3H47A

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 71
structure length 201
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h47A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h47A02
4U0DA 3G0VA 4J93A 2XXMA 2WLVB 3NTEA 1M9YC 1M9DC 1M9FC 1M9EC 4HTWA 4DGAC 1QRJA 2PWOA 2KODA 3DS3A 2X83A 5DCKA 3DPHA 1A43A 4E92A 4XFYA 1A8OA 2XV6A 2V4XA 2GONA 4XFZA 5HGNA 2JYGA 4LQWC 2XGUA 4XROA 2JYLA 2M8LA 2X82A 4PH2A 3MGEA 4XRQA 4XFXA 1G03A 1L6NA 2ONTA 3DTJA 4U0AA 4B4NA 3G26A 3DS5A 4QNBA 3VRLC 3G28A 1M9XC 4DGEC 5HGOA 1AUMA 4U0FA 2L6EA 3G1IA 4PH1A 5JPAA 2PXRC 2GOLB 4INBA 4U0BA 1GWPA 2XT1A 3BP9A 3DS4A 2M8NA 2JPRA 2Y4ZA 2KGFA 2WLVA 5HGMA 1EM9A 4NX4C 4WYMA 3DS2A 4COPA 4PH3A 3G21A 2XGYA 3H4EA 1E6JP 5HGKA 2EIAA 4COCA 4U0EA 1AFVA 1D1DA 1EOQA 2LF4A 4IPYA 5HGLA 1P7NA 1U7KA 3P05A 4E91A 4U0CA 3G29A 3G1GA 1M9CC 1BAJA 5I4TG 4M0IA 3DS1A 2BUOA 2XDEA 3H47A 2PWMA 3LRYA 2XGVA 4PH0A 3DS0A 2X2DD 1EIAA 1AK4C 2M8PA 2JO0A
chains in the Genus database with same CATH superfamily
4BPGA 3G0VA 4J93A 2JBGA 2EG5A 2JGPA 2MD9A 1M9EC 4DGAC 4BPFA 3B5IA 2KODA 1IMPA 2V4XA 4XFZA 2L22A 4LQWC 3EJDA 2M8LA 2FQ1A 2MR7A 3E2DA 2K0DX 5BS1A 1CEIA 2DNWA 2GDWA 1JJ2O 1L6NA 2CG5B 2GZFA 3H0DA 4B4NA 3G71P 2PNGA 2KGDA 3CCJP 4H2WC 1VQLP 1HQBA 1VQ6P 5F2OA 4H2YC 4MRTC 4U0FA 2L6EA 2N6ZA 5EW5E 4PH1A 2AFDA 2QA4P 5JPAA 1VQKP 2XT1A 3DS4A 1L0HA 2KGFA 1RNIA 2GZGA 4WYMA 2K92A 3DS2A 4COPA 1X3OA 3H4EA 1OR5A 1E6JP 2EIAA 1UNKA 2GDYA 4U0EA 4COCA 1DNYA 1KD1Q 3Q20A 1ACPA 2L0QA 1QVFO 4IPYA 5F2KA 1P7NA 2MVUA 3CC4P 3CCVP 1VHNA 3HYBA 2EHSA 2FQ2A 3GZMA 1IUQA 1M9CC 1BAJA 4CA3A 2BUOA 2XDEA 1GXGA 2PWMA 4HKGA 3DS0A 2LKIA 1EIAA 1GPJA 2KOPA 1M6EX 5EJDA 2GZJA 2CGQA 2XXMA 1K30A 2KG9A 2NO8A 2DGYA 1QRJA 1K73Q 3DS3A 1NQ4A 2OTLP 1VQ9P 2GONA 4IZ6A 1M1KQ 2XGUA 2P9XA 2JYLA 1VQ5P 5BS2A 2JQ4A 2KOQA 2MF4A 2FAEA 1NJIQ 4U0AA 2ROQA 2JAZA 3RG6C 2LMLA 2K94A 3CMAP 2QEXP 1YJWP 2LTEA 2KORA 3VRLC 2PEQA 3G28A 1KLPA 5HGOA 3B4QA 2MVVA 2KGCA 4H2XC 3G1IA 2FADA 4R0MA 2AVAA 2KWLA 