3H3VL

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h3vL00
3PO2C 4A3CC 3GTOK 3HOVC 3RZOK 1TWAC 1SMYA 3S2DK 2PA8L 3S1NK 2R93C 5IYDC 4X6AC 4BBRC 4A3MK 3GTLK 2NVYK 3S1RC 2CW0A 3GTGK 4A3BC 4BY1C 4AYBL 5FLMC 2E2JC 5IP7C 5C3EK 3GTQK 3H0GC 3HOZC 3I4NC 2NVQC 1SFOK 1IW7A 4A3DK 2JA5C 2VUMC 5C4XC 1TWCC 4Y7NC 1K83C 4A3EK 2E2HK 1TWHC 3S14C 4A3JK 4A3KK 3S15C 5TMCA 4MQ9A 4YFNA 3RZDC 3GTKC 1BDFA 3GTMK 4MEYA 3H3VL 4QJVB 4A3IK 2JA7C 1TWGC 4A3FC 2E2IC 1I6VA 3GTPK 1TWFC 5IYBC 4BY7C 3DXJA 4AYBD 4MEXA 4C2MK 1Y1VC 3S17C 1Y1WK 3PO3K 3M4OK 2A6EA 3S2HC 1R9TK 5M5WK 2Y0SD 4XLNA 5C44C 2WAQD 1I50C 3HOWC 5IP9K 3S16C 4Q5SA 3PO2K 3FKIC 4OIQA 3K7AC 3CQZC 4KMUA 4A93C 2YU9C 3HOUC 2O5IA 2R92C 3I4MC 3M3YC 4BBRK 2Y0SL 1XPPA 4BXXK 5IYCC 2B63C 2WB1L 2WAQL 3H3VD 5C4JC 3HKZD 3GTOC 2NVTK 2R7ZK 3S2DC 3HOZK 1I6HK 4OIPA 3S1QC 4C3IK 4A3GK 4GZYA 4LJZA 2JA5K 1I3QK 4A3MC 3GTJK 2JA6K 2NVYC 3GTGC 4A3LK 3HKZL 3HOXK 3WODA 5C3EC 3GTQC 5M3FK 5M5YK 4A3DC 4JK1A 4C3JK 2JA8K 3S1MK 1YNJA 1TWGK 4C3HK 2NVXK 4A3EC 2WB1D 2E2HC 2YU9K 4A3JC 1WCMC 4A3KC 3HOYK 4YFXA 5D4DA 4A3CK 4BBSK 4Y52K 4OIOA 3HOVK 2R93K 1TWAK 2BE5A 4X6AK 3GTMC 5IYDK 5M5XK 4A3IC 4KN4A 2A6HA 3FKIK 3S1RK 3GTPC 4A3BK 4QJVA 2PMZD 4XLPA 4BY1K 3M4OC 5FLMK 1Y1WC 2E2JK 5IP7K 2R92K 2A68A 1R9TC 3H0GK 3I4NK 3M3YK 2NVQK 1ZYRA 3RZOC 4YG2A 3S1NC 4XSXA 5C4XK 5IP9C 2VUMK 3EQLA 1TWCK 3GTLC 4NOIA 4G7OA 4Y7NK 1K83K 2PPBA 3S14K 1TWHK 2PMZL 4G7ZA 3S15K 1HQMA 3S1QK 4QIWL 3RZDK 3GTKK 4KN7A 1SFOC 4OINA 4BXXC 2O5JA 4XSZA 4Q4ZA 4YFKA 4ZH4A 2JA7K 4LK0A 4A3FK 2E2IK 2NVTC 2R7ZC 1TWFK 5IYBK 4BY7K 4OIRA 1I6HC 5M3MK 3S17K 4G7HA 1Y1VK 3S2HK 4A3GC 1I3QC 2JA6C 2A69A 3GTJC 4LK1A 3HOYC 4A3LC 4LLGA 5C44K 3HOWK 1I50K 5FJ8K 1WCMK 3S16K 3HOXC 3PO3C 3K7AK 3CQZK 2PA8D 4A93K 3HOUK 4QIWD 2JA8C 3I4MK 3S1MC 5TMFA 2NVXC 1YNNA 5IYCK 2B63K 4BBSC 4Y52C 5C4JK
chains in the Genus database with same CATH superfamily
3PO2C 3HOVC 2R93C 1TWAC 1SMYA 1WQGA 3BP3A 4GT9A 4A3MK 2CW0A 3G4AA 2YU9A 5IP7C 5C3EK 3HOZC 3H0GC 1IW7A 1DD5A 2W7VA 3BP8C 1XXCA 4MQ9A 4YFNA 3GTKC 4QJVB 4A3FC 1O2BA 1PJ6A 1TWFC 4BY7C 3S2HC 1Y1VC 3M4OK 1Y1WK 1DCHA 1O2AA 3VA7A 1F7UA 4XLNA 5C44C 3HOWC 1BS2A 4LQYA 3TTGA 5HL8A 4OIQA 4KMUA 3N3YA 3HXAA 3HOUC 1WSVA 4AH6A 2Y0SL 4GTEA 5IYCC 5L46A 