 4PZ7A 1HR0W 4OX9L 4L5SA 3CD6A 4Y7NH 1YHBA 1UE1A 4X6AH 1XNRQ 4A3CH 1NY4A 1YJNA 4IFDJ 4A4IA 3PUYA 1VQ4A 5C0XJ 1KQSA 1M90C 3CC2A 4DR3Q 4PG3A 3HOYH 3HOWG 2E2JH 3M4QA 1VS0A 4A3DG 1CKOA 1P16A 5JJLA 1K3RA 1MIUA 3G71A 2K5NA 1T9HA 4UP7A 4HIKA 4HJ8A 4MNOA 4A3EH 4B3SL 3LGJA 4DV7Q 4NXML 1Q46A 1PVOA 5HGQA 1X9NA 1CUKA 3CXCA 5C3EH 4DV1L 4C3HH 2CWAA 2D62A 3GTGH 4NXNQ 1SR3A 1UEBA 4BBRG 4MZ9A 2FXQA 2WP8J 3FP9A 3ULJA 1N36L 5C44G 3OTOL 5IYDH 4A3LG 2YYZA 3TRZA 2E2IH 4X66L 5IWAQ 1XNQQ 1QZHA 1AH9A 1WJJA 3KF6B 4AYBG 5IYCH 1OTCA 2VW9A 2JA7H 1HZCA 4R4QA 4NB3A 4GS3A 5GAEC 4KHZA 5FLXc 5AJ3L 1G291 1U0LA 3RN2A 4GOPB 1EWIA 3PO3H 1X6OA 3G6EA 1CSQA 4R4OA 3U4ZA 2MO0A 4OONA 1HR0L 2UXDQ 1VQGA 5FJ8G 1PH9A 4R1JA 1DGSA 4OXPA 1PH8A 3KJOA 4DV4Q 4JYAL 5FLMG 3S17H 3PGZA 3HOXH 1SLJA 2D0OA 3RNUA 4IJHA 2I5LX 2AWOA 2GN5A 4L5TA 4OWXB 4DK6C 1K0RA 1U5KA 2E2HH 4HJ7A 4DR1L 2E5LL 3I4OA 2K50A 4X62L 2VS1A 2PI2A 5M3FG 1SN8A 4IPDA 2NZOA 4KLKA 4JI1Q 1VQDA 1X3EA 3PO2G 4JG2A 3H0GH 3KDFA 3BZKA 5JEAJ 3J81i 1E1TA 4LF8L 2KCMA 2MQHA 2F3IA 3PCOB 3RLOA 4LF6L 1VQBA 1UE6A 4X65Q 3MEFA 3H3VI 1N8RC 3T1HQ 2HHHL 3S2DH 3E9HA 4DV5Q 3PUZA 2Y0SE 4LFCL 3AFQA 4WJ3M 2IT1A 5M5XH 1HZAA 3GTMH 3I4MH 4A3JG 3GDEA 5M5YH 3HOUG 3EN2A 4NPSA 2JA5H 2CFMA 4UPAA 4AQYQ 1VQLA 1A8VA 3M85A 4BY1H 4IFDI 1X54A 1S40A 2R7ZG 3RZOH 5IYBH 1E1OA 2KBNA 1IYJB 4YCWA 2UUAQ 3PUXA 2WAQG 2R92H 5LMUL 3JC66 2HQLA 2ASBA 4DAMA 1X55A 1J5EQ 1HNWL 2RHSB 1KAWA 2LSSA 1RL2A 2UU9L 4JI6Q 1I94L 1VQ5A 1VQ7A 3HOWH 4YY3L 3NENA 4DV6L 4GNXB 2GVBA 4LWCA 1S72A 4A3DH 4JI7Q 1B8AA 3GO5A 2NN6G 3NEMA 2AKWB 2ID0A 4DNIA 2YV5A 4LNQA 4OWWB 5GROA 4GKKL 4DV0Q 4HJ9A 1GO3E 4DAYB 1QVFA 1CSPA 4DR2L 4AH6A 2VQEQ 4B3ML 4JI7L 2Z6KA 2EIFA 1Y1WG 1KIXA 2CKZB 2I5MX 5LMNQ 1D8LA 4ME3A 4LW1A 1NMGA 1PH5A 1A63A 4BBRH 1VQEA 4PZ8A 1KRTA 4AIMA 5C44H 3W1BA 4A3LH 5DLQE 1IBKL 4DR4L 3TREA 3KFUA 4AYBE 4HJ5A 2F4VQ 2ES2A 4L5RC 1EIFA 3BJUA 3NELA 3UDFA 3D31A 4LF4L 3GTQH 4LFBQ 1JJCB 5IP7H 1XPOA 2E8GA 4O0AA 1EIYB 1WOCA 2XTIA 4DR7L 5GAGC 1YNXA 4TVAB 1TWAH 4IJLA 3SGIA 1IL2A 4DUYL 4A3BG 2UXCQ 3UE0A 2NVYH 2HIVA 3AEVA 5EAYA 2RHQB 3STBC 5FJ8H 1BVSA 4HIOA 4KHPL 2JQOA 4DKAC 1L1OB 4DPGA 3EIVA 5FLMH 2VQFQ 2BH2A 3S24A 1HNZL 2MFIA 4DR3L 4X64L 3UE1A 3F2DA 1SFOH 1N32L 1XMOQ 4R4CA 5M3FH 3RN5A 3T1YQ 1HJPA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUO A;  4BA1 I;  2NVQ H;  4R4T A;  4DV7 L;  3PO2 H;  4DR6 Q;  3GTO H;  1I6H H;  2HT1 A;  3PF5 A;  1L0W A;  4P75 A;  2WFW A;  3ERS X;  2R6G A;  1K8G A;  4XIG S;  3HKS A;  3PSI A;  1YJ9 A;  1SMX A;  2DGY A;  1TXY A;  1VQP A;  2Q2U A;  3CCS A;  3S1M H;  2VZA A;  4GN3 B;  4JCV E;  1R9T H;  1LUZ A;  4A3J H;  5JJK A;  3HOU H;  3J81 j;  1FVI A;  1YHA A;  1OXX K;  5IWA L;  3DLL A;  1IBM Q;  2ZJR A;  1XNQ L;  1WCM G;  2R7Z H;  4YWL A;  4YHH Q;  2AWN A;  2B3G A;  2WAQ E;  4B3S Q;  2JA8 G;  3MXN B;  4IFD G;  5IP7 G;  4JI5 Q;  5BR8 Q;  1PH1 A;  1W3S A;  3S1R H;  3J7Z C;  5ELN A;  4B3T Q;  4JI4 L;  4LF5 Q;  1C9O A;  5C0X G;  3E9I A;  4DV1 Q;  1JT8 A;  3CF5 A;  3CME A;  1GD7 A;  5GQO A;  4IPC A;  3AYH B;  1Q86 C;  3J80 i;  2UXD L;  3PIO A;  1NE3 A;  1E24 A;  4IO9 A;  2Z6K C;  1C7Y A;  2UXB Q;  4L5Q A;  2RCN A;  3ZJY C;  1G6P A;  2EQS A;  3CCL A;  3Q8D A;  1QVG A;  3UDG A;  2K5H A;  3S1N H;  2YTX A;  4A3I G;  4P72 A;  1O7I A;  3J81 c;  3PIP A;  3L2P A;  2MO1 A;  1PHJ A;  1Z47 A;  3KF6 A;  3GD7 A;  1VQI A;  1Y1W H;  3FKI G;  1YBY A;  2YU9 H;  4IOA A;  1AE2 A;  1IXR A;  1V1Q A;  1PH6 A;  1VQA A;  1A62 A;  1J6Q A;  1YIT A;  1A0I A;  4JI8 Q;  4GOP A;  2JJQ A;  1L2F A;  1VQJ A;  1BBU A;  1MKH A;  2B29 A;  4LFA Q;  4GKJ L;  4X65 L;  5M5W H;  3K80 C;  2MNA A;  4DV2 Q;  3T1H L;  1QZG A;  3I2Z A;  1X65 A;  2KHI A;  1QVC A;  2CQO A;  2JEA I;  4GLV B;  1VCI A;  4A3K G;  1V43 A;  4DR1 Q;  3CCU A;  1IBL Q;  1LYL A;  1BKB A;  1JE5 A;  1KRS A;  1QUQ B;  4A3B H;  1TWC H;  2KEN A;  2OTL A;  2OQK A;  2UUA L;  3PUW A;  4DR5 Q;  1HNX Q;  3ER0 A;  1D7Q A;  4QL5 A;  1EFW A;  1PYB A;  1NJI C;  4JV5 Q;  1J5E L;  3KLW A;  4LF6 Q;  4LUV A;  1NMF A;  3AFP A;  1B7Y B;  4JI6 L;  2ZTC A;  1ASY A;  4LFC Q;  1P8L A;  3F8T A;  4A3F G;  2UUB Q;  3U4V A;  3U58 A;  1WFQ A;  4JI2 L;  3NBH B;  1UWV A;  3RLF A;  3HOV G;  5E7N A;  2K52 A;  5JEA G;  1SRO A;  1TWF H;  3M7N A;  2ATW A;  2B63 H;  1YJW A;  2N49 A;  1HZB A;  3W5O A;  3A0J A;  3L7Z C;  4DV0 L;  2VL6 A;  1YZ6 A;  3CC4 A;  4K0K L;  1RIP A;  1VQH A;  3TQY A;  4A76 A;  2UUC Q;  4P74 A;  2PQA B;  4APV A;  4BXX G;  3KYH C;  3CQZ H;  2IX1 A;  4YWK A;  4LUZ A;  1YEZ A;  2K75 A;  1N9W A;  4A93 G;  4OWT B;  3JAM i;  4BY7 G;  2OTJ A;  3H3V H;  3CC7 A;  1OXV A;  1XMQ L;  4B3R Q;  1K83 H;  4DV6 Q;  2QGQ A;  1B70 B;  2F4V L;  1WCM H;  4GNX A;  1Q7Y C;  4QGU A;  4DV3 Q;  2CCZ A;  2JA8 H;  1OXT A;  5IE8 A;  4GKK Q;  4LFB L;  4LF9 Q;  5IT9 c;  1VQ9 A;  1HH2 P;  1I50 H;  1N34 Q;  1N33 Q;  2JA6 G;  4HIM A;  1JB7 A;  3VDY A;  4B3M Q;  2GVA A;  4JI0 Q;  3RR5 A;  1CKN B;  4DUZ Q;  1PYS B;  4HJA A;  2ZM6 L;  2UXC L;  2JE6 I;  3CCV A;  4P71 A;  2PQA A;  1EOV A;  4RMF A;  3HOZ G;  1XNR L;  4JBJ A;  1AE3 A;  1Q12 A;  4YWM A;  2HIX A;  3PV0 A;  1I3Q H;  4IPH A;  4UP9 A;  4BA2 I;  4FDB A;  2VQF L;  3GTL H;  2AHO B;  3IRB A;  4GOP C;  2ZTE A;  2Q2I A;  3OW2 A;  1IBK Q;  1VQK A;  4LF7 Q;  3KJP A;  4A3I H;  1FJG Q;  1KC8 C;  3S2H H;  1GVP A;  2I5H A;  3TS2 A;  1S3O A;  1XMO L;  3I56 A;  4RG1 A;  3T1Y L;  4XTC S;  3GTJ H;  3K7A H;  3FKI H;  4JI3 Q;  1Q1B A;  4DR6 L;  3U50 C;  3M4O H;  3S16 H;  4OO1 I;  1NBW A;  4J15 A;  1VQC A;  2WB1 G;  2AMC B;  4OX9 Q;  4KHP Q;  1SE8 A;  1X3G A;  4JBK A;  4JOI A;  1X3F A;  1EUJ A;  1VQO A;  4NXN L;  2N8N A;  1KXL A;  1XTD A;  1YI2 A;  2R93 G;  2IY5 B;  3W1G A;  1L1O A;  2A19 A;  1HNZ Q;  2NN6 I;  4X64 Q;  3KOJ A;  4A3K H;  1OXS C;  1IBM L;  1N32 Q;  5C4J H;  