2PEMA 2OTJP 4INBA 2GYKA 2Y4ZA 3CCUP 1EM9A 2K2QA 1YHQP 3M1MA 4PH3A 2X2BA 1FR2A 1ZNVA 2MY5A 2L9FA 4GR6A 2FQ0A 2JU1A 3CC2P 3P05A 2Z44A 4E91A 4U0CA 1AF8A 2JU2A 1Q82Q 1KC8Q 2Z46A 4UHPB 2CQ8A 5I4TG 2PEJA 1YJNP 2LIUA 1MZ8A 3RG2A 2N50A 2Z45A 2VLOA 2M8PA 1QVGO 1Q86Q 4U0DA 2LL8A 2PEOA 2MR8A 3CXCO 2WLVB 1VQ4P 1M9YC 7CEIA 2AF8A 1M9FC 2OARA 1YIJP 1YJ9P 1ZMBA 2LPKA 2N5IA 5DCKA 3DPHA 1A43A 2PEKA 4E92A 2ERHA 3CMEP 2XV6A 3I56P 2JYGA 1RO2A 4XROA 3G4SP 2X82A 1F80D 2FHSC 3MGEA 2PENA 3U43A 4PWVB 1G03A 3GZLA 2ONTA 3LMOA 1VQMP 3DTJA 2XZ1C 1BXIA 3G26A 1HY8A 4QNBA 2GDXA 1M9XC 4DGEC 1AUMA 2E1MA 3CCSP 2N5HA 2PXRC 2GOLB 1GWPA 3EJEA 3BP9A 3CD6P 4GR2A 2JPRA 3GJNA 2WLVA 2XZ0D 5HGMA 1T8KA 3HZQA 4NX4C 2K0XA 3CCLP 3G21A 1VQNP 1W2BO 4PXHB 2BHVA 5HGKA 3CCRP 1AFVA 1D1DA 4QKOA 4NEOA 5HGLA 1U7KA 3NY7B 3WBHA 1VQ7P 2CWOA 2KOSA 2K93A 1K8AQ 2VSQA 1N8RQ 1VQ8P 3CCMP 5HV8A 3OW2O 2XGVA 4PH0A 1YITP 3CPWO 2K0YA 1AK4C 2FVEA 3I55P 2PY8A 3NTEA 1M9DC 2QNWA 3CCEP 1K9MQ 4HTWA 2PWOA 5F2NA 1KQSO 2X83A 3CE7A 2L4BA 2LOLA 4BPHA 4XFYA 2VLPA 1A8OA 1VQOP 5HGNA 2FVFA 2WPTA 2K5XA 1YI2P 4PH2A 1Z6MA 4XRQA 1Q81Q 1E0HA 1GXHA 2JB0A 4XFXA 1M90Q 2KGAA 2GZEA 2FACA 5KP7B 1RO0A 5CZDB 3DS5A 5KP8B 1Q7YQ 5KP6B 3CCQP 1UJZA 2EHTA 2EFJA 1M6NA 2M5RA 2LIWA 2KG8A 2N6YA 3GKLC 2KGEA 3G6EP 4U0BA 5HVCA 2PEIA 4DG9A 2VLNA 1VKUA 2M8NA 1S72P 2N98A 3EJBA 3CC7P 2KR5A 1EMVA 2KG6A 2XGYA 1VQPP 1L0IA 4F37A 2CNRA 1EOQA 2LF4A 1M74A 2KOOA 2FVAA 1IMQA 1AYIA 3G29A 3G1GA 2GZIA 2KW2A 2AFEA 4M0IA 3DS1A 3H47A 3LRYA 1DV5A 2X2DD 2VLQA 2JO0A
chains in the Genus database with same CATH topology
1QVGO 1Q86Q 4U0DA 3I55P 2PY8A 1M6EX 3G0VA 4J93A 2PEOA 3CXCO 2XXMA 2WLVB 1K30A 2EG5A 1VQ4P 3NTEA 1M9YC 1M9DC 3CCEP 1M9FC 2DGYA 1M9EC 4HTWA 4DGAC 2OARA 1YIJP 1YJ9P 1QRJA 2PWOA 1ZMBA 3B5IA 2KODA 5F2NA 3DS3A 1K73Q 1KQSO 2X83A 5DCKA 3DPHA 1A43A 2PEKA 4E92A 2OTLP 1VQ9P 4XFYA 3CMEP 1A8OA 2XV6A 1VQOP 2V4XA 2GONA 4XFZA 3I56P 5HGNA 2JYGA 1M1KQ 4LQWC 2XGUA 1RO2A 2P9XA 4XROA 2JYLA 3G4SP 2M8LA 2X82A 1VQ5P 