3H3VL

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h3vL00
3CQZC 3GTOC 3HOVC 5IP9C 2PMZL 1TWHK 4Y7NK 4C3IK 5C44C 4A3KK 2E2JK 4BY1C 2YU9K 2R93C 1SMYA 1Y1VC 2WAQL 1TWAK 3GTJC 3HOWC 4KN7A 3S16C 3S14K 3H3VL 2JA5K 4YFNA 5IP7C 4A3IC 5IYCK 3GTLK 2NVXC 4KMUA 4A93K 4KN4A 5TMFA 4Q4ZA 4QJVA 1K83C 5FLMK 3HOYC 3S17C 3FKIK 2NVTK 1HQMA 1YNNA 2YU9C 4X6AK 4A3BC 4BXXC 2Y0SD 3S2HK 5C4XC 4Y7NC 5IP7K 3GTKK 1TWHC 4MEYA 3S15K 4A3LK 1I6HC 3HOVK 1TWAC 3HOWK 3I4MK 4Y52K 1R9TC 1Y1WK 4X6AC 2PPBA 2B63K 2NVQK 3RZOK 3FKIC 2WB1D 2NVTC 5IYBK 3EQLA 2PA8L 3K7AK 3S1NK 2Y0SL 4NOIA 2R92C 4A3DC 4ZH4A 5TMCA 3HOZC 4BY7C 4A3EK 2VUMK 4BBSC 2O5IA 4C3JK 2A69A 2A6EA 5M5WK 4A3CC 2E2HC 2JA6K 3GTQC 3GTLC 2NVQC 3RZOC 4A3CK 4A3MC 4A3IK 2JA7K 4A3EC 2VUMC 4A3GK 3GTMK 3PO3K 4BBSK 2R92K 3GTGC 1I6VA 3GTJK 3S16K 4LLGA 4G7ZA 1TWGK 2B63C 2NVYK 4QJVB 4A3FK 3HOUC 3M3YC 4A3BK 4BXXK 4AYBD 4A3JK 3HOXC 3S2DC 1K83K 3S15C 4LJZA 4MQ9A 5M5YK 3GTGK 3S1RC 3GTKC 3S1MK 3PO2C 1XPPA 1IW7A 1TWCC 4YG2A 4BBRK 2O5JA 2WB1L 1ZYRA 2A68A 5FLMC 3HOYK 4YFXA 5C4JK 3H3VD 5C3EK 3GTPK 2E2IC 5M5XK 5IYBC 1YNJA 4A3JC 5FJ8K 2WAQD 1Y1VK 2PA8D 3M4OK 5C44K 3DXJA 4A3KC 3I4MC 3S1MC 4Q5SA 1WCMC 3H0GK 4LK0A 3S14C 2A6HA 4AYBL 4A3LC 2BE5A 5IYDK 4OINA 4QIWD 1I50K 4LK1A 2E2JC 3S2HC 2NVYC 3M4OC 1I50C 4MEXA 3S1QC 2E2HK 2JA6C 3GTQK 5IYDC 1SFOK 2JA8C 3S17K 5C3EC 4XSXA 4JK1A 3GTPC 3CQZK 4G7OA 4XLPA 3GTMC 3HOZK 1WCMK 2R7ZC 3K7AC 1TWCK 5IYCC 4Y52C 5D4DA 3PO2K 3RZDK 4OIQA 4BY7K 1I6HK 3S1NC 4A3DK 4BBRC 5M3MK 2PMZD 4OIPA 3S1QK 1I3QC 4C3HK 1R9TK 3HOUK 5M3FK 1TWGC 3S1RK 5IP9K 3HKZD 3HOXK 3S2DK 3GTOK 4QIWL 3PO3C 3H0GC 5C4XK 4G7HA 4A3FC 4OIOA 4C2MK 1I3QK 1TWFK 2NVXK 3M3YK 4A93C 4GZYA 4OIRA 2E2IK 2R7ZK 3I4NK 5C4JC 3RZDC 3I4NC 1BDFA 4A3MK 1SFOC 2JA8K 2JA7C 4A3GC 2CW0A 1TWFC 4XSZA 3HKZL 4YFKA 4XLNA 1Y1WC 4BY1K 2R93K 3WODA 2JA5C
chains in the Genus database with same CATH superfamily
1WOOA 3CQZC 4Y7NK 4C3HC 4GT9A 1PJ5A 1TWAK 3GTJC 2VUMA 1EH1A 2Y3PA 2JA6A 4A3IC 1ZQ1C 3GTLK 4KN4A 1BJTA 1K83C 1WQHA 1YNNA 4GTFA 4X6AK 1YCLA 4P5BA 3S15K 3NUHA 2EBBA 4KMDA 3GEEA 1TWHA 1Y1WK 5EGEA 2B63K 4KB4A 3K7AK 4NOIA 3HOZC 4C3JK 1WIHA 2A6EA 3TFJA 4A3CC 2E2HC 3GTQC 3RZOC 3FOEA 3AQPA 4A3IK 3T01A 4LOWA 1ZVUA 3OPFA 3S16K 4LLGA 1IBAA 4KMHA 