3H3VK

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3h3vK00
1YRNB 3IH2A 1DU6A 2D5VA 3SFIA 1IDYA 1MH4A 1CQTA 1ETOA 4A3CJ 5K7HA 2I10A 3HBLA 3LNQA 2DTZA 4DZJA 2TRTA 4DYQA 4UUSB 2HXOA 2JA8J 2O7OA 1IJWC 1BA5A 4DYCA 3LSPA 2E1OA 2WV1A 1X58A 2LY9A 1ZR4A 3TP0A 4A69C 3A01B 4RDUA 3MKLA 4XIDA 2XSDC 3GTLJ 5FKOA 4MFDA 3BR3A 3Q0WA 5F0HA 3I4NJ 1VF9A 5J3LA 2HOSA 2GBYA 2COBA 3HOZJ 1U78A 4C3IJ 1XG1A 3BTCA 4XRMA 3JRAA 4BY7J 4J19A 3GTKJ 1ETWA 1BW5A 5GP9A 3JR9A 4MFEA 2DN0A 1ORKA 1GV5A 2AHQA 3QPLA 2YUSA 2AO9A 5F04A 1U8BA 2R7ZJ 1RR7A 4QIWN 4A93J 1TC3C 1HOMA 4JP0A 2M9HA 2PMZN 4FE7A 3G1LA 2M0CA 1JKQC 3ZQIA 4BBSJ 3ZQFA 5M5XJ 2ECBA 3FKIJ 2DA4A 1U9NA 1Y1VJ 5FKLA 1MH3A 2X6OA 4AUXA 1DU0A 4M3FA 5C4XJ 5IYCJ 3GTPJ 2NVXJ 2R0QC 2K9NA 2IAIA 5IYDJ 1IC8A 1JTYA 1HF0A 1QVTA 1VI0A 2R5YA 3G1MA 1X2MA 1QPIA 2DA3A 3TEDA 2DJNA 2YU9J 1F43A 1OCPA 4ABZA 1K83J 2Y9YA 3CQZJ 2JJ7A 3HM5A 1MNMC 1VFCA 3G1OA 5HODA 2FD5A 4M3BA 3MN2A 2ME0A 1ITYA 1MBFA 5J1RA 3BQYA 3M4OJ 1APLC 5IOZA 4D5FA 2Y0SN 2DA1A 2NVYJ 5FLMJ 4XK4A 1WI3A 4Y7NJ 1AU7A 2NS7A 1OJLA 5E3NA 2L7ZA 1Q1VA 4V2FA 1FIPA 1GV2A 4AYBN 1XC5A 1NK2P 5J1UA 1RKWA 1ENHA 4W97A 5EG0A 5IP7J 3PO2J 4D7NA 2Y9ZA 1H89C 2JN6A 2IEKA 3BR2A 4JX6A 1HDPA 3NAUA 1GUUA 1WH7A 1TWCJ 1AKHA 4M3GA 3BG9A 1BL0A 2CJJA 1B72A 3JRDA 1IV6A 1P7IA 2E2HJ 4A3DJ 2XPWA 2E2JJ 2L9RA 3S2DJ 2L7FP 3S2HJ 2NVQJ 1TWFJ 2VUMJ 3Q0VA 5K7FA 2O8KA 2M2EA 1RETA 1IRZA 1HDDC 5DS9A 2DA6A 2OPTA 4B1RA 2K40A 1SANA 4A3KJ 3RZDJ 2LR8A 4IHXA 3FISA 3O8GA 4I76A 3JRIA 4RBOA 1PUFA 1LFBA 3S16J 3W6VA 3HGYA 2MG4A 4FTHA 2DMQA 3CCYA 5IPAA 5F0CA 2HOAA 5EEAA 1VNDA 4JX4A 3HOWJ 4CYCA 4NDLA 3QPSA 1H88C 1RPWA 3FK7A 2GM4A 3OIOA 2DMPA 5C3EJ 2X48A 1BW6A 5JLWA 3H3VK 4I6ZA 2EZIA 5IYBJ 1FJLA 4D5CA 4BY1J 4A3GJ 3HKZN 1F36A 1MBJA 2EQRA 4DZPA 5EGOB 4M3DA 5F1JA 4C2MJ 5IP9J 1SFOJ 1JJ8C 5E3OA 3HOUJ 3DCFA 2E2IJ 2N8GA 1D5YA 3F0CA 2VKEA 3BTIA 2MW8A 1HCRA 3BR0A 2R92J 3WHBA 1JUSA 5BNGA 2VPRA 1MBKA 1T56A 3TW6A 2XPVA 3HOXJ 4D7MA 2OF7A 3QQAA 3ZQGA 2MSYA 2W48A 2LTPA 3CMYA 2R5YB 1ZKGA 3ZQLA 1ETVA 4XICA 1LE8A 4A3BJ 3S1MJ 1P7JA 4A3EJ 1I6HJ 1MBEA 2CU7A 4BXXJ 4BKXA 2CUEA 5M5WJ 3ZQCA 1UMQA 2LLKA 3GTJJ 1U9OA 2E19A 3RKQA 3UKGA 2XRLA 1ZR2A 4Y52J 1OFCX 4JYKA 4C3JJ 2K9QA 1JTXA 3OSGA 2H8RA 4MIMA 3BR6A 5DTDA 3NARA 2DMUA 3LSRA 3JRCA 2RAEA 1BJZA 2XPUA 3ZQHA 2ID3A 2EBIA 5M3FJ 1ZGWA 1B8IA 1IG7A 1IGNA 1O4XA 3E7LA 3PM1A 5FKMA 2HQ5A 1I50J 1QVUA 1K61A 4IHVA 1POGA 5EG0B 1W0UA 1JKOC 2R5ZA 3GTOJ 3GTGJ 1FTZA 2NOGA 3S1RJ 1AKHB 2EH3A 1B72B 5C44J 1EF4A 5F27A 4A3FJ 3S15J 5E3MA 2JA7J 3VPRA 2HXIA 1RKTA 1UG2A 5IOYA 3CDLA 4A3MJ 1H8AC 3BTJA 3IH4A 1MBGA 1TWGJ 4DYRA 2JMWA 3BG3A 2CQQA 3HOYJ 3LSGA 3JRFA 1A5JA 2TCTA 1JKRC 2XGEA 1MSEC 3Q3SA 4X1EA 9ANTA 2DA7A 2WB1N 3Q0UA 1NTCA 2JA6J 2DA5A 2KT0A 3SDGA 3K2AA 4LOCA 1LFUP 3D1NI 5EYRA 4EEFG 1PUFB 1UHSA 2ZB9A 3RQIA 5GPCA 1IDZA 1TWAJ 5EF6A 2B63J 2LKXA 1MSFC 1TWHJ 2KDZA 3PO3J 2M8GX 3BQZA 4JX5A 3M3YJ 4CYCB 3HOVJ 2JWTA 5J1YA 3JRGA 4B4CA 2EZKA 1JUPA 2HYJA 1Y1WJ 1OCTC 5M5YJ 4UUTA 2LP0A 4W1UA 2DMTA 3DEWA 5EDNA 3GBGA 1YRNA 5IP6A 1ETKA 2Y2ZA 3RZOJ 1XS9A 5F0FA 1ZK8A 2NS8A 4G12A 1JT6A 3WHCA 3L1PA 5FLVA 2CRGA 4UUSA 2QCOA 3S1QJ 2FJ1A 2ECCA 1FTTA 5FKKA 2CUFA 2QF7A 3GTQJ 1Z77A 3A01A 2ID6A 4M3EA 2L0KA 1ETYA 2M34A 1ZTRA 2DA2A 3IV5A 4AC0A 4IEJA 5EZGA 2GLOA 3TW7A 3S1NJ 2H1KA 4XRSG 1ETQA 5GPAA 5E3LA 3JRBA 4A3IJ 1JKPC 1LE8B 3O8HA 3K7AJ 4QTRA 1X2NA 1W0TA 2MGQA 4IHYA 2LVSA 1WGXA 1A6IA 1HLVA 2WAQN 5K7ZA 3MVPA 5EGOA 1S7EA 3JRHA 3A02A 2DMNA 3C2BA 4M6VA 2YS9A 3SJMA 1GT0C 3IH3A 1I3QJ 1E3OC 1AHDP 1JJ6C 4MLOA 4DW6A 2X9DA 1JGGA 1WH5A 2EZHA 1B8IB 3JREA 1IUFA 2CQXA 2FX0A 1JUMA 2L7MP 2XB5A 5M3MJ 4FISA 1GVDA 1RESA 4A3LJ 2EZLA 3OOUA 2K9SA 4IHWA 1NK3P 2P81A 2HDDA 1MBHA 4XRSA 2R5ZB 1FEXA 1G2HA 2ME6A 3ZOBA 1GDTA 4A3JJ 2O9LA 5JLXA 2FQ4A 3A03A 3HEFA 3BR5A 2VKVA 3BG5A 2ELKA 1WCMJ 2Y31A 3BR1A 5F08A 5FJ8J 2HOTA 4HNVA 4FCYA 3H0GJ 3B6CA 3LOCA 3B6AA 1WPKA 3S14J 4GFBA 1QRYA 3FIWA 2NVTJ 1ETXA 3S17J 4MO7A 3FK6A 3TP3A 1Z0XA 4QSHA 3LSJA 2JK3A 4FE4A 4L5EA 3BT9A 2Y30A 3GTMJ 4C3HJ 5C4JJ 3OSFA 2XGCA 2JA5J 3HGGA 5FKNA 2LK2A 1T33A 2HI3A 3HB9A 3BTLA 2XB0X 2LD5A 2IBDA 2VI6A 4V2GA 2R93J 5EZHA 3I4MJ 3HDDA 1JT0A 1ZQ3P 4B3AA 4S0HB 1R9TJ 2XGDA 1FIAA 4BBRJ 4X6AJ 2G0EA 2LFBA
chains in the Genus database with same CATH superfamily
2CMPA 2NAZA 4BAYA 1FLIA 1YRNB 1LFPA 2C6YA 3R0AA 1IDYA 3HBLA 3M07A 2DTZA 3T1BA 4DZJA 2ZXJA 4KFCA 5IT9K 4BE2A 2IPQX 1J09A 3HZJA 4F55A 3FXUA 3PQKA 3K4BA 3RQ4A 2ZXWH 4CA0A 2PMUA 3B02A 2E1CA 4A69C 2X0LA 1RNLA 1G4DA 3FMRA 4XIDA 3BCAA 3IWZA 5FKOA 5F6FA 3K4KA 3COAC 1IUYA 4CUGA 5LLQA 2UXXA 4G9YA 2GBYA 1Z1DA 3E5UA 1RR8C 4AVZA 4J19A 5TJJA 1Z7LA 2XF6A 3QODA 2ETHA 1Q1HA 2HPMA 1OCZH 3JW4A 3VB2A 1GV5A 3AL0C 4A12A 3S3NA 2AHQA 1XGNA 2YUSA 2AO9A 5F04A 2O3FA 1SC7A 2R7ZJ 3J81K 1RR7A 1KZHA 4A93J 1HOMA 2M9HA 4ITVA 3TDUC 1CF7A 5HS7A 3P9CA 1JKQC 1ZGAA 2ESNA 1J59A 2ECBA 1KQ0A 2LY2A 2DA4A 5J8FA 2BXZA 2DK8A 4MHGA 4AUXA 5DD8A 1XDSA 2F4IA 3IC7A 2NVUB 5KHDA 3DU5A 2P5VA 1Z21A 4I98B 3ESWB 1OCRH 2QQAA 3QOPA 2NVXJ 1I6XA 4YFXF 2K9NA 1RC9A 3QYFA 4HLXA 1BI3A 3K4MA 5L3CA 2BV6A 4U87A 3WU2C 2V6EA 5D4SA 1YG2A 4RGXA 1HF0A 1LEBA 2LBFB 3K4CA 4HNTA 3I56I 4LD5A 1P92A 2XAGA 4K2EA 3OYEA 2QEXI 3TEDA 3KYDB 3HL2A 1F43A 3MQ0A 3FKJA 3OYDA 2JJ7A 2CGPA 1VFCA 3MAJA 2CO5A 2M45A 2FD5A 1R23A 4L9JA 2ME0A 3BCBA 1P2FA 4PJ0C 3QYBA 1O7LA 3DBLB 1OLTA 2E60A 3RTRA 5L3BA 5BOXA 1YHQI 1X1AA 4EQQA 1H9GA 1K7AA 4HDUA 2NVYJ 4CHUA 5HS9A 4BH9A 2NNNA 3OYJA 4GYIA 4G7ZF 3IKVA 5J4VA 2L7ZA 3GFLA 3TGNA 2X51A 3W6JB 1NK2P 5J1UA 3DLLF 1YW9A 4IQJA 1ENHA 3VSKA 5EG0A 4RAYA 5D8LB 4UB6C 4M9ZA 5HLHA 3FHNA 2IEKA 3LA7A 4UHTA 4NC8A 2MFZA 3WTTC 4BE0A 3HPGA 1H9TA 2CJJA 4NC6A 4FX4A 3GFMA 1IV6A 1WVRA 2E2JJ 2L9RA 2L7FP 3DFGA 4IJAA 5KVRA 1DQUA 1KU9A 2DOEA 3Q0VA 2GA2A 1E2XA 3HC7A 2O03A 4NNJA 2ZMEB 1LVKA 2DW4A 4XN0A 4CXFA 3LSIA 4M9XA 4G94A 2QZ8A 3G3ZA 4PFOA 2HTJA 4M72A 2VLAA 2A69F 5B5EC 4XONA 4M74A 5J8CA 3O8GA 3FXRA 3HKZA 3JRIA 1WSUA 1L3LA 1UB9A 1PUFA 2FF4A 1LFBA 4BNCA 4RAGA 4CO8A 5IPAA 2BVLA 1YE9A 4EJVA 4ZDLA 5EEAA 2GAUA 1TNSA 2EPFA 1J2XA 2Y69H 3FXLA 2B0LA 3A0HC 3T0YA 4ZZLA 3OYKA 4ZYAA 2E36A 4EVIA 1IV8A 3G71I 2P8TA 2ZCWA 4L5JA 1XMXA 1F9NA 1RPWA 3LFUA 1OISA 3FK7A 1XGSA 3K1NA 3KETA 3CC7I 5JLWA 3TL4X 3ABMH 1WJFA 2BHYA 5KK1A 4XR6A 4L5IA 4KN7X 2L54A 1EKEA 3HKZN 4YRVA 4DZPA 4Q4ZF 1Z05A 4M3DA 5EGOB 1MNEA 2OU2A 2BW3B 2DXIA 3GUDA 3JTGA 1BOBA 1SFOJ 5E3OA 2CV1A 2KDOA 5AIQA 3FMQA 1M1EB 2ZXHA 2TDXA 2RQQA 1WJDA 2HFHA 3F0CA 1VQLI 3BTIA 3CP8A 3MCZA 4IKFA 3BR0A 1WI9A 5ILSA 3H3UA 4Y13A 1MBKA 1WWXA 2PBIA 4EM2A 5HS8A 1SVOA 5KCMA 2Z9OA 3S93A 2W48A 1WJAA 5EEGA 1LUJB 3CMYA 4XICA 4A3BJ 1DP7P 3S1MJ 1P7JA 2GXGA 2LH9A 3GWZA 2QA4I 1VZ0A 4BXXJ 3KLOA 3BOQA 5FFXA 3GTJJ 3PNVA 2HYGD 1U9OA 2M30A 3K0LA 2E19A 3RKQA 3UKGA 2XRLA 2K9QA 1JTXA 1XMKA 4ZC3A 3OSGA 1K4SA 2H8RA 2HVRA 3NARA 5DCFA 1ERDA 3BG6A 1MNDA 1BJZA 3OYHA 3OS2A 2MA3A 2ID3A 2L2OA 3H9JA 2X1EA 1TBXA 1B8IA 2YX7A 1IGNA 2COMA 3FBNB 4PUSA 1ACIA 2LKSA 3GO5A 3PM1A 4DBQA 2HU9A 3SZTA 2PJRA 1BBYA 2K86A 2DK5A 5LHGA 2VE9A 3HIFA 3BZCA 2IW5A 4PSWA 3SDBA 2V1XA 1AKHB 1B72B 2BXYA 2R7VA 1BR2A 3KLNA 3I59B 1OKRA 1QGPA 1UG2A 5IOYA 3A0BC 5K5OA 5BQTA 3LSHA 4CCLA 3B73A 3RIRA 3JRFA 4QPQA 3NWSA 4QPOA 3J80Z 3ASOH 4EM1A 2YSRA 2XGEA 3T8RA 1SVLA 3WTVC 3CMAI 1WQ2A 2WC2A 5FD5A 1YITI 3H3ZA 2KT0A 2P6TA 2KZVA 3K2AA 4PGGA 1VQ6I 2GXBA 3CDIA 2XAQA 3ELKA 3DTEA 5EYRA 1UHSA 2DT6A 2JUGA 3C18A 5GPCA 1UZCA 1IN4A 1MSFC 1TWHJ 2A5WA 2KDZA 4EJOA 2M8GX 3BQZA 3R60A 3M3YJ 3I5UA 3FXOA 2OCEA 4LG0B 3FDYA 3K1PA 4CCMA 4P1WA 4WXHA 5J1YA 3JRGA 4MEXF 1BC7C 1K6YA 2D1HA 2Z99A 3AKZA 5AIPA 3TOBA 1I3AA 2JSCA 4W1UA 1Y8QB 5EDNA 2R7TA 2F2EA 1ZH5A 5E8IA 3RZOJ 3VFZA 5D5UB 4L0YB 4BEHB 4G12A 5FLVA 2E71A 4EATA 2CRGA 4UUSA 3D5LA 3EYYA 4RB0A 4ESBA 2UZKA 1FPQA 4IQ4A 5LGNA 3N97A 5LD2C 2FJ1A 1XSVA 3WTXC 1Z91A 4XKVA 1TT0A 2HTSA 4I7HA 3A01A 2UWMA 4M3EA 2L0KA 2M34A 4OMZA 4PJLA 1R1UA 5EZGA 4NHJA 3KYLA 1NG7A 2V4JC 4XKCA 5BPDA 1FBQA 5J4YA 1R1TA 1QZEA 2R7UA 3DTIA 2VKDA 4BXFA 4FETA 2Z5UA 4Z6YA 1U5TA 1T8IA 2XF7A 2KL4A 5E17F 2L9SA 2H6BA 1W5CC 1WGXA 2BY1A 3V42A 5K7ZA 1LEAA 2FRHA 1IN6A 5DCMA 3OIQA 2VXDA 2XIGA 3CDHA 1JJ6C 4YIIA 1WFXA 4DW6A 4WXCA 2VQCA 3IKTA 4EV0A 2RC4A 1KA8A 3GMEA 4BDYA 2A6EF 5M3MJ 3KX2A 2FBIA 2IA2A 3WGIA 3OOUA 3RYPA 1MD0A 3CCJI 2HDDA 5HNHA 3KE2A 1Z67A 4YFKF 2IA0A 4A3JJ 2KZGA 2G7UA 4B3XA 2FQ4A 5JVTA 3BR5A 2FNPA 4P96A 2JQ7A 2D45A 4II3A 3F8MA 2ELKA 1WCMJ 4BJTA 3KPHA 2H6CA 3DV8A 1J0RA 3ZMUA 4HNVA 4N4NB 3LOCA 3KP6A 1F5TA 1IRXA 3S14J 1R4NB 3K9TA 2GOMA 3WTSC 2NVTJ 3IWFA 2ZNZA 3P5JA 1Z0XA 3V8KA 1PVEA 4LJZF 2NRAC 3EYIA 4L5EA 3BT9A 1MJAA 2Y30A 2XROA 2X85A 1R4MB 5L3EA 1ZAOA 2IS6A 