2FQTA 1JVIA 2RGRA 1WSRA 3S2DC 3Q3QA 3S1QC 4C3IK 3FOEA 4J3NA 1J6XA 2JA5K 2NVYC 1F93A 3HOXK 2B63A 3WODA 1ZVUA 5M3FK 5M5YK 4C3JK 2JA8K 4A3EC 4A3KC 3GTLA 1PJ5A 1V5VA 4XCHA 4OIOA 3HOVK 2R93K 1TWAK 2BE5A 1DCOA 1RU0A 3GTQA 2A6HA 1WOOA 4QJVA 4G0WA 4KMDA 5IP7K 2R92K 2A68A 3H0GK 4YG2A 5IP9C 1GE9A 4G7OA 1IQ0A 3GTPA 3GTKK 1XZPB 4BXXC 3ERED 2O5JA 3N0BA 3T01A 1R9TA 4XSZA 3FHZA 4LK0A 4A3FK 2NVTC 1TWFK 4BY7K 4OIRA 5M3MK 4G7HA 1Y1VK 3S2HK 2R93A 3GIRA 2A69A 3BUEA 3GTJC 5TJ3A 3NUHA 3SZYA 5C44K 3L4JA 3HOWK 4WJ4A 1WCMK 3T00A 4GTBA 3AQOA 2R7ZA 3OPFA 3HOUK 4QIWD 3S1MC 1IBAA 1YNNA 5E68A 5IYCK 2CFAB 4Y52C 3HOYC 2GSUA 1B4BA 3RZOK 3S2DK 5IYDC 4C45A 2NVYK 3S1RC 4A3BC 4AYBL 2NVXA 4GTFA 1TWFA 1O28A 3I4NC 2NVQC 4RMFA 2JA5C 5C4XC 1B4AA 1TWCC 1F7VA 3AD9C 4DDQA 4A3EK 3S14C 1TWHC 4A3KK 1VGXA 4MEYA 4C3JC 3H3VL 4KM9A 1XZPA 2E2IC 5IOQA 4M1XA 3DXJA 4MEXA 4LR2A 2A6EA 4KARA 1O29A 1AB4A 2Y0SD 1L0WA 1I50C 5IP9K 2JA7A 4A93C 2O5IA 2R92C 2XCQA 4BXXK 2WB1L 5C4JC 3GTOC 2NVTK 2CFAA 1XXBA 3CQZA 4LJZA 4KDDA 1BJTA 3GTJK 3GTGC 3OREA 5EGEA 4GTAA 3HKZL 4P9SA 1PJ7A 3OEPA 2ZFZA 1O25A 2V6SA 3JSTA 3S1MK 1TWGK 2E2HC 4Y52K 1WCMC 3HOYK 3A8IA 1USOA 3GTMC 5IYDK 4KN4A 1J6VA 3FKIK 3S1RK 3AD8C 4A3BK 4BKWA 4C2MC 3RZOC 3M3YK 1VRQC 3A8JA 2NVQK 1ZYRA 3I4NK 4P5AA 5C4XK 1TWCK 3S14K 1TWHK 2EBBA 4PABA 1HQMA 1Y1WA 4YFKA 2E2IK 4WJ3M 5JVOA 1O2FB 1I6HC 4A3GC 1I3QC 2JA6C 4LK1A 4A3LC 4LLGA 1I50K 5FJ8K 1JOEA 4A93K 1INNA 4C3HC 3GSIA 2JA5A 2YU9C 5C4JK 4A3CC 3ADAC 4G0VA 3GTOK 3G4CA 4GTDA 2PHCB 4GTCA 3GTGK 1EQRA 2E2IA 5CJ9A 3GDZA 3L4KA 1SFOK 1TWAA 2VUMC 2GSOA 4Y7NC 1K83C 2E2HK 1WOSA 2ZUEA 1BDFA 1ISEA 4WILA 2R92A 3GTMK 3H0GA 2V6TA 1TWGC 5IOSA 1I6VA 1O26A 1EFWA 4KMHA 3S17C 4C2MK 5M5WK 1ZQ1C 3GTKA 3CAGA 3SZZA 3S16C 3FKIC 4GFQA 3K7AC 4LOWA 3T02A 3M3YC 1Y1VA 4BBRK 1XPPA 2B63C 2WAQL 1J6WA 1WOPA 2XCRB 3HKZD 1EK8A 1WCMA 1I6HK 4OIPA 3A8KA 3S0XA 4A3GK 4GZYA 1I3QK 2JA6K 4A3LK 3GTQC 1WQHA 2GAHC 4A3DC 4KMAA 2FQOA 4C3HK 1WIHA 1KQ4A 2YU9K 2RH6A 4A3JC 2NVYA 4YFXA 4A3CK 1VJEA 1VLOA 4GTLA 1JQWA 5M5XK 4A3IC 2ZUFA 3MMLB 3GTPC 4G0UA 1R9TC 3LPXA 2VUMK 3V4GA 3EQLA 1UV7A 4NOIA 4Y7NK 1K83K 2PMZL 4G7ZA 1EH1A 1ZBSA 4QIWL 4KN7A 1SFOC 4KC6A 4ZH4A 2V6UA 2R7ZC 4KATA 3S17K 1X31C 4KB4A 3TFHA 3S16K 4KM8A 3K7AK 2Y3PA 