1Z9F A;  3I4N G;  2ZJP A;  1WYD A;  4YHH L;  4GLA C;  1FGU A;  1NTG A;  2PI2 E;  3FHW A;  3PUV A;  3J80 c;  4NXM Q;  4A3G G;  1EQR A;  4JI5 L;  4GN5 A;  5BR8 L;  2BA0 A;  3ULP A;  2ALY B;  2VUM H;  1UE5 A;  4B3T L;  4LF5 L;  2KHJ A;  2ZJQ A;  1Y1V G;  1Q1E A;  1LTL A;  3ICE A;  2PMZ E;  1H95 A;  4DK3 C;  1C0A A;  2BH8 A;  2UXB L;  1VQN A;  4GLX A;  1I5F A;  4A3F H;  1TWH H;  5JJI A;  4DV4 L;  1N36 Q;  3UDI A;  3D0F A;  3OTO Q;  1WI5 A;  3HOV H;  1KHI A;  1IZ6 A;  2RF4 A;  2YTY A;  4POF A;  4X66 Q;  2YTV A;  2ZTD A;  1V9P A;  2CWP A;  3G48 A;  3HKZ G;  1FL0 A;  3CCR A;  4EX5 A;  2V1C C;  1VQM A;  2C35 B;  3AQQ A;  4GNX C;  3K81 C;  3KDF B;  4JI1 L;  5C4X G;  1G51 A;  4JI4 Q;  4O2D A;  4BXX H;  3M9B A;  5AJ3 Q;  4BBS G;  3CP0 A;  1OXU A;  1X56 A;  4R4I A;  3WWV A;  5LMN W;  4A3M H;  4JI8 L;  1E3P A;  5IP9 G;  4PMW A;  4A75 A;  1HR0 Q;  1LM0 A;  4HID A;  4LFA L;  5M3M H;  1YIJ A;  4QJF A;  3ULL A;  4A93 H;  1HZ9 A;  1PA6 A;  1E22 A;  4DV2 L;  2NVX H;  2OWO A;  3I7F A;  2JK8 A;  4A3C G;  4JYA Q;  4QQB X;  4QY7 A;  4DV5 L;  3CMA A;  2Q2T A;  1Y14 B;  1GKH A;  2F52 A;  1PH4 A;  2BA1 A;  2Q2H A;  3HOY G;  3CCJ A;  1Q81 C;  5IY0 A;  3STB D;  1EQQ A;  1VQF A;  2VY3 A;  2K14 A;  3G4S A;  4AQY L;  2E5L Q;  2I0Q A;  1M1K C;  1VQ6 A;  4X62 Q;  1IBL L;  2JA6 H;  3F2C A;  3HFZ B;  4A3E G;  3A5U A;  1VQ8 A;  3S1Q H;  1BBW A;  3EBE A;  4C3J H;  4DR5 L;  1XPR A;  1HNX L;  4LF8 Q;  3GTP H;  2VUM G;  3HOZ H;  1KL9 A;  5C3E G;  4GKJ Q;  4JV5 L;  2IHF A;  1KD1 C;  3F2B A;  1GM5 A;  2VNU D;  3RZD H;  3K7U C;  1UE7 A;  1Q8K A;  4H02 A;  2HHH Q;  2UUB L;  4C3I H;  5H1S E;  4JOI C;  1JMC A;  2JA9 A;  1ASZ A;  5IYD G;  3PF4 A;  2QEX A;  4PZ6 A;  3B6Y A;  3F1Z A;  1L1O C;  2LXK A;  3OYY A;  2IX0 A;  2R7F A;  1PH3 A;  2OQ0 A;  1YHQ A;  2A8V A;  2WB1 E;  5IYC G;  2DUD A;  3TS0 A;  3JAM c;  5C0X I;  2VQE L;  2JA7 G;  2NZH A;  2Z0S A;  3J7A 5;  3CCM A;  2UUC L;  1QUQ A;  4UY8 C;  2N78 A;  4OO1 G;  5LMU Q;  1JJ2 A;  5LMN L;  3BZC A;  2K4K A;  4UP8 A;  3PO3 G;  1HNW Q;  1JJG A;  3M4P A;  3A5Z B;  4JC0 A;  4A3M G;  1XJV A;  1PH7 A;  2UU9 Q;  4BY7 H;  1SRU A;  2R93 H;  1I94 Q;  1MJE A;  5M3M G;  2LXJ A;  1YVC A;  3E0E A;  4QIW E;  4YY3 Q;  3GTK H;  4B3R L;  4WJ4 A;  3DM3 A;  1PH2 A;  3S14 H;  4POG A;  4YCV A;  4JI2 Q;  1W2B A;  2PNH A;  3I4N H;  3UDX A;  3HOX G;  3L0O A;  4C2M H;  4DV3 L;  1K9M C;  1K73 C;  3I55 A;  4JBM A;  4LF9 L;  4GN4 B;  4IPG A;  2A1A A;  3RLN A;  5GAH C;  4A3G H;  1TWG H;  5ELO A;  2OCE A;  4DR2 Q;  1N34 L;  1Q82 C;  3CPF A;  4JI0 L;  1N33 L;  4K0K Q;  4DUZ L;  1Y1V H;  2R7D A;  3CW2 C;  2B63 G;  2NVT H;  3H0G G;  1PFS A;  5K36 G;  3BU2 A;  3K0X A;  1EYG A;  2QA4 A;  5HY6 A;  4Y52 H;  1CKM A;  3KF8 B;  4MTN A;  2D0P A;  1XMQ Q;  2L15 A;  2H5X A;  3A74 A;  4ALP A;  3CAM A;  2EXD A;  4DR4 Q;  3HKZ E;  4LF7 L;  1FJG L;  1E7Z A;  2N3S A;  3H15 A;  5GAD C;  3S15 H;  1K8A C;  2IHE A;  3K8A A;  3I4M G;  2K5V A;  2Y0S G;  4LF4 Q;  3M3Y H;  3CCE A;  2KCT A;  2JA5 G;  4BY1 G;  4JI3 L;  5C4X H;  3CPW A;  2XGT A;  4YCU A;  5J3B A;  4DR7 Q;  4IOC A;  4TQU S;  5IYB G;  4BBS H;  4EQ5 A;  2ZM6 Q;  4DUY Q;  1MJC A;  2JEB I;  4JBW A;  4P73 A;  1CKN A;  3TEH B;  5IP9 H;  3CCQ A;  1PV4 A;  1XPU A;  2R92 G;  4PZ7 A;  1HR0 W;  4OX9 L;  4L5S A;  3CD6 A;  4Y7N H;  1YHB A;  1UE1 A;  4X6A H;  1XNR Q;  4A3C H;  1NY4 A;  1YJN A;  4IFD J;  4A4I A;  3PUY A;  1VQ4 A;  5C0X J;  1KQS A;  1M90 C;  3CC2 A;  4DR3 Q;  4PG3 A;  3HOY H;  3HOW G;  2E2J H;  3M4Q A;  1VS0 A;  4A3D G;  1CKO A;  1P16 A;  5JJL A;  1K3R A;  1MIU A;  3G71 A;  2K5N A;  1T9H A;  4UP7 A;  4HIK A;  4HJ8 A;  4MNO A;  4A3E H;  4B3S L;  3LGJ A;  4DV7 Q;  4NXM L;  1Q46 A;  1PVO A;  5HGQ A;  1X9N A;  1CUK A;  3CXC A;  5C3E H;  4DV1 L;  4C3H H;  2CWA A;  2D62 A;  3GTG H;  4NXN Q;  1SR3 A;  1UEB A;  4BBR G;  4MZ9 A;  2FXQ A;  2WP8 J;  3FP9 A;  3ULJ A;  1N36 L;  5C44 G;  3OTO L;  5IYD H;  4A3L G;  2YYZ A;  3TRZ A;  2E2I H;  4X66 L;  5IWA Q;  1XNQ Q;  1QZH A;  1AH9 A;  1WJJ A;  3KF6 B;  4AYB G;  5IYC H;  1OTC A;  2VW9 A;  2JA7 H;  1HZC A;  4R4Q A;  4NB3 A;  4GS3 A;  5GAE C;  4KHZ A;  5FLX c;  5AJ3 L;  1G29 1;  1U0L A;  3RN2 A;  4GOP B;  1EWI A;  3PO3 H;  1X6O A;  3G6E A;  1CSQ A;  4R4O A;  3U4Z A;  2MO0 A;  4OON A;  1HR0 L;  2UXD Q;  1VQG A;  5FJ8 G;  1PH9 A;  4R1J A;  1DGS A;  4OXP A;  1PH8 A;  3KJO A;  4DV4 Q;  4JYA L;  5FLM G;  3S17 H;  3PGZ A;  3HOX H;  1SLJ A;  2D0O A;  3RNU A;  4IJH A;  2I5L X;  2AWO A;  2GN5 A;  4L5T A;  4OWX B;  4DK6 C;  1K0R A;  1U5K A;  2E2H H;  4HJ7 A;  4DR1 L;  2E5L L;  3I4O A;  2K50 A;  4X62 L;  2VS1 A;  2PI2 A;  5M3F G;  1SN8 A;  4IPD A;  2NZO A;  4KLK A;  4JI1 Q;  1VQD A;  1X3E A;  3PO2 G;  4JG2 A;  3H0G H;  3KDF A;  3BZK A;  5JEA J;  3J81 i;  1E1T A;  4LF8 L;  2KCM A;  2MQH A;  2F3I A;  3PCO B;  3RLO A;  4LF6 L;  1VQB A;  1UE6 A;  4X65 Q;  3MEF A;  3H3V I;  1N8R C;  3T1H Q;  2HHH L;  3S2D H;  3E9H A;  4DV5 Q;  3PUZ A;  2Y0S E;  4LFC L;  3AFQ A;  4WJ3 M;  2IT1 A;  5M5X H;  1HZA A;  3GTM H;  3I4M H;  4A3J G;  3GDE A;  5M5Y H;  3HOU G;  3EN2 A;  4NPS A;  2JA5 H;  2CFM A;  4UPA A;  4AQY Q;  1VQL A;  1A8V A;  3M85 A;  4BY1 H;  4IFD I;  1X54 A;  1S40 A;  2R7Z G;  3RZO H;  5IYB H;  1E1O A;  2KBN A;  1IYJ B;  4YCW A;  2UUA Q;  3PUX A;  2WAQ G;  2R92 H;  5LMU L;  3JC6 6;  2HQL A;  2ASB A;  4DAM A;  1X55 A;  1J5E Q;  1HNW L;  2RHS B;  1KAW A;  2LSS A;  1RL2 A;  2UU9 L;  4JI6 Q;  1I94 L;  1VQ5 A;  1VQ7 A;  3HOW H;  4YY3 L;  3NEN A;  4DV6 L;  4GNX B;  2GVB A;  4LWC A;  1S72 A;  4A3D H;  4JI7 Q;  1B8A A;  3GO5 A;  2NN6 G;  3NEM A;  2AKW B;  2ID0 A;  4DNI A;  2YV5 A;  4LNQ A;  4OWW B;  5GRO A;  4GKK L;  4DV0 Q;  4HJ9 A;  1GO3 E;  4DAY B;  1QVF A;  1CSP A;  4DR2 L;  4AH6 A;  2VQE Q;  4B3M L;  4JI7 