1XZQA 2V6UA 3M3YC 3LPXA 4PAAA 1ZXOA 4KC6A 1GE9A 3HOXC 3GTGK 3S1RC 3IPJA 1UV7A 4BBRK 2WB1L 1ZYRA 5C3EK 3GTPK 2E2IC 1XXAA 1PJ6A 1YNJA 3T02A 4A3KC 1DCOA 3I4MC 4M1XA 3HXAA 3N0BA 2R92A 2NVXA 4OINA 3GTJA 3S2HC 2NVYC 1I50C 1WOPA 3GSIA 2JA6C 1VLOA 4P5AA 3S17K 4G7OA 1O2BA 3K7AC 1TWCK 3LAJA 3RZDK 4BY7K 5EGHA 4BBRC 1R9TK 1Y1VA 2ZFZA 4KATA 5M3FK 4BLBA 4GTCA 2JA5A 3S2DK 1VH2A 3GTLA 4GZYA 1TWFK 4A93C 3TFIA 4OIRA 1USOA 3SZYA 4GTEA 2R7ZK 3BP3A 1B4AA 1L0WA 2JA7C 4A3GC 2XCOA 3BUEA 4YFKA 4XSZA 2R93K 3GTOC 3A8JA 2PMZL 2B63A 5C44C 2E2JK 3HOWC 2XCQA 1EQRA 3H3VL 5IP7C 1WORA 4Q4ZA 2ZUFA 4KDDA 3MMLB 3S17C 3FKIK 2YU9C 3LAPA 4Y7NC 5IP7K 3GTKK 3TFHA 1TWHC 4A3LK 1I6HC 3HOVK 1TWAC 4KARA 1DD5A 1IQ0A 1EK8A 1O27A 3GEHA 3AH5A 1F93A 3FKIC 3S1NK 3T00A 2CFAB 3QX3A 2RH6A 1O2AA 4BLAA 5M5WK 3H0GA 1B4BA 2NVQC 4A3CK 2CFAA 2JA7K 4A3GK 3GTMK 4PABA 4J3NA 2R92K 1IE0A 1I6VA 3GTJK 4G7ZA 1XXCA 4QJVB 1WOSA 3JSTA 4A3BK 4BXXK 4DDQA 3ADAC 4BKWA 1C0AA 5M5YK 3GTKC 4GFQA 1O29A 1TWCC 4YG2A 4RMFA 3HOYK 1ISEA 4YFXA 4G0WA 5IOQA 5IOSA 1Y1VK 3M4OK 1IS1A 3A8IA 1WCMC 4LK0A 4Q5SA 2GSNA 4AYBL 2BE5A 5IYDK 1TWFA 1DCHA 1F9NA 2R7ZA 2E2HK 3BP8C 3GTQK 1J6VA 5IYDC 1SFOK 3L4KA 3CQZK 1J6XA 3HOZK 1WCMK 3L4JA 2R7ZC 2R93A 5IORA 5D4DA 2GSUA 3S1NC 2PHCB 5M3MK 1I3QC 4C3HK 3FHZA 1TWAA 5IP9K 3HKZD 4XCHA 3HOXK 3GTOK 1RU0A 3GIRA 5C4XK 4A3FC 4KB2A 1I50A 3RZDC 4A3MK 1J98A 1SFOC 1VJEA 1EI6A 5E68A 1Y1WC 2W7VA 1TWHK 1Y1WA 2ZUEA 4C3IK 4BY1C 2YU9K 1Y1VC 2WAQL 3AD7C 1JQWA 3SZZA 4KN7A 4YFNA 5IYCK 2NVXC 3GDZA 1I3QA 4QJVA 1J6WA 4LQYA 2E2IA 3HOYC 3S2HK 1IL2A 1ZBSA 4ILDA 4P9SA 3HOWK 3A8KA 3OEPA 4O2DA 4X6AC 3RZOK 2FQOA 4WILA 4G0VA 2GAGC 5IYBK 3VA7A 2PA8L 3GTPA 4A3DC 2Y0SL 4ZH4A 5TMCA 4BY7C 4C45A 4A3EK 2VUMK 4BBSC 2A69A 3GTLC 1XZPA 4A3MC 4A3EC 2VUMC 4BBSK 3PO3K 1XZPB 4LR2A 3GTGC 1TWGK 3AD8C 2NVYK 3HOUC 3FOFA 1K83K 3S15C 3AQOA 1TWCA 1X31C 2GAHC 2V6TA 1XPPA 2KWAA 2O5JA 5FLMC 2A68A 5C4JK 5IYBC 1R9TA 5FJ8K 3G4AA 2PA8D 5C44K 3DXJA 1O28A 5CHPA 3S14C 2A6HA 4A3LC 1F7UA 4QIWD 5L46A 1YX2A 5JVOA 4KMAA 2JA8C 4XLPA 3GTMC 2D6FC 3S0XA 5IYCC 4FZBA 4KM8A 4OIQA 1I6HK 4G0UA 4A3DK 2YU9A 4OIPA 5TJ3A 3S1QK 2XCRB 1TWGC 2GSOA 3PO3C 3G4CA 1XZQB 4G7HA 3M3YK 4C2MK 1V5VA 3ERED 3I4NK 5CJ9A 1BDFA 1DCPA 2JA8K 4WJ4A 1O25A 2CW0A 