2NVXC 2VUMA 2B63K 4BBSC 3GTJA 1K83A 4X6AC 2PA8L 3S1NK 4BLAA 4BBRC 1O24A 3GTLK 3GEIA 1TWGA 4BY1C 3FOFA 5FLMC 2E2JC 3GTQK 4A3DK 3AQPA 4FZBA 4A3JK 1YCLA 3FKIA 5TMCA 3S15C 3RZDC 4A3IK 2JA7C 3GTPK 3N0CA 5IYBC 1TWCA 4AYBD 1ZXOA 3PO3K 1IE0A 1VH2A 1TWHA 2KWAA 1R9TK 1IL2A 1USMA 2WAQD 4Q5SA 3PO2K 1EI6A 2GAGC 3CQZC 1C0AA 5IORA 3I4MC 3TFJA 2P8TA 3H3VD 1WORA 1XXAA 1HI9A 1I50A 2R7ZK 3HOZK 1XZQB 3TFIA 4A3MC 4ILDA 5JFEA 4KASA 5C3EC 3GTOA 3AH5A 4JK1A 1YNJA 5IOTA 2D6FC 2XCOA 2NVXK 2WB1D 4BBSK 3GTGA 5D4DA 2P5MA 4X6AK 3GEEA 1IS1A 1SFOA 2JH3A 1BGWA 5EGHA 2PMZD 4XLPA 4BY1K 3M4OC 5FLMK 5CHPA 1Y1WC 2E2JK 2E2HA 3S1NC 4XSXA 3GTMA 3LAJA 3GTLC 1G51A 2PPBA 1F9NA 3S15K 3S1QK 1J98A 3RZDK 4O2DA 4OINA 4Q4ZA 2JA7K 3GEHA 5IYBK 3QX3A 3IPJA 4C3IC 1O27A 4PAAA 1XZQA 1WQFA 2GSNA 3HOXC 4BLBA 1YX2A 1DCPA 4FM9A 3AD7C 3PO3C 3CQZK 2PA8D 4KAWX 4KB2A 4P5BA 2JA8C 3I4MK 5TMFA 3LAPA 1I3QA 2JA6A
chains in the Genus database with same CATH topology
3PO2C 4A3CC 3GTOK 3HOVC 3RZOK 1TWAC 1SMYA 3S2DK 2PA8L 3S1NK 2R93C 5IYDC 4X6AC 4BBRC 4A3MK 3GTLK 2NVYK 3S1RC 2CW0A 3GTGK 4A3BC 4BY1C 4AYBL 5FLMC 2E2JC 5IP7C 5C3EK 3GTQK 3H0GC 3HOZC 3I4NC 2NVQC 1SFOK 1IW7A 4A3DK 2JA5C 2VUMC 5C4XC 1TWCC 4Y7NC 1K83C 4A3EK 2E2HK 1TWHC 3S14C 4A3JK 4A3KK 3S15C 5TMCA 4MQ9A 4YFNA 3RZDC 3GTKC 1BDFA 3GTMK 4MEYA 3H3VL 4QJVB 4A3IK 2JA7C 1TWGC 4A3FC 2E2IC 1I6VA 3GTPK 1TWFC 5IYBC 4BY7C 3DXJA 4AYBD 4MEXA 4C2MK 1Y1VC 3S17C 1Y1WK 3PO3K 3M4OK 2A6EA 3S2HC 1R9TK 5M5WK 2Y0SD 4XLNA 5C44C 2WAQD 1I50C 3HOWC 5IP9K 3S16C 4Q5SA 3PO2K 3FKIC 4OIQA 3K7AC 3CQZC 4KMUA 4A93C 2YU9C 3HOUC 2O5IA 2R92C 3I4MC 3M3YC 4BBRK 2Y0SL 1XPPA 4BXXK 5IYCC 2B63C 2WB1L 2WAQL 3H3VD 5C4JC 3HKZD 3GTOC 2NVTK 2R7ZK 3S2DC 3HOZK 1I6HK 4OIPA 3S1QC 4C3IK 4A3GK 4GZYA 4LJZA 2JA5K 1I3QK 4A3MC 3GTJK 2JA6K 2NVYC 3GTGC 4A3LK 3HKZL 3HOXK 3WODA 5C3EC 3GTQC 5M3FK 5M5YK 4A3DC 4JK1A 4C3JK 2JA8K 3S1MK 1YNJA 1TWGK 4C3HK 2NVXK 4A3EC 2WB1D 2E2HC 2YU9K 4A3JC 1WCMC 4A3KC 3HOYK 4YFXA 5D4DA 4A3CK 4BBSK 4Y52K 4OIOA 3HOVK 2R93K 1TWAK 2BE5A 4X6AK 3GTMC 5IYDK 5M5XK 4A3IC 4KN4A 2A6HA 3FKIK 3S1RK 3GTPC 4A3BK 4QJVA 2PMZD 4XLPA 4BY1K 3M4OC 5FLMK 1Y1WC 2E2JK 5IP7K 2R92K 2A68A 1R9TC 3H0GK 3I4NK 3M3YK 2NVQK 1ZYRA 3RZOC 4YG2A 3S1NC 4XSXA 5C4XK 5IP9C 2VUMK 3EQLA 1TWCK 