L;  2Z6K A;  2EIF A;  1Y1W G;  1KIX A;  2CKZ B;  2I5M X;  5LMN Q;  1D8L A;  4ME3 A;  4LW1 A;  1NMG A;  1PH5 A;  1A63 A;  4BBR H;  1VQE A;  4PZ8 A;  1KRT A;  4AIM A;  5C44 H;  3W1B A;  4A3L H;  5DLQ E;  1IBK L;  4DR4 L;  3TRE A;  3KFU A;  4AYB E;  4HJ5 A;  2F4V Q;  2ES2 A;  4L5R C;  1EIF A;  3BJU A;  3NEL A;  3UDF A;  3D31 A;  4LF4 L;  3GTQ H;  4LFB Q;  1JJC B;  5IP7 H;  1XPO A;  2E8G A;  4O0A A;  1EIY B;  1WOC A;  2XTI A;  4DR7 L;  5GAG C;  1YNX A;  4TVA B;  1TWA H;  4IJL A;  3SGI A;  1IL2 A;  4DUY L;  4A3B G;  2UXC Q;  3UE0 A;  2NVY H;  2HIV A;  3AEV A;  5EAY A;  2RHQ B;  3STB C;  5FJ8 H;  1BVS A;  4HIO A;  4KHP L;  2JQO A;  4DKA C;  1L1O B;  4DPG A;  3EIV A;  5FLM H;  2VQF Q;  2BH2 A;  3S24 A;  1HNZ L;  2MFI A;  4DR3 L;  4X64 L;  3UE1 A;  3F2D A;  1SFO H;  1N32 L;  1XMO Q;  4R4C A;  5M3F H;  3RN5 A;  3T1Y Q;  1HJP A;  4KI0 A; 
#chains in the Genus database with same CATH topology
 4LUO A;  4R4T A;  2NTT A;  3DHQ A;  4P75 A;  2WFW A;  4CHT B;  4TKO B;  4OL7 A;  4A3I B;  1SMX A;  2DGY A;  1EY7 A;  1VQP A;  1XTC D;  3CCS A;  1SFO B;  4UAI A;  1LUZ A;  3M4Y A;  2JN4 A;  4ILW A;  2F0I A;  1YHA A;  1OXX K;  3VR3 A;  1YNJ D;  5EPL A;  2ZJR A;  1IBM Q;  3GTO B;  4YHH Q;  3WDN A;  2ICI A;  2WAQ E;  4B3S Q;  3MXN B;  5ELC A;  2A6E C;  3FEW X;  5BR8 Q;  3S1R H;  3J7Z C;  4IZ8 A;  2KUM A;  4B3T Q;  4LF5 Q;  1C9O A;  2NB0 A;  1JT8 A;  3CF5 A;  1GD7 A;  5E3F A;  3AYH B;  1TT2 A;  3QOJ A;  4A3J B;  3HOU B;  1H9K A;  2UXB Q;  2RDH A;  3CCL A;  3Q22 A;  4JPB W;  1TVX A;  3UDG A;  1AW7 A;  3R2T A;  2YTX A;  5D65 A;  1O7I A;  2WAQ B;  5KEE A;  2MO1 A;  3W3A A;  5CV4 A;  4IOA A;  1YBY A;  4C1N I;  5A2Q L;  2Z4H A;  3K6O A;  4JI8 Q;  1VQJ A;  1BBU A;  1CA5 A;  2F0T A;  3T4A C;  2MNA A;  4DV2 Q;  4FXG C;  3S1N B;  5J22 A;  4IUN A;  4XYQ A;  3D8G A;  4ZUI A;  4HCE A;  4A3K G;  2YU9 B;  5KYL A;  2EY6 A;  5JVH 3;  1LYL A;  1IBL Q;  1PZI D;  1BKB A;  2B2W A;  1JE5 A;  2ICE C;  2JSO A;  1SSO A;  2N88 A;  1LLR D;  1HFN A;  3CRK C;  3KLW A;  3NWS A;  5CV8 A;  5KNC A;  3F8T A;  4A3F G;  1WFQ A;  4JI2 L;  1UWV A;  5E7N A;  5JEA G;  4Q5V A;  3K5M A;  3MEH A;  4A3B B;  3TME A;  1EOT A;  3BG3 A;  3KLS X;  2PQA B;  3KYH C;  4YWK A;  4LUZ A;  1YEZ A;  4A93 G;  4DXF A;  1V1P B;  3TBI B;  1LV9 A;  5G3L F;  3Q0A A;  1C48 A;  2F4V L;  4WFN 3;  4GNX A;  1Q7Y C;  1PYW D;  4LFB L;  4ID6 A;  3LWU A;  4HIM A;  2GVA A;  2I46 A;  2L0C A;  5E1F A;  3SK5 A;  2ZM6 L;  4C56 C;  3P1H A;  3MAQ A;  1JWU D;  1I4Q A;  4RMF A;  1XNR L;  4YWM A;  4IPH A;  1ET6 A;  2VQF L;  3MFG A;  3IRB A;  3I8Z A;  2ZTE A;  3J81 E;  4GOP C;  1IBK Q;  2ZXP A;  1VQK A;  2BOS A;  4C3I G;  1PTO D;  1G2T A;  1IL8 A;  3HGB A;  2I5H A;  3TS2 A;  2L5T A;  2G9D A;  5EQ0 A;  3I56 A;  3GTJ H;  4JI3 Q;  4DR6 L;  2K5D A;  3M4O H;  4FXD A;  1WD0 A;  1VQC A;  1I3Q B;  1SNO A;  5I6Y A;  4OX9 Q;  1QE6 A;  1X3F A;  4K2K A;  1BCP F;  4NXN L;  4QF4 A;  4CJ0 B;  2IY5 B;  2EE1 A;  3M3Y B;  2ZXO A;  1EFI D;  2AQ2 B;  1PDQ A;  4A3K H;  1STA A;  1OXS C;  3EQL C;  3L9A X;  4H0L C;  1N32 Q;  5C4J H;  2ZJP A;  1PFB A;  1I6V C;  1NTG A;  3PUV A;  4RKB A;  1CK1 A;  4JI5 L;  3KBX A;  1Q90 A;  1DON A;  1AN8 A;  2PMZ E;  1PRT D;  3T13 A;  4DK3 C;  1H95 A;  2F0O A;  5CMD A;  4A3F H;  5JJI A;  1LT3 D;  4DV4 L;  4B9X A;  4RCO A;  4A3E B;  1WI5 A;  5JEA H;  4O1N A;  4L6T B;  4X66 Q;  4POF A;  1NNX A;  2YTV A;  3G48 A;  4Q0F A;  2CWP A;  3BDC A;  4RA8 A;  4XQN A;  4P2C B;  1G51 A;  4O2D A;  4PNY A;  4BBS G;  5LMN W;  3WWV A;  4A93 H;  1TWH B;  1E3P A;  4A75 A;  1LM0 A;  1D1K A;  3I7F A;  2JK8 A;  4QQB X;  4QY7 A;  4DV5 L;  1GKH A;  2F52 A;  2BA1 A;  2Q2H A;  1Q81 C;  2K14 A;  1VQ6 A;  4ODG A;  4QMG A;  4N8X 1;  1VQ8 A;  1W6K A;  4DR5 L;  3NXW A;  1KL9 A;  3RD4 A;  4C3H G;  2VNU D;  3K7U C;  4H02 A;  5D14 A;  4S3S A;  4C3I H;  5H1S E;  1EEI D;  2KOL A;  1ROD A;  1JMC A;  5IYD G;  2F03 A;  3B6Y A;  5D3I B;  3S1Q B;  1Y8O B;  2R7F A;  1PH3 A;  1YHQ A;  1NR2 A;  2V4D A;  3HOZ B;  3TS0 A;  3JAM c;  3K5L A;  2JA7 G;  4UY8 C;  4OO1 G;  3MWY W;  1BXT A;  5LMN L;  3BZC A;  3PO3 G;  3A5Z B;  4K8I A;  3GTK H;  4QIW E;  2KVM A;  2KA7 A;  1PH2 A;  3S14 H;  4POG A;  1W2B A;  3EJI A;  2J0T D;  4JI2 Q;  2PNH A;  3E3X A;  1LTT D;  2O4X A;  1XWE A;  4C2M H;  3VR4 A;  1S5D D;  1U4R A;  3LWE A;  4LF9 L;  3RLN A;  1HCZ A;  2A1A A;  5GAH C;  1N34 L;  1HQM C;  3CKI B;  4B08 A;  4JVZ A;  1EYG A;  4X3S A;  1F9R A;  1O7Y A;  1DM0 B;  2D0P A;  1BCP B;  3I4N B;  2L15 A;  2F4I A;  3CAM A;  4ALP A;  2CH4 A;  4XQQ A;  2KCC A;  1E7Z A;  4OHJ A;  2PZU A;  3OPO A;  4PMC A;  2Z8L A;  2DY7 A;  2Y0S G;  1Y1V B;  3CPW A;  3C1E A;  2XGT A;  4DR7 Q;  4IOC A;  4BBS H;  4KN7 C;  2R3Z A;  2AUK A;  2ZM6 Q;  1LAB A;  4F7X A;  1M4V A;  1CKN A;  1PV4 A;  1RKN A;  1XPU A;  3CD6 A;  4PZ7 A;  1WTW A;  4FO2 A;  1HR0 W;  3BVM A;  1SJH D;  3FRP B;  4Y7N H;  1XNR Q;  1NY4 A;  1YJN A;  2JXM B;  4A4I A;  2KEC A;  4CKE A;  3S15 B;  3PIP 3;  1KQS A;  1M90 C;  4PG3 A;  1VS0 A;  3FDT A;  1MIU A;  4F8M A;  4G7O C;  4HJ8 A;  3LGJ A;  1K28 A;  2XVS A;  1EY4 A;  1Q46 A;  3NQT A;  5HGQ A;  4OGQ C;  1I4X A;  4C3H H;  3I73 A;  3NSW A;  1E2V A;  2LY7 A;  3GTG H;  4NXN Q;  1A2U A;  4N9T A;  3DUZ A;  4BBR G;  1UUP A;  1QB5 D;  4MZ9 A;  2FXQ A;  4NKL A;  1N36 L;  5IYD H;  2YYZ A;  3TRZ A;  3PO2 B;  1AH9 A;  1HTL D;  1Y8P B;  2K28 A;  1OTC A;  2H1E A;  2VW9 A;  2JA7 H;  3A54 A;  5IGG A;  4NB3 A;  3QJY A;  4OO1 H;  2F1M A;  2KHS A;  3A8K E;  5AJ3 L;  3PO3 H;  5EGT A;  1CSQ A;  1HR0 L;  3J80 L;  1PH9 A;  4G57 A;  1PH8 A;  4DV4 Q;  3GQB A;  5FLM G;  2WKC A;  4DK6 C;  4FF1 A;  4DR1 L;  4CGY B;  4X62 L;  2VS1 A;  2IL8 A;  2B2T C;  4KLK A;  1ZYR D;  4JG2 A;  4ZLT F;  1RTN A;  3KDF A;  1E1T A;  4LF8 L;  2OT2 A;  2KCM