3GTKA 1TWFC 3AD9C 2JA5C 4WJ3M 3HOVC 5IP9C 3GEIA 4A3KK 2R93C 1SMYA 1HI9A 3S16C 3S14K 2JA5K 1INNA 1WQFA 1BGWA 4KMUA 4A93K 3GTMA 1JOEA 5TMFA 1TWGA 5FLMK 2NVYA 2NVTK 1HQMA 5HL8A 4A3BC 4BXXC 2Y0SD 5C4XC 1K83A 1WQGA 4MEYA 3N3YA 4GTAA 3I4MK 4Y52K 1R9TC 2PPBA 2NVQK 2FQTA 2NVTC 2WB1D 1VRQC 4KAWX 3EQLA 1PJ7A 2R92C 3N0CA 5IOTA 2O5IA 2JA6K 1O26A 2RGRA 1O2FB 1AB4A 1BS2A 2B63C 4A3FK 3FKIA 1SFOA 2P8TA 4AYBD 4A3JK 1WCMA 3S2DC 1KQ4A 4LJZA 4MQ9A 3OREA 3S1MK 3PO2C 1WSRA 1IW7A 3V4GA 2JH3A 3H3VD 5M5XK 4A3JC 3Q3QA 2WAQD 3TTGA 4KM9A 4KASA 4C3IC 3S1MC 3H0GK 4GTBA 3GTOA 1USMA 2JA7A 1I50K 4LK1A 2E2JC 3CAGA 3M4OC 4MEXA 3S1QC 4FM9A 5C3EC 4XSXA 4JK1A 3GTPC 3GTGA 1VGXA 4C2MC 1EFWA 4Y52C 3PO2K 5JFEA 2PMZD 2P5MA 2V6SA 3HOUK 3S1RK 4QIWL 3H0GC 4GTDA 4AH6A 1O24A 4OIOA 1I3QK 2NVXK 1WSVA 4C3JC 1F7VA 2E2IK 3GTQA 2E2HA 5C4JC 3I4NC 4GTLA 3CQZA 1G51A 1XXBA 4BY1K 3HKZL 4XLNA 1JVIA 3WODA
chains in the Genus database with same CATH topology
3CQZC 3GTOC 3HOVC 5IP9C 2PMZL 1TWHK 4Y7NK 4C3IK 5C44C 4A3KK 2E2JK 4BY1C 2YU9K 2R93C 1SMYA 1Y1VC 2WAQL 1TWAK 3GTJC 3HOWC 4KN7A 3S16C 3S14K 3H3VL 2JA5K 4YFNA 5IP7C 4A3IC 5IYCK 3GTLK 2NVXC 4KMUA 4A93K 4KN4A 5TMFA 4Q4ZA 4QJVA 1K83C 5FLMK 3HOYC 3S17C 3FKIK 2NVTK 1HQMA 1YNNA 2YU9C 4X6AK 4A3BC 4BXXC 2Y0SD 3S2HK 5C4XC 4Y7NC 5IP7K 3GTKK 1TWHC 4MEYA 3S15K 4A3LK 1I6HC 3HOVK 1TWAC 3HOWK 3I4MK 4Y52K 1R9TC 1Y1WK 4X6AC 2PPBA 2B63K 2NVQK 3RZOK 3FKIC 2WB1D 2NVTC 5IYBK 3EQLA 2PA8L 3K7AK 3S1NK 2Y0SL 4NOIA 2R92C 4A3DC 4ZH4A 5TMCA 3HOZC 4BY7C 4A3EK 2VUMK 4BBSC 2O5IA 4C3JK 2A69A 2A6EA 5M5WK 4A3CC 2E2HC 2JA6K 3GTQC 3GTLC 2NVQC 3RZOC 4A3CK 4A3MC 4A3IK 2JA7K 4A3EC 2VUMC 4A3GK 3GTMK 3PO3K 4BBSK 2R92K 3GTGC 1I6VA 3GTJK 3S16K 4LLGA 4G7ZA 1TWGK 2B63C 2NVYK 4QJVB 4A3FK 3HOUC 3M3YC 4A3BK 4BXXK 4AYBD 4A3JK 3HOXC 3S2DC 1K83K 3S15C 4LJZA 4MQ9A 5M5YK 3GTGK 3S1RC 3GTKC 3S1MK 3PO2C 1XPPA 1IW7A 1TWCC 4YG2A 4BBRK 2O5JA 2WB1L 1ZYRA 2A68A 5FLMC 3HOYK 4YFXA 5C4JK 3H3VD 5C3EK 3GTPK 2E2IC 5M5XK 5IYBC 1YNJA 4A3JC 5FJ8K 2WAQD 1Y1VK 2PA8D 3M4OK 5C44K 3DXJA 4A3KC 3I4MC 3S1MC 4Q5SA 1WCMC 3H0GK 4LK0A 3S14C 2A6HA 4AYBL 4A3LC 2BE5A 5IYDK 4OINA 4QIWD 1I50K 4LK1A 2E2JC 3S2HC 2NVYC 3M4OC 1I50C 4MEXA 3S1QC 2E2HK 2JA6C 3GTQK 5IYDC 1SFOK 2JA8C 3S17K 5C3EC 4XSXA 4JK1A 