3GTLC 4NOIA 4G7OA 4Y7NK 1K83K 2PPBA 3S14K 1TWHK 2PMZL 4G7ZA 3S15K 1HQMA 3S1QK 4QIWL 3RZDK 3GTKK 4KN7A 1SFOC 4OINA 4BXXC 2O5JA 4XSZA 4Q4ZA 4YFKA 4ZH4A 2JA7K 4LK0A 4A3FK 2E2IK 2NVTC 2R7ZC 1TWFK 5IYBK 4BY7K 4OIRA 1I6HC 5M3MK 3S17K 4G7HA 1Y1VK 3S2HK 4A3GC 1I3QC 2JA6C 2A69A 3GTJC 4LK1A 3HOYC 4A3LC 4LLGA 5C44K 3HOWK 1I50K 5FJ8K 1WCMK 3S16K 3HOXC 3PO3C 3K7AK 3CQZK 2PA8D 4A93K 3HOUK 4QIWD 2JA8C 3I4MK 3S1MC 5TMFA 2NVXC 1YNNA 5IYCK 2B63K 4BBSC 4Y52C 5C4JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 C;  4A3C C;  3GTO K;  3HOV C;  3RZO K;  1TWA C;  1SMY A;  3S2D K;  2PA8 L;  3S1N K;  2R93 C;  5IYD C;  4X6A C;  4BBR C;  4A3M K;  3GTL K;  2NVY K;  3S1R C;  2CW0 A;  3GTG K;  4A3B C;  4BY1 C;  4AYB L;  5FLM C;  2E2J C;  5IP7 C;  5C3E K;  3GTQ K;  3H0G C;  3HOZ C;  3I4N C;  2NVQ C;  1SFO K;  1IW7 A;  4A3D K;  2JA5 C;  2VUM C;  5C4X C;  1TWC C;  4Y7N C;  1K83 C;  4A3E K;  2E2H K;  1TWH C;  3S14 C;  4A3J K;  4A3K K;  3S15 C;  5TMC A;  4MQ9 A;  4YFN A;  3RZD C;  3GTK C;  1BDF A;  3GTM K;  4MEY A;  3H3V L;  4QJV B;  4A3I K;  2JA7 C;  1TWG C;  4A3F C;  2E2I C;  1I6V A;  3GTP K;  1TWF C;  5IYB C;  4BY7 C;  3DXJ A;  4AYB D;  4MEX A;  4C2M K;  1Y1V C;  3S17 C;  1Y1W K;  3PO3 K;  3M4O K;  2A6E A;  3S2H C;  1R9T K;  5M5W K;  2Y0S D;  4XLN A;  5C44 C;  2WAQ D;  1I50 C;  3HOW C;  5IP9 K;  3S16 C;  4Q5S A;  3PO2 K;  3FKI C;  4OIQ A;  3K7A C;  3CQZ C;  4KMU A;  4A93 C;  2YU9 C;  3HOU C;  2O5I A;  2R92 C;  3I4M C;  3M3Y C;  4BBR K;  2Y0S L;  1XPP A;  4BXX K;  5IYC C;  2B63 C;  2WB1 L;  2WAQ L;  3H3V D;  5C4J C;  3HKZ D;  3GTO C;  2NVT K;  2R7Z K;  3S2D C;  3HOZ K;  1I6H K;  4OIP A;  3S1Q C;  4C3I K;  4A3G K;  4GZY A;  4LJZ A;  2JA5 K;  1I3Q K;  4A3M C;  3GTJ K;  2JA6 K;  2NVY C;  3GTG C;  4A3L K;  3HKZ L;  3HOX K;  3WOD A;  5C3E C;  3GTQ C;  5M3F K;  5M5Y K;  4A3D C;  4JK1 A;  4C3J K;  2JA8 K;  3S1M K;  1YNJ A;  1TWG K;  4C3H K;  2NVX K;  4A3E C;  2WB1 D;  2E2H C;  2YU9 K;  4A3J C;  1WCM C;  4A3K C;  3HOY K;  4YFX A;  5D4D A;  4A3C K;  4BBS K;  4Y52 K;  4OIO A;  3HOV K;  2R93 K;  1TWA K;  2BE5 A;  4X6A K;  3GTM C;  5IYD K;  5M5X K;  4A3I C;  4KN4 A;  2A6H A;  3FKI K;  3S1R K;  3GTP C;  4A3B K;  4QJV A;  2PMZ D;  4XLP A;  4BY1 