5BS2A 3E2DA 1YI2P 4PH2A 5BS1A 3MGEA 4XRQA 1Q81Q 2PENA 4XFXA 1G03A 1JJ2O 1M90Q 1L6NA 2ONTA 1NJIQ 1VQMP 3DTJA 4U0AA 3H0DA 4B4NA 1RO0A 3RG6C 3G71P 2Z45A 3G26A 3DS5A 3CMAP 3CCJP 1Q7YQ 2QEXP 1YJWP 1VQLP 3CCQP 1VQ6P 5F2OA 1K9MQ 4QNBA 3VRLC 2PEQA 3G28A 1M9XC 4DGEC 5HGOA 1AUMA 4U0FA 2EFJA 1M6NA 2L6EA 3G1IA 2E1MA 4PH1A 3CCSP 2QA4P 5JPAA 2PXRC 1VQKP 2GOLB 2PEMA 2OTJP 3G6EP 4INBA 4U0BA 1GWPA 2XT1A 3BP9A 2PEIA 3CD6P 3DS4A 2M8NA 4GR2A 2JPRA 2Y4ZA 1S72P 2KGFA 2WLVA 3CCUP 5HGMA 1EM9A 1RNIA 3HZQA 4NX4C 3CC7P 3CCLP 4WYMA 1YHQP 3DS2A 3M1MA 4PH3A 4COPA 3G21A 1VQNP 1W2BO 2XGYA 3H4EA 1VQPP 2BHVA 1E6JP 5HGKA 3CCRP 2EIAA 4COCA 4U0EA 1AFVA 1D1DA 1KD1Q 1EOQA 3Q20A 4GR6A 1QVFO 2LF4A 3CC2P 1M74A 4IPYA 5F2KA 5HGLA 1P7NA 1U7KA 3P05A 2Z44A 4E91A 4U0CA 3CC4P 3CCVP 3G29A 1Q82Q 3G1GA 3WBHA 3HYBA 1VQ7P 1KC8Q 2Z46A 1IUQA 1M9CC 2CWOA 1BAJA 1K8AQ 5I4TG 4M0IA 1N8RQ 3DS1A 2PEJA 2BUOA 2XDEA 1VQ8P 3CCMP 1YJNP 3H47A 2PWMA 3LRYA 3OW2O 2XGVA 4PH0A 1YITP 3DS0A 2X2DD 3CPWO 1EIAA 1AK4C 2M8PA 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0D A;  3G0V A;  4J93 A;  2XXM A;  2WLV B;  3NTE A;  1M9Y C;  1M9D C;  1M9F C;  1M9E C;  4HTW A;  4DGA C;  1QRJ A;  2PWO A;  2KOD A;  3DS3 A;  2X83 A;  5DCK A;  3DPH A;  1A43 A;  4E92 A;  4XFY A;  1A8O A;  2XV6 A;  2V4X A;  2GON A;  4XFZ A;  5HGN A;  2JYG A;  4LQW C;  2XGU A;  4XRO A;  2JYL A;  2M8L A;  2X82 A;  4PH2 A;  3MGE A;  4XRQ A;  4XFX A;  1G03 A;  1L6N A;  2ONT A;  3DTJ A;  4U0A A;  4B4N A;  3G26 A;  3DS5 A;  4QNB A;  3VRL C;  3G28 A;  1M9X C;  4DGE C;  5HGO A;  1AUM A;  4U0F A;  2L6E A;  3G1I A;  4PH1 A;  5JPA A;  2PXR C;  2GOL B;  4INB A;  4U0B A;  1GWP A;  2XT1 A;  3BP9 A;  3DS4 A;  2M8N A;  2JPR A;  2Y4Z A;  2KGF A;  2WLV A;  5HGM A;  1EM9 A;  4NX4 C;  4WYM A;  3DS2 A;  4COP A;  4PH3 A;  3G21 A;  2XGY A;  3H4E A;  1E6J P;  5HGK A;  2EIA A;  4COC A;  4U0E A;  1AFV A;  1D1D A;  1EOQ A;  2LF4 A;  4IPY A;  5HGL A;  1P7N A;  1U7K A;  3P05 A;  4E91 A;  4U0C A;  3G29 A;  3G1G A;  1M9C C;  1BAJ A;  5I4T G;  4M0I A;  3DS1 A;  2BUO A;  2XDE A;  3H47 A;  2PWM A;  3LRY A;  2XGV A;  4PH0 A;  3DS0 A;  2X2D D;  1EIA A;  1AK4 C;  2M8P A;  2JO0 A; 