3GTPC 3CQZK 4G7OA 4XLPA 3GTMC 3HOZK 1WCMK 2R7ZC 3K7AC 1TWCK 5IYCC 4Y52C 5D4DA 3PO2K 3RZDK 4OIQA 4BY7K 1I6HK 3S1NC 4A3DK 4BBRC 5M3MK 2PMZD 4OIPA 3S1QK 1I3QC 4C3HK 1R9TK 3HOUK 5M3FK 1TWGC 3S1RK 5IP9K 3HKZD 3HOXK 3S2DK 3GTOK 4QIWL 3PO3C 3H0GC 5C4XK 4G7HA 4A3FC 4OIOA 4C2MK 1I3QK 1TWFK 2NVXK 3M3YK 4A93C 4GZYA 4OIRA 2E2IK 2R7ZK 3I4NK 5C4JC 3RZDC 3I4NC 1BDFA 4A3MK 1SFOC 2JA8K 2JA7C 4A3GC 2CW0A 1TWFC 4XSZA 3HKZL 4YFKA 4XLNA 1Y1WC 4BY1K 2R93K 3WODA 2JA5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ C;  3GTO C;  3HOV C;  5IP9 C;  2PMZ L;  1TWH K;  4Y7N K;  4C3I K;  5C44 C;  4A3K K;  2E2J K;  4BY1 C;  2YU9 K;  2R93 C;  1SMY A;  1Y1V C;  2WAQ L;  1TWA K;  3GTJ C;  3HOW C;  4KN7 A;  3S16 C;  3S14 K;  3H3V L;  2JA5 K;  4YFN A;  5IP7 C;  4A3I C;  5IYC K;  3GTL K;  2NVX C;  4KMU A;  4A93 K;  4KN4 A;  5TMF A;  4Q4Z A;  4QJV A;  1K83 C;  5FLM K;  3HOY C;  3S17 C;  3FKI K;  2NVT K;  1HQM A;  1YNN A;  2YU9 C;  4X6A K;  4A3B C;  4BXX C;  2Y0S D;  3S2H K;  5C4X C;  4Y7N C;  5IP7 K;  3GTK K;  1TWH C;  4MEY A;  3S15 K;  4A3L K;  1I6H C;  3HOV K;  1TWA C;  3HOW K;  3I4M K;  4Y52 K;  1R9T C;  1Y1W K;  4X6A C;  2PPB A;  2B63 K;  2NVQ K;  3RZO K;  3FKI C;  2WB1 D;  2NVT C;  5IYB K;  3EQL A;  2PA8 L;  3K7A K;  3S1N K;  2Y0S L;  4NOI A;  2R92 C;  4A3D C;  4ZH4 A;  5TMC A;  3HOZ C;  4BY7 C;  4A3E K;  2VUM K;  4BBS C;  2O5I A;  4C3J K;  2A69 A;  2A6E A;  5M5W K;  4A3C C;  2E2H C;  2JA6 K;  3GTQ C;  3GTL C;  2NVQ C;  3RZO C;  4A3C K;  4A3M C;  4A3I K;  2JA7 K;  4A3E C;  2VUM C;  4A3G K;  3GTM K;  3PO3 K;  4BBS K;  2R92 K;  3GTG C;  1I6V A;  3GTJ K;  3S16 K;  4LLG A;  4G7Z A;  1TWG K;  2B63 C;  2NVY K;  4QJV B;  4A3F K;  3HOU C;  3M3Y C;  4A3B K;  4BXX K;  4AYB D;  4A3J K;  3HOX C;  3S2D C;  1K83 K;  3S15 C;  4LJZ A;  4MQ9 A;  5M5Y K;  3GTG K;  3S1R C;  3GTK C;  3S1M K;  3PO2 C;  1XPP A;  1IW7 A;  1TWC C;  4YG2 A;  4BBR K;  2O5J A;  2WB1 L;  1ZYR A;  2A68 A;  5FLM C;  3HOY K;  4YFX A;  5C4J K;  3H3V D;  5C3E K;  3GTP K;  2E2I C;  5M5X K;  5IYB C;  1YNJ A;  4A3J C;  5FJ8 K;  2WAQ D;  1Y1V K;  2PA8 D;  3M4O K;  5C44 K;  3DXJ A;  4A3K C;  3I4M C;  3S1M C;  4Q5S A;  1WCM C;  3H0G K;  4LK0 A;  3S14 C;  2A6H A;  4AYB L;  4A3L C;  2BE5 