K;  3M4O C;  5FLM K;  1Y1W C;  2E2J K;  5IP7 K;  2R92 K;  2A68 A;  1R9T C;  3H0G K;  3I4N K;  3M3Y K;  2NVQ K;  1ZYR A;  3RZO C;  4YG2 A;  3S1N C;  4XSX A;  5C4X K;  5IP9 C;  2VUM K;  3EQL A;  1TWC K;  3GTL C;  4NOI A;  4G7O A;  4Y7N K;  1K83 K;  2PPB A;  3S14 K;  1TWH K;  2PMZ L;  4G7Z A;  3S15 K;  1HQM A;  3S1Q K;  4QIW L;  3RZD K;  3GTK K;  4KN7 A;  1SFO C;  4OIN A;  4BXX C;  2O5J A;  4XSZ A;  4Q4Z A;  4YFK A;  4ZH4 A;  2JA7 K;  4LK0 A;  4A3F K;  2E2I K;  2NVT C;  2R7Z C;  1TWF K;  5IYB K;  4BY7 K;  4OIR A;  1I6H C;  5M3M K;  3S17 K;  4G7H A;  1Y1V K;  3S2H K;  4A3G C;  1I3Q C;  2JA6 C;  2A69 A;  3GTJ C;  4LK1 A;  3HOY C;  4A3L C;  4LLG A;  5C44 K;  3HOW K;  1I50 K;  5FJ8 K;  1WCM K;  3S16 K;  3HOX C;  3PO3 C;  3K7A K;  3CQZ K;  2PA8 D;  4A93 K;  3HOU K;  4QIW D;  2JA8 C;  3I4M K;  3S1M C;  5TMF A;  2NVX C;  1YNN A;  5IYC K;  2B63 K;  4BBS C;  4Y52 C;  5C4J K; 
#chains in the Genus database with same CATH topology
 3PO2 C;  3HOV C;  2R93 C;  1TWA C;  1SMY A;  1WQG A;  3BP3 A;  4GT9 A;  4A3M K;  2CW0 A;  3G4A A;  2YU9 A;  5IP7 C;  5C3E K;  3HOZ C;  3H0G C;  1IW7 A;  1DD5 A;  2W7V A;  3BP8 C;  1XXC A;  4MQ9 A;  4YFN A;  3GTK C;  4QJV B;  4A3F C;  1O2B A;  1PJ6 A;  1TWF C;  4BY7 C;  3S2H C;  1Y1V C;  3M4O K;  1Y1W K;  1DCH A;  1O2A A;  3VA7 A;  1F7U A;  4XLN A;  5C44 C;  3HOW C;  1BS2 A;  4LQY A;  3TTG A;  5HL8 A;  4OIQ A;  4KMU A;  3N3Y A;  3HXA A;  3HOU C;  1WSV A;  4AH6 A;  2Y0S L;  4GTE A;  5IYC C;  5L46 A;  2FQT A;  1JVI A;  2RGR A;  1WSR A;  3S2D C;  3Q3Q A;  3S1Q C;  4C3I K;  3FOE A;  4J3N A;  1J6X A;  2JA5 K;  2NVY C;  1F93 A;  3HOX K;  2B63 A;  3WOD A;  1ZVU A;  5M3F K;  5M5Y K;  4C3J K;  2JA8 K;  4A3E C;  4A3K C;  3GTL A;  1PJ5 A;  1V5V A;  4XCH A;  4OIO A;  3HOV K;  2R93 K;  1TWA K;  2BE5 A;  1DCO A;  1RU0 A;  3GTQ A;  2A6H A;  1WOO A;  4QJV A;  4G0W A;  4KMD A;  5IP7 K;  2R92 K;  2A68 A;  3H0G K;  4YG2 A;  5IP9 C;  1GE9 A;  4G7O A;  1IQ0 A;  3GTP A;  3GTK K;  1XZP B;  4BXX C;  3ERE D;  2O5J A;  3N0B A;  3T01 A;  1R9T A;  4XSZ A;  3FHZ A;  4LK0 A;  4A3F K;  2NVT C;  1TWF K;  4BY7 K;  4OIR A;  5M3M K;  4G7H A;  1Y1V K;  3S2H K;  2R93 A;  3GIR A;  2A69 A;  3BUE A;  3GTJ C;  5TJ3 A;  3NUH A;  