1N75A 2XGCA 2EV5A 1RI7A 3TO7A 1ZRFA 1R00A 2DAOA 1D1BA 1FC3A 3ZMVA 3QPTA 3ZRGA 4CCJA 3CJQB 5TGTA 5L3GA 2ZJ2A 1OQYA 4E4HA 4D0PA 3FXJA 1R71A 3VYSB 3OMYA 5FO5A 3RPUA 2JUCA 1XGMA 5EZHA 3N4MA 3U9GA 2O8XA 2ZFUA 2QSHX 1VQ7I 2XGDA 3R6SA 4BBRJ 3C1DA 2G0EA 2FXAA 1WJBA 1MJBA 4DNCA 4M6YA 3DTKA 3L7WA 1SVMA 3IH2A 3I3LA 2IJLA 2KMUA 1MH4A 1U3EM 5CKTA 1CQTA 4A3CJ 1LKXA 2H1LA 3LNQA 2NOJB 1ZHFA 2TRTA 2HEOA 2QVOA 2LG4A 2Q2EB 4MQ9F 1QQIA 2HXOA 3DKXA 3WTYC 1BA5A 2ESHA 3LSPA 2PMZA 4DIQA 1S9HA 1HC8A 1G6NA 1X58A 4RM3A 3TP0A 2BVMA 1USSA 2X6YA 1ULYA 5CQEA 4RDUA 5DD4A 1Z3XA 3K69A 3D5RC 2W1OA 3MKLA 2XSDC 3GTLJ 1FOYA 4XSZF 1YQAA 5F0HA 5FRMA 3I4NJ 1U2WA 4ZH4F 2HOSA 5J3LA 2COBA 2E1NA 3HOZJ 3K10A 3JRAA 3GTKJ 1R49A 4BACA 3JR9A 4MFEA 5CVVA 4GXOA 3CUQA 4UXNA 1IO2A 1DP3A 3W2VA 2DYRH 3E6MA 2NYXA 3HJEA 1V55H 2PMZN 4FE7A 1QNTA 1OPCA 2HZTA 2A5YB 4EJUA 1ON1A 3NWTA 2M0CA 3ZQIA 4L18B 3ZQFA 4ZDPA 1GXQA 1U9NA 1ZG1A 1EJ9A 5GAEJ 3JSPA 3A2KA 2CW8A 3ECHA 5JHUA 3QU6A 4RLFA 3RPUD 1QBJA 2Y0SA 5C4XJ 3DBRB 1ZN2A 4HRIA 3DPLC 4M71A 2KFDA 3GTPJ 4I09A 1FP2A 2FU4A 2IAIA 3WTWC 1JTYA 1XPXA 2M1BA 4H4KC 3IL2A 3V7RA 3I64A 4AYBA 1I39A 1GVJA 3KP5A 3OYLA 2K9MA 2R5YA 1F1ZA 2CYYA 3BZ6A 3TO6A 2DA3A 1TW3A 4CGZA 1KU3A 3QWLA 4ABZA 3GF2A 3GVAA 4KIGA 4LK0F 3HTSB 1MNMC 2F5EA 2HDWA 5F1RA 3G73A 1AOYA 4GCVA 2DFFA 3JSOA 1ZREA 1ITYA 2VQHA 1X1DA 3VODA 3M4OJ 1APLC 4RGSA 5CYVA 2Y0SN 4HW0A 1X3UA 2A61A 1LNWA 2HNHA 1WI3A 2EWNA 4XK4A 4Y7NJ 2NS7A 2JZYA 3BY6A 3NEUA 1T0FA 1OJLA 2VT2A 3KYCB 2M7AA 1Q1VA 1TTYA 2G9WA 2MD0A 1GV2A 4AYBN 1OYYA 1R22A 2V1UA 3GYHX 3U21A 2DCEA 2DFEA 1O3SA 2QBYA 4CYDA 1XD7A 1XCVA 4W97A 2NS0A 2KRFA 3VSLA 5IP7J 2MLGA 4CCOA 6PAXA 1H89C 2HS5A 3DLAA 3BR2A 4LLLA 1J75A 3AL0B 4HF2A 1FBUA 3KEQA 1HQCA 3G4SI 3OYCA 1MDMA 3V8JA 1G3WA 4M3GA 4DGWB 2E2HJ 1P7IA 2CUZA 4A3DJ 2KIFA 5LRSA 1A36A 1USTA 1HXDA 3OWTA 3ULQB 2CS3A 1TWFJ 3VDXA 5K7FA 1HW2A 2HKOA 2O8KA 1W7PA 2M2EA 4GO1A 2E1MC 1YI2I 3RYRA 2JA2A 3HHGA 4XKBA 2OPTA 3TOAA 4KYWA 3OV8A 1SANA 2LR8A 3OYMA 1ONVA 5FGMA 1U6GA 3FM5A 4RGRA 4OWRB 1T0FC 4UUVA 5AONA 1G3TA 4BQQA 5F0CA 2JT1A 3F72A 2VOOA 2HOAA 1HA8A 3HOWJ 5LGTA 3A1YA 1CGPA 2B7EA 4M73A 1E17A 2QGUA 3OYAA 3KZYA 4KIFA 1H88C 3GCMA 3HOTA 4I0AA 1OCCH 4LK1F 3SXYA 4Q47A 2IGNA 1YTYA 2XASA 2DMPA 3DEUA 2X48A 1BW6A 2Y0MA 2E35A 2JVGA 1J7KA 1NHAA 4WF2A 5ICGA 1LPQA 4E7HA 1P4AA 1RUNA 4LFUA 1CF7B 5IYBJ 3HYIA 2BE5F 2OBPA 3I54A 4D5CA 4BY1J 4GGGA 3FXQA 1YJNI 1F36A 2J5PA 2W00A 1V54H 2LF8A 3Q9SA 4IOAF 3ERMA 4AVPA 3HOUJ 4XLNF 3CJRB 2E2IJ 2KPMA 4BGDA 4ZYGA 4G6QA 2VKEA 3C2GA 1HCRA 2R92J 4GRIA 5BNGA 2VPRA 2DQRA 1T56A 2XGXA 2FEZA 3CD6I 3QQAA 5J40A 3CCMI 1K6OA 1KYZA 3MKZA 2LTPA 3CLQA 1LE8A 4P55A 2VQGA 4A3EJ 2L01A 2CU7A 4PGHA 4OAYA 2CUEA 2WBMA 5KAIC 3ML6A 3ZQCA 1UMQA 3LSKA 4L9VA 2W84A 2KRCA 1Y6IA 4C3JJ 3E6BA 1TLHB 4UY8I 4KT6A 2QQ8A 2QKMB 3BR6A 3ZXSA 2DMUA 1TZLA 2VT3A 2EV6A 2RAEA 2BZTA 4PJMA 5LEKA 2R7OA 4BHPA 2DU9A 4OIPF 3ABKH 2Z3YA 3BJAA 4PZJA 3F23A 5FLXZ 2KLOA 5E18F 1ZGWA 1P4WA 3QOEA 1IG7A 2RQPA 4MQVA 2VASA 3QAHA 4WK8F 5FKMA 3L00A 2BY2A 1K61A 2K3FA 3AG2H 5EG0B 3VYTB 3KP7A 2R5ZA 2UUZA 3KZZA 3FZVA 2W82A 3GTGJ 2M8EA 1VTNC 2NOGA 4ON0A 1I1GA 1EH8A 3PL8A 4BDZA 2AXLA 3DP7A 4ZYDA 1MMSA 5F27A 2JA7J 1ZELA 5TRDA 2V9PA 4B43A 1MBGA 3HOYJ 3F6OA 1MSEC 2X1DA 1TW2A 9ANTA 1JGSA 2BEOA 3HXLA 2DA7A 3WTUC 2WB1N 2AQFA 3I0TA 2JA6J 1P4XA 4ZYEA 2IS1A 3DEEA 1NH3A 4NQWA 1LFUP 3OYNA 2W7NA 4ASNA 1PUFB 4EEFG 1YIJI 2CG4A 2ZB9A 3CJTB 3IRQA 1BI2A 2DTRA 4AIDA 2LKXA 3DPUA 3PO3J 3BC8A 1OR7A 2UV1A 3W2AA 3F8CA 5D4RA 4Q5SF 3HOVJ 4LITA 4EGZA 3AG1H 4B4CA 5A2QZ 1JUPA 1XN7A 5TISC 1FYLA 2JRTA 5M5YJ 4P9FA 2LSOA 3LA2A 2QYOA 3FXKA 2K02A 3CCUI 3I55I 4G7HF 2PFBA 1K78A 4A2UA 3F8NA 3E1SA 2Y2ZA 1XS9A 3HSRA 2OA4A 5F0FA 2NS8A 2EFNA 2A6TA 1JT6A 3K4LA 3CP2A 3IAS2 2XHKA 3WHCA 1RUOA 4O3MA 1X4PA 2LY1A 4EGYA 2LNBA 3TBIA 1UJ8A 1ZGJA 4JQFA 3PSIA 2FNAA 2W25A 1FTTA 4RMNA 1HSJA 4YG2F 2QF7A 4KUMA 2HZDA 4E7SA 2VBXA 1ZTRA 2JPCA 5LBQA 1SMTA 1Y8RB 4IEJA 3TW7A 1VQOI 2EFQA 2H1KA 1ETQA 3JRBA 2AXTC 4A3IJ 2I5UA 1D1CA 1OR7C 2PMHA 2GIZA 5H6RA 1K4TA 1JKPC 3ONQA 1MKMA 2ELHA 3DKYA 3D5SC 3C3WA 2QQ9A 3DF8A 5LRRA 2XUBA 4QTRA 1R6RA 1X2NA 3L2QA 2PLYA 1D0XA 4C2UA 3F8FA 2MGQA 4IHYA 1A6IA 1HLVA 2L02A 3MVPA 5EGOA 1BR1A 3JRHA 4KA4A 2W24A 3C2BA 3ECOA 5K5QA 4M6VA 2YS9A 4UVBA 4XN3A 1GT0C 3IH3A 2IGOA 1ZRCA 2JPBA 2E5NA 3KP2A 2R7FA 2DT7B 3FF5A 3S32A 5D8KB 4MLOA 4F92B 1D0YA 1Z6TA 4YIFA 2OTLI 1JGGA 4Q48A 2EZHA 1B8IB 4B44A 3PIOF 2FOKA 1IUFA 3D0SA 2FX0A 2XB5A 1X4OA 1GVDA 2HKXA 3HHHA 1TL8A 3E5XA 2EIKH 3HUGA 2EZLA 3KIOA 2PJRB 4IHWA 3GEZA 3JTHA 4GDFA 4NBQA 5HDNA 2DI3A 3M1EA 4XSXF 2JTVA 3PUFA 4BQOA 2V6CA 2EILH 2LDUA 2CUJA 2V9KA 3REOA 3A03A 3H9GA 5JLXA 2GXAA 4RM2A 2HVSA 4EJTA 3JAMZ 4M9SA 4FASD 2EA2A 4BXUA 5L3DA 3B6CA 1S7AA 5ILUA 4XOPA 1H0MA 2XAJA 2VN2A 3FIWA 1O7FA 4XLCA 4AIKA 2OQRA 3S17J 3FM3A 3FK6A 3LSTA 4RB3C 3OL3A 1BM9A 3T8TA 1SD7A 1V5EA 1FMVA 3AFHA 5EEHA 3GTMJ 2EIJH 1TQPA 2ELJA 4XLFA 5CPRB 3S2WA 2O61A 5E1XA 4HEA2 1T98A 2JA5J 2W4SA 3ZN1A 1WRJA 2CH0A 2LK2A 3FWEA 3C2HA 3BDDA 2VC1A 2ZSHB 4IXAA 2HOEA 5HLIA 1SEUA 2IXSA 2VB6A 3BTLA 4LG3A 2LD5A 2R93J 2X6XA 2RN7A 4Y4RA 1SMYF 2CFXA 2VONA 4BHBA 4UNOA 2RNJA 4B3AA 3CO7C 1R9TJ 3RKYA 1FIAA 4OIQF 1BJAA 1SFKA 2JSPA 3SFIA 2BY0A 1BIBA 3TMOA 1ETOA 5E20A 4IO9F 4DYQA 1KYWA 1NG6A 4R1HA 4A5MA 4UUSB 3FXMA 5J6XA 2O7OA 2R4GA 3VOEA 1C0WA 4DYCA 1MZBA 1JE8A 2E1OA 2OZUA 3OS1A 2A05A 2LY9A 2K27A 3A01B 3CUOA 4IX7A 1A31A 2DO7A 1EH6A 3BR3A 3Q0WA 1YIOA 4E7KA 2DLLA 3BP8A 5IT9Z 3HOSA 2YU3A 1U78A 4C3IJ 1TT5B 2QWWA 1WJEA 4BY7J 1BW5A 5GP9A 3EDPA 3H1CA 1U5TB 2IP2A 2V79A 3KP4A 2L7KA 2WAEA 3UR3C 2XC7A 1IAWA 2DFIA 5DUKA 1N78A 1FP1D 1VQMI 2HQAA 1U8BA 4BYYA 4QWQA 2VQLA 2V9VA 3K4NA 4RS8A 2QLZA 4QIWN 1IN8A 1YS6A 1TC3C 1YOVB 3F21A 5DCMB 2JRMA 1SFXA 4LGWA 1R7JA 4LLGF 3OY9A 3M7GA 5BS6A 4XM3A 3ZMTA 5FKLA 1O57A 4XOTA 1D5VA 1MH3A 3H5RA 4MTDA 3WODF 1DU0A 2X6WA 4M3FA 5LGUA 4G7OF 1E0EA 5H20A 3J81Z 2ZNYA 2L5QA 3QYEA 4FX0A 3J7YJ 5JR3A 2ZFWA 3DWLE 2R0QC 4EM0B 1T08B 3ZPLA 1E3PA 1QVTA 1SD4A 3IHUA 3JCUC 1UHMA 1IW7F 1VI0A 1F4KA 5FLXK 3G1MA 1X2MA 4HX4A 3T5XA 5BMZA 1QPIA 4I02A 2NXNB 3GFIA 2KQRA 2DJNA 4P9UA 4UB8C 1OCPA 3CCEI 4XL9A 3RSNA 1K83J 2Y9YA 1UAAA 3G1OA 3E6DA 1TP4A 2FUG2 5J1RA 3BQYA 3KEOA 1U5TC 1X1BA 4BE1A 1O3QA 1ODDA 3HSEA 3I9V2 4D5FA 1BR4A 3E3VA 3I71A 2EFWA 2DA1A 5FLMJ 4XNFA 4DBRA 4XLAA 3SZPA 1QZYA 2M5WA 2VBZA 3OOPA 3CF5F 1FIPA 2VOPA 1DPRA 5B66C 2VIXA 1RKWA 1Z3YA 5LFAA 4OAZA 2MBFA 1EV7A 4MEYF 3EPZA 2L9NA 4D7NA 2ZJQF 2Y9ZA 3K1MA 1O3TA 3PO2J 1OMIA 2AQEA 3A4CA 1LB2A 2FA5A 1FOKA 1D1AA 5CVUA 1HDPA 3QU3A 4IHSA 3NAUA 1WH7A 1TWCJ 2HR3A 4HG2A 1SAXA 3JRDA 2XPWA 3ABLH 4CZZA 2WWYA 3S2DJ 2GOXB 3U1DA 2O0YA 3S2HJ 2NVQJ 1PUEE 2VUMJ 5H2FC 3IRRA 1RETA 1IRZA 1HDDC 5A2QK 4HF0A 2DA6A 3DQVC 3H9QA 1R5ID 4B1RA 3RZDJ 4AU7A 4LLNA 1UCRA 5J47A 2LRDA 3IAM2 3PFYA 4LMYA 4IHXA 5CVJA 4DOZA 4RBOA 1Y0UA 3CTAA 4RAZA 1IN5A 3S16J 3W6VA 3HGYA 2MG4A 1FX7A 1ZYRF 2DMQA 1K79A 2OJED 1FWZA 1B59A 3WG7H 4NC7A 4CYCA 3FMSA 5BPIA 4NDLA 1DUXC 2XKPA 3LQQA 1B1BA 2RGVA 3CUQB 3K2ZA 1I5ZA 4WWCA 2QSGX 1R5GA 2A68F 2M7BA 3OIOA 5JI6A 5C3EJ 2F4OB 2ZC2A 3IP4B 2EZIA 2M87A 5D6FA 5FROA 2H27A 4A3GJ 4ZYHA 5GADJ 5IP9J 4I2OA 3DU6A 4XLHA 1JJ8C 3QPHA 1X3ZB 3DCFA 4RB1A 1ZG3A 3QP6A 3MKWB 4C9YA 4HPQA 5IY5H 2P5KA 1FZPB 1RZ4A 1IXRC 2GIVA 1WKMA 1D5YA 2MW8A 1P9QC 4V19K 2CQNA 3M8JA 4UVCA 4AIHA 2IVMA 2EJRA 4HX7A 2XAUA 1W36C 3QP5A 3FHZA 3L09A 2OF7A 4PJJA 2VC0A 3ZQGA 4MTEA 1KU7A 3ISPA 4HLYA 2R5YB 2F5FA 2LYCA 1ZKGA 2V1DA 3OYIA 3ZQLA 4GYGA 2EIMH 2DOAA 4E6KG 1I6HJ 1MBEA 2XAFA 3ZN0A 4B8XA 2NNYA 4BKXA 5M5WJ 2LLKA 2E1MB 2E7WA 1ZR2A 3ZMDA 2A07F 4JYKA 4Y52J 1BC8C 3CUQC 3OYBA 1W36D 3LSRA 5DTDA 3AG3H 3JRCA 4ZJZA 5D5XB 2EK5A 2XPUA 3JAMK 4ESFA 3BLYA 3CMMA 1BI1A 3MZYA 4RB2C 2MABA 2WY7Q 3KP3A 5M3FJ 3BJ6A 1GLNA 3DPTA 1VQPI 3SQNA 5HDGA 2P5LC 1T39A 2HQ5A 1I50J 1QVUA 2YR2A 2QBYB 1IRFA 2BYVE 1POGA 4OINF 3TDZC 1PYVA 4A0ZA 4NUBA 3RKWA 1JHHA 3J80K 2CQ7A 1V4RA 3GTOJ 2VL8A 1MDMB 2A3SA 1B4AA 3H5NA 2D1VA 1QZZA 4OIRF 3IUOA 3EUHA 2X4HA 1EF4A 1FYKA 3S15J 2MH2A 3I58A 1U0JA 3VPRA 4KISA 2HWVA 3BG7A 3CDLA 1SD6A 3MMYB 3LAPA 1H8AC 1W7PB 1TWGJ 3CMEI 2VODA 3L2CA 4BHCA 3K70C 2HYFA 2OZ6A 4XBFA 3ERED 3LSGA 4UV9A 2TCTA 4HNUA 1JKRC 3CCVI 3F8BA 3Q0UA 3KZIC 3PFIA 2DA5A 4CCNA 4LOCA 1UG0A 3J7AO 3D1NI 4HDVA 4YFNF 3OS0A 4Y33A 2ACJA 3RQIA 1TWAJ 2B63J 2PI0A 2MLKA 2OV7A 3OR1C 3MWMA 3HRTA 4WXDA 2DPDA 4F93B 3W3CA 2JWTA 2P6SA 2DJIA 3KCCA 1Y1WJ 2P4WA 1OCTC 5E79C 5ICCA 5B3SH 2LP0A 4XQFA 4HOBA 2DMTA 3DEWA 1YRNA 4F91B 3U1KA 3EUHC 2STTA 1ETKA 4J01A 1QO0D 2V1NA 2F6CA 4BS9A 5CVIA 1YX5A 5DYMA 3L1PA 2ISYA 4I99C 1LDKB 2KKOA 2QCOA 2WAQA 5F64A 3J7AY 