A;  2MQH A;  3I90 A;  3IKJ A;  2F0Q A;  1UE6 A;  4X65 Q;  3S2D H;  4DV5 Q;  2EVB A;  1EU4 A;  2RVL A;  4O42 A;  4WJ3 M;  1HZA A;  3LX0 A;  2SNS A;  4A3J G;  1SDF A;  3HOU G;  1STE A;  2CFM A;  3W2D A;  1VQL A;  1S40 A;  4R8I A;  1J9O A;  2KBN A;  2WAQ G;  1PRT F;  3OHX C;  3PQI A;  3GTM B;  1LTI D;  2MUY A;  1I94 L;  3FMC A;  2JA5 B;  1JCK B;  4GNX B;  1S72 A;  3RZO B;  3GO5 A;  1S5B D;  1S5C D;  4KV6 A;  2YV5 A;  1LO5 D;  4GKK L;  2R92 B;  2Z4I A;  1QVF A;  4DR2 L;  4ZK9 B;  4B3M L;  4JI7 L;  1STY A;  3H91 A;  1Y1W G;  3V05 A;  2CKZ B;  5LMN Q;  2PNR C;  4ME3 A;  3NK9 A;  1NMG A;  4LW1 A;  1PH5 A;  4BBR H;  4A3D B;  4PZ8 A;  1KRT A;  1BOS A;  4AIM A;  2MPM A;  3BDO A;  4U68 A;  2B63 B;  4ZYS A;  4AYB E;  4IUP A;  2FJ2 A;  5NUC A;  3UDF A;  3TZU A;  5BN4 A;  4I65 A;  3QB3 A;  3CQZ B;  1WOC A;  5COR A;  2Q8T A;  5C0X H;  1YNN C;  4A3B G;  2FMM A;  2RSN A;  1JC7 A;  3AEV A;  5EAY A;  3STB C;  5C4H A;  4HIO A;  1STB A;  5FLM H;  3J7A F;  4AYB B;  3GTQ B;  3DWQ A;  3DMU A;  1HNZ L;  5I6W A;  4X64 L;  1W6J A;  4IAL A;  3F2D A;  2BCO A;  1SFO H;  1K8O A;  1ZEQ X;  3RN5 A;  1HJP A;  1CZW A;  3DM1 A;  5JOB A;  4RKL A;  3GTO H;  5J39 A;  1PXU A;  1TXY A;  3IFD A;  2Q2U A;  2PW5 A;  2VZA A;  4A3J H;  1BF4 A;  3HOU H;  5JJK A;  1DYQ A;  3TP5 A;  1G6Z A;  1PTO B;  3FKI B;  3DWA A;  2NVQ B;  5IWA L;  1XNQ L;  5FKA C;  1WTQ A;  3SEB A;  2Z9H A;  1SMY D;  2B3G A;  4QUC A;  2EPB A;  4L63 B;  4CDF C;  5IP7 G;  5KNB A;  2L11 A;  4JI4 L;  1BUV T;  2K32 A;  3E9I A;  4DXG A;  1SXT A;  4ZRZ A;  3OW7 A;  3S1M B;  4IPC A;  1R9T B;  2B8F A;  1FNW A;  4L5Q A;  2EYJ A;  3MTS A;  3Q8D A;  2R7Z B;  4LK1 C;  2EDG A;  1SYG A;  2K5H A;  3S1N H;  4P72 A;  3L2P A;  3PIP A;  1QOH A;  3K5O A;  3GD7 A;  1JOQ A;  1Y1W H;  4R9W A;  2F0M A;  2YU9 H;  1CTM A;  1AE2 A;  1A6X A;  1V1Q A;  2H4O A;  2NUC A;  1PH6 A;  4FF2 A;  4NDX A;  2DN8 A;  1A0I A;  1WTH A;  1JOO A;  3K59 A;  4GOP A;  1L2F A;  1PRT B;  1MKH A;  3SR1 A;  3K80 C;  4OIK A;  2KHI A;  2F0G A;  2CQO A;  2MP1 A;  5DM6 3;  3P20 A;  5IOD A;  5EBC A;  4K14 A;  5D3D A;  4DR1 Q;  2Q8R E;  1ILP A;  3WOF A;  4DNR B;  4A3B H;  2UUA L;  1HNX Q;  3ER0 A;  1PFM A;  5ELF A;  1QNK A;  5M5W B;  1D7Q A;  1PYB A;  4JV5 Q;  1NMF A;  3AFP A;  1JQY D;  2ZTC A;  1ASY A;  1MGS A;  1P8L A;  2B39 A;  2JA6 B;  5C5L A;  4LAA A;  3RLF A;  2N49 A;  5EKL A;  3W5O A;  3OIQ A;  2ENB A;  3A0J A;  3L7Z C;  3R93 A;  1YZ6 A;  4A76 A;  2O2L D;  5FOB B;  4APV A;  1WD1 A;  1N9W A;  3OOC A;  4IUQ A;  1EWC A;  1TY0 A;  2SDF A;  3H3V H;  1XMQ L;  2MHV A;  4IN3 A;  5JVG 3;  1TWF B;  4B3R Q;  2QGQ A;  1KAA A;  3A7L A;  1XYI A;  4QGU A;  1TS4 A;  1S5E D;  4GKK Q;  1VQ9 A;  3KLS A;  4IUT A;  1HH2 P;  5I2X A;  1JB7 A;  4B3M Q;  4JI0 Q;  2J4X A;  4JI7 Q;  2E74 C;  1CKN B;  2UXC L;  3CCV A;  1EOV A;  1QWY A;  1K83 B;  2X6L A;  3HOZ G;  3NQI A;  1Q12 A;  2PYK A;  1WCM B;  1I3Q H;  2JA8 B;  1KDA A;  3EFX D;  3NBI A;  3KJP A;  4Z9C B;  1KC8 C;  3DEP A;  1GVP A;  4RG1 A;  4DN4 M;  3T1Y L;  4I7A A;  5KRU A;  2A68 C;  2B2Y C;  5CR3 A;  4RGT A;  2JP1 A;  5I4D A;  2LFN A;  3S16 H;  1GJX A;  1NBW A;  4RGM A;  1SNP A;  2RQX A;  2M2L A;  1PMR A;  4QB4 A;  1IKL A;  4JBK A;  1X3G A;  3QO2 A;  1VQO A;  2K7V A;  1XTD A;  1YI2 A;  3S2H B;  2R93 G;  4M8A A;  2K33 A;  1HNZ Q;  4X64 Q;  3KOJ A;  2D2C C;  3K7A B;  3SK8 A;  1F2L A;  1LTS D;  1IHZ A;  3D4D A;  1Z9F A;  3I4N G;  5EKK A;  4C1N K;  1U4L A;  4NXM Q;  3FHW A;  1CM9 A;  3HG9 A;  3J80 c;  3SXH A;  3PMF A;  5JPM C;  3ULP A;  1Y1V G;  1Q1E A;  3ICE A;  2K04 A;  1LT4 D;  1TWH H;  4DGZ A;  5EPK A;  3J7A V;  3T51 B;  2K1B A;  1LTB D;  2VUM B;  3CCR A;  1VQM A;  3AQQ A;  3KDF B;  4JI1 L;  4UHV A;  5C4X G;  3MXG A;  4JI4 Q;  2F0H A;  3CP0 A;  2QDL A;  4R4I A;  5IP9 G;  2B2U C;  3F2U A;  4LFA L;  3VR6 A;  1CHP D;  4QJF A;  3HOV B;  1HZ9 A;  1SYC A;  2G5D A;  3KLR A;  4CBV A;  4JYA Q;  3MC0 B;  1Y14 B;  5IT9 E;  1PH4 A;  3CCJ A;  2D9U A;  1VQF A;  3G4S A;  3VYS A;  2E5L Q;  2I0Q A;  1HFG A;  4A3M B;  3MXU A;  1PZK D;  3S1Q H;  3EBE A;  5M3M B;  1XPR A;  1B44 D;  3HOZ H;  2A73 B;  2FMC A;  4XYO A;  3UI2 A;  1UE7 A;  2UUB L;  3H3V C;  4JOI C;  2JA9 A;  1D5Z C;  2CHB D;  1SE4 A;  2LXK A;  3GTP B;  1DXM A;  2DUD A;  4XT1 B;  5CV7 A;  2VQE L;  1EY5 A;  2NWG A;  2NZH A;  2UUC L;  1QUQ A;  2XWB B;  1F9Q A;  1VF5 C;  2N78 A;  1SNC A;  4CJ1 B;  5LMU Q;  3RZD B;  3BVZ A;  2K4K A;  1HNW Q;  1JJG A;  1RHP A;  4JC0 A;  3ONA B;  2R93 H;  3I4M B;  2R61 A;  2B2V C;  4EQP A;  2G9H D;  2A6H C;  3DM3 A;  4YCV A;  1HQR D;  3I4N H;  4DV3 L;  3A8J E;  1GXD C;  2CQA A;  4JBM A;  4IPG A;  3T16 A;  1N33 L;  4DUZ L;  1Y1V H;  3BDL A;  2R7D A;  5E4W C;  4RFB A;  1KTK A;  1JB3 A;  4Y52 H;  4B9W A;  1XMQ Q;  1TKW B;  1CZG A;  1A15 A;  2K01 A;  4DR4 Q;  3HKZ E;  4LF7 L;  1FJG L;  2N3S A;  1U4P A;  2B2T A;  5GAD C;  1WTP A;  1K8A C;  3S15 H;  2QDB A;  1TWG B;  2IHE A;  2WAC A;  3K8A A;  2EZV A;  4LF4 Q;  2KCT A;  2JA5 G;  4IUU A;  5C4X H;  4YCU A;  5J3B A;  4TQU S;  3IL8 A;  5IYB G;  3PIO 3;  3EVQ A;  4ZUJ A;  5IP9 H;  2R92 G;  3HKZ B;  5C0X J;  2VB3 X;  3CC2 A;  4A3D G;  5F2D A;  2K5N A;  1T9H A;  4UP7 A;  4HIK A;  4MNO A;  3BZD B;  1PVO A;  1CUK A;  3NP8 A;  3TDQ A;  1RJT A;  3HOY B;  2EYP A;  1STN A;  2C9O A;  4CDC C;  1TQO A;  3OTO L;  5DNF A;  4A3L G;  1Q8I A;  2VXW A;  2E2I H;  1KLU D;  3E5S A;  4AYB G;  3GV3 A;  5C3E B;  1IW7 C;  4NP5 A;  3NWT A;  2N55 A;  1B9M A;  2Z6B A;  2IWH A;  4GOP B;  2XNA C;  1SE3 A;  4KN4 C;  2HCC A;  1VQG A;  2FIN B;  1SNM A;  3I3C A;  4R1J A;  1TU2 B;  1I4H A;  3PGZ A;  1SLJ A;  1JWM D;  4OWX B;  4HJ7 A;  1XXG A;  2PI2 A;  1SN8 A;  4IPD A;  2NZO A;  3TP6 A;  4JI1 Q;  1BBX C;  3R8B A;  3BZK A;  2NYZ D;  2RSO A;  1BDO A;  4RH6 