3SZY A;  5C44 K;  3L4J A;  3HOW K;  4WJ4 A;  1WCM K;  3T00 A;  4GTB A;  3AQO A;  2R7Z A;  3OPF A;  3HOU K;  4QIW D;  3S1M C;  1IBA A;  1YNN A;  5E68 A;  5IYC K;  2CFA B;  4Y52 C;  3HOY C;  2GSU A;  1B4B A;  3RZO K;  3S2D K;  5IYD C;  4C45 A;  2NVY K;  3S1R C;  4A3B C;  4AYB L;  2NVX A;  4GTF A;  1TWF A;  1O28 A;  3I4N C;  2NVQ C;  4RMF A;  2JA5 C;  5C4X C;  1B4A A;  1TWC C;  1F7V A;  3AD9 C;  4DDQ A;  4A3E K;  3S14 C;  1TWH C;  4A3K K;  1VGX A;  4MEY A;  4C3J C;  3H3V L;  4KM9 A;  1XZP A;  2E2I C;  5IOQ A;  4M1X A;  3DXJ A;  4MEX A;  4LR2 A;  2A6E A;  4KAR A;  1O29 A;  1AB4 A;  2Y0S D;  1L0W A;  1I50 C;  5IP9 K;  2JA7 A;  4A93 C;  2O5I A;  2R92 C;  2XCQ A;  4BXX K;  2WB1 L;  5C4J C;  3GTO C;  2NVT K;  2CFA A;  1XXB A;  3CQZ A;  4LJZ A;  4KDD A;  1BJT A;  3GTJ K;  3GTG C;  3ORE A;  5EGE A;  4GTA A;  3HKZ L;  4P9S A;  1PJ7 A;  3OEP A;  2ZFZ A;  1O25 A;  2V6S A;  3JST A;  3S1M K;  1TWG K;  2E2H C;  4Y52 K;  1WCM C;  3HOY K;  3A8I A;  1USO A;  3GTM C;  5IYD K;  4KN4 A;  1J6V A;  3FKI K;  3S1R K;  3AD8 C;  4A3B K;  4BKW A;  4C2M C;  3RZO C;  3M3Y K;  1VRQ C;  3A8J A;  2NVQ K;  1ZYR A;  3I4N K;  4P5A A;  5C4X K;  1TWC K;  3S14 K;  1TWH K;  2EBB A;  4PAB A;  1HQM A;  1Y1W A;  4YFK A;  2E2I K;  4WJ3 M;  5JVO A;  1O2F B;  1I6H C;  4A3G C;  1I3Q C;  2JA6 C;  4LK1 A;  4A3L C;  4LLG A;  1I50 K;  5FJ8 K;  1JOE A;  4A93 K;  1INN A;  4C3H C;  3GSI A;  2JA5 A;  2YU9 C;  5C4J K;  4A3C C;  3ADA C;  4G0V A;  3GTO K;  3G4C A;  4GTD A;  2PHC B;  4GTC A;  3GTG K;  1EQR A;  2E2I A;  5CJ9 A;  3GDZ A;  3L4K A;  1SFO K;  1TWA A;  2VUM C;  2GSO A;  4Y7N C;  1K83 C;  2E2H K;  1WOS A;  2ZUE A;  1BDF A;  1ISE A;  4WIL A;  2R92 A;  3GTM K;  3H0G A;  2V6T A;  1TWG C;  5IOS A;  1I6V A;  1O26 A;  1EFW A;  4KMH A;  3S17 C;  4C2M K;  5M5W K;  1ZQ1 C;  3GTK A;  3CAG A;  3SZZ A;  3S16 C;  3FKI C;  4GFQ A;  3K7A C;  4LOW A;  3T02 A;  3M3Y C;  1Y1V A;  4BBR K;  1XPP A;  2B63 C;  2WAQ L;  1J6W A;  1WOP A;  2XCR B;  3HKZ D;  1EK8 A;  1WCM A;  1I6H K;  4OIP A;  3A8K A;  3S0X A;  4A3G K;  4GZY A;  1I3Q K;  2JA6 K;  4A3L K;  3GTQ C;  1WQH A;  2GAH C;  4A3D C;  4KMA A;  2FQO A;  4C3H K;  1WIH A;  1KQ4 A;  2YU9 K;  2RH6 A;  4A3J C;  2NVY A;  4YFX