5CQGA 3F22A 4DJAA 2XRNA 1B9MA 2ECCA 3O2PE 5DV5A 4WCGA 5FKKA 2CUFA 1WJ5A 2CV2A 2Z1DA 1W5SA 1Z77A 2ID6A 2OCCH 1R5HA 3MFKA 2DA2A 4QLCU 1R1VA 2VXZA 3IV5A 2RREA 3M8EA 4AC0A 1YJWI 1OCOH 4IF4A 4L9TA 1U8RA 5E3LA 3S8PA 5D5VB 2W85A 1XCBA 4KJZA 5HLGA 2HQRA 2K9LA 2RV8A 3SEZA 1LE8B 1G59A 3O8HA 1IZ1A 2DYSH 1QHGA 1I27A 3KFWX 2KHMA 5D6EA 3L2UA 3V7SA 3ZQ7A 1W7PD 4IOCF 1W0TA 4U0WA 2LVSA 2WAQN 5DM7F 5CLSA 5ICFA 1IXCA 2IGKA 5GAHJ 1IXSB 2DMNA 4L0ZB 1STZA 3ZGKA 5E8GA 1I3QJ 3K4JA 2DDBA 3FBIB 2DDAA 2X9DA 5FFZA 4BL0B 1V5FA 1WH5A 4H0EA 2L9VA 3LA3A 2CQXA 2R7QA 2FBKA 4E7ZA 1FBSA 1JUMA 1YW7A 2RVCA 3MEXA 1FOXA 2L7MP 4FISA 2RDPA 2WAFA 4HQMA 1HKTA 2P81A 5E1ZB 4F7ZA 1KGSA 2LMDA 1MBHA 2KIUA 4CZCA 2R5ZB 2WB1A 2LBFA 3ZOBA 1GDTA 1G3YA 4EJWA 2Q8KA 3SHFA 2O9LA 1WZ2A 4PJNA 4XLPF 2Y31A 2WADA 4FCYA 3H0GJ 2X1CA 4FT8A 1O3RA 2IT0A 3WU0A 4AM3A 4LIVA 2V26A 1WPKA 4I01A 4A6EA 2O6GE 1Y56A 1EA3A 3PIPF 4IRGA 1FMWA 4QSHA 2XKOA 3LSJA 4HA8A 2JK3A 4E7JA 1MJ9A 2PN6A 3O3KA 2QENA 4NB5A 1DPUA 3ABUA 3OSFA 2DQLA 2ZBKA 4NQWB 4AWXB 3H35A 3HGGA 1IN7A 4CDGA 3CCSI 3L2WA 2CW0F 2Q1ZB 1DDNA 4HBLA 5JFRA 1T33A 2XDVA 2FOWA 4A6DA 1S6LA 2R3SA 3SZGA 2QKLB 5B1AH 4IPAA 1X3WB 2ZSIB 4ZZDA 2VI6A 4V2GA 2KIMA 3I4MJ 2FQ3A 2HGCA 4BQNA 3EQLF 3L2VA 2QSFX 3BPVA 1JI8A 1ZQ3P 2LF7A 4S0HB 4X6AJ 1YFHA 4II2A 2ISZA 1QPMA 3HPHA 1K78B 1DU6A 1XX5A 2D5VA 2QQBA 4WX9A 3GX4X 2ZMEA 2OTJI 5K7HA 2I10A 2R7XA 2D2WA 2EFOA 4HV6A 2ICWG 3HTUA 1LQ1A 2JA8J 3LL7A 1IJWC 1J5YA 2K4JA 4HV5A 2IS2A 1R58A 3ZP5A 2L4AA 2WV1A 4A5NA 1FY7A 3LQRA 4KMUX 1ZR4A 1ZG5A 4D1QA 3E97A 1MW7A 1G3SA 5ERIA 1YO5C 2GQQA 3OIPA 4HSTA 4RGUA 4MFDA 1DGWY 1HBXG 1VF9A 2BOLA 3HSFA 5CVRA 3V4GA 2OAZA 4KMFA 2ZO4A 4YELA 1QA6A 1XG1A 2Y75A 3BTCA 4CH7A 4XRMA 1MMGA 4KDPA 1ETWA 2HQNA 1ON2A 2F5VA 4IL6C 3UNGC 2M0MA 2DN0A 1ORKA 3BWGA 3QPLA 1LJ9A 1PJRA 2ZJPF 3E6CC 1MMDA 1VQ4I 3VWBA 4KITB 1JHFA 4JP0A 1ZARA 3ABTA 3SYTA 3G1LA 1D3YA 3K6GA 2ZMEC 4BBSJ 5M5XJ 2PX9A 1R36A 3FKIJ 1KQ9A 2BW3A 1XMAA 1Y1VJ 3GXOA 5B1BH 4F52A 2K3PA 1LVAA 3X2QH 2DFHA 1BOAA 2X6OA 3ZR8X 4C2TA 3E0JB 4ANJA 3MD2A 2MH9A 4E70A 5IYCJ 1IF1A 4U88A 2VJIA 2PQ8A 3HUGB 4ZTFA 3GZ6A 5IYDJ 1IC8A 4ZDOA 3ZMSA 5KAFC 1UHWA 3VEPA 1XSDA 2DT5A 4LB5A 3GW2A 3CCLI 3CESA 3RCOA 5HOOA 5K1YA 4ETSA 1ZLKA 2YU9J 4KNYA 2GZWA 4ENNA 3CQZJ 3DKWA 3M9AA 3HM5A 5H6QA 5HVQC 2CW7A 5ILVA 5FB2A 4MNUA 4HX8A 1Z9CA 5HODA 2E7XA 3MKYB 4M3BA 2KJCA 3MN2A 2RNGA 1MBFA 2GWRA 2AS5F 1FOWA 4HAMA 1KONA 1GHCA 3MZHA 4D9JA 5IOZA 1Z7UA 1LDJA 1HSTA 2BBYA 3CC2I 4TV7A 2OD5A 4BJ6C 1S72I 3H92A 4N4OB 4A0XA 1HW1A 2VBWA 2K85A 1AU7A 4BQAA 1N25A 5E3NA 2IA1A 4V2FA 3Q5FA 1XC5A 4OMYA 3HRSA 3G2BA 2H8WA 4Y15A 2BGCA 3VYRB 3CCRI 4XORA 5HDKA 2Y48A 1GXPA 1PP7U 1BIAA 2JN6A 2R7DA 5GTIC 4JX6A 3WG9A 2FSWA 3WGHA 4E7LA 4A0YA 1GUUA 2HDCA 1AKHA 4HQEA 3BG9A 1BL0A 1B72A 1VQKI 1Y39A 1N77A 1FYMA 1KQ8A 4J00A 2UXNA 4C30A 1XGOA 2DPUA 3I59A 4CCKA 1D8KA 1XDUA 2FBHA 1RIOH 4BJ5C 4FHTA 3WGGA 5JVGF 1LDDA 3GLLA 3H5AA 4IZZA 4P5OA 5DS9A 1S8NA 2FE3A 5ED4A 2K40A 4A3KJ 2Z2SB 1HKSA 4HF1A 3FISA 4I76A 1ZLJA 3EUKL 4PK4A 3ZQQA 4KIBA 3OYFA 1X1CA 1E3HA 4FTHA 2R7SA 4JOMA 3CCYA 2V7FA 2KRHA 2LKPA 1VNDA 2H94A 3MZ8A 3NQOA 4JX4A 1VQ9I 2L4MA 2L3DA 3H0DA 4N9IA 1OYWA 2J5OA 1T6SA 3H36A 2F5CA 4LG0A 2WY8Q 2VPLA 3QPSA 1D0ZA 2F48A 2HVQA 1VQ5I 2K5CA 2GM4A 1UELB 1BN5A 4LIUA 4M6XA 1Y0NA 5LHIA 3W6KB 1VQNI 3BJOA 5DDGA 3F6VA 3H3VK 1S5LC 3R0JA 4JBAA 4I6ZA 2IS4A 4RAFA 3AAFA 3I4PA 3TKYA 4ESJA 1FJLA 3C7JA 2Q0OA 4BEHA 2PG4A 1D8JA 1MBJA 2EQRA 3PJRA 1OYIA 5F1JA 1MGTA 1UFMA 2QM3A 4C2MJ 3ROUA 3LMMA 4ENKA 3DBHB 2M4GA 3OL4A 3OR2C 1YS7A 1A04A 2N8GA 4G6TB 3RPQA 3VYUB 1AWCA 4HYEA 2EA4A 3GZNB 1V5GA 3WHBA 1JUSA 2KIQA 3PNYA 3TW6A 2VJ5A 2XPVA 4CICA 5ICEA 3HOXJ 4XKWA 4D7MA 4Z2YA 2MSYA 3N05A 4E7IA 3V7CA 2XAHA 1ETVA 3BROA 5K5RA 3F3XA 2MYSA 1FSEA 4B48A 1FT9A 5FD6A 3TQNA 1FNNA 4IRHA 5EJCA 1L0OC 5GTHC 2DBBA 4N0BA 4CSWA 1OFCX 3S3OA 2OUMA 4Y17A 2I8DA 4MIMA 3GZ5A 4KICA 2K4BA 4ZTJA 3LSMA 3P7NA 1S29A 3ZQHA 3R61A 2EBIA 3BPXA 5LEJA 4U0YA 4YEJA 2M4KA 4UVAA 1EH7A 2VE8A 4ENMA 1O4XA 1QHHD 3E7LA 1A35A 3G6EI 3CO6C 4IHVA 5FRNA 2P0WA 4LB6B 1W0UA 2F4MB 3L9FA 2ZKZA 2BHZA 1J9IA 2STWA 3E5QA 1JKOC 3BZKA 2CSOA 2YX4A 1FTZA 5HLTA 3S1RJ 2EH3A 3EUAA 2VJJA 4U7DA 3WTZA 5C44J 3CC4I 5IT3A 2P7VB 1G8XA 4A3FJ 4FQGA 3M8FA 5E3MA 2RKHA 2HXIA 1RKTA 2LOOA 4HZFA 4A3MJ 2MC4A 1SAUA 3BTJA 2FMLA 3IH4A 3PUBA 1VQ8I 1IRGA 4DYRA 2OQGA 2JMWA 3BG3A 1B9NA 4KT5C 2CQQA 2EINH 2W57A 3PSFA 4F3QA 1A5JA 3FX3A 1QU3A 1PP8F 3M1CA 5E1WA 3HRUA 2KISA 3Q3SA 4X1EA 4N9HA 4I0BA 1YJ9I 1NTCA 2XSJC 3SDGA 1X1PA 1FSHA 1Z6RA 4PSXA 3U2RA 1IDZA 3ASNH 3DXJF 4R79A 5EF6A 2GA1A 1DGRM 4IHTA 2YPRA 2VJ4A 3F9KA 3L2RA 1T38A 4JX5A 1X19A 2A6HF 5L3FA 4CYCB 4UV8A 4B09A 3CLOA 2EZKA 1XSXA 3HRMA 2O5RA 3O6BB 2XVCA 4RA2A 2HYJA 3GLXA 4L9NA 4OU0A 2B9SA 2WTEA 4UUTA 3GBGA 3AG4H 3LFKA 5IP6A 2R7RA 3KEYA 2Z33A 2LC2A 4S04A 1T2KA 5DM6F 1YYVA 1ZK8A 1AA7A 4EMSA 2Q2EA 2CV0A 1BI0A 1KU2A 2DOFA 2E34A 2XV4S 3S1QJ 3P9IA 1B6AA 1XTAA 2JVHA 1W4MA 2PJPA 4PFPA 2Z16A 4RLQA 1SD5A 3CF2A 1TQMA 3GTQJ 2LREA 1ETYA 4XRFA 2OC6A 2KP6A 2XF5A 4XLEA 3SFZA 3WU1B 3RDIA 1SFEA 2VBYA 2GLOA 3S1NJ 4MGRA 1S7OA 4XRSG 1RRJA 3EETA 5GPAA 2CQKA 1I1SA 2VKHA 4U7BA 2WA0A 3K7AJ 1V3FA 2EFPA 3ZCOA 3J7ZI 4KN4X 4O6JA 2DODA 2P7CB 1W5TA 2IGMA 1W1WE 3NRVA 1MIJA 4XMYA 2F5DA 4G8XA 5DUIA 2MD5A 1S7EA 2H09A 5GAGJ 4U0VA 3A02A 4PDKA 3WE2A 2KJBA 4B47A 3RJPA 3SJMA 5DEQA 5KNLA 2EB7A 3I53A 5D5WB 1E3OC 1AHDP 1PDNC 1REPC 3TO9A 4AIJA 3OYGA 3JREA 2PEXA 4IRIA 3W2WA 2EV0A 2MC3A 5CJ9A 1TNTA 1P6RA 1YX3A 4S05A 4PCQA 1RESA 4A3LJ 2K9SA 3QRFF 1NK3P 3PNTA 4AD9A 5LHHA 4Y3OA 4XRSA 1WJCA 4OIOF 1FEXA 1MMNA 4R8HA 3P9KA 3HG9A 1G2HA 2ME6A 4JK1X 4BUPA 3WE3A 4IVNA 2ZJRF 3HEFA 4YIRX 2VKVA 3BG5A 3LAJA 3CZ6A 3V8LA 2HOTA 3BR1A 5F08A 5FJ8J 5JHFA 4BU2A 1SFUA 3B6AA 4DQ2A 4GFBA 2WV0A 5HNFA 3PQJA 2HPIA 1QRYA 1WHUA 3RI4A 1ETXA 2E5ZA 2QUFA 4MO7A 3TP3A 1MMAA 2ZXIA 1A6QA 2K7LA 1S3JA 1YLFA 4FE4A 3R4KA 3ZMZA 4C3HJ 4O5VA 5C4JJ 3LWFA 2CWEA 4HSRA 2IRFG 2ADUA 3S3MA 4OOIA 1JXSA 5FKNA 1HKQA 1HW5A 3RKXA 4X0GA 1TQIA 4G6DA 1XB4A 2M3AA 1T95A 2HI3A 2CFOA 3HB9A 1YW8A 2XB0X 4ENJA 2FMYA 2IBDA 3Q9VA 3CJNA 2G7HA 3GFJA 2R7WA 3HDDA 2BY3A 3SEQA 3CCQI 1ZRDA 1JT0A 3K70D 2LFBA
chains in the Genus database with same CATH topology
1YRNB 3IH2A 1DU6A 2D5VA 3SFIA 1IDYA 1MH4A 1CQTA 1ETOA 4A3CJ 5K7HA 2I10A 3HBLA 3LNQA 2DTZA 4DZJA 2TRTA 4DYQA 4UUSB 2HXOA 2JA8J 2O7OA 1IJWC 1BA5A 4DYCA 3LSPA 2E1OA 2WV1A 1X58A 2LY9A 1ZR4A 3TP0A 4A69C 3A01B 4RDUA 3MKLA 4XIDA 2XSDC 3GTLJ 5FKOA 4MFDA 3BR3A 3Q0WA 5F0HA 3I4NJ 1VF9A 5J3LA 2HOSA 2GBYA 2COBA 3HOZJ 1U78A 4C3IJ 1XG1A 3BTCA 4XRMA 3JRAA 4BY7J 4J19A 3GTKJ 1ETWA 1BW5A 5GP9A 3JR9A 4MFEA 2DN0A 1ORKA 1GV5A 2AHQA 3QPLA 2YUSA 2AO9A 5F04A 1U8BA 2R7ZJ 1RR7A 4QIWN 4A93J 1TC3C 1HOMA 4JP0A 2M9HA 2PMZN 4FE7A 3G1LA 2M0CA 1JKQC 3ZQIA 4BBSJ 3ZQFA 5M5XJ 2ECBA 3FKIJ 2DA4A 1U9NA 1Y1VJ 5FKLA 1MH3A 2X6OA 4AUXA 1DU0A 4M3FA 5C4XJ 5IYCJ 3GTPJ 2NVXJ 2R0QC 2K9NA 2IAIA 5IYDJ 1IC8A 1JTYA 1HF0A 1QVTA 1VI0A 2R5YA 3G1MA 1X2MA 1QPIA 2DA3A 3TEDA 2DJNA 2YU9J 1F43A 1OCPA 4ABZA 1K83J 2Y9YA 3CQZJ 2JJ7A 3HM5A 1MNMC 1VFCA 3G1OA 5HODA 2FD5A 4M3BA 3MN2A 2ME0A 1ITYA 1MBFA 5J1RA 3BQYA 3M4OJ 1APLC 5IOZA 4D5FA 2Y0SN 2DA1A 2NVYJ 5FLMJ 4XK4A 1WI3A 4Y7NJ 1AU7A 2NS7A 1OJLA 5E3NA 2L7ZA 1Q1VA 4V2FA 1FIPA 1GV2A 4AYBN 1XC5A 1NK2P 5J1UA 1RKWA 1ENHA 4W97A 5EG0A 5IP7J 3PO2J 4D7NA 2Y9ZA 1H89C 2JN6A 2IEKA 3BR2A 4JX6A 1HDPA 3NAUA 1GUUA 1WH7A 1TWCJ 1AKHA 4M3GA 3BG9A 1BL0A 2CJJA 1B72A 3JRDA 1IV6A 1P7IA 2E2HJ 4A3DJ 2XPWA 2E2JJ 2L9RA 3S2DJ 2L7FP 3S2HJ 2NVQJ 1TWFJ 2VUMJ 3Q0VA 5K7FA 2O8KA 2M2EA 1RETA 1IRZA 1HDDC 5DS9A 2DA6A 2OPTA 4B1RA 2K40A 1SANA 4A3KJ 3RZDJ 2LR8A 4IHXA 3FISA 3O8GA 4I76A 3JRIA 4RBOA 1PUFA 1LFBA 3S16J 3W6VA 3HGYA 2MG4A 4FTHA 2DMQA 3CCYA 5IPAA 5F0CA 2HOAA 5EEAA 1VNDA 4JX4A 3HOWJ 4CYCA 4NDLA 3QPSA 1H88C 1RPWA 3FK7A 2GM4A 3OIOA 2DMPA 5C3EJ 2X48A 1BW6A 5JLWA 3H3VK 4I6ZA 2EZIA 5IYBJ 1FJLA 4D5CA 4BY1J 4A3GJ 3HKZN 1F36A 1MBJA 2EQRA 4DZPA 5EGOB 4M3DA 5F1JA 4C2MJ 5IP9J 1SFOJ 1JJ8C 5E3OA 3HOUJ 3DCFA 2E2IJ 2N8GA 1D5YA 3F0CA 2VKEA 3BTIA 2MW8A 1HCRA 3BR0A 2R92J 3WHBA 1JUSA 5BNGA 2VPRA 1MBKA 1T56A 3TW6A 2XPVA 3HOXJ 4D7MA 2OF7A 3QQAA 3ZQGA 2MSYA 2W48A 2LTPA 3CMYA 2R5YB 1ZKGA 3ZQLA 1ETVA 4XICA 1LE8A 4A3BJ 3S1MJ 1P7JA 4A3EJ 1I6HJ 1MBEA 2CU7A 4BXXJ 4BKXA 2CUEA 5M5WJ 3ZQCA 1UMQA 2LLKA 3GTJJ 1U9OA 2E19A 3RKQA 3UKGA 2XRLA 1ZR2A 4Y52J 1OFCX 4JYKA 4C3JJ 2K9QA 1JTXA 3OSGA 2H8RA 4MIMA 3BR6A 5DTDA 3NARA 2DMUA 3LSRA 3JRCA 2RAEA 1BJZA 2XPUA 3ZQHA 2ID3A 2EBIA 5M3FJ 1ZGWA 1B8IA 1IG7A 1IGNA 1O4XA 3E7LA 3PM1A 5FKMA 2HQ5A 1I50J 1QVUA 1K61A 4IHVA 1POGA 5EG0B 1W0UA 1JKOC 2R5ZA 3GTOJ 3GTGJ 1FTZA 2NOGA 3S1RJ 