A;  4LF6 L;  1VQB A;  3HOX B;  3MEF A;  4EVO A;  1N8R C;  2HHH L;  1LTA D;  2IT1 A;  3C46 A;  3GTM H;  3TSS A;  3GDE A;  3EN2 A;  2JA5 H;  3TN2 A;  1AFP A;  4IFD I;  2R7Z G;  3RZO H;  5IYB H;  1E1O A;  5KYI A;  3PUX A;  2R92 H;  4FNF A;  1O7Z A;  1X55 A;  1CQV A;  2UU9 L;  5M5Y B;  5M9O A;  4YY3 L;  1CHQ D;  4BY1 B;  1LT5 D;  4A3D H;  1B8A A;  2NN6 G;  2ID0 A;  1RTO A;  2XN9 C;  3R3O A;  4DNI A;  4OWW B;  4K5V A;  4HJ9 A;  4XT3 B;  4XQJ A;  5J1Z A;  2VQE Q;  4OEM B;  5CYU A;  3K5N A;  4ABN A;  1KIX A;  2DJF C;  1FD7 D;  1A63 A;  4HSV A;  3A8I E;  4MIU A;  3ERQ A;  3W1B A;  2A69 C;  4A3L H;  5ELD A;  2M9V A;  2F4V Q;  1MSH A;  2ES2 A;  5DEH A;  1PZJ D;  3A55 A;  1M8A A;  1SAP A;  3D31 A;  5CV6 A;  5FLX E;  3GTQ H;  4LFB Q;  4HMI A;  1EIY B;  1DCZ A;  1EU3 A;  2OXP A;  4IJL A;  4KTA A;  3SGI A;  1IL2 A;  2L12 A;  4DUY L;  2HIV A;  1NSN S;  4KY7 A;  2RHQ B;  4KHP L;  5C5M A;  5CV9 A;  4DPG A;  3EIV A;  2BH2 A;  3KF8 A;  2VQF Q;  5IIF A;  2MFI A;  4DR3 L;  5COY A;  3UE1 A;  3GV6 A;  1RCV D;  1PTO H;  2K03 A;  1JE4 A;  2NVY B;  4DV7 L;  2NVQ H;  4DR6 Q;  1I6H H;  2HT1 A;  1EQT A;  3D6C A;  3PF5 A;  1K8G A;  4XIG S;  3SVM A;  3PSI A;  3DEO A;  2RCF A;  4ZKB B;  3S1M H;  2IPK D;  4JCV E;  2A68 D;  1R9T H;  1K0S A;  1UNS A;  3GTJ B;  1FVI A;  3ERO A;  2HD3 A;  1H9J A;  4RGO S;  3K58 A;  1WCM G;  2R7Z H;  4YWL A;  2JA8 G;  5JJZ A;  4JI5 Q;  2BDN A;  5C0X G;  3CME A;  5EPJ A;  5GQO A;  2E75 C;  2UXD L;  3PIO A;  1NE3 A;  1E24 A;  4IO9 A;  2Z6K C;  1C7Y A;  1EL0 A;  3OMG A;  4KKU A;  3ZJY C;  2NN6 H;  1F2Y A;  2A6E D;  4A3I G;  2KJX A;  5EKI A;  3J81 c;  1PHJ A;  4MN3 A;  1B1Z A;  1GHJ A;  1VQI A;  2PZT A;  2F3W A;  4OEL B;  1IXR A;  2XRQ D;  1VQA A;  2PCF B;  1A62 A;  1J6Q A;  4E6I A;  2QIL A;  4GKJ L;  1GUG A;  2GA4 B;  5M5W H;  3T1H L;  1QZG A;  1QVC A;  2B2Y A;  2WIN B;  1VCI A;  4YIJ A;  2AUJ D;  2TMP A;  3Q6S A;  4ZAI A;  1SNQ A;  4DAV A;  1QUQ B;  2KEN A;  4MTK A;  1BNZ A;  2OTL A;  1B53 A;  4DR5 Q;  4KK7 A;  1EFW A;  4HTH A;  3BVG A;  5JPN C;  1DZ1 A;  1J5E L;  4LF6 Q;  4CKC A;  4JI6 L;  4H13 C;  1HPC A;  4BWG B;  2WV6 D;  5IGC A;  3U4V A;  5HUR A;  4GZY C;  2F0S A;  3HOV G;  2XIW A;  1TWF H;  5BN3 A;  1TWC B;  2HDM A;  4IUV A;  2ATW A;  4N9P A;  1ENF A;  1HZB A;  4CJ2 C;  1TS5 A;  4DV0 L;  3E6Z X;  3CC4 A;  4K0K L;  1RIP A;  1F9P A;  1HUN A;  1JWS D;  4BXX G;  2IX1 A;  2K6A A;  4OWT B;  3JAM i;  4V19 0;  5KND A;  5TSS A;  1E2Z A;  1K83 H;  1H9S A;  1D5X C;  1WCM H;  1E0B A;  3SDZ A;  2PW7 A;  2CCZ A;  3VR2 A;  2JA8 H;  1EY6 A;  3QWN A;  5IGF A;  4LF9 Q;  4XXE A;  4K5X A;  2MJ8 A;  1N34 Q;  2B2U A;  5DAU A;  5HGT A;  1TR5 A;  1PTO C;  3VDY A;  3RR5 A;  4HJA A;  2JE6 I;  2PQA A;  2K5Q A;  3VA7 A;  1AE3 A;  3PV0 A;  4UP9 A;  1FYC A;  4FDB A;  5BN5 A;  2KQ3 A;  3GP7 A;  4A3I H;  3S2H H;  1I50 B;  4G7H C;  3IFT A;  1S3O A;  1XMO L;  1NUC A;  3K7A H;  1Q1B A;  4QUF A;  4KD4 A;  4DK0 A;  4BS9 A;  2EY2 A;  4J15 A;  2L55 A;  2JYO A;  3VYU A;  2AMC B;  3GTL B;  4KHP Q;  1D1I A;  5CGK A;  4JOI A;  2N8N A;  1EYA A;  5FO8 B;  2A19 A;  1B3Q A;  2F0N A;  4U67 3;  4QCL A;  1IBM L;  4BBS B;  1WYD A;  4YHH L;  2F0U A;  3G6J B;  4KY5 A;  2SOB A;  2LKV A;  2PI2 E;  1ICF B;  2QKI C;  5BR8 L;  2ALY B;  2VUM H;  1UE5 A;  4B3T L;  2F0P A;  4LF5 L;  2KHJ A;  4CDD C;  2ZJQ A;  2B2V A;  2P5Z X;  1LTL A;  4ZQ3 A;  1C0A A;  2UXB L;  1U4M A;  1SYF A;  1N36 Q;  3UDI A;  3NHH A;  3D0F A;  5LL6 X;  1EZ6 A;  3HOV H;  1KHI A;  1IZ6 A;  1D5M C;  2YTY A;  2DNC A;  2ZTD A;  3HKZ G;  1FL0 A;  2V1C C;  3MFY A;  2C35 B;  5E4X A;  1NR4 A;  5I9P A;  2F3V A;  4C3H B;  1AZQ A;  4BXX H;  3M9B A;  5AJ3 Q;  4L8J A;  4A3M H;  2EJM A;  4JI8 L;  1HR0 Q;  2IJ0 A;  4PMW A;  3HZX A;  3QR8 A;  1ESF A;  1V1O A;  5M3M H;  1YIJ A;  4HAE A;  1PA6 A;  1E22 A;  4DV2 L;  2OWO A;  3Q24 A;  3D4W A;  3NUC A;  3CMA A;  2Q2T A;  1SYD A;  1BO0 A;  3HOY G;  4V0B A;  1EQQ A;  1FNV A;  1KNE A;  4R8N A;  2F0K A;  4AQY L;  4X62 Q;  1IBL L;  2SNM A;  3HFZ B;  3PO3 B;  4A3E G;  2BE5 C;  3G7L A;  4BY7 B;  3A5U A;  4ME5 A;  1BBW A;  4LF8 Q;  3GTP H;  2NVX B;  5C3E G;  4KJN A;  4GKJ Q;  2HUG A;  2IHF A;  1GHK A;  1GM5 A;  3RZD H;  4PQX A;  1SJE D;  1ASZ A;  2MGS A;  3PF4 A;  2QEX A;  4PZ6 A;  2AQ1 B;  3OYY A;  1L1O C;  4C3J B;  2A8V A;  1Y8N B;  2WB1 E;  5IYC G;  1WTX A;  4WOR A;  3J7A 5;  3CCM A;  2EJG C;  1TY2 A;  1JJ2 A;  4K6L A;  3M4P A;  4X3K A;  1I94 Q;  1MJE A;  4WJ4 A;  1EY9 A;  3RMH A;  3HOX G;  3L0O A;  4PMB A;  3NBH A;  1K9M C;  5A35 A;  2WB1 B;  4TRD A;  4GN4 B;  2PPB C;  1QJO A;  1TWG H;  2OCE A;  4K6D A;  5ELO A;  4DR2 Q;  3CPF A;  1Q82 C;  4K0K Q;  5CBA E;  1FNU A;  1IYV A;  1PFS A;  5K36 G;  3BU2 A;  1S4Z A;  1MHW C;  3K0X A;  2E2D C;  5HY6 A;  3KF8 B;  1DOL A;  1X3Q A;  3QIA A;  2EXD A;  2XSC A;  3AB9 A;  3H15 A;  4A3G B;  3M3Y H;  1F2M A;  4BY1 G;  2NVT B;  2D5D A;  4JI3 L;  2HDL A;  1B2T A;  1MJC A;  5FO7 B;  3IAY A;  2M00 A;  5IT9 L;  4OX9 L;  1E2W A;  4X6A H;  4IFD J;  3PUY A;  1VQ4 A;  3HOY H;  1RF2 D;  4H44 C;  3M4Q A;  1CKO A;  1P16 A;  5IGE A;  2A5H A;  5JJL A;  1K3R A;  3G71 A;  2L1B A;  4A3E H;  1TS2 A;  4UDU C;  1T5X D;  3L3O C;  3I72 A;  3RUZ A;  5C3E H;  4KKS A;  4DV1 L;  2D62 A;  4IQZ A;  2DJG C;  1Z7T A;  1SR3 A;  3FPP A;  2E2J B;  2WP8 J;  3FP9 A;  2BDO A;  3KUP A;  1KDC A;  4X66 L;  5IWA Q;  1XNQ Q;  1B4O A;  2HCI A;  3JAM E;  1O7L A;  5KIX A;  1QZH A;  1GOZ A;  3C1F A;  2O5I C;  5IYC H;  2EYM A;  3QOL A;  4GS3 A;  3DXJ C;  2EYH A;  3RN2 A;  1EWI A;  1X6O A;  4RAU C;  3MZ5 A;  4R4O A;  3U4Z A;  1KLG D;  2AQ3 B;  1ZYR C;  5FJ8 G;  1DGS A;  4OXP A;  1LT6 D;  3KJO A;  2F0E A;  3SHL A;  3VR5 A;  1IYU A;  3HOX H;  2D0O A;  3RNU A;  4IJH A;  2I5L X;  4L5T A;  5C3X A;  1K0R A;  1U5K