A;  5IYD K;  4OIN A;  4QIW D;  1I50 K;  4LK1 A;  2E2J C;  3S2H C;  2NVY C;  3M4O C;  1I50 C;  4MEX A;  3S1Q C;  2E2H K;  2JA6 C;  3GTQ K;  5IYD C;  1SFO K;  2JA8 C;  3S17 K;  5C3E C;  4XSX A;  4JK1 A;  3GTP C;  3CQZ K;  4G7O A;  4XLP A;  3GTM C;  3HOZ K;  1WCM K;  2R7Z C;  3K7A C;  1TWC K;  5IYC C;  4Y52 C;  5D4D A;  3PO2 K;  3RZD K;  4OIQ A;  4BY7 K;  1I6H K;  3S1N C;  4A3D K;  4BBR C;  5M3M K;  2PMZ D;  4OIP A;  3S1Q K;  1I3Q C;  4C3H K;  1R9T K;  3HOU K;  5M3F K;  1TWG C;  3S1R K;  5IP9 K;  3HKZ D;  3HOX K;  3S2D K;  3GTO K;  4QIW L;  3PO3 C;  3H0G C;  5C4X K;  4G7H A;  4A3F C;  4OIO A;  4C2M K;  1I3Q K;  1TWF K;  2NVX K;  3M3Y K;  4A93 C;  4GZY A;  4OIR A;  2E2I K;  2R7Z K;  3I4N K;  5C4J C;  3RZD C;  3I4N C;  1BDF A;  4A3M K;  1SFO C;  2JA8 K;  2JA7 C;  4A3G C;  2CW0 A;  1TWF C;  4XSZ A;  3HKZ L;  4YFK A;  4XLN A;  1Y1W C;  4BY1 K;  2R93 K;  3WOD A;  2JA5 C; 
#chains in the Genus database with same CATH topology
 1WOO A;  3CQZ C;  4Y7N K;  4C3H C;  4GT9 A;  1PJ5 A;  1TWA K;  3GTJ C;  2VUM A;  1EH1 A;  2Y3P A;  2JA6 A;  4A3I C;  1ZQ1 C;  3GTL K;  4KN4 A;  1BJT A;  1K83 C;  1WQH A;  1YNN A;  4GTF A;  4X6A K;  1YCL A;  4P5B A;  3S15 K;  3NUH A;  2EBB A;  4KMD A;  3GEE A;  1TWH A;  1Y1W K;  5EGE A;  2B63 K;  4KB4 A;  3K7A K;  4NOI A;  3HOZ C;  4C3J K;  1WIH A;  2A6E A;  3TFJ A;  4A3C C;  2E2H C;  3GTQ C;  3RZO C;  3FOE A;  3AQP A;  4A3I K;  3T01 A;  4LOW A;  1ZVU A;  3OPF A;  3S16 K;  4LLG A;  1IBA A;  4KMH A;  1XZQ A;  2V6U A;  3M3Y C;  3LPX A;  4PAA A;  1ZXO A;  4KC6 A;  1GE9 A;  3HOX C;  3GTG K;  3S1R C;  3IPJ A;  1UV7 A;  4BBR K;  2WB1 L;  1ZYR A;  5C3E K;  3GTP K;  2E2I C;  1XXA A;  1PJ6 A;  1YNJ A;  3T02 A;  4A3K C;  1DCO A;  3I4M C;  4M1X A;  3HXA A;  3N0B A;  2R92 A;  2NVX A;  4OIN A;  3GTJ A;  3S2H C;  2NVY C;  1I50 C;  1WOP A;  3GSI A;  2JA6 C;  1VLO A;  4P5A A;  3S17 K;  4G7O A;  1O2B A;  3K7A C;  1TWC K;  3LAJ A;  3RZD K;  4BY7 K;  5EGH A;  4BBR C;  1R9T K;  1Y1V A;  2ZFZ A;  4KAT A;  5M3F K;  4BLB A;  4GTC A;  2JA5 A;  3S2D K;  1VH2 A;  3GTL A;  4GZY A;  1TWF K;  4A93 C;  3TFI A;  4OIR A;  1USO A;  3SZY A;  4GTE A;  2R7Z K;  3BP3 A;  1B4A A;  1L0W A;  2JA7 C;  4A3G C;  2XCO A;  3BUE A;  