1AKHB 2EH3A 1B72B 5C44J 1EF4A 5F27A 4A3FJ 3S15J 5E3MA 2JA7J 3VPRA 2HXIA 1RKTA 1UG2A 5IOYA 3CDLA 4A3MJ 1H8AC 3BTJA 3IH4A 1MBGA 1TWGJ 4DYRA 2JMWA 3BG3A 2CQQA 3HOYJ 3LSGA 3JRFA 1A5JA 2TCTA 1JKRC 2XGEA 1MSEC 3Q3SA 4X1EA 9ANTA 2DA7A 2WB1N 3Q0UA 1NTCA 2JA6J 2DA5A 2KT0A 3SDGA 3K2AA 4LOCA 1LFUP 3D1NI 5EYRA 4EEFG 1PUFB 1UHSA 2ZB9A 3RQIA 5GPCA 1IDZA 1TWAJ 5EF6A 2B63J 2LKXA 1MSFC 1TWHJ 2KDZA 3PO3J 2M8GX 3BQZA 4JX5A 3M3YJ 4CYCB 3HOVJ 2JWTA 5J1YA 3JRGA 4B4CA 2EZKA 1JUPA 2HYJA 1Y1WJ 1OCTC 5M5YJ 4UUTA 2LP0A 4W1UA 2DMTA 3DEWA 5EDNA 3GBGA 1YRNA 5IP6A 1ETKA 2Y2ZA 3RZOJ 1XS9A 5F0FA 1ZK8A 2NS8A 4G12A 1JT6A 3WHCA 3L1PA 5FLVA 2CRGA 4UUSA 2QCOA 3S1QJ 2FJ1A 2ECCA 1FTTA 5FKKA 2CUFA 2QF7A 3GTQJ 1Z77A 3A01A 2ID6A 4M3EA 2L0KA 1ETYA 2M34A 1ZTRA 2DA2A 3IV5A 4AC0A 4IEJA 5EZGA 2GLOA 3TW7A 3S1NJ 2H1KA 4XRSG 1ETQA 5GPAA 5E3LA 3JRBA 4A3IJ 1JKPC 1LE8B 3O8HA 3K7AJ 4QTRA 1X2NA 1W0TA 2MGQA 4IHYA 2LVSA 1WGXA 1A6IA 1HLVA 2WAQN 5K7ZA 3MVPA 5EGOA 1S7EA 3JRHA 3A02A 2DMNA 3C2BA 4M6VA 2YS9A 3SJMA 1GT0C 3IH3A 1I3QJ 1E3OC 1AHDP 1JJ6C 4MLOA 4DW6A 2X9DA 1JGGA 1WH5A 2EZHA 1B8IB 3JREA 1IUFA 2CQXA 2FX0A 1JUMA 2L7MP 2XB5A 5M3MJ 4FISA 1GVDA 1RESA 4A3LJ 2EZLA 3OOUA 2K9SA 4IHWA 1NK3P 2P81A 2HDDA 1MBHA 4XRSA 2R5ZB 1FEXA 1G2HA 2ME6A 3ZOBA 1GDTA 4A3JJ 2O9LA 5JLXA 2FQ4A 3A03A 3HEFA 3BR5A 2VKVA 3BG5A 2ELKA 1WCMJ 2Y31A 3BR1A 5F08A 5FJ8J 2HOTA 4HNVA 4FCYA 3H0GJ 3B6CA 3LOCA 3B6AA 1WPKA 3S14J 4GFBA 1QRYA 3FIWA 2NVTJ 1ETXA 3S17J 4MO7A 3FK6A 3TP3A 1Z0XA 4QSHA 3LSJA 2JK3A 4FE4A 4L5EA 3BT9A 2Y30A 3GTMJ 4C3HJ 5C4JJ 3OSFA 2XGCA 2JA5J 3HGGA 5FKNA 2LK2A 1T33A 2HI3A 3HB9A 3BTLA 2XB0X 2LD5A 2IBDA 2VI6A 4V2GA 2R93J 5EZHA 3I4MJ 3HDDA 1JT0A 1ZQ3P 4B3AA 4S0HB 1R9TJ 2XGDA 1FIAA 4BBRJ 4X6AJ 2G0EA 2LFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN B;  3IH2 A;  1DU6 A;  2D5V A;  3SFI A;  1IDY A;  1MH4 A;  1CQT A;  1ETO A;  4A3C J;  5K7H A;  2I10 A;  3HBL A;  3LNQ A;  2DTZ A;  4DZJ A;  2TRT A;  4DYQ A;  4UUS B;  2HXO A;  2JA8 J;  2O7O A;  1IJW C;  1BA5 A;  4DYC A;  3LSP A;  2E1O A;  2WV1 A;  1X58 A;  2LY9 A;  1ZR4 A;  3TP0 A;  4A69 C;  3A01 B;  4RDU A;  3MKL A;  4XID A;  2XSD C;  3GTL J;  5FKO A;  4MFD A;  3BR3 A;  3Q0W A;  5F0H A;  3I4N J;  1VF9 A;  5J3L A;  2HOS A;  2GBY A;  2COB A;  3HOZ J;  1U78 A;  4C3I J;  1XG1 A;  3BTC A;  4XRM A;  3JRA A;  4BY7 J;  4J19 A;  3GTK J;  1ETW A;  1BW5 A;  5GP9 A;  3JR9 A;  4MFE A;  2DN0 A;  1ORK A;  1GV5 A;  2AHQ A;  3QPL A;  2YUS A;  2AO9 A;  5F04 A;  1U8B A;  2R7Z J;  1RR7 A;  4QIW N;  4A93 J;  1TC3 C;  1HOM A;  4JP0 A;  2M9H A;  2PMZ N;  4FE7 A;  3G1L A;  2M0C A;  1JKQ C;  3ZQI A;  4BBS J;  3ZQF A;  5M5X J;  2ECB A;  3FKI J;  2DA4 A;  1U9N A;  1Y1V J;  5FKL A;  1MH3 A;  2X6O A;  4AUX A;  1DU0 A;  4M3F A;  5C4X J;  5IYC J;  3GTP J;  2NVX J;  2R0Q C;  2K9N A;  2IAI A;  5IYD J;  1IC8 A;  1JTY A;  1HF0 A;  1QVT A;  1VI0 A;  2R5Y A;  3G1M A;  1X2M A;  1QPI A;  2DA3 A;  3TED A;  2DJN A;  2YU9 J;  1F43 A;  1OCP A;  4ABZ A;  1K83 J;  2Y9Y A;  3CQZ J;  2JJ7 A;  3HM5 A;  1MNM C;  1VFC A;  3G1O A;  5HOD A;  2FD5 A;  4M3B A;  3MN2 A;  2ME0 A;  1ITY A;  1MBF A;  5J1R A;  3BQY A;  3M4O J;  1APL C;  5IOZ A;  4D5F A;  2Y0S N;  2DA1 A;  2NVY J;  5FLM J;  4XK4 A;  1WI3 A;  4Y7N J;  1AU7 A;  2NS7 A;  1OJL A;  5E3N A;  2L7Z A;  1Q1V A;  4V2F A;  1FIP A;  1GV2 A;  4AYB N;  1XC5 A;  1NK2 P;  5J1U A;  1RKW A;  1ENH A;  4W97 A;  5EG0 A;  5IP7 J;  3PO2 J;  4D7N A;  2Y9Z A;  1H89 C;  2JN6 A;  2IEK A;  3BR2 A;  4JX6 A;  1HDP A;  3NAU A;  1GUU A;  1WH7 A;  1TWC J;  1AKH A;  4M3G A;  3BG9 A;  1BL0 A;  2CJJ A;  1B72 A;  3JRD A;  1IV6 A;  1P7I A;  2E2H J;  4A3D J;  2XPW A;  2E2J J;  2L9R A;  3S2D J;  2L7F P;  3S2H J;  2NVQ J;  1TWF J;  2VUM J;  3Q0V A;  5K7F A;  2O8K A;  2M2E A;  1RET A;  1IRZ A;  1HDD C;  5DS9 A;  2DA6 A;  2OPT A;  4B1R A;  2K40 A;  1SAN A;  4A3K J;  3RZD J;  2LR8 A;  4IHX A;  3FIS A;  3O8G A;  4I76 A;  3JRI A;  4RBO A;  1PUF A;  1LFB A;  3S16 J;  3W6V A;  3HGY A;  2MG4 A;  4FTH A;  2DMQ A;  3CCY A;  5IPA A;  5F0C A;  2HOA A;  5EEA A;  1VND A;  4JX4 A;  3HOW J;  4CYC A;  4NDL A;  3QPS A;  1H88 C;  1RPW A;  3FK7 A;  2GM4 A;  3OIO A;  2DMP A;  5C3E J;  2X48 A;  1BW6 A;  5JLW A;  3H3V K;  4I6Z A;  2EZI A;  5IYB J;  1FJL A;  4D5C A;  4BY1 J;  4A3G J;  3HKZ N;  1F36 A;  1MBJ A;  2EQR A;  4DZP A;  5EGO B;  4M3D A;  5F1J A;  4C2M J;  5IP9 J;  1SFO J;  1JJ8 C;  5E3O A;  3HOU J;  3DCF A;  2E2I J;  2N8G A;  1D5Y A;  3F0C A;  2VKE A;  3BTI A;  2MW8 A;  1HCR A;  3BR0 A;  2R92 J;  3WHB A;  1JUS A;  5BNG A;  2VPR A;  1MBK A;  1T56 A;  3TW6 A;  2XPV A;  3HOX J;  4D7M A;  2OF7 A;  3QQA A;  3ZQG A;  2MSY A;  2W48 A;  2LTP A;  3CMY A;  2R5Y B;  1ZKG A;  3ZQL A;  1ETV A;  4XIC A;  1LE8 A;  4A3B J;  3S1M J;  1P7J A;  4A3E J;  1I6H J;  1MBE A;  2CU7 A;  4BXX J;  4BKX A;  2CUE A;  5M5W J;  3ZQC A;  1UMQ A;  2LLK A;  3GTJ J;  1U9O A;  2E19 A;  3RKQ A;  3UKG A;  2XRL A;  1ZR2 A;  4Y52 J;  1OFC X;  4JYK A;  4C3J J;  2K9Q A;  1JTX A;  3OSG A;  2H8R A;  4MIM A;  3BR6 A;  5DTD A;  3NAR A;  2DMU A;  3LSR A;  3JRC A;  2RAE A;  1BJZ A;  2XPU A;  3ZQH A;  2ID3 A;  2EBI A;  5M3F J;  1ZGW A;  1B8I A;  1IG7 A;  1IGN A;  1O4X A;  3E7L A;  3PM1 A;  5FKM A;  2HQ5 A;  1I50 J;  1QVU A;  1K61 A;  4IHV A;  1POG A;  5EG0 B;  1W0U A;  1JKO C;  2R5Z A;  3GTO J;  3GTG J;  1FTZ A;  2NOG A;  3S1R J;  1AKH B;  2EH3 A;  1B72 B;  5C44 J;  1EF4 A;  5F27 A;  4A3F J;  3S15 J;  5E3M A;  2JA7 J;  3VPR A;  2HXI A;  1RKT A;  1UG2 A;  5IOY A;  3CDL A;  4A3M J;  1H8A C;  3BTJ A;  3IH4 A;  1MBG A;  1TWG J;  4DYR A;  2JMW A;  3BG3 A;  2CQQ A;  3HOY J;  3LSG A;  3JRF A;  1A5J A;  2TCT A;  1JKR C;  2XGE A;  1MSE C;  3Q3S A;  4X1E A;  9ANT A;  2DA7 A;  2WB1 N;  3Q0U A;  1NTC A;  2JA6 J;  2DA5 A;  2KT0 A;  3SDG A;  3K2A A;  4LOC A;  1LFU P;  3D1N I;  5EYR A;  4EEF G;  1PUF B;  1UHS A;  2ZB9 A;  3RQI A;  5GPC A;  1IDZ A;  1TWA J;  5EF6 A;  2B63 J;  2LKX A;  1MSF C;  1TWH J;  2KDZ A;  3PO3 J;  2M8G X;  3BQZ A;  4JX5 A;  3M3Y J;  4CYC B;  3HOV J;  2JWT A;  5J1Y A;  3JRG A;  4B4C A;  2EZK A;  1JUP A;  2HYJ A;  1Y1W J;  1OCT C;  5M5Y J;  4UUT A;  2LP0 A;  4W1U A;  2DMT A;  3DEW A;  5EDN A;  3GBG A;  1YRN A;  5IP6 A;  1ETK A;  2Y2Z A;  3RZO J;  1XS9 A;  5F0F A;  1ZK8 A;  2NS8 A;  4G12 A;  1JT6 A;  3WHC A;  3L1P A;  5FLV A;  2CRG A;  4UUS A;  2QCO A;  3S1Q J;  2FJ1 A;  2ECC A;  1FTT A;  5FKK A;  2CUF A;  2QF7 A;  3GTQ J;  1Z77 A;  3A01 A;  2ID6 A;  4M3E A;  2L0K A;  1ETY A;  2M34 A;  1ZTR A;  2DA2 A;  3IV5 A;  4AC0 A;  4IEJ A;  5EZG A;  2GLO A;  3TW7 A;  3S1N J;  2H1K A;  4XRS G;  1ETQ A;  5GPA A;  5E3L A;  3JRB A;  4A3I J;  1JKP C;  1LE8 B;  3O8H A;  3K7A J;  4QTR A;  1X2N A;  1W0T A;  2MGQ A;  4IHY A;  2LVS A;  1WGX A;  1A6I A;  1HLV A;  2WAQ N;  5K7Z A;  3MVP A;  5EGO A;  1S7E A;  3JRH A;  3A02 A;  2DMN A;  3C2B A;  4M6V A;  2YS9 A;  3SJM A;  1GT0 C;  3IH3 A;  1I3Q J;  1E3O C;  1AHD P;  1JJ6 C;  4MLO A;  4DW6 A;  2X9D A;  1JGG A;  1WH5 A;  2EZH A;  1B8I B;  3JRE A;  1IUF A;  2CQX A;  2FX0 A;  1JUM A;  2L7M P;  2XB5 A;  5M3M J;  4FIS A;  1GVD A;  1RES A;  4A3L J;  2EZL A;  3OOU A;  2K9S A;  4IHW A;  1NK3 P;  2P81 A;  2HDD A;  1MBH A;  4XRS A;  2R5Z B;  1FEX A;  1G2H A;  2ME6 A;  3ZOB A;  1GDT A;  4A3J J;  2O9L A;  5JLX A;  2FQ4 A;  3A03 A;  3HEF A;  3BR5 A;  2VKV A;  3BG5 A;  2ELK A;  1WCM J;  2Y31 A;  3BR1 A;  5F08 A;  5FJ8 J;  2HOT A;  4HNV A;  4FCY A;  3H0G J;  3B6C A;  3LOC A;  3B6A A;  1WPK A;  3S14 J;  4GFB A;  1QRY A;  3FIW A;  2NVT J;  1ETX A;  3S17 J;  4MO7 A;  3FK6 A;  3TP3 A;  1Z0X A;  4QSH A;  3LSJ A;  2JK3 A;  4FE4 A;  4L5E A;  3BT9 A;  2Y30 A;  3GTM J;  4C3H J;  5C4J J;  3OSF A;  2XGC A;  2JA5 J;  3HGG A;  5FKN A;  2LK2 A;  1T33 A;  2HI3 A;  3HB9 A;  3BTL A;  2XB0 X;  2LD5 A;  2IBD A;  2VI6 A;  4V2G A;  2R93 J;  5EZH A;  3I4M J;  3HDD A;  1JT0 A;  1ZQ3 P;  4B3A A;  4S0H B;  1R9T J;  2XGD A;  1FIA A;  4BBR J;  4X6A J;  2G0E A;  2LFB A; 
#chains in the Genus database with same CATH topology