A;  4A3C K;  1VJE A;  1VLO A;  4GTL A;  1JQW A;  5M5X K;  4A3I C;  2ZUF A;  3MML B;  3GTP C;  4G0U A;  1R9T C;  3LPX A;  2VUM K;  3V4G A;  3EQL A;  1UV7 A;  4NOI A;  4Y7N K;  1K83 K;  2PMZ L;  4G7Z A;  1EH1 A;  1ZBS A;  4QIW L;  4KN7 A;  1SFO C;  4KC6 A;  4ZH4 A;  2V6U A;  2R7Z C;  4KAT A;  3S17 K;  1X31 C;  4KB4 A;  3TFH A;  3S16 K;  4KM8 A;  3K7A K;  2Y3P A;  2NVX C;  2VUM A;  2B63 K;  4BBS C;  3GTJ A;  1K83 A;  4X6A C;  2PA8 L;  3S1N K;  4BLA A;  4BBR C;  1O24 A;  3GTL K;  3GEI A;  1TWG A;  4BY1 C;  3FOF A;  5FLM C;  2E2J C;  3GTQ K;  4A3D K;  3AQP A;  4FZB A;  4A3J K;  1YCL A;  3FKI A;  5TMC A;  3S15 C;  3RZD C;  4A3I K;  2JA7 C;  3GTP K;  3N0C A;  5IYB C;  1TWC A;  4AYB D;  1ZXO A;  3PO3 K;  1IE0 A;  1VH2 A;  1TWH A;  2KWA A;  1R9T K;  1IL2 A;  1USM A;  2WAQ D;  4Q5S A;  3PO2 K;  1EI6 A;  2GAG C;  3CQZ C;  1C0A A;  5IOR A;  3I4M C;  3TFJ A;  2P8T A;  3H3V D;  1WOR A;  1XXA A;  1HI9 A;  1I50 A;  2R7Z K;  3HOZ K;  1XZQ B;  3TFI A;  4A3M C;  4ILD A;  5JFE A;  4KAS A;  5C3E C;  3GTO A;  3AH5 A;  4JK1 A;  1YNJ A;  5IOT A;  2D6F C;  2XCO A;  2NVX K;  2WB1 D;  4BBS K;  3GTG A;  5D4D A;  2P5M A;  4X6A K;  3GEE A;  1IS1 A;  1SFO A;  2JH3 A;  1BGW A;  5EGH A;  2PMZ D;  4XLP A;  4BY1 K;  3M4O C;  5FLM K;  5CHP A;  1Y1W C;  2E2J K;  2E2H A;  3S1N C;  4XSX A;  3GTM A;  3LAJ A;  3GTL C;  1G51 A;  2PPB A;  1F9N A;  3S15 K;  3S1Q K;  1J98 A;  3RZD K;  4O2D A;  4OIN A;  4Q4Z A;  2JA7 K;  3GEH A;  5IYB K;  3QX3 A;  3IPJ A;  4C3I C;  1O27 A;  4PAA A;  1XZQ A;  1WQF A;  2GSN A;  3HOX C;  4BLB A;  1YX2 A;  1DCP A;  4FM9 A;  3AD7 C;  3PO3 C;  3CQZ K;  2PA8 D;  4KAW X;  4KB2 A;  4P5B A;  2JA8 C;  3I4M K;  5TMF A;  3LAP A;  1I3Q A;  2JA6 A; 
#chains in the Genus database with same CATH homology
 3PO2 C;  4A3C C;  3GTO K;  3HOV C;  3RZO K;  1TWA C;  1SMY A;  3S2D K;  2PA8 L;  3S1N K;  2R93 C;  5IYD C;  4X6A C;  4BBR C;  4A3M K;  3GTL K;  2NVY K;  3S1R C;  2CW0 A;  3GTG K;  4A3B C;  4BY1 C;  4AYB L;  5FLM C;  2E2J C;  5IP7 C;  5C3E K;  3GTQ K;  3H0G C;  3HOZ C;  3I4N C;  2NVQ C;  1SFO K;  1IW7 A;  4A3D K;  2JA5 C;  2VUM C;  5C4X C;  1TWC C;  4Y7N C;  1K83 C;  4A3E K;  2E2H K;  1TWH C;  3S14 C;  4A3J K;  4A3K K;  3S15 C;  