4YFK A;  4XSZ A;  2R93 K;  3GTO C;  3A8J A;  2PMZ L;  2B63 A;  5C44 C;  2E2J K;  3HOW C;  2XCQ A;  1EQR A;  3H3V L;  5IP7 C;  1WOR A;  4Q4Z A;  2ZUF A;  4KDD A;  3MML B;  3S17 C;  3FKI K;  2YU9 C;  3LAP A;  4Y7N C;  5IP7 K;  3GTK K;  3TFH A;  1TWH C;  4A3L K;  1I6H C;  3HOV K;  1TWA C;  4KAR A;  1DD5 A;  1IQ0 A;  1EK8 A;  1O27 A;  3GEH A;  3AH5 A;  1F93 A;  3FKI C;  3S1N K;  3T00 A;  2CFA B;  3QX3 A;  2RH6 A;  1O2A A;  4BLA A;  5M5W K;  3H0G A;  1B4B A;  2NVQ C;  4A3C K;  2CFA A;  2JA7 K;  4A3G K;  3GTM K;  4PAB A;  4J3N A;  2R92 K;  1IE0 A;  1I6V A;  3GTJ K;  4G7Z A;  1XXC A;  4QJV B;  1WOS A;  3JST A;  4A3B K;  4BXX K;  4DDQ A;  3ADA C;  4BKW A;  1C0A A;  5M5Y K;  3GTK C;  4GFQ A;  1O29 A;  1TWC C;  4YG2 A;  4RMF A;  3HOY K;  1ISE A;  4YFX A;  4G0W A;  5IOQ A;  5IOS A;  1Y1V K;  3M4O K;  1IS1 A;  3A8I A;  1WCM C;  4LK0 A;  4Q5S A;  2GSN A;  4AYB L;  2BE5 A;  5IYD K;  1TWF A;  1DCH A;  1F9N A;  2R7Z A;  2E2H K;  3BP8 C;  3GTQ K;  1J6V A;  5IYD C;  1SFO K;  3L4K A;  3CQZ K;  1J6X A;  3HOZ K;  1WCM K;  3L4J A;  2R7Z C;  2R93 A;  5IOR A;  5D4D A;  2GSU A;  3S1N C;  2PHC B;  5M3M K;  1I3Q C;  4C3H K;  3FHZ A;  1TWA A;  5IP9 K;  3HKZ D;  4XCH A;  3HOX K;  3GTO K;  1RU0 A;  3GIR A;  5C4X K;  4A3F C;  4KB2 A;  1I50 A;  3RZD C;  4A3M K;  1J98 A;  1SFO C;  1VJE A;  1EI6 A;  5E68 A;  1Y1W C;  2W7V A;  1TWH K;  1Y1W A;  2ZUE A;  4C3I K;  4BY1 C;  2YU9 K;  1Y1V C;  2WAQ L;  3AD7 C;  1JQW A;  3SZZ A;  4KN7 A;  4YFN A;  5IYC K;  2NVX C;  3GDZ A;  1I3Q A;  4QJV A;  1J6W A;  4LQY A;  2E2I A;  3HOY C;  3S2H K;  1IL2 A;  1ZBS A;  4ILD A;  4P9S A;  3HOW K;  3A8K A;  3OEP A;  4O2D A;  4X6A C;  3RZO K;  2FQO A;  4WIL A;  4G0V A;  2GAG C;  5IYB K;  3VA7 A;  2PA8 L;  3GTP A;  4A3D C;  2Y0S L;  4ZH4 A;  5TMC A;  4BY7 C;  4C45 A;  4A3E K;  2VUM K;  4BBS C;  2A69 A;  3GTL C;  1XZP A;  4A3M C;  4A3E C;  2VUM C;  4BBS K;  3PO3 K;  1XZP B;  4LR2 A;  3GTG C;  1TWG K;  3AD8 C;  2NVY K;  3HOU C;  3FOF A;  1K83 K;  3S15 C;  3AQO A;  1TWC A;  1X31 C;  2GAH C;  2V6T A;  1XPP A;  2KWA A;  2O5J A;  5FLM C;  2A68 A;  5C4J K;  5IYB C;  1R9T A;  5FJ8 K;  3G4A A;  2PA8 D;  5C44 K;  3DXJ A;  1O28 A;  5CHP A;  3S14 C;  2A6H A;  4A3L C;  1F7U