 2CMP A;  2NAZ A;  4BAY A;  1FLI A;  1YRN B;  1LFP A;  2C6Y A;  3R0A A;  1IDY A;  3HBL A;  3M07 A;  2DTZ A;  3T1B A;  4DZJ A;  2ZXJ A;  4KFC A;  5IT9 K;  4BE2 A;  2IPQ X;  1J09 A;  3HZJ A;  4F55 A;  3FXU A;  3PQK A;  3K4B A;  3RQ4 A;  2ZXW H;  4CA0 A;  2PMU A;  3B02 A;  2E1C A;  4A69 C;  2X0L A;  1RNL A;  1G4D A;  3FMR A;  4XID A;  3BCA A;  3IWZ A;  5FKO A;  5F6F A;  3K4K A;  3COA C;  1IUY A;  4CUG A;  5LLQ A;  2UXX A;  4G9Y A;  2GBY A;  1Z1D A;  3E5U A;  1RR8 C;  4AVZ A;  4J19 A;  5TJJ A;  1Z7L A;  2XF6 A;  3QOD A;  2ETH A;  1Q1H A;  2HPM A;  1OCZ H;  3JW4 A;  3VB2 A;  1GV5 A;  3AL0 C;  4A12 A;  3S3N A;  2AHQ A;  1XGN A;  2YUS A;  2AO9 A;  5F04 A;  2O3F A;  1SC7 A;  2R7Z J;  3J81 K;  1RR7 A;  1KZH A;  4A93 J;  1HOM A;  2M9H A;  4ITV A;  3TDU C;  1CF7 A;  5HS7 A;  3P9C A;  1JKQ C;  1ZGA A;  2ESN A;  1J59 A;  2ECB A;  1KQ0 A;  2LY2 A;  2DA4 A;  5J8F A;  2BXZ A;  2DK8 A;  4MHG A;  4AUX A;  5DD8 A;  1XDS A;  2F4I A;  3IC7 A;  2NVU B;  5KHD A;  3DU5 A;  2P5V A;  1Z21 A;  4I98 B;  3ESW B;  1OCR H;  2QQA A;  3QOP A;  2NVX J;  1I6X A;  4YFX F;  2K9N A;  1RC9 A;  3QYF A;  4HLX A;  1BI3 A;  3K4M A;  5L3C A;  2BV6 A;  4U87 A;  3WU2 C;  2V6E A;  5D4S A;  1YG2 A;  4RGX A;  1HF0 A;  1LEB A;  2LBF B;  3K4C A;  4HNT A;  3I56 I;  4LD5 A;  1P92 A;  2XAG A;  4K2E A;  3OYE A;  2QEX I;  3TED A;  3KYD B;  3HL2 A;  1F43 A;  3MQ0 A;  3FKJ A;  3OYD A;  2JJ7 A;  2CGP A;  1VFC A;  3MAJ A;  2CO5 A;  2M45 A;  2FD5 A;  1R23 A;  4L9J A;  2ME0 A;  3BCB A;  1P2F A;  4PJ0 C;  3QYB A;  1O7L A;  3DBL B;  1OLT A;  2E60 A;  3RTR A;  5L3B A;  5BOX A;  1YHQ I;  1X1A A;  4EQQ A;  1H9G A;  1K7A A;  4HDU A;  2NVY J;  4CHU A;  5HS9 A;  4BH9 A;  2NNN A;  3OYJ A;  4GYI A;  4G7Z F;  3IKV A;  5J4V A;  2L7Z A;  3GFL A;  3TGN A;  2X51 A;  3W6J B;  1NK2 P;  5J1U A;  3DLL F;  1YW9 A;  4IQJ A;  1ENH A;  3VSK A;  5EG0 A;  4RAY A;  5D8L B;  4UB6 C;  4M9Z A;  5HLH A;  3FHN A;  2IEK A;  3LA7 A;  4UHT A;  4NC8 A;  2MFZ A;  3WTT C;  4BE0 A;  3HPG A;  1H9T A;  2CJJ A;  4NC6 A;  4FX4 A;  3GFM A;  1IV6 A;  1WVR A;  2E2J J;  2L9R A;  2L7F P;  3DFG A;  4IJA A;  5KVR A;  1DQU A;  1KU9 A;  2DOE A;  3Q0V A;  2GA2 A;  1E2X A;  3HC7 A;  2O03 A;  4NNJ A;  2ZME B;  1LVK A;  2DW4 A;  4XN0 A;  4CXF A;  3LSI A;  4M9X A;  4G94 A;  2QZ8 A;  3G3Z A;  4PFO A;  2HTJ A;  4M72 A;  2VLA A;  2A69 F;  5B5E C;  4XON A;  4M74 A;  5J8C A;  3O8G A;  3FXR A;  3HKZ A;  3JRI A;  1WSU A;  1L3L A;  1UB9 A;  1PUF A;  2FF4 A;  1LFB A;  4BNC A;  4RAG A;  4CO8 A;  5IPA A;  2BVL A;  1YE9 A;  4EJV A;  4ZDL A;  5EEA A;  2GAU A;  1TNS A;  2EPF A;  1J2X A;  2Y69 H;  3FXL A;  2B0L A;  3A0H C;  3T0Y A;  4ZZL A;  3OYK A;  4ZYA A;  2E36 A;  4EVI A;  1IV8 A;  3G71 I;  2P8T A;  2ZCW A;  4L5J A;  1XMX A;  1F9N A;  1RPW A;  3LFU A;  1OIS A;  3FK7 A;  1XGS A;  3K1N A;  3KET A;  3CC7 I;  5JLW A;  3TL4 X;  3ABM H;  1WJF A;  2BHY A;  5KK1 A;  4XR6 A;  4L5I A;  4KN7 X;  2L54 A;  1EKE A;  3HKZ N;  4YRV A;  4DZP A;  4Q4Z F;  1Z05 A;  4M3D A;  5EGO B;  1MNE A;  2OU2 A;  2BW3 B;  2DXI A;  3GUD A;  3JTG A;  1BOB A;  1SFO J;  5E3O A;  2CV1 A;  2KDO A;  5AIQ A;  3FMQ A;  1M1E B;  2ZXH A;  2TDX A;  2RQQ A;  1WJD A;  2HFH A;  3F0C A;  1VQL I;  3BTI A;  3CP8 A;  3MCZ A;  4IKF A;  3BR0 A;  1WI9 A;  5ILS A;  3H3U A;  4Y13 A;  1MBK A;  1WWX A;  2PBI A;  4EM2 A;  5HS8 A;  1SVO A;  5KCM A;  2Z9O A;  3S93 A;  2W48 A;  1WJA A;  5EEG A;  1LUJ B;  3CMY A;  4XIC A;  4A3B J;  1DP7 P;  3S1M J;  1P7J A;  2GXG A;  2LH9 A;  3GWZ A;  2QA4 I;  1VZ0 A;  4BXX J;  3KLO A;  3BOQ A;  5FFX A;  3GTJ J;  3PNV A;  2HYG D;  1U9O A;  2M30 A;  3K0L A;  2E19 A;  3RKQ A;  3UKG A;  2XRL A;  2K9Q A;  1JTX A;  1XMK A;  4ZC3 A;  3OSG A;  1K4S A;  2H8R A;  2HVR A;  3NAR A;  5DCF A;  1ERD A;  3BG6 A;  1MND A;  1BJZ A;  3OYH A;  3OS2 A;  2MA3 A;  2ID3 A;  2L2O A;  3H9J A;  2X1E A;  1TBX A;  1B8I A;  2YX7 A;  1IGN A;  2COM A;  3FBN B;  4PUS A;  1ACI A;  2LKS A;  3GO5 A;  3PM1 A;  4DBQ A;  2HU9 A;  3SZT A;  2PJR A;  1BBY A;  2K86 A;  2DK5 A;  5LHG A;  2VE9 A;  3HIF A;  3BZC A;  2IW5 A;  4PSW A;  3SDB A;  2V1X A;  1AKH B;  1B72 B;  2BXY A;  2R7V A;  1BR2 A;  3KLN A;  3I59 B;  1OKR A;  1QGP A;  1UG2 A;  5IOY A;  3A0B C;  5K5O A;  5BQT A;  3LSH A;  4CCL A;  3B73 A;  3RIR A;  3JRF A;  4QPQ A;  3NWS A;  4QPO A;  3J80 Z;  3ASO H;  4EM1 A;  2YSR A;  2XGE A;  3T8R A;  1SVL A;  3WTV C;  3CMA I;  1WQ2 A;  2WC2 A;  5FD5 A;  1YIT I;  3H3Z A;  2KT0 A;  2P6T A;  2KZV A;  3K2A A;  4PGG A;  1VQ6 I;  2GXB A;  3CDI A;  2XAQ A;  3ELK A;  3DTE A;  5EYR A;  1UHS A;  2DT6 A;  2JUG A;  3C18 A;  5GPC A;  1UZC A;  1IN4 A;  1MSF C;  1TWH J;  2A5W A;  2KDZ A;  4EJO A;  2M8G X;  3BQZ A;  3R60 A;  3M3Y J;  3I5U A;  3FXO A;  2OCE A;  4LG0 B;  3FDY A;  3K1P A;  4CCM A;  4P1W A;  4WXH A;  5J1Y A;  3JRG A;  4MEX F;  1BC7 C;  1K6Y A;  2D1H A;  2Z99 A;  3AKZ A;  5AIP A;  3TOB A;  1I3A A;  2JSC A;  4W1U A;  1Y8Q B;  5EDN A;  2R7T A;  2F2E A;  1ZH5 A;  5E8I A;  3RZO J;  3VFZ A;  5D5U B;  4L0Y B;  4BEH B;  4G12 A;  5FLV A;  2E71 A;  4EAT A;  2CRG A;  4UUS A;  3D5L A;  3EYY A;  4RB0 A;  4ESB A;  2UZK A;  1FPQ A;  4IQ4 A;  5LGN A;  3N97 A;  5LD2 C;  2FJ1 A;  1XSV A;  3WTX C;  1Z91 A;  4XKV A;  1TT0 A;  2HTS A;  4I7H A;  3A01 A;  2UWM A;  4M3E A;  2L0K A;  2M34 A;  4OMZ A;  4PJL A;  1R1U A;  5EZG A;  4NHJ A;  3KYL A;  1NG7 A;  2V4J C;  4XKC A;  5BPD A;  1FBQ A;  5J4Y A;  1R1T A;  1QZE A;  2R7U A;  3DTI A;  2VKD A;  4BXF A;  4FET A;  2Z5U A;  4Z6Y A;  1U5T A;  1T8I A;  2XF7 A;  2KL4 A;  5E17 F;  2L9S A;  2H6B A;  1W5C C;  1WGX A;  2BY1 A;  3V42 A;  5K7Z A;  1LEA A;  2FRH A;  1IN6 A;  5DCM A;  3OIQ A;  2VXD A;  2XIG A;  3CDH A;  1JJ6 C;  4YII A;  1WFX A;  4DW6 A;  4WXC A;  2VQC A;  3IKT A;  4EV0 A;  2RC4 A;  1KA8 A;  3GME A;  4BDY A;  2A6E F;  5M3M J;  3KX2 A;  2FBI A;  2IA2 A;  3WGI A;  3OOU A;  3RYP A;  1MD0 A;  3CCJ I;  2HDD A;  5HNH A;  3KE2 A;  1Z67 A;  4YFK F;  2IA0 A;  4A3J J;  2KZG A;  2G7U A;  4B3X A;  2FQ4 A;  5JVT A;  3BR5 A;  2FNP A;  4P96 A;  2JQ7 A;  2D45 A;  4II3 A;  3F8M A;  2ELK A;  1WCM J;  4BJT A;  3KPH A;  2H6C A;  3DV8 A;  1J0R A;  3ZMU A;  4HNV A;  4N4N B;  3LOC A;  3KP6 A;  1F5T A;  1IRX A;  3S14 J;  1R4N B;  3K9T A;  2GOM A;  3WTS C;  2NVT J;  3IWF A;  2ZNZ A;  3P5J A;  1Z0X A;  3V8K A;  1PVE A;  4LJZ F;  2NRA C;  3EYI A;  4L5E A;  3BT9 A;  1MJA A;  2Y30 A;  2XRO A;  2X85 A;  1R4M B;  5L3E A;  1ZAO A;  2IS6 A;  1N75 A;  2XGC A;  2EV5 A;  1RI7 A;  3TO7 A;  1ZRF A;  1R00 A;  2DAO A;  1D1B A;  1FC3 A;  3ZMV A;  3QPT A;  3ZRG A;  4CCJ A;  3CJQ B;  5TGT A;  5L3G A;  2ZJ2 A;  1OQY A;  4E4H A;  4D0P A;  3FXJ A;  1R71 A;  3VYS B;  3OMY A;  5FO5 A;  3RPU A;  2JUC A;  1XGM A;  5EZH A;  3N4M A;  3U9G A;  2O8X A;  2ZFU A;  2QSH X;  1VQ7 I;  2XGD A;  3R6S A;  4BBR J;  3C1D A;  2G0E A;  2FXA A;  1WJB A;  1MJB A;  4DNC A;  4M6Y A;  3DTK A;  3L7W A;  1SVM A;  3IH2 A;  3I3L A;  2IJL A;  2KMU A;  1MH4 A;  1U3E M;  5CKT A;  1CQT A;  4A3C J;  1LKX A;  2H1L A;  3LNQ A;  2NOJ B;  1ZHF A;  2TRT A;  2HEO A;  2QVO A;  2LG4 A;  2Q2E B;  4MQ9 F;  1QQI A;  2HXO A;  3DKX A;  3WTY C;  1BA5 A;  2ESH A;  3LSP A;  2PMZ A;  4DIQ A;  1S9H A;  1HC8 A;  1G6N A;  1X58 A;  4RM3 A;  3TP0 A;  2BVM A;  1USS A;  2X6Y A;  1ULY A;  5CQE A;  4RDU A;  5DD4 A;  1Z3X A;  3K69 A;  3D5R C;  2W1O A;  3MKL A;  2XSD C;  3GTL J;  1FOY A;  4XSZ F;  1YQA A;  5F0H A;  5FRM A;  3I4N J;  1U2W A;  4ZH4 F;  2HOS A;  5J3L A;  2COB A;  2E1N A;  3HOZ J;  3K10 A;  3JRA A;  3GTK J;  1R49 A;  4BAC A;  3JR9 A;  4MFE A;  5CVV A;  4GXO A;  3CUQ A;  4UXN A;  1IO2 A;  1DP3 A;  3W2V A;  2DYR H;  3E6M A;  2NYX A;  3HJE A;  1V55 H;  2PMZ N;  4FE7 A;  1QNT A;  1OPC A;  2HZT A;  2A5Y B;  4EJU A;  1ON1 A;  3NWT A;  2M0C A;  3ZQI A;  4L18 B;  3ZQF A;  4ZDP A;  1GXQ A;  1U9N A;  1ZG1 A;  1EJ9 A;  5GAE J;  3JSP A;  3A2K A;  2CW8 A;  3ECH A;  5JHU A;  3QU6 A;  4RLF A;  3RPU D;  1QBJ A;  2Y0S A;  5C4X J;  3DBR B;  1ZN2 A;  4HRI A;  3DPL C;  4M71 A;  2KFD A;  3GTP J;  4I09 A;  1FP2 A;  2FU4 A;  2IAI A;  3WTW C;  1JTY A;  1XPX A;  2M1B A;  4H4K C;  3IL2 A;  3V7R A;  3I64 A;  4AYB A;  1I39 A;  1GVJ A;  3KP5 A;  3OYL A;  2K9M A;  2R5Y A;  1F1Z A;  2CYY A;  3BZ6 A;  3TO6 A;  2DA3 A;  1TW3 A;  4CGZ A;  1KU3 A;  3QWL A;  4ABZ A;  3GF2 A;  3GVA A;  4KIG A;  4LK0 F;  3HTS B;  1MNM C;  2F5E A;  2HDW A;  5F1R A;  3G73 A;  1AOY A;  4GCV A;  2DFF A;  3JSO A;  1ZRE A;  1ITY A;  2VQH A;  1X1D A;  3VOD A;  3M4O J;  1APL C;  4RGS A;  5CYV A;  2Y0S N;  4HW0 A;  1X3U A;  2A61 A;  1LNW A;  2HNH A;  1WI3 A;  2EWN A;  4XK4 A;  4Y7N J;  2NS7 A;  2JZY A;  3BY6 A;  3NEU A;  1T0F A;  1OJL A;  2VT2 A;  3KYC B;  2M7A A;  1Q1V A;  1TTY A;  2G9W A;  2MD0 A;  1GV2 A;  4AYB N;  1OYY A;  1R22 A;  2V1U A;  3GYH X;  3U21 A;  2DCE A;  2DFE A;  1O3S A;  2QBY A;  4CYD A;  1XD7 A;  1XCV A;  4W97 A;  2NS0 A;  2KRF A;  3VSL A;  5IP7 J;  2MLG A;  4CCO A;  6PAX A;  1H89 C;  2HS5 A;  3DLA A;  3BR2 A;  4LLL A;  1J75 A;  3AL0 B;  4HF2 A;  1FBU A;  3KEQ A;  1HQC A;  3G4S I;  3OYC A;  1MDM A;  