5TMC A;  4MQ9 A;  4YFN A;  3RZD C;  3GTK C;  1BDF A;  3GTM K;  4MEY A;  3H3V L;  4QJV B;  4A3I K;  2JA7 C;  1TWG C;  4A3F C;  2E2I C;  1I6V A;  3GTP K;  1TWF C;  5IYB C;  4BY7 C;  3DXJ A;  4AYB D;  4MEX A;  4C2M K;  1Y1V C;  3S17 C;  1Y1W K;  3PO3 K;  3M4O K;  2A6E A;  3S2H C;  1R9T K;  5M5W K;  2Y0S D;  4XLN A;  5C44 C;  2WAQ D;  1I50 C;  3HOW C;  5IP9 K;  3S16 C;  4Q5S A;  3PO2 K;  3FKI C;  4OIQ A;  3K7A C;  3CQZ C;  4KMU A;  4A93 C;  2YU9 C;  3HOU C;  2O5I A;  2R92 C;  3I4M C;  3M3Y C;  4BBR K;  2Y0S L;  1XPP A;  4BXX K;  5IYC C;  2B63 C;  2WB1 L;  2WAQ L;  3H3V D;  5C4J C;  3HKZ D;  3GTO C;  2NVT K;  2R7Z K;  3S2D C;  3HOZ K;  1I6H K;  4OIP A;  3S1Q C;  4C3I K;  4A3G K;  4GZY A;  4LJZ A;  2JA5 K;  1I3Q K;  4A3M C;  3GTJ K;  2JA6 K;  2NVY C;  3GTG C;  4A3L K;  3HKZ L;  3HOX K;  3WOD A;  5C3E C;  3GTQ C;  5M3F K;  5M5Y K;  4A3D C;  4JK1 A;  4C3J K;  2JA8 K;  3S1M K;  1YNJ A;  1TWG K;  4C3H K;  2NVX K;  4A3E C;  2WB1 D;  2E2H C;  2YU9 K;  4A3J C;  1WCM C;  4A3K C;  3HOY K;  4YFX A;  5D4D A;  4A3C K;  4BBS K;  4Y52 K;  4OIO A;  3HOV K;  2R93 K;  1TWA K;  2BE5 A;  4X6A K;  3GTM C;  5IYD K;  5M5X K;  4A3I C;  4KN4 A;  2A6H A;  3FKI K;  3S1R K;  3GTP C;  4A3B K;  4QJV A;  2PMZ D;  4XLP A;  4BY1 K;  3M4O C;  5FLM K;  1Y1W C;  2E2J K;  5IP7 K;  2R92 K;  2A68 A;  1R9T C;  3H0G K;  3I4N K;  3M3Y K;  2NVQ K;  1ZYR A;  3RZO C;  4YG2 A;  3S1N C;  4XSX A;  5C4X K;  5IP9 C;  2VUM K;  3EQL A;  1TWC K;  3GTL C;  4NOI A;  4G7O A;  4Y7N K;  1K83 K;  2PPB A;  3S14 K;  1TWH K;  2PMZ L;  4G7Z A;  3S15 K;  1HQM A;  3S1Q K;  4QIW L;  3RZD K;  3GTK K;  4KN7 A;  1SFO C;  4OIN A;  4BXX C;  2O5J A;  4XSZ A;  4Q4Z A;  4YFK A;  4ZH4 A;  2JA7 K;  4LK0 A;  4A3F K;  2E2I K;  2NVT C;  2R7Z C;  1TWF K;  5IYB K;  4BY7 K;  4OIR A;  1I6H C;  5M3M K;  3S17 K;  4G7H A;  1Y1V K;  3S2H K;  4A3G C;  1I3Q C;  2JA6 C;  2A69 A;  3GTJ C;  4LK1 A;  3HOY C;  4A3L C;  4LLG A;  5C44 K;  3HOW K;  1I50 K;  5FJ8 K;  1WCM K;  3S16 K;  3HOX C;  3PO3 C;  3K7A K;  3CQZ K;  2PA8 D;  4A93 K;  3HOU K;  4QIW D;  2JA8 C;  3I4M K;  3S1M C;  5TMF A;  2NVX C;  1YNN A;  5IYC K;  2B63 K;  4BBS C;  4Y52 C;  5C4J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...