A;  4QIW D;  5L46 A;  1YX2 A;  5JVO A;  4KMA A;  2JA8 C;  4XLP A;  3GTM C;  2D6F C;  3S0X A;  5IYC C;  4FZB A;  4KM8 A;  4OIQ A;  1I6H K;  4G0U A;  4A3D K;  2YU9 A;  4OIP A;  5TJ3 A;  3S1Q K;  2XCR B;  1TWG C;  2GSO A;  3PO3 C;  3G4C A;  1XZQ B;  4G7H A;  3M3Y K;  4C2M K;  1V5V A;  3ERE D;  3I4N K;  5CJ9 A;  1BDF A;  1DCP A;  2JA8 K;  4WJ4 A;  1O25 A;  2CW0 A;  3GTK A;  1TWF C;  3AD9 C;  2JA5 C;  4WJ3 M;  3HOV C;  5IP9 C;  3GEI A;  4A3K K;  2R93 C;  1SMY A;  1HI9 A;  3S16 C;  3S14 K;  2JA5 K;  1INN A;  1WQF A;  1BGW A;  4KMU A;  4A93 K;  3GTM A;  1JOE A;  5TMF A;  1TWG A;  5FLM K;  2NVY A;  2NVT K;  1HQM A;  5HL8 A;  4A3B C;  4BXX C;  2Y0S D;  5C4X C;  1K83 A;  1WQG A;  4MEY A;  3N3Y A;  4GTA A;  3I4M K;  4Y52 K;  1R9T C;  2PPB A;  2NVQ K;  2FQT A;  2NVT C;  2WB1 D;  1VRQ C;  4KAW X;  3EQL A;  1PJ7 A;  2R92 C;  3N0C A;  5IOT A;  2O5I A;  2JA6 K;  1O26 A;  2RGR A;  1O2F B;  1AB4 A;  1BS2 A;  2B63 C;  4A3F K;  3FKI A;  1SFO A;  2P8T A;  4AYB D;  4A3J K;  1WCM A;  3S2D C;  1KQ4 A;  4LJZ A;  4MQ9 A;  3ORE A;  3S1M K;  3PO2 C;  1WSR A;  1IW7 A;  3V4G A;  2JH3 A;  3H3V D;  5M5X K;  4A3J C;  3Q3Q A;  2WAQ D;  3TTG A;  4KM9 A;  4KAS A;  4C3I C;  3S1M C;  3H0G K;  4GTB A;  3GTO A;  1USM A;  2JA7 A;  1I50 K;  4LK1 A;  2E2J C;  3CAG A;  3M4O C;  4MEX A;  3S1Q C;  4FM9 A;  5C3E C;  4XSX A;  4JK1 A;  3GTP C;  3GTG A;  1VGX A;  4C2M C;  1EFW A;  4Y52 C;  3PO2 K;  5JFE A;  2PMZ D;  2P5M A;  2V6S A;  3HOU K;  3S1R K;  4QIW L;  3H0G C;  4GTD A;  4AH6 A;  1O24 A;  4OIO A;  1I3Q K;  2NVX K;  1WSV A;  4C3J C;  1F7V A;  2E2I K;  3GTQ A;  2E2H A;  5C4J C;  3I4N C;  4GTL A;  3CQZ A;  1G51 A;  1XXB A;  4BY1 K;  3HKZ L;  4XLN A;  1JVI A;  3WOD A; 
#chains in the Genus database with same CATH homology
 3CQZ C;  3GTO C;  3HOV C;  5IP9 C;  2PMZ L;  1TWH K;  4Y7N K;  4C3I K;  5C44 C;  4A3K K;  2E2J K;  4BY1 C;  2YU9 K;  2R93 C;  1SMY A;  1Y1V C;  2WAQ L;  1TWA K;  3GTJ C;  3HOW C;  4KN7 A;  3S16 C;  3S14 K;  3H3V L;  2JA5 K;  4YFN A;  5IP7 C;  4A3I C;  5IYC K;  3GTL K;  2NVX C;  4KMU A;  4A93 K;  4KN4 A;  5TMF A;  4Q4Z A;  4QJV A;  1K83 C;  5FLM K;  3HOY C;  3S17 C;  3FKI K;  2NVT K;  1HQM A;  1YNN A;  2YU9 C;  4X6A K;  4A3B C;  