3V8J A;  1G3W A;  4M3G A;  4DGW B;  2E2H J;  1P7I A;  2CUZ A;  4A3D J;  2KIF A;  5LRS A;  1A36 A;  1UST A;  1HXD A;  3OWT A;  3ULQ B;  2CS3 A;  1TWF J;  3VDX A;  5K7F A;  1HW2 A;  2HKO A;  2O8K A;  1W7P A;  2M2E A;  4GO1 A;  2E1M C;  1YI2 I;  3RYR A;  2JA2 A;  3HHG A;  4XKB A;  2OPT A;  3TOA A;  4KYW A;  3OV8 A;  1SAN A;  2LR8 A;  3OYM A;  1ONV A;  5FGM A;  1U6G A;  3FM5 A;  4RGR A;  4OWR B;  1T0F C;  4UUV A;  5AON A;  1G3T A;  4BQQ A;  5F0C A;  2JT1 A;  3F72 A;  2VOO A;  2HOA A;  1HA8 A;  3HOW J;  5LGT A;  3A1Y A;  1CGP A;  2B7E A;  4M73 A;  1E17 A;  2QGU A;  3OYA A;  3KZY A;  4KIF A;  1H88 C;  3GCM A;  3HOT A;  4I0A A;  1OCC H;  4LK1 F;  3SXY A;  4Q47 A;  2IGN A;  1YTY A;  2XAS A;  2DMP A;  3DEU A;  2X48 A;  1BW6 A;  2Y0M A;  2E35 A;  2JVG A;  1J7K A;  1NHA A;  4WF2 A;  5ICG A;  1LPQ A;  4E7H A;  1P4A A;  1RUN A;  4LFU A;  1CF7 B;  5IYB J;  3HYI A;  2BE5 F;  2OBP A;  3I54 A;  4D5C A;  4BY1 J;  4GGG A;  3FXQ A;  1YJN I;  1F36 A;  2J5P A;  2W00 A;  1V54 H;  2LF8 A;  3Q9S A;  4IOA F;  3ERM A;  4AVP A;  3HOU J;  4XLN F;  3CJR B;  2E2I J;  2KPM A;  4BGD A;  4ZYG A;  4G6Q A;  2VKE A;  3C2G A;  1HCR A;  2R92 J;  4GRI A;  5BNG A;  2VPR A;  2DQR A;  1T56 A;  2XGX A;  2FEZ A;  3CD6 I;  3QQA A;  5J40 A;  3CCM I;  1K6O A;  1KYZ A;  3MKZ A;  2LTP A;  3CLQ A;  1LE8 A;  4P55 A;  2VQG A;  4A3E J;  2L01 A;  2CU7 A;  4PGH A;  4OAY A;  2CUE A;  2WBM A;  5KAI C;  3ML6 A;  3ZQC A;  1UMQ A;  3LSK A;  4L9V A;  2W84 A;  2KRC A;  1Y6I A;  4C3J J;  3E6B A;  1TLH B;  4UY8 I;  4KT6 A;  2QQ8 A;  2QKM B;  3BR6 A;  3ZXS A;  2DMU A;  1TZL A;  2VT3 A;  2EV6 A;  2RAE A;  2BZT A;  4PJM A;  5LEK A;  2R7O A;  4BHP A;  2DU9 A;  4OIP F;  3ABK H;  2Z3Y A;  3BJA A;  4PZJ A;  3F23 A;  5FLX Z;  2KLO A;  5E18 F;  1ZGW A;  1P4W A;  3QOE A;  1IG7 A;  2RQP A;  4MQV A;  2VAS A;  3QAH A;  4WK8 F;  5FKM A;  3L00 A;  2BY2 A;  1K61 A;  2K3F A;  3AG2 H;  5EG0 B;  3VYT B;  3KP7 A;  2R5Z A;  2UUZ A;  3KZZ A;  3FZV A;  2W82 A;  3GTG J;  2M8E A;  1VTN C;  2NOG A;  4ON0 A;  1I1G A;  1EH8 A;  3PL8 A;  4BDZ A;  2AXL A;  3DP7 A;  4ZYD A;  1MMS A;  5F27 A;  2JA7 J;  1ZEL A;  5TRD A;  2V9P A;  4B43 A;  1MBG A;  3HOY J;  3F6O A;  1MSE C;  2X1D A;  1TW2 A;  9ANT A;  1JGS A;  2BEO A;  3HXL A;  2DA7 A;  3WTU C;  2WB1 N;  2AQF A;  3I0T A;  2JA6 J;  1P4X A;  4ZYE A;  2IS1 A;  3DEE A;  1NH3 A;  4NQW A;  1LFU P;  3OYN A;  2W7N A;  4ASN A;  1PUF B;  4EEF G;  1YIJ I;  2CG4 A;  2ZB9 A;  3CJT B;  3IRQ A;  1BI2 A;  2DTR A;  4AID A;  2LKX A;  3DPU A;  3PO3 J;  3BC8 A;  1OR7 A;  2UV1 A;  3W2A A;  3F8C A;  5D4R A;  4Q5S F;  3HOV J;  4LIT A;  4EGZ A;  3AG1 H;  4B4C A;  5A2Q Z;  1JUP A;  1XN7 A;  5TIS C;  1FYL A;  2JRT A;  5M5Y J;  4P9F A;  2LSO A;  3LA2 A;  2QYO A;  3FXK A;  2K02 A;  3CCU I;  3I55 I;  4G7H F;  2PFB A;  1K78 A;  4A2U A;  3F8N A;  3E1S A;  2Y2Z A;  1XS9 A;  3HSR A;  2OA4 A;  5F0F A;  2NS8 A;  2EFN A;  2A6T A;  1JT6 A;  3K4L A;  3CP2 A;  3IAS 2;  2XHK A;  3WHC A;  1RUO A;  4O3M A;  1X4P A;  2LY1 A;  4EGY A;  2LNB A;  3TBI A;  1UJ8 A;  1ZGJ A;  4JQF A;  3PSI A;  2FNA A;  2W25 A;  1FTT A;  4RMN A;  1HSJ A;  4YG2 F;  2QF7 A;  4KUM A;  2HZD A;  4E7S A;  2VBX A;  1ZTR A;  2JPC A;  5LBQ A;  1SMT A;  1Y8R B;  4IEJ A;  3TW7 A;  1VQO I;  2EFQ A;  2H1K A;  1ETQ A;  3JRB A;  2AXT C;  4A3I J;  2I5U A;  1D1C A;  1OR7 C;  2PMH A;  2GIZ A;  5H6R A;  1K4T A;  1JKP C;  3ONQ A;  1MKM A;  2ELH A;  3DKY A;  3D5S C;  3C3W A;  2QQ9 A;  3DF8 A;  5LRR A;  2XUB A;  4QTR A;  1R6R A;  1X2N A;  3L2Q A;  2PLY A;  1D0X A;  4C2U A;  3F8F A;  2MGQ A;  4IHY A;  1A6I A;  1HLV A;  2L02 A;  3MVP A;  5EGO A;  1BR1 A;  3JRH A;  4KA4 A;  2W24 A;  3C2B A;  3ECO A;  5K5Q A;  4M6V A;  2YS9 A;  4UVB A;  4XN3 A;  1GT0 C;  3IH3 A;  2IGO A;  1ZRC A;  2JPB A;  2E5N A;  3KP2 A;  2R7F A;  2DT7 B;  3FF5 A;  3S32 A;  5D8K B;  4MLO A;  4F92 B;  1D0Y A;  1Z6T A;  4YIF A;  2OTL I;  1JGG A;  4Q48 A;  2EZH A;  1B8I B;  4B44 A;  3PIO F;  2FOK A;  1IUF A;  3D0S A;  2FX0 A;  2XB5 A;  1X4O A;  1GVD A;  2HKX A;  3HHH A;  1TL8 A;  3E5X A;  2EIK H;  3HUG A;  2EZL A;  3KIO A;  2PJR B;  4IHW A;  3GEZ A;  3JTH A;  4GDF A;  4NBQ A;  5HDN A;  2DI3 A;  3M1E A;  4XSX F;  2JTV A;  3PUF A;  4BQO A;  2V6C A;  2EIL H;  2LDU A;  2CUJ A;  2V9K A;  3REO A;  3A03 A;  3H9G A;  5JLX A;  2GXA A;  4RM2 A;  2HVS A;  4EJT A;  3JAM Z;  4M9S A;  4FAS D;  2EA2 A;  4BXU A;  5L3D A;  3B6C A;  1S7A A;  5ILU A;  4XOP A;  1H0M A;  2XAJ A;  2VN2 A;  3FIW A;  1O7F A;  4XLC A;  4AIK A;  2OQR A;  3S17 J;  3FM3 A;  3FK6 A;  3LST A;  4RB3 C;  3OL3 A;  1BM9 A;  3T8T A;  1SD7 A;  1V5E A;  1FMV A;  3AFH A;  5EEH A;  3GTM J;  2EIJ H;  1TQP A;  2ELJ A;  4XLF A;  5CPR B;  3S2W A;  2O61 A;  5E1X A;  4HEA 2;  1T98 A;  2JA5 J;  2W4S A;  3ZN1 A;  1WRJ A;  2CH0 A;  2LK2 A;  3FWE A;  3C2H A;  3BDD A;  2VC1 A;  2ZSH B;  4IXA A;  2HOE A;  5HLI A;  1SEU A;  2IXS A;  2VB6 A;  3BTL A;  4LG3 A;  2LD5 A;  2R93 J;  2X6X A;  2RN7 A;  4Y4R A;  1SMY F;  2CFX A;  2VON A;  4BHB A;  4UNO A;  2RNJ A;  4B3A A;  3CO7 C;  1R9T J;  3RKY A;  1FIA A;  4OIQ F;  1BJA A;  1SFK A;  2JSP A;  3SFI A;  2BY0 A;  1BIB A;  3TMO A;  1ETO A;  5E20 A;  4IO9 F;  4DYQ A;  1KYW A;  1NG6 A;  4R1H A;  4A5M A;  4UUS B;  3FXM A;  5J6X A;  2O7O A;  2R4G A;  3VOE A;  1C0W A;  4DYC A;  1MZB A;  1JE8 A;  2E1O A;  2OZU A;  3OS1 A;  2A05 A;  2LY9 A;  2K27 A;  3A01 B;  3CUO A;  4IX7 A;  1A31 A;  2DO7 A;  1EH6 A;  3BR3 A;  3Q0W A;  1YIO A;  4E7K A;  2DLL A;  3BP8 A;  5IT9 Z;  3HOS A;  2YU3 A;  1U78 A;  4C3I J;  1TT5 B;  2QWW A;  1WJE A;  4BY7 J;  1BW5 A;  5GP9 A;  3EDP A;  3H1C A;  1U5T B;  2IP2 A;  2V79 A;  3KP4 A;  2L7K A;  2WAE A;  3UR3 C;  2XC7 A;  1IAW A;  2DFI A;  5DUK A;  1N78 A;  1FP1 D;  1VQM I;  2HQA A;  1U8B A;  4BYY A;  4QWQ A;  2VQL A;  2V9V A;  3K4N A;  4RS8 A;  2QLZ A;  4QIW N;  1IN8 A;  1YS6 A;  1TC3 C;  1YOV B;  3F21 A;  5DCM B;  2JRM A;  1SFX A;  4LGW A;  1R7J A;  4LLG F;  3OY9 A;  3M7G A;  5BS6 A;  4XM3 A;  3ZMT A;  5FKL A;  1O57 A;  4XOT A;  1D5V A;  1MH3 A;  3H5R A;  4MTD A;  3WOD F;  1DU0 A;  2X6W A;  4M3F A;  5LGU A;  4G7O F;  1E0E A;  5H20 A;  3J81 Z;  2ZNY A;  2L5Q A;  3QYE A;  4FX0 A;  3J7Y J;  5JR3 A;  2ZFW A;  3DWL E;  2R0Q C;  4EM0 B;  1T08 B;  3ZPL A;  1E3P A;  1QVT A;  1SD4 A;  3IHU A;  3JCU C;  1UHM A;  1IW7 F;  1VI0 A;  1F4K A;  5FLX K;  3G1M A;  1X2M A;  4HX4 A;  3T5X A;  5BMZ A;  1QPI A;  4I02 A;  2NXN B;  3GFI A;  2KQR A;  2DJN A;  4P9U A;  4UB8 C;  1OCP A;  3CCE I;  4XL9 A;  3RSN A;  1K83 J;  2Y9Y A;  1UAA A;  3G1O A;  3E6D A;  1TP4 A;  2FUG 2;  5J1R A;  3BQY A;  3KEO A;  1U5T C;  1X1B A;  4BE1 A;  1O3Q A;  1ODD A;  3HSE A;  3I9V 2;  4D5F A;  1BR4 A;  3E3V A;  3I71 A;  2EFW A;  2DA1 A;  5FLM J;  4XNF A;  4DBR A;  4XLA A;  3SZP A;  1QZY A;  2M5W A;  2VBZ A;  3OOP A;  3CF5 F;  1FIP A;  2VOP A;  1DPR A;  5B66 C;  2VIX A;  1RKW A;  1Z3Y A;  5LFA A;  4OAZ A;  2MBF A;  1EV7 A;  4MEY F;  3EPZ A;  2L9N A;  4D7N A;  2ZJQ F;  2Y9Z A;  3K1M A;  1O3T A;  3PO2 J;  1OMI A;  2AQE A;  3A4C A;  1LB2 A;  2FA5 A;  1FOK A;  1D1A A;  5CVU A;  1HDP A;  3QU3 A;  4IHS A;  3NAU A;  1WH7 A;  1TWC J;  2HR3 A;  4HG2 A;  1SAX A;  3JRD A;  2XPW A;  3ABL H;  4CZZ A;  2WWY A;  3S2D J;  2GOX B;  3U1D A;  2O0Y A;  3S2H J;  2NVQ J;  1PUE E;  2VUM J;  5H2F C;  3IRR A;  1RET A;  1IRZ A;  1HDD C;  5A2Q K;  4HF0 A;  2DA6 A;  3DQV C;  3H9Q A;  1R5I D;  4B1R A;  3RZD J;  4AU7 A;  4LLN A;  1UCR A;  5J47 A;  2LRD A;  3IAM 2;  3PFY A;  4LMY A;  4IHX A;  5CVJ A;  4DOZ A;  4RBO A;  1Y0U A;  3CTA A;  4RAZ A;  1IN5 A;  3S16 J;  3W6V A;  3HGY A;  2MG4 A;  1FX7 A;  1ZYR F;  2DMQ A;  1K79 A;  2OJE D;  1FWZ A;  1B59 A;  3WG7 H;  4NC7 A;  4CYC A;  3FMS A;  5BPI A;  4NDL A;  1DUX C;  2XKP A;  3LQQ A;  1B1B A;  2RGV A;  3CUQ B;  3K2Z A;  1I5Z A;  4WWC A;  2QSG X;  1R5G A;  2A68 F;  2M7B A;  3OIO A;  5JI6 A;  5C3E J;  2F4O B;  2ZC2 A;  3IP4 B;  2EZI A;  2M87 A;  5D6F A;  5FRO A;  2H27 A;  4A3G J;  4ZYH A;  5GAD J;  5IP9 J;  4I2O A;  3DU6 A;  4XLH A;  1JJ8 C;  3QPH A;  1X3Z B;  3DCF A;  4RB1 A;  1ZG3 A;  3QP6 A;  3MKW B;  4C9Y A;  4HPQ A;  5IY5 H;  2P5K A;  1FZP B;  1RZ4 A;  1IXR C;  2GIV A;  1WKM A;  1D5Y A;  2MW8 A;  1P9Q C;  4V19 K;  2CQN A;  3M8J A;  4UVC A;  4AIH A;  2IVM A;  2EJR A;  4HX7 A;  2XAU A;  1W36 C;  3QP5 A;  3FHZ A;  3L09 A;  2OF7 A;  4PJJ A;  2VC0 A;  3ZQG A;  4MTE A;  1KU7 A;  3ISP A;  4HLY A;  2R5Y B;  2F5F A;  2LYC A;  1ZKG A;  2V1D A;  3OYI A;  3ZQL A;  4GYG A;  2EIM H;  2DOA A;  4E6K G;  1I6H J;  