A;  3BYY B;  2K5W A;  3I4O A;  3LNN A;  3SK4 A;  1VQD A;  1X3E A;  3O13 A;  1HTP A;  1QIL A;  3CRL C;  4RWS C;  3PO2 G;  1PLF A;  5K36 H;  2EJF C;  3J81 L;  4HMJ A;  2F3I A;  3PCO B;  3S17 B;  1BQQ T;  1H9R A;  4I7Z C;  1F77 A;  1FGB D;  1GUS A;  4HCS A;  2E2H B;  3MHB A;  4LFC L;  3AFQ A;  3D4R A;  3OWE B;  5M5Y H;  3VYT A;  1Z6H A;  4NPS A;  1Y1W B;  1RDP D;  3AU7 A;  3H0G B;  1A8V A;  3M85 A;  4AQY Q;  4BY1 H;  1X54 A;  1KDB A;  2SEB D;  3K57 A;  4M1U B;  2UUA Q;  1EYD A;  4K8J A;  3JC6 6;  2HQL A;  2ASB A;  4IUR A;  4DAM A;  2RHS B;  5M5X B;  2KCN A;  1VQ5 A;  1DJR D;  1VQ7 A;  1H9S B;  4DV6 L;  2GVB A;  4RHR A;  3SK6 A;  2WKD A;  1NAP A;  3FVQ A;  4F87 A;  3NEM A;  2AKW B;  4LNQ A;  2EY1 A;  3ND8 A;  1GO3 E;  1CSP A;  1UEA B;  2RBM A;  4AH6 A;  3ZYY X;  2Z6K A;  2DNE A;  2F0D A;  3HEJ A;  3HOW B;  5A2Q E;  5DLQ E;  5JAV A;  3TRE A;  3KFU A;  2KEE A;  1EYC A;  1IKM A;  3OMC A;  4L5R C;  1EIF A;  3BJU A;  1C8C A;  1XPO A;  3HRZ C;  4O0A A;  4X3U A;  1U9R A;  2XTI A;  3I4L A;  4DR7 L;  3SE0 A;  2UXC Q;  2RKS A;  2NVY H;  5C44 B;  1ML0 D;  5FJ8 H;  2TSS A;  4EGV A;  4DKA C;  2J7Z A;  4FXK C;  4HED A;  4NW2 A;  1EIG A;  1XX8 A;  2LMC B;  1ENC A;  1A3T A;  1YNN D;  4X3T A;  4R4C A;  1SYE A;  1TWA B;  3T1Y Q;  4KI0 A;  3STB D;  4BA1 I;  2B63 G;  1ESR A;  3PO2 H;  1EZ8 A;  1L0W A;  3NTK A;  3ERS X;  1SMY C;  3BS1 A;  2R6G A;  3HKS A;  1YJ9 A;  3DWP A;  3C2P A;  2B8G A;  4GN3 B;  1I4G A;  5M3F B;  1DOK A;  2PQE A;  1II3 A;  3J81 j;  3DLL A;  3S16 B;  1FR3 A;  2AWN A;  1RD9 D;  4IFD G;  3D3R A;  1PH1 A;  1W3S A;  5ELN A;  3A56 A;  1SYB A;  4DV1 Q;  1WTR A;  1Q86 C;  3E0J A;  3J80 i;  1WTV A;  2RCN A;  1G6P A;  3HP3 A;  2EQS A;  1QVG A;  2F0L A;  3S1R B;  1Z47 A;  1ILQ A;  3KF6 A;  1CI3 M;  3FKI G;  1CQF A;  1ONL A;  1YIT A;  2PMZ B;  3M7G A;  1D6E C;  2JJQ A;  2B29 A;  2NZ1 D;  4LFA Q;  4PV1 C;  3MA2 B;  3ND9 A;  1QCB D;  4X65 L;  5FLX L;  1HXY D;  1ZKO A;  3I2Z A;  2LS0 1;  1HHV A;  1X65 A;  2I07 B;  2JEA I;  4GLV B;  1V43 A;  1BCP C;  2QF7 A;  3CCU A;  1ICW A;  1KRS A;  1TWC H;  5CC4 A;  3NTH A;  2OQK A;  3PUW A;  4N8F A;  1LTG D;  2CW0 C;  4OIJ A;  4QL5 A;  1NJI C;  1NCV A;  4XDX A;  3OWF A;  4LUV A;  1B7Y B;  2EXZ A;  4LFC Q;  2UUB Q;  1EY8 A;  3TP8 A;  3U58 A;  2BE5 D;  1GUW A;  4J1M A;  1MBY A;  3NBH B;  3M7N A;  2K52 A;  2ZXR A;  1SRO A;  4JW0 A;  2B63 H;  1YJW A;  3FPU B;  1TII D;  2VL6 A;  5T1G A;  1VQH A;  3H94 A;  3TQY A;  2UUC Q;  1EWH A;  4P74 A;  2PO4 A;  3VA5 A;  3CQZ H;  2F0V A;  2K75 A;  2OTJ A;  4K5W A;  4BY7 G;  1AP0 A;  3N6R A;  4DF7 A;  3CC7 A;  1OXV A;  3ITP A;  4DV6 Q;  1B70 B;  5L37 A;  4DV3 Q;  5IGD A;  1OXT A;  5IE8 A;  2EOT A;  4IFD H;  5IT9 c;  1EIH A;  2WII B;  1H9M A;  1I50 H;  3QG1 A;  1N33 Q;  1Q3L A;  2JA6 G;  3C3L A;  4DAY A;  4DUZ Q;  2R93 B;  1PYS B;  4ZKC B;  5ISR A;  4C3J G;  4P71 A;  4KMU C;  1EQV A;  1VMC A;  4JBJ A;  5IOC A;  3EA6 A;  2HIX A;  4QIW B;  4CKB A;  4BA2 I;  3K0Y A;  1ZXT A;  4WRD A;  3GTL H;  1K3B C;  2AHO B;  4NMZ A;  3OW2 A;  2Q2I A;  1FJG Q;  1JOK A;  4LF7 Q;  1GUN A;  1A3V A;  2QW7 A;  1X32 A;  5EJW A;  5ELE A;  4XTC S;  3FKI H;  3U50 C;  2A74 C;  4OO1 I;  1YNJ C;  1VDZ A;  2WB1 G;  4DU9 A;  3CU7 A;  1SE8 A;  2B2W C;  1EUJ A;  1MD2 D;  4DA2 A;  1R4P B;  2KED A;  1KXL A;  3W1G A;  1L1O A;  2XWJ B;  3A7A B;  3H09 A;  2NN6 I;  4DK1 A;  1CA6 A;  1HA6 A;  5C4X B;  1G8Z D;  1O78 A;  3OSO A;  1G2S A;  1L0X B;  1SBB B;  1VMP A;  3M4O B;  4GLA C;  1FGU A;  1UAP A;  4KJO A;  1WVL A;  2ZT9 C;  4A3G G;  5C3W A;  1EQR A;  4GN5 A;  1R4Q B;  2BA0 A;  2L4N A;  4F88 A;  4LJZ C;  3TP7 A;  4RGN A;  1SND A;  3I70 A;  3X3M A;  2BH8 A;  4A3K B;  1VQN A;  4GLX A;  1I5F A;  5T1I A;  5C4J B;  4G7Z C;  1GUO A;  1VF7 A;  3OTO Q;  1I4P A;  2RF4 A;  1V9P A;  3P7J A;  4EX5 A;  4EQO A;  2RDG A;  2F0F A;  4GNX C;  3K81 C;  3V96 A;  3MXN A;  1STH A;  1GUT A;  1OXU A;  1X56 A;  4A3F B;  5KGU A;  3MXP A;  4BY7 H;  4HID A;  3ULL A;  4J6H A;  4A3C G;  2E2I B;  3KK7 A;  2NVX H;  1K8M A;  1PTO F;  1HRJ A;  4ZCK A;  1PFN A;  1G91 A;  2EYL A;  3WOE A;  5IY0 A;  2CVR A;  2VY3 A;  2XRS D;  2Q8I B;  1M1K C;  2JA6 H;  3F2C A;  4A93 B;  2EY5 A;  4CDE C;  1DD2 A;  4C3J H;  1AZP A;  1HNX L;  1L0Y B;  1LTR D;  2VUM G;  5K5P A;  1B50 A;  4JV5 L;  1KD1 C;  3F2B A;  1Q8K A;  2HHH Q;  2IW3 A;  2NTS A;  4H7B A;  4KY6 A;  2X6G A;  4KD3 A;  3F1Z A;  2IX0 A;  1B9N A;  2EYF A;  2OQ0 A;  3KBG A;  1QNU A;  5C0X I;  2Z0S A;  5AFW A;  3V2T A;  3X3N A;  4UP8 A;  5CV5 A;  1XJV A;  4C3I B;  4A3M G;  1PH7 A;  2UU9 Q;  1SRU A;  5M3M G;  2LXJ A;  1YVC A;  3E0E A;  4YY3 Q;  1O80 A;  4B3R L;  1DOM A;  4G4K A;  3UDX A;  3J80 E;  1ET9 A;  1ENA A;  2DY8 A;  1K73 C;  3I55 A;  4A3G H;  3U9O A;  2F0J A;  4JI0 L;  3CW2 C;  2CH4 W;  2NVT H;  3H0G G;  3U9S A;  4FP5 D;  2A6H D;  2IX3 A;  3GTK B;  4WJW A;  2QA4 A;  1CFM A;  3S14 B;  1CKM A;  4MTN A;  5DM7 3;  5CBE E;  1V1P A;  2H5X A;  3OIP A;  3A74 A;  4C2M B;  1HA5 A;  2RDF A;  5LL6 S;  4DFA A;  2L9H A;  2VB2 X;  3I4M G;  2K5V A;  3AMU A;  5FK9 C;  3CCE A;  1QG7 A;  3H6M A;  1V8Q A;  1TS3 A;  1SE2 A;  4EQ5 A;  4DUY Q;  2JEB I;  4JBW A;  4P73 A;  3TEH B;  3CCQ A;  4L5S A;  3N52 A;  1YHB A;  1UE1 A;  4TSS A;  4A3C H;  5ELB A;  4DR3 Q;  3HOW G;  1PRT C;  2E2J H;  1A3U A;  1EY0 A;  2OEO A;  1AEX A;  4B3S L;  4DV7 Q;  4NXM L;  4FYD A;  5I9O A;  4Y7N B;  5FO9 B;  1X9N A;  1HUM A;  3CXC A;  4RHS A;  1OO9 B;  2CWA A;  1UEB A;  1B3A A;  3P75 A;  3ULJ A;  5I2Y A;  1MSG A;  2OF1 A;  2C5C A;  5C44 G;  3NE5 B;  1KAB A;  1I6H B;  1D2B A;  1WJJ A;  3KF6 B;  4KHV A;  3MVV A;  1HZC A;  4R4Q A;  1A2T A;  5GAE C;  3GTG B;  4KHZ A;  5FLX c;  1G29 1;  1U0L A;  3TZD A;  4KKT A;  3G6E A;  1MI2 A;  3NPP A;  2MO0 A;  4OON A;  