4BXX C;  2Y0S D;  3S2H K;  5C4X C;  4Y7N C;  5IP7 K;  3GTK K;  1TWH C;  4MEY A;  3S15 K;  4A3L K;  1I6H C;  3HOV K;  1TWA C;  3HOW K;  3I4M K;  4Y52 K;  1R9T C;  1Y1W K;  4X6A C;  2PPB A;  2B63 K;  2NVQ K;  3RZO K;  3FKI C;  2WB1 D;  2NVT C;  5IYB K;  3EQL A;  2PA8 L;  3K7A K;  3S1N K;  2Y0S L;  4NOI A;  2R92 C;  4A3D C;  4ZH4 A;  5TMC A;  3HOZ C;  4BY7 C;  4A3E K;  2VUM K;  4BBS C;  2O5I A;  4C3J K;  2A69 A;  2A6E A;  5M5W K;  4A3C C;  2E2H C;  2JA6 K;  3GTQ C;  3GTL C;  2NVQ C;  3RZO C;  4A3C K;  4A3M C;  4A3I K;  2JA7 K;  4A3E C;  2VUM C;  4A3G K;  3GTM K;  3PO3 K;  4BBS K;  2R92 K;  3GTG C;  1I6V A;  3GTJ K;  3S16 K;  4LLG A;  4G7Z A;  1TWG K;  2B63 C;  2NVY K;  4QJV B;  4A3F K;  3HOU C;  3M3Y C;  4A3B K;  4BXX K;  4AYB D;  4A3J K;  3HOX C;  3S2D C;  1K83 K;  3S15 C;  4LJZ A;  4MQ9 A;  5M5Y K;  3GTG K;  3S1R C;  3GTK C;  3S1M K;  3PO2 C;  1XPP A;  1IW7 A;  1TWC C;  4YG2 A;  4BBR K;  2O5J A;  2WB1 L;  1ZYR A;  2A68 A;  5FLM C;  3HOY K;  4YFX A;  5C4J K;  3H3V D;  5C3E K;  3GTP K;  2E2I C;  5M5X K;  5IYB C;  1YNJ A;  4A3J C;  5FJ8 K;  2WAQ D;  1Y1V K;  2PA8 D;  3M4O K;  5C44 K;  3DXJ A;  4A3K C;  3I4M C;  3S1M C;  4Q5S A;  1WCM C;  3H0G K;  4LK0 A;  3S14 C;  2A6H A;  4AYB L;  4A3L C;  2BE5 A;  5IYD K;  4OIN A;  4QIW D;  1I50 K;  4LK1 A;  2E2J C;  3S2H C;  2NVY C;  3M4O C;  1I50 C;  4MEX A;  3S1Q C;  2E2H K;  2JA6 C;  3GTQ K;  5IYD C;  1SFO K;  2JA8 C;  3S17 K;  5C3E C;  4XSX A;  4JK1 A;  3GTP C;  3CQZ K;  4G7O A;  4XLP A;  3GTM C;  3HOZ K;  1WCM K;  2R7Z C;  3K7A C;  1TWC K;  5IYC C;  4Y52 C;  5D4D A;  3PO2 K;  3RZD K;  4OIQ A;  4BY7 K;  1I6H K;  3S1N C;  4A3D K;  4BBR C;  5M3M K;  2PMZ D;  4OIP A;  3S1Q K;  1I3Q C;  4C3H K;  1R9T K;  3HOU K;  5M3F K;  1TWG C;  3S1R K;  5IP9 K;  3HKZ D;  3HOX K;  3S2D K;  3GTO K;  4QIW L;  3PO3 C;  3H0G C;  5C4X K;  4G7H A;  4A3F C;  4OIO A;  4C2M K;  1I3Q K;  1TWF K;  2NVX K;  3M3Y K;  4A93 C;  4GZY A;  4OIR A;  2E2I K;  2R7Z K;  3I4N K;  5C4J C;  3RZD C;  3I4N C;  1BDF A;  4A3M K;  1SFO C;  2JA8 K;  2JA7 C;  4A3G C;  2CW0 A;  1TWF C;  4XSZ A;  3HKZ L;  4YFK A;  4XLN A;  1Y1W C;  4BY1 K;  2R93 K;  3WOD A;  2JA5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...