1MBE A;  2XAF A;  3ZN0 A;  4B8X A;  2NNY A;  4BKX A;  5M5W J;  2LLK A;  2E1M B;  2E7W A;  1ZR2 A;  3ZMD A;  2A07 F;  4JYK A;  4Y52 J;  1BC8 C;  3CUQ C;  3OYB A;  1W36 D;  3LSR A;  5DTD A;  3AG3 H;  3JRC A;  4ZJZ A;  5D5X B;  2EK5 A;  2XPU A;  3JAM K;  4ESF A;  3BLY A;  3CMM A;  1BI1 A;  3MZY A;  4RB2 C;  2MAB A;  2WY7 Q;  3KP3 A;  5M3F J;  3BJ6 A;  1GLN A;  3DPT A;  1VQP I;  3SQN A;  5HDG A;  2P5L C;  1T39 A;  2HQ5 A;  1I50 J;  1QVU A;  2YR2 A;  2QBY B;  1IRF A;  2BYV E;  1POG A;  4OIN F;  3TDZ C;  1PYV A;  4A0Z A;  4NUB A;  3RKW A;  1JHH A;  3J80 K;  2CQ7 A;  1V4R A;  3GTO J;  2VL8 A;  1MDM B;  2A3S A;  1B4A A;  3H5N A;  2D1V A;  1QZZ A;  4OIR F;  3IUO A;  3EUH A;  2X4H A;  1EF4 A;  1FYK A;  3S15 J;  2MH2 A;  3I58 A;  1U0J A;  3VPR A;  4KIS A;  2HWV A;  3BG7 A;  3CDL A;  1SD6 A;  3MMY B;  3LAP A;  1H8A C;  1W7P B;  1TWG J;  3CME I;  2VOD A;  3L2C A;  4BHC A;  3K70 C;  2HYF A;  2OZ6 A;  4XBF A;  3ERE D;  3LSG A;  4UV9 A;  2TCT A;  4HNU A;  1JKR C;  3CCV I;  3F8B A;  3Q0U A;  3KZI C;  3PFI A;  2DA5 A;  4CCN A;  4LOC A;  1UG0 A;  3J7A O;  3D1N I;  4HDV A;  4YFN F;  3OS0 A;  4Y33 A;  2ACJ A;  3RQI A;  1TWA J;  2B63 J;  2PI0 A;  2MLK A;  2OV7 A;  3OR1 C;  3MWM A;  3HRT A;  4WXD A;  2DPD A;  4F93 B;  3W3C A;  2JWT A;  2P6S A;  2DJI A;  3KCC A;  1Y1W J;  2P4W A;  1OCT C;  5E79 C;  5ICC A;  5B3S H;  2LP0 A;  4XQF A;  4HOB A;  2DMT A;  3DEW A;  1YRN A;  4F91 B;  3U1K A;  3EUH C;  2STT A;  1ETK A;  4J01 A;  1QO0 D;  2V1N A;  2F6C A;  4BS9 A;  5CVI A;  1YX5 A;  5DYM A;  3L1P A;  2ISY A;  4I99 C;  1LDK B;  2KKO A;  2QCO A;  2WAQ A;  5F64 A;  3J7A Y;  5CQG A;  3F22 A;  4DJA A;  2XRN A;  1B9M A;  2ECC A;  3O2P E;  5DV5 A;  4WCG A;  5FKK A;  2CUF A;  1WJ5 A;  2CV2 A;  2Z1D A;  1W5S A;  1Z77 A;  2ID6 A;  2OCC H;  1R5H A;  3MFK A;  2DA2 A;  4QLC U;  1R1V A;  2VXZ A;  3IV5 A;  2RRE A;  3M8E A;  4AC0 A;  1YJW I;  1OCO H;  4IF4 A;  4L9T A;  1U8R A;  5E3L A;  3S8P A;  5D5V B;  2W85 A;  1XCB A;  4KJZ A;  5HLG A;  2HQR A;  2K9L A;  2RV8 A;  3SEZ A;  1LE8 B;  1G59 A;  3O8H A;  1IZ1 A;  2DYS H;  1QHG A;  1I27 A;  3KFW X;  2KHM A;  5D6E A;  3L2U A;  3V7S A;  3ZQ7 A;  1W7P D;  4IOC F;  1W0T A;  4U0W A;  2LVS A;  2WAQ N;  5DM7 F;  5CLS A;  5ICF A;  1IXC A;  2IGK A;  5GAH J;  1IXS B;  2DMN A;  4L0Z B;  1STZ A;  3ZGK A;  5E8G A;  1I3Q J;  3K4J A;  2DDB A;  3FBI B;  2DDA A;  2X9D A;  5FFZ A;  4BL0 B;  1V5F A;  1WH5 A;  4H0E A;  2L9V A;  3LA3 A;  2CQX A;  2R7Q A;  2FBK A;  4E7Z A;  1FBS A;  1JUM A;  1YW7 A;  2RVC A;  3MEX A;  1FOX A;  2L7M P;  4FIS A;  2RDP A;  2WAF A;  4HQM A;  1HKT A;  2P81 A;  5E1Z B;  4F7Z A;  1KGS A;  2LMD A;  1MBH A;  2KIU A;  4CZC A;  2R5Z B;  2WB1 A;  2LBF A;  3ZOB A;  1GDT A;  1G3Y A;  4EJW A;  2Q8K A;  3SHF A;  2O9L A;  1WZ2 A;  4PJN A;  4XLP F;  2Y31 A;  2WAD A;  4FCY A;  3H0G J;  2X1C A;  4FT8 A;  1O3R A;  2IT0 A;  3WU0 A;  4AM3 A;  4LIV A;  2V26 A;  1WPK A;  4I01 A;  4A6E A;  2O6G E;  1Y56 A;  1EA3 A;  3PIP F;  4IRG A;  1FMW A;  4QSH A;  2XKO A;  3LSJ A;  4HA8 A;  2JK3 A;  4E7J A;  1MJ9 A;  2PN6 A;  3O3K A;  2QEN A;  4NB5 A;  1DPU A;  3ABU A;  3OSF A;  2DQL A;  2ZBK A;  4NQW B;  4AWX B;  3H35 A;  3HGG A;  1IN7 A;  4CDG A;  3CCS I;  3L2W A;  2CW0 F;  2Q1Z B;  1DDN A;  4HBL A;  5JFR A;  1T33 A;  2XDV A;  2FOW A;  4A6D A;  1S6L A;  2R3S A;  3SZG A;  2QKL B;  5B1A H;  4IPA A;  1X3W B;  2ZSI B;  4ZZD A;  2VI6 A;  4V2G A;  2KIM A;  3I4M J;  2FQ3 A;  2HGC A;  4BQN A;  3EQL F;  3L2V A;  2QSF X;  3BPV A;  1JI8 A;  1ZQ3 P;  2LF7 A;  4S0H B;  4X6A J;  1YFH A;  4II2 A;  2ISZ A;  1QPM A;  3HPH A;  1K78 B;  1DU6 A;  1XX5 A;  2D5V A;  2QQB A;  4WX9 A;  3GX4 X;  2ZME A;  2OTJ I;  5K7H A;  2I10 A;  2R7X A;  2D2W A;  2EFO A;  4HV6 A;  2ICW G;  3HTU A;  1LQ1 A;  2JA8 J;  3LL7 A;  1IJW C;  1J5Y A;  2K4J A;  4HV5 A;  2IS2 A;  1R58 A;  3ZP5 A;  2L4A A;  2WV1 A;  4A5N A;  1FY7 A;  3LQR A;  4KMU X;  1ZR4 A;  1ZG5 A;  4D1Q A;  3E97 A;  1MW7 A;  1G3S A;  5ERI A;  1YO5 C;  2GQQ A;  3OIP A;  4HST A;  4RGU A;  4MFD A;  1DGW Y;  1HBX G;  1VF9 A;  2BOL A;  3HSF A;  5CVR A;  3V4G A;  2OAZ A;  4KMF A;  2ZO4 A;  4YEL A;  1QA6 A;  1XG1 A;  2Y75 A;  3BTC A;  4CH7 A;  4XRM A;  1MMG A;  4KDP A;  1ETW A;  2HQN A;  1ON2 A;  2F5V A;  4IL6 C;  3UNG C;  2M0M A;  2DN0 A;  1ORK A;  3BWG A;  3QPL A;  1LJ9 A;  1PJR A;  2ZJP F;  3E6C C;  1MMD A;  1VQ4 I;  3VWB A;  4KIT B;  1JHF A;  4JP0 A;  1ZAR A;  3ABT A;  3SYT A;  3G1L A;  1D3Y A;  3K6G A;  2ZME C;  4BBS J;  5M5X J;  2PX9 A;  1R36 A;  3FKI J;  1KQ9 A;  2BW3 A;  1XMA A;  1Y1V J;  3GXO A;  5B1B H;  4F52 A;  2K3P A;  1LVA A;  3X2Q H;  2DFH A;  1BOA A;  2X6O A;  3ZR8 X;  4C2T A;  3E0J B;  4ANJ A;  3MD2 A;  2MH9 A;  4E70 A;  5IYC J;  1IF1 A;  4U88 A;  2VJI A;  2PQ8 A;  3HUG B;  4ZTF A;  3GZ6 A;  5IYD J;  1IC8 A;  4ZDO A;  3ZMS A;  5KAF C;  1UHW A;  3VEP A;  1XSD A;  2DT5 A;  4LB5 A;  3GW2 A;  3CCL I;  3CES A;  3RCO A;  5HOO A;  5K1Y A;  4ETS A;  1ZLK A;  2YU9 J;  4KNY A;  2GZW A;  4ENN A;  3CQZ J;  3DKW A;  3M9A A;  3HM5 A;  5H6Q A;  5HVQ C;  2CW7 A;  5ILV A;  5FB2 A;  4MNU A;  4HX8 A;  1Z9C A;  5HOD A;  2E7X A;  3MKY B;  4M3B A;  2KJC A;  3MN2 A;  2RNG A;  1MBF A;  2GWR A;  2AS5 F;  1FOW A;  4HAM A;  1KON A;  1GHC A;  3MZH A;  4D9J A;  5IOZ A;  1Z7U A;  1LDJ A;  1HST A;  2BBY A;  3CC2 I;  4TV7 A;  2OD5 A;  4BJ6 C;  1S72 I;  3H92 A;  4N4O B;  4A0X A;  1HW1 A;  2VBW A;  2K85 A;  1AU7 A;  4BQA A;  1N25 A;  5E3N A;  2IA1 A;  4V2F A;  3Q5F A;  1XC5 A;  4OMY A;  3HRS A;  3G2B A;  2H8W A;  4Y15 A;  2BGC A;  3VYR B;  3CCR I;  4XOR A;  5HDK A;  2Y48 A;  1GXP A;  1PP7 U;  1BIA A;  2JN6 A;  2R7D A;  5GTI C;  4JX6 A;  3WG9 A;  2FSW A;  3WGH A;  4E7L A;  4A0Y A;  1GUU A;  2HDC A;  1AKH A;  4HQE A;  3BG9 A;  1BL0 A;  1B72 A;  1VQK I;  1Y39 A;  1N77 A;  1FYM A;  1KQ8 A;  4J00 A;  2UXN A;  4C30 A;  1XGO A;  2DPU A;  3I59 A;  4CCK A;  1D8K A;  1XDU A;  2FBH A;  1RIO H;  4BJ5 C;  4FHT A;  3WGG A;  5JVG F;  1LDD A;  3GLL A;  3H5A A;  4IZZ A;  4P5O A;  5DS9 A;  1S8N A;  2FE3 A;  5ED4 A;  2K40 A;  4A3K J;  2Z2S B;  1HKS A;  4HF1 A;  3FIS A;  4I76 A;  1ZLJ A;  3EUK L;  4PK4 A;  3ZQQ A;  4KIB A;  3OYF A;  1X1C A;  1E3H A;  4FTH A;  2R7S A;  4JOM A;  3CCY A;  2V7F A;  2KRH A;  2LKP A;  1VND A;  2H94 A;  3MZ8 A;  3NQO A;  4JX4 A;  1VQ9 I;  2L4M A;  2L3D A;  3H0D A;  4N9I A;  1OYW A;  2J5O A;  1T6S A;  3H36 A;  2F5C A;  4LG0 A;  2WY8 Q;  2VPL A;  3QPS A;  1D0Z A;  2F48 A;  2HVQ A;  1VQ5 I;  2K5C A;  2GM4 A;  1UEL B;  1BN5 A;  4LIU A;  4M6X A;  1Y0N A;  5LHI A;  3W6K B;  1VQN I;  3BJO A;  5DDG A;  3F6V A;  3H3V K;  1S5L C;  3R0J A;  4JBA A;  4I6Z A;  2IS4 A;  4RAF A;  3AAF A;  3I4P A;  3TKY A;  4ESJ A;  1FJL A;  3C7J A;  2Q0O A;  4BEH A;  2PG4 A;  1D8J A;  1MBJ A;  2EQR A;  3PJR A;  1OYI A;  5F1J A;  1MGT A;  1UFM A;  2QM3 A;  4C2M J;  3ROU A;  3LMM A;  4ENK A;  3DBH B;  2M4G A;  3OL4 A;  3OR2 C;  1YS7 A;  1A04 A;  2N8G A;  4G6T B;  3RPQ A;  3VYU B;  1AWC A;  4HYE A;  2EA4 A;  3GZN B;  1V5G A;  3WHB A;  1JUS A;  2KIQ A;  3PNY A;  3TW6 A;  2VJ5 A;  2XPV A;  4CIC A;  5ICE A;  3HOX J;  4XKW A;  4D7M A;  4Z2Y A;  2MSY A;  3N05 A;  4E7I A;  3V7C A;  2XAH A;  1ETV A;  3BRO A;  5K5R A;  3F3X A;  2MYS A;  1FSE A;  4B48 A;  1FT9 A;  5FD6 A;  3TQN A;  1FNN A;  4IRH A;  5EJC A;  1L0O C;  5GTH C;  2DBB A;  4N0B A;  4CSW A;  1OFC X;  3S3O A;  2OUM A;  4Y17 A;  2I8D A;  4MIM A;  3GZ5 A;  4KIC A;  2K4B A;  4ZTJ A;  3LSM A;  3P7N A;  1S29 A;  3ZQH A;  3R61 A;  2EBI A;  3BPX A;  5LEJ A;  4U0Y A;  4YEJ A;  2M4K A;  4UVA A;  1EH7 A;  2VE8 A;  4ENM A;  1O4X A;  1QHH D;  3E7L A;  1A35 A;  3G6E I;  3CO6 C;  4IHV A;  5FRN A;  2P0W A;  4LB6 B;  1W0U A;  2F4M B;  3L9F A;  2ZKZ A;  2BHZ A;  1J9I A;  2STW A;  3E5Q A;  1JKO C;  3BZK A;  2CSO A;  2YX4 A;  1FTZ A;  5HLT A;  3S1R J;  2EH3 A;  3EUA A;  2VJJ A;  4U7D A;  3WTZ A;  5C44 J;  3CC4 I;  5IT3 A;  2P7V B;  1G8X A;  4A3F J;  4FQG A;  3M8F A;  5E3M A;  2RKH A;  2HXI A;  1RKT A;  2LOO A;  4HZF A;  4A3M J;  2MC4 A;  1SAU A;  3BTJ A;  2FML A;  3IH4 A;  3PUB A;  1VQ8 I;  1IRG A;  4DYR A;  2OQG A;  2JMW A;  3BG3 A;  1B9N A;  4KT5 C;  2CQQ A;  2EIN H;  2W57 A;  3PSF A;  4F3Q A;  1A5J A;  3FX3 A;  1QU3 A;  1PP8 F;  3M1C A;  5E1W A;  3HRU A;  2KIS A;  3Q3S A;  4X1E A;  4N9H A;  4I0B A;  1YJ9 I;  1NTC A;  2XSJ C;  3SDG A;  1X1P A;  1FSH A;  1Z6R A;  4PSX A;  3U2R A;  1IDZ A;  3ASN H;  3DXJ F;  4R79 A;  5EF6 A;  2GA1 A;  1DGR M;  4IHT A;  2YPR A;  2VJ4 A;  3F9K A;  3L2R A;  1T38 A;  4JX5 A;  1X19 