2UXD Q;  2F0W A;  1JR0 D;  4JYA L;  1JOR A;  2FFK B;  1C4Q A;  1IW7 D;  2QEJ C;  3S17 H;  4MHE A;  5G3L D;  5IGB A;  3I91 A;  1F9S A;  4HN7 A;  2JA7 B;  2AWO A;  2GN5 A;  2E2H H;  4HR7 B;  2E5L L;  2K50 A;  5M3F G;  3D6W A;  3J7Y W;  1T5E A;  4EQN A;  2QCP X;  3H0G H;  1X3P A;  5JEA J;  3J81 i;  4ULL A;  4RCN A;  3RLO A;  5C6A A;  4FF4 A;  4JK1 C;  3H3V I;  3T1H Q;  3E9H A;  1J8I A;  2Z1C A;  3PUZ A;  2Y0S E;  5EBD A;  5LHY 1;  5M5X H;  3I4M H;  4K2L A;  2NBF A;  4UPA A;  3NTI A;  1IYJ B;  4YCW A;  3Q23 A;  1STG A;  3BYT B;  5LMU L;  3CHB D;  1I4R A;  3S2D B;  1J5E Q;  1JIC A;  1HNW L;  2LSS A;  1KAW A;  1RL2 A;  4JI6 Q;  1BCP D;  2Y0S B;  3HOW H;  2EYO A;  2K05 A;  3NEN A;  4LWC A;  3T53 B;  1SEB D;  2CW0 D;  5GRO A;  4LMQ D;  4DV0 Q;  4DAY B;  1CT1 D;  2EIF A;  4HSP A;  2X69 A;  2I5M X;  1D8L A;  2RA4 A;  3JAM L;  1VQE A;  1S5F D;  2E76 C;  5C44 H;  1IBK L;  4DR4 L;  4DAP A;  1F2Z A;  4HJ5 A;  3HS0 C;  4DNT B;  3NEL A;  3URY A;  2PZW A;  4LF4 L;  5C4Z A;  1JJC B;  5IP7 H;  2E8G A;  4J8Q A;  1KNA A;  5GAG C;  1YNX A;  4TVA B;  1TWA H;  3T56 B;  1Y69 U;  4BBR B;  1LAC A;  1EEF D;  3UE0 A;  1WTO A;  2A69 D;  2O5J C;  1BVS A;  3S9W A;  3R2I A;  4FVM A;  2JQO A;  1L1O B;  3S24 A;  2FHT A;  2HQE A;  3VYR A;  4FF3 A;  1N32 L;  1XMO Q;  5M3F H;  1BR9 A; 
#chains in the Genus database with same CATH homology
 4LUO A;  4BA1 I;  2NVQ H;  4R4T A;  4DV7 L;  3PO2 H;  4DR6 Q;  3GTO H;  1I6H H;  2HT1 A;  3PF5 A;  1L0W A;  4P75 A;  2WFW A;  3ERS X;  2R6G A;  1K8G A;  4XIG S;  3HKS A;  3PSI A;  1YJ9 A;  1SMX A;  2DGY A;  1TXY A;  1VQP A;  2Q2U A;  3CCS A;  3S1M H;  2VZA A;  4GN3 B;  4JCV E;  1R9T H;  1LUZ A;  4A3J H;  5JJK A;  3HOU H;  3J81 j;  1FVI A;  1YHA A;  1OXX K;  5IWA L;  3DLL A;  1IBM Q;  2ZJR A;  1XNQ L;  1WCM G;  2R7Z H;  4YWL A;  4YHH Q;  2AWN A;  2B3G A;  2WAQ E;  4B3S Q;  2JA8 G;  3MXN B;  4IFD G;  5IP7 G;  4JI5 Q;  5BR8 Q;  1PH1 A;  1W3S A;  3S1R H;  3J7Z C;  5ELN A;  4B3T Q;  4JI4 L;  4LF5 Q;  1C9O A;  5C0X G;  3E9I A;  4DV1 Q;  1JT8 A;  3CF5 A;  3CME A;  1GD7 A;  5GQO A;  4IPC A;  3AYH B;  1Q86 C;  3J80 i;  2UXD L;  3PIO A;  1NE3 A;  1E24 A;  4IO9 A;  2Z6K C;  1C7Y A;  2UXB Q;  4L5Q A;  2RCN A;  3ZJY C;  1G6P A;  2EQS A;  3CCL A;  3Q8D A;  1QVG A;  3UDG A;  2K5H A;  3S1N H;  2YTX A;  4A3I G;  4P72 A;  1O7I A;  3J81 c;  3PIP A;  3L2P A;  2MO1 A;  1PHJ A;  1Z47 A;  3KF6 A;  3GD7 A;  1VQI A;  1Y1W H;  3FKI G;  1YBY A;  2YU9 H;  4IOA A;  1AE2 A;  1IXR A;  1V1Q A;  1PH6 A;  1VQA A;  1A62 A;  1J6Q A;  1YIT A;  1A0I A;  4JI8 Q;  4GOP A;  2JJQ A;  1L2F A;  1VQJ A;  1BBU A;  1MKH A;  2B29 A;  4LFA Q;  4GKJ L;  4X65 L;  5M5W H;  3K80 C;  2MNA A;  4DV2 Q;  3T1H L;  1QZG A;  3I2Z A;  1X65 A;  2KHI A;  1QVC A;  2CQO A;  2JEA I;  4GLV B;  1VCI A;  4A3K G;  1V43 A;  4DR1 Q;  3CCU A;  1IBL Q;  1LYL A;  1BKB A;  1JE5 A;  1KRS A;  1QUQ B;  4A3B H;  1TWC H;  2KEN A;  2OTL A;  2OQK A;  2UUA L;  3PUW A;  4DR5 Q;  1HNX Q;  3ER0 A;  1D7Q A;  4QL5 A;  1EFW A;  1PYB A;  1NJI C;  4JV5 Q;  1J5E L;  3KLW A;  4LF6 Q;  4LUV A;  1NMF A;  3AFP A;  1B7Y B;  4JI6 L;  2ZTC A;  1ASY A;  4LFC Q;  1P8L A;  3F8T A;  4A3F G;  2UUB Q;  3U4V A;  3U58 A;  1WFQ A;  4JI2 L;  3NBH B;  1UWV A;  3RLF A;  3HOV G;  5E7N A;  2K52 A;  5JEA G;  1SRO A;  1TWF H;  3M7N A;  2ATW A;  2B63 H;  1YJW A;  2N49 A;  1HZB A;  3W5O A;  3A0J A;  3L7Z C;  4DV0 L;  2VL6 A;  1YZ6 A;  3CC4 A;  4K0K L;  1RIP A;  1VQH A;  3TQY A;  4A76 A;  2UUC Q;  4P74 A;  2PQA B;  4APV A;  4BXX G;  3KYH C;  3CQZ H;  2IX1 A;  4YWK A;  4LUZ A;  1YEZ A;  2K75 A;  1N9W A;  4A93 G;  4OWT B;  3JAM i;  4BY7 G;  2OTJ A;  3H3V H;  3CC7 A;  1OXV A;  1XMQ L;  4B3R Q;  1K83 H;  4DV6 Q;  2QGQ A;  1B70 B;  2F4V L;  1WCM H;  4GNX A;  1Q7Y C;  4QGU A;  4DV3 Q;  2CCZ A;  2JA8 H;  1OXT A;  5IE8 A;  4GKK Q;  4LFB L;  4LF9 Q;  5IT9 c;  1VQ9 A;  1HH2 P;  1I50 H;  1N34 Q;  1N33 Q;  2JA6 G;  4HIM A;  1JB7 A;  3VDY A;  4B3M Q;  2GVA A;  4JI0 Q;  3RR5 A;  1CKN B;  4DUZ Q;  1PYS B;  4HJA A;  2ZM6 L;  2UXC L;  2JE6 I;  3CCV A;  4P71 A;  2PQA A;  1EOV A;  4RMF A;  3HOZ G;  1XNR L;  4JBJ A;  1AE3 A;  1Q12 A;  4YWM A;  2HIX A;  3PV0 A;  1I3Q H;  4IPH A;  4UP9 A;  4BA2 I;  4FDB A;  2VQF L;  3GTL H;  2AHO B;  3IRB A;  4GOP C;  2ZTE A;  2Q2I A;  3OW2 A;  1IBK Q;  1VQK A;  4LF7 Q;  3KJP A;  4A3I H;  1FJG Q;  1KC8 C;  3S2H H;  1GVP A;  2I5H A;  3TS2 A;  1S3O A;  1XMO L;  3I56 A;  4RG1 A;  3T1Y L;  4XTC S;  3GTJ H;  3K7A H;  3FKI H;  4JI3 Q;  1Q1B A;  4DR6 L;  3U50 C;  3M4O H;  3S16 H;  4OO1 I;  1NBW A;  4J15 A;  1VQC A;  2WB1 G;  2AMC B;  4OX9 Q;  4KHP Q;  1SE8 A;  1X3G A;  4JBK A;  4JOI A;  1X3F A;  1EUJ A;  1VQO A;  4NXN L;  2N8N A;  1KXL A;  1XTD A;  1YI2 A;  2R93 G;  2IY5 B;  3W1G A;  1L1O A;  2A19 A;  1HNZ Q;  2NN6 I;  4X64 Q;  3KOJ A;  4A3K H;  1OXS C;  1IBM L;  1N32 Q;  5C4J H;  1Z9F A;  3I4N G;  2ZJP A;  1WYD A;  4YHH L;  4GLA C;  1FGU A;  1NTG A;  2PI2 E;  3FHW A;  3PUV A;  3J80 c;  4NXM Q;  4A3G G;  1EQR A;  4JI5 L;  4GN5 A;  5BR8 L;  2BA0 A;  3ULP A;  2ALY B;  2VUM H;  1UE5 A;  4B3T L;  4LF5 L;  2KHJ A;  2ZJQ A;  1Y1V G;  1Q1E A;  1LTL A;  3ICE A;  2PMZ E;  1H95 A;  4DK3 C;  1C0A A;  2BH8 A;  2UXB L;  1VQN A;  4GLX A;  1I5F A;  4A3F H;  1TWH H;  5JJI A;  4DV4 L;  1N36 Q;  3UDI A;  3D0F A;  3OTO Q;  1WI5 A;  3HOV H;  1KHI A;  1IZ6 A;  2RF4 A;  2YTY A;  4POF A;  4X66 Q;  2YTV A;  2ZTD A;  1V9P A;  2CWP A;  3G48 A;  3HKZ G;  1FL0 A;  3CCR A;  4EX5 A;  2V1C C;  1VQM A;  2C35 B;  3AQQ A;  4GNX C;  3K81 C;  3KDF B;  4JI1 L;  5C4X G;  1G51 A;  4JI4 Q;  4O2D A;  4BXX H;  3M9B A;  5AJ3 Q;  4BBS G;  3CP0 A;  1OXU A;  1X56 A;  4R4I A;  3WWV A;  5LMN W;  4A3M H;  4JI8 L;  1E3P A;  5IP9 G;  4PMW A;  4A75 A;  1HR0 Q;  1LM0 A;  4HID A;  4LFA L;  5M3M H;  