A;  2A6H F;  5L3F A;  4CYC B;  4UV8 A;  4B09 A;  3CLO A;  2EZK A;  1XSX A;  3HRM A;  2O5R A;  3O6B B;  2XVC A;  4RA2 A;  2HYJ A;  3GLX A;  4L9N A;  4OU0 A;  2B9S A;  2WTE A;  4UUT A;  3GBG A;  3AG4 H;  3LFK A;  5IP6 A;  2R7R A;  3KEY A;  2Z33 A;  2LC2 A;  4S04 A;  1T2K A;  5DM6 F;  1YYV A;  1ZK8 A;  1AA7 A;  4EMS A;  2Q2E A;  2CV0 A;  1BI0 A;  1KU2 A;  2DOF A;  2E34 A;  2XV4 S;  3S1Q J;  3P9I A;  1B6A A;  1XTA A;  2JVH A;  1W4M A;  2PJP A;  4PFP A;  2Z16 A;  4RLQ A;  1SD5 A;  3CF2 A;  1TQM A;  3GTQ J;  2LRE A;  1ETY A;  4XRF A;  2OC6 A;  2KP6 A;  2XF5 A;  4XLE A;  3SFZ A;  3WU1 B;  3RDI A;  1SFE A;  2VBY A;  2GLO A;  3S1N J;  4MGR A;  1S7O A;  4XRS G;  1RRJ A;  3EET A;  5GPA A;  2CQK A;  1I1S A;  2VKH A;  4U7B A;  2WA0 A;  3K7A J;  1V3F A;  2EFP A;  3ZCO A;  3J7Z I;  4KN4 X;  4O6J A;  2DOD A;  2P7C B;  1W5T A;  2IGM A;  1W1W E;  3NRV A;  1MIJ A;  4XMY A;  2F5D A;  4G8X A;  5DUI A;  2MD5 A;  1S7E A;  2H09 A;  5GAG J;  4U0V A;  3A02 A;  4PDK A;  3WE2 A;  2KJB A;  4B47 A;  3RJP A;  3SJM A;  5DEQ A;  5KNL A;  2EB7 A;  3I53 A;  5D5W B;  1E3O C;  1AHD P;  1PDN C;  1REP C;  3TO9 A;  4AIJ A;  3OYG A;  3JRE A;  2PEX A;  4IRI A;  3W2W A;  2EV0 A;  2MC3 A;  5CJ9 A;  1TNT A;  1P6R A;  1YX3 A;  4S05 A;  4PCQ A;  1RES A;  4A3L J;  2K9S A;  3QRF F;  1NK3 P;  3PNT A;  4AD9 A;  5LHH A;  4Y3O A;  4XRS A;  1WJC A;  4OIO F;  1FEX A;  1MMN A;  4R8H A;  3P9K A;  3HG9 A;  1G2H A;  2ME6 A;  4JK1 X;  4BUP A;  3WE3 A;  4IVN A;  2ZJR F;  3HEF A;  4YIR X;  2VKV A;  3BG5 A;  3LAJ A;  3CZ6 A;  3V8L A;  2HOT A;  3BR1 A;  5F08 A;  5FJ8 J;  5JHF A;  4BU2 A;  1SFU A;  3B6A A;  4DQ2 A;  4GFB A;  2WV0 A;  5HNF A;  3PQJ A;  2HPI A;  1QRY A;  1WHU A;  3RI4 A;  1ETX A;  2E5Z A;  2QUF A;  4MO7 A;  3TP3 A;  1MMA A;  2ZXI A;  1A6Q A;  2K7L A;  1S3J A;  1YLF A;  4FE4 A;  3R4K A;  3ZMZ A;  4C3H J;  4O5V A;  5C4J J;  3LWF A;  2CWE A;  4HSR A;  2IRF G;  2ADU A;  3S3M A;  4OOI A;  1JXS A;  5FKN A;  1HKQ A;  1HW5 A;  3RKX A;  4X0G A;  1TQI A;  4G6D A;  1XB4 A;  2M3A A;  1T95 A;  2HI3 A;  2CFO A;  3HB9 A;  1YW8 A;  2XB0 X;  4ENJ A;  2FMY A;  2IBD A;  3Q9V A;  3CJN A;  2G7H A;  3GFJ A;  2R7W A;  3HDD A;  2BY3 A;  3SEQ A;  3CCQ I;  1ZRD A;  1JT0 A;  3K70 D;  2LFB A; 
#chains in the Genus database with same CATH homology
 1YRN B;  3IH2 A;  1DU6 A;  2D5V A;  3SFI A;  1IDY A;  1MH4 A;  1CQT A;  1ETO A;  4A3C J;  5K7H A;  2I10 A;  3HBL A;  3LNQ A;  2DTZ A;  4DZJ A;  2TRT A;  4DYQ A;  4UUS B;  2HXO A;  2JA8 J;  2O7O A;  1IJW C;  1BA5 A;  4DYC A;  3LSP A;  2E1O A;  2WV1 A;  1X58 A;  2LY9 A;  1ZR4 A;  3TP0 A;  4A69 C;  3A01 B;  4RDU A;  3MKL A;  4XID A;  2XSD C;  3GTL J;  5FKO A;  4MFD A;  3BR3 A;  3Q0W A;  5F0H A;  3I4N J;  1VF9 A;  5J3L A;  2HOS A;  2GBY A;  2COB A;  3HOZ J;  1U78 A;  4C3I J;  1XG1 A;  3BTC A;  4XRM A;  3JRA A;  4BY7 J;  4J19 A;  3GTK J;  1ETW A;  1BW5 A;  5GP9 A;  3JR9 A;  4MFE A;  2DN0 A;  1ORK A;  1GV5 A;  2AHQ A;  3QPL A;  2YUS A;  2AO9 A;  5F04 A;  1U8B A;  2R7Z J;  1RR7 A;  4QIW N;  4A93 J;  1TC3 C;  1HOM A;  4JP0 A;  2M9H A;  2PMZ N;  4FE7 A;  3G1L A;  2M0C A;  1JKQ C;  3ZQI A;  4BBS J;  3ZQF A;  5M5X J;  2ECB A;  3FKI J;  2DA4 A;  1U9N A;  1Y1V J;  5FKL A;  1MH3 A;  2X6O A;  4AUX A;  1DU0 A;  4M3F A;  5C4X J;  5IYC J;  3GTP J;  2NVX J;  2R0Q C;  2K9N A;  2IAI A;  5IYD J;  1IC8 A;  1JTY A;  1HF0 A;  1QVT A;  1VI0 A;  2R5Y A;  3G1M A;  1X2M A;  1QPI A;  2DA3 A;  3TED A;  2DJN A;  2YU9 J;  1F43 A;  1OCP A;  4ABZ A;  1K83 J;  2Y9Y A;  3CQZ J;  2JJ7 A;  3HM5 A;  1MNM C;  1VFC A;  3G1O A;  5HOD A;  2FD5 A;  4M3B A;  3MN2 A;  2ME0 A;  1ITY A;  1MBF A;  5J1R A;  3BQY A;  3M4O J;  1APL C;  5IOZ A;  4D5F A;  2Y0S N;  2DA1 A;  2NVY J;  5FLM J;  4XK4 A;  1WI3 A;  4Y7N J;  1AU7 A;  2NS7 A;  1OJL A;  5E3N A;  2L7Z A;  1Q1V A;  4V2F A;  1FIP A;  1GV2 A;  4AYB N;  1XC5 A;  1NK2 P;  5J1U A;  1RKW A;  1ENH A;  4W97 A;  5EG0 A;  5IP7 J;  3PO2 J;  4D7N A;  2Y9Z A;  1H89 C;  2JN6 A;  2IEK A;  3BR2 A;  4JX6 A;  1HDP A;  3NAU A;  1GUU A;  1WH7 A;  1TWC J;  1AKH A;  4M3G A;  3BG9 A;  1BL0 A;  2CJJ A;  1B72 A;  3JRD A;  1IV6 A;  1P7I A;  2E2H J;  4A3D J;  2XPW A;  2E2J J;  2L9R A;  3S2D J;  2L7F P;  3S2H J;  2NVQ J;  1TWF J;  2VUM J;  3Q0V A;  5K7F A;  2O8K A;  2M2E A;  1RET A;  1IRZ A;  1HDD C;  5DS9 A;  2DA6 A;  2OPT A;  4B1R A;  2K40 A;  1SAN A;  4A3K J;  3RZD J;  2LR8 A;  4IHX A;  3FIS A;  3O8G A;  4I76 A;  3JRI A;  4RBO A;  1PUF A;  1LFB A;  3S16 J;  3W6V A;  3HGY A;  2MG4 A;  4FTH A;  2DMQ A;  3CCY A;  5IPA A;  5F0C A;  2HOA A;  5EEA A;  1VND A;  4JX4 A;  3HOW J;  4CYC A;  4NDL A;  3QPS A;  1H88 C;  1RPW A;  3FK7 A;  2GM4 A;  3OIO A;  2DMP A;  5C3E J;  2X48 A;  1BW6 A;  5JLW A;  3H3V K;  4I6Z A;  2EZI A;  5IYB J;  1FJL A;  4D5C A;  4BY1 J;  4A3G J;  3HKZ N;  1F36 A;  1MBJ A;  2EQR A;  4DZP A;  5EGO B;  4M3D A;  5F1J A;  4C2M J;  5IP9 J;  1SFO J;  1JJ8 C;  5E3O A;  3HOU J;  3DCF A;  2E2I J;  2N8G A;  1D5Y A;  3F0C A;  2VKE A;  3BTI A;  2MW8 A;  1HCR A;  3BR0 A;  2R92 J;  3WHB A;  1JUS A;  5BNG A;  2VPR A;  1MBK A;  1T56 A;  3TW6 A;  2XPV A;  3HOX J;  4D7M A;  2OF7 A;  3QQA A;  3ZQG A;  2MSY A;  2W48 A;  2LTP A;  3CMY A;  2R5Y B;  1ZKG A;  3ZQL A;  1ETV A;  4XIC A;  1LE8 A;  4A3B J;  3S1M J;  1P7J A;  4A3E J;  1I6H J;  1MBE A;  2CU7 A;  4BXX J;  4BKX A;  2CUE A;  5M5W J;  3ZQC A;  1UMQ A;  2LLK A;  3GTJ J;  1U9O A;  2E19 A;  3RKQ A;  3UKG A;  2XRL A;  1ZR2 A;  4Y52 J;  1OFC X;  4JYK A;  4C3J J;  2K9Q A;  1JTX A;  3OSG A;  2H8R A;  4MIM A;  3BR6 A;  5DTD A;  3NAR A;  2DMU A;  3LSR A;  3JRC A;  2RAE A;  1BJZ A;  2XPU A;  3ZQH A;  2ID3 A;  2EBI A;  5M3F J;  1ZGW A;  1B8I A;  1IG7 A;  1IGN A;  1O4X A;  3E7L A;  3PM1 A;  5FKM A;  2HQ5 A;  1I50 J;  1QVU A;  1K61 A;  4IHV A;  1POG A;  5EG0 B;  1W0U A;  1JKO C;  2R5Z A;  3GTO J;  3GTG J;  1FTZ A;  2NOG A;  3S1R J;  1AKH B;  2EH3 A;  1B72 B;  5C44 J;  1EF4 A;  5F27 A;  4A3F J;  3S15 J;  5E3M A;  2JA7 J;  3VPR A;  2HXI A;  1RKT A;  1UG2 A;  5IOY A;  3CDL A;  4A3M J;  1H8A C;  3BTJ A;  3IH4 A;  1MBG A;  1TWG J;  4DYR A;  2JMW A;  3BG3 A;  2CQQ A;  3HOY J;  3LSG A;  3JRF A;  1A5J A;  2TCT A;  1JKR C;  2XGE A;  1MSE C;  3Q3S A;  4X1E A;  9ANT A;  2DA7 A;  2WB1 N;  3Q0U A;  1NTC A;  2JA6 J;  2DA5 A;  2KT0 A;  3SDG A;  3K2A A;  4LOC A;  1LFU P;  3D1N I;  5EYR A;  4EEF G;  1PUF B;  1UHS A;  2ZB9 A;  3RQI A;  5GPC A;  1IDZ A;  1TWA J;  5EF6 A;  2B63 J;  2LKX A;  1MSF C;  1TWH J;  2KDZ A;  3PO3 J;  2M8G X;  3BQZ A;  4JX5 A;  3M3Y J;  4CYC B;  3HOV J;  2JWT A;  5J1Y A;  3JRG A;  4B4C A;  2EZK A;  1JUP A;  2HYJ A;  1Y1W J;  1OCT C;  5M5Y J;  4UUT A;  2LP0 A;  4W1U A;  2DMT A;  3DEW A;  5EDN A;  3GBG A;  1YRN A;  5IP6 A;  1ETK A;  2Y2Z A;  3RZO J;  1XS9 A;  5F0F A;  1ZK8 A;  2NS8 A;  4G12 A;  1JT6 A;  3WHC A;  3L1P A;  5FLV A;  2CRG A;  4UUS A;  2QCO A;  3S1Q J;  2FJ1 A;  2ECC A;  1FTT A;  5FKK A;  2CUF A;  2QF7 A;  3GTQ J;  1Z77 A;  3A01 A;  2ID6 A;  4M3E A;  2L0K A;  1ETY A;  2M34 A;  1ZTR A;  2DA2 A;  3IV5 A;  4AC0 A;  4IEJ A;  5EZG A;  2GLO A;  3TW7 A;  3S1N J;  2H1K A;  4XRS G;  1ETQ A;  5GPA A;  5E3L A;  3JRB A;  4A3I J;  1JKP C;  1LE8 B;  3O8H A;  3K7A J;  4QTR A;  1X2N A;  1W0T A;  2MGQ A;  4IHY A;  2LVS A;  1WGX A;  1A6I A;  1HLV A;  2WAQ N;  5K7Z A;  3MVP A;  5EGO A;  1S7E A;  3JRH A;  3A02 A;  2DMN A;  3C2B A;  4M6V A;  2YS9 A;  3SJM A;  1GT0 C;  3IH3 A;  1I3Q J;  1E3O C;  1AHD P;  1JJ6 C;  4MLO A;  4DW6 A;  2X9D A;  1JGG A;  1WH5 A;  2EZH A;  1B8I B;  3JRE A;  1IUF A;  2CQX A;  2FX0 A;  1JUM A;  2L7M P;  2XB5 A;  5M3M J;  4FIS A;  1GVD A;  1RES A;  4A3L J;  2EZL A;  3OOU A;  2K9S A;  4IHW A;  1NK3 P;  2P81 A;  2HDD A;  1MBH A;  4XRS A;  2R5Z B;  1FEX A;  1G2H A;  2ME6 A;  3ZOB A;  1GDT A;  4A3J J;  2O9L A;  5JLX A;  2FQ4 A;  3A03 A;  3HEF A;  3BR5 A;  2VKV A;  3BG5 A;  2ELK A;  1WCM J;  2Y31 A;  3BR1 A;  5F08 A;  5FJ8 J;  2HOT A;  4HNV A;  4FCY A;  3H0G J;  3B6C A;  3LOC A;  3B6A A;  1WPK A;  3S14 J;  4GFB A;  1QRY A;  3FIW A;  2NVT J;  1ETX A;  3S17 J;  4MO7 A;  3FK6 A;  3TP3 A;  1Z0X A;  4QSH A;  3LSJ A;  2JK3 A;  4FE4 A;  4L5E A;  3BT9 A;  2Y30 A;  3GTM J;  4C3H J;  5C4J J;  3OSF A;  2XGC A;  2JA5 J;  3HGG A;  5FKN A;  2LK2 A;  1T33 A;  2HI3 A;  3HB9 A;  3BTL A;  2XB0 X;  2LD5 A;  2IBD A;  2VI6 A;  4V2G A;  2R93 J;  5EZH A;  3I4M J;  3HDD A;  1JT0 A;  1ZQ3 P;  4B3A A;  4S0H B;  1R9T J;  2XGD A;  1FIA A;  4BBR J;  4X6A J;  2G0E A;  2LFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...