1YIJ A;  4QJF A;  3ULL A;  4A93 H;  1HZ9 A;  1PA6 A;  1E22 A;  4DV2 L;  2NVX H;  2OWO A;  3I7F A;  2JK8 A;  4A3C G;  4JYA Q;  4QQB X;  4QY7 A;  4DV5 L;  3CMA A;  2Q2T A;  1Y14 B;  1GKH A;  2F52 A;  1PH4 A;  2BA1 A;  2Q2H A;  3HOY G;  3CCJ A;  1Q81 C;  5IY0 A;  3STB D;  1EQQ A;  1VQF A;  2VY3 A;  2K14 A;  3G4S A;  4AQY L;  2E5L Q;  2I0Q A;  1M1K C;  1VQ6 A;  4X62 Q;  1IBL L;  2JA6 H;  3F2C A;  3HFZ B;  4A3E G;  3A5U A;  1VQ8 A;  3S1Q H;  1BBW A;  3EBE A;  4C3J H;  4DR5 L;  1XPR A;  1HNX L;  4LF8 Q;  3GTP H;  2VUM G;  3HOZ H;  1KL9 A;  5C3E G;  4GKJ Q;  4JV5 L;  2IHF A;  1KD1 C;  3F2B A;  1GM5 A;  2VNU D;  3RZD H;  3K7U C;  1UE7 A;  1Q8K A;  4H02 A;  2HHH Q;  2UUB L;  4C3I H;  5H1S E;  4JOI C;  1JMC A;  2JA9 A;  1ASZ A;  5IYD G;  3PF4 A;  2QEX A;  4PZ6 A;  3B6Y A;  3F1Z A;  1L1O C;  2LXK A;  3OYY A;  2IX0 A;  2R7F A;  1PH3 A;  2OQ0 A;  1YHQ A;  2A8V A;  2WB1 E;  5IYC G;  2DUD A;  3TS0 A;  3JAM c;  5C0X I;  2VQE L;  2JA7 G;  2NZH A;  2Z0S A;  3J7A 5;  3CCM A;  2UUC L;  1QUQ A;  4UY8 C;  2N78 A;  4OO1 G;  5LMU Q;  1JJ2 A;  5LMN L;  3BZC A;  2K4K A;  4UP8 A;  3PO3 G;  1HNW Q;  1JJG A;  3M4P A;  3A5Z B;  4JC0 A;  4A3M G;  1XJV A;  1PH7 A;  2UU9 Q;  4BY7 H;  1SRU A;  2R93 H;  1I94 Q;  1MJE A;  5M3M G;  2LXJ A;  1YVC A;  3E0E A;  4QIW E;  4YY3 Q;  3GTK H;  4B3R L;  4WJ4 A;  3DM3 A;  1PH2 A;  3S14 H;  4POG A;  4YCV A;  4JI2 Q;  1W2B A;  2PNH A;  3I4N H;  3UDX A;  3HOX G;  3L0O A;  4C2M H;  4DV3 L;  1K9M C;  1K73 C;  3I55 A;  4JBM A;  4LF9 L;  4GN4 B;  4IPG A;  2A1A A;  3RLN A;  5GAH C;  4A3G H;  1TWG H;  5ELO A;  2OCE A;  4DR2 Q;  1N34 L;  1Q82 C;  3CPF A;  4JI0 L;  1N33 L;  4K0K Q;  4DUZ L;  1Y1V H;  2R7D A;  3CW2 C;  2B63 G;  2NVT H;  3H0G G;  1PFS A;  5K36 G;  3BU2 A;  3K0X A;  1EYG A;  2QA4 A;  5HY6 A;  4Y52 H;  1CKM A;  3KF8 B;  4MTN A;  2D0P A;  1XMQ Q;  2L15 A;  2H5X A;  3A74 A;  4ALP A;  3CAM A;  2EXD A;  4DR4 Q;  3HKZ E;  4LF7 L;  1FJG L;  1E7Z A;  2N3S A;  3H15 A;  5GAD C;  3S15 H;  1K8A C;  2IHE A;  3K8A A;  3I4M G;  2K5V A;  2Y0S G;  4LF4 Q;  3M3Y H;  3CCE A;  2KCT A;  2JA5 G;  4BY1 G;  4JI3 L;  5C4X H;  3CPW A;  2XGT A;  4YCU A;  5J3B A;  4DR7 Q;  4IOC A;  4TQU S;  5IYB G;  4BBS H;  4EQ5 A;  2ZM6 Q;  4DUY Q;  1MJC A;  2JEB I;  4JBW A;  4P73 A;  1CKN A;  3TEH B;  5IP9 H;  3CCQ A;  1PV4 A;  1XPU A;  2R92 G;  4PZ7 A;  1HR0 W;  4OX9 L;  4L5S A;  3CD6 A;  4Y7N H;  1YHB A;  1UE1 A;  4X6A H;  1XNR Q;  4A3C H;  1NY4 A;  1YJN A;  4IFD J;  4A4I A;  3PUY A;  1VQ4 A;  5C0X J;  1KQS A;  1M90 C;  3CC2 A;  4DR3 Q;  4PG3 A;  3HOY H;  3HOW G;  2E2J H;  3M4Q A;  1VS0 A;  4A3D G;  1CKO A;  1P16 A;  5JJL A;  1K3R A;  1MIU A;  3G71 A;  2K5N A;  1T9H A;  4UP7 A;  4HIK A;  4HJ8 A;  4MNO A;  4A3E H;  4B3S L;  3LGJ A;  4DV7 Q;  4NXM L;  1Q46 A;  1PVO A;  5HGQ A;  1X9N A;  1CUK A;  3CXC A;  5C3E H;  4DV1 L;  4C3H H;  2CWA A;  2D62 A;  3GTG H;  4NXN Q;  1SR3 A;  1UEB A;  4BBR G;  4MZ9 A;  2FXQ A;  2WP8 J;  3FP9 A;  3ULJ A;  1N36 L;  5C44 G;  3OTO L;  5IYD H;  4A3L G;  2YYZ A;  3TRZ A;  2E2I H;  4X66 L;  5IWA Q;  1XNQ Q;  1QZH A;  1AH9 A;  1WJJ A;  3KF6 B;  4AYB G;  5IYC H;  1OTC A;  2VW9 A;  2JA7 H;  1HZC A;  4R4Q A;  4NB3 A;  4GS3 A;  5GAE C;  4KHZ A;  5FLX c;  5AJ3 L;  1G29 1;  1U0L A;  3RN2 A;  4GOP B;  1EWI A;  3PO3 H;  1X6O A;  3G6E A;  1CSQ A;  4R4O A;  3U4Z A;  2MO0 A;  4OON A;  1HR0 L;  2UXD Q;  1VQG A;  5FJ8 G;  1PH9 A;  4R1J A;  1DGS A;  4OXP A;  1PH8 A;  3KJO A;  4DV4 Q;  4JYA L;  5FLM G;  3S17 H;  3PGZ A;  3HOX H;  1SLJ A;  2D0O A;  3RNU A;  4IJH A;  2I5L X;  2AWO A;  2GN5 A;  4L5T A;  4OWX B;  4DK6 C;  1K0R A;  1U5K A;  2E2H H;  4HJ7 A;  4DR1 L;  2E5L L;  3I4O A;  2K50 A;  4X62 L;  2VS1 A;  2PI2 A;  5M3F G;  1SN8 A;  4IPD A;  2NZO A;  4KLK A;  4JI1 Q;  1VQD A;  1X3E A;  3PO2 G;  4JG2 A;  3H0G H;  3KDF A;  3BZK A;  5JEA J;  3J81 i;  1E1T A;  4LF8 L;  2KCM A;  2MQH A;  2F3I A;  3PCO B;  3RLO A;  4LF6 L;  1VQB A;  1UE6 A;  4X65 Q;  3MEF A;  3H3V I;  1N8R C;  3T1H Q;  2HHH L;  3S2D H;  3E9H A;  4DV5 Q;  3PUZ A;  2Y0S E;  4LFC L;  3AFQ A;  4WJ3 M;  2IT1 A;  5M5X H;  1HZA A;  3GTM H;  3I4M H;  4A3J G;  3GDE A;  5M5Y H;  3HOU G;  3EN2 A;  4NPS A;  2JA5 H;  2CFM A;  4UPA A;  4AQY Q;  1VQL A;  1A8V A;  3M85 A;  4BY1 H;  4IFD I;  1X54 A;  1S40 A;  2R7Z G;  3RZO H;  5IYB H;  1E1O A;  2KBN A;  1IYJ B;  4YCW A;  2UUA Q;  3PUX A;  2WAQ G;  2R92 H;  5LMU L;  3JC6 6;  2HQL A;  2ASB A;  4DAM A;  1X55 A;  1J5E Q;  1HNW L;  2RHS B;  1KAW A;  2LSS A;  1RL2 A;  2UU9 L;  4JI6 Q;  1I94 L;  1VQ5 A;  1VQ7 A;  3HOW H;  4YY3 L;  3NEN A;  4DV6 L;  4GNX B;  2GVB A;  4LWC A;  1S72 A;  4A3D H;  4JI7 Q;  1B8A A;  3GO5 A;  2NN6 G;  3NEM A;  2AKW B;  2ID0 A;  4DNI A;  2YV5 A;  4LNQ A;  4OWW B;  5GRO A;  4GKK L;  4DV0 Q;  4HJ9 A;  1GO3 E;  4DAY B;  1QVF A;  1CSP A;  4DR2 L;  4AH6 A;  2VQE Q;  4B3M L;  4JI7 L;  2Z6K A;  2EIF A;  1Y1W G;  1KIX A;  2CKZ B;  2I5M X;  5LMN Q;  1D8L A;  4ME3 A;  4LW1 A;  1NMG A;  1PH5 A;  1A63 A;  4BBR H;  1VQE A;  4PZ8 A;  1KRT A;  4AIM A;  5C44 H;  3W1B A;  4A3L H;  5DLQ E;  1IBK L;  4DR4 L;  3TRE A;  3KFU A;  4AYB E;  4HJ5 A;  2F4V Q;  2ES2 A;  4L5R C;  1EIF A;  3BJU A;  3NEL A;  3UDF A;  3D31 A;  4LF4 L;  3GTQ H;  4LFB Q;  1JJC B;  5IP7 H;  1XPO A;  2E8G A;  4O0A A;  1EIY B;  1WOC A;  2XTI A;  4DR7 L;  5GAG C;  1YNX A;  4TVA B;  1TWA H;  4IJL A;  3SGI A;  1IL2 A;  4DUY L;  4A3B G;  2UXC Q;  3UE0 A;  2NVY H;  2HIV A;  3AEV A;  5EAY A;  2RHQ B;  3STB C;  5FJ8 H;  1BVS A;  4HIO A;  4KHP L;  2JQO A;  4DKA C;  1L1O B;  4DPG A;  3EIV A;  5FLM H;  2VQF Q;  2BH2 A;  3S24 A;  1HNZ L;  2MFI A;  4DR3 L;  4X64 L;  3UE1 A;  3F2D A;  1SFO H;  1N32 L;  1XMO Q;  4R4C A;  5M3F H;  3RN5 A;  3T1Y Q;  1HJP A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...