#chains in the Genus database with same CATH topology
 4BPG A;  3G0V A;  4J93 A;  2JBG A;  2EG5 A;  2JGP A;  2MD9 A;  1M9E C;  4DGA C;  4BPF A;  3B5I A;  2KOD A;  1IMP A;  2V4X A;  4XFZ A;  2L22 A;  4LQW C;  3EJD A;  2M8L A;  2FQ1 A;  2MR7 A;  3E2D A;  2K0D X;  5BS1 A;  1CEI A;  2DNW A;  2GDW A;  1JJ2 O;  1L6N A;  2CG5 B;  2GZF A;  3H0D A;  4B4N A;  3G71 P;  2PNG A;  2KGD A;  3CCJ P;  4H2W C;  1VQL P;  1HQB A;  1VQ6 P;  5F2O A;  4H2Y C;  4MRT C;  4U0F A;  2L6E A;  2N6Z A;  5EW5 E;  4PH1 A;  2AFD A;  2QA4 P;  5JPA A;  1VQK P;  2XT1 A;  3DS4 A;  1L0H A;  2KGF A;  1RNI A;  2GZG A;  4WYM A;  2K92 A;  3DS2 A;  4COP A;  1X3O A;  3H4E A;  1OR5 A;  1E6J P;  2EIA A;  1UNK A;  2GDY A;  4U0E A;  4COC A;  1DNY A;  1KD1 Q;  3Q20 A;  1ACP A;  2L0Q A;  1QVF O;  4IPY A;  5F2K A;  1P7N A;  2MVU A;  3CC4 P;  3CCV P;  1VHN A;  3HYB A;  2EHS A;  2FQ2 A;  3GZM A;  1IUQ A;  1M9C C;  1BAJ A;  4CA3 A;  2BUO A;  2XDE A;  1GXG A;  2PWM A;  4HKG A;  3DS0 A;  2LKI A;  1EIA A;  1GPJ A;  2KOP A;  1M6E X;  5EJD A;  2GZJ A;  2CGQ A;  2XXM A;  1K30 A;  2KG9 A;  2NO8 A;  2DGY A;  1QRJ A;  1K73 Q;  3DS3 A;  1NQ4 A;  2OTL P;  1VQ9 P;  2GON A;  4IZ6 A;  1M1K Q;  2XGU A;  2P9X A;  2JYL A;  1VQ5 P;  5BS2 A;  2JQ4 A;  2KOQ A;  2MF4 A;  2FAE A;  1NJI Q;  4U0A A;  2ROQ A;  2JAZ A;  3RG6 C;  2LML A;  2K94 A;  3CMA P;  2QEX P;  1YJW P;  2LTE A;  2KOR A;  3VRL C;  2PEQ A;  3G28 A;  1KLP A;  5HGO A;  3B4Q A;  2MVV A;  2KGC A;  4H2X C;  3G1I A;  2FAD A;  4R0M A;  2AVA A;  2KWL A;  2PEM A;  2OTJ P;  4INB A;  2GYK A;  2Y4Z A;  3CCU P;  1EM9 A;  2K2Q A;  1YHQ P;  3M1M A;  4PH3 A;  2X2B A;  1FR2 A;  1ZNV A;  2MY5 A;  2L9F A;  4GR6 A;  2FQ0 A;  2JU1 A;  3CC2 P;  3P05 A;  2Z44 A;  4E91 A;  4U0C A;  1AF8 A;  2JU2 A;  1Q82 Q;  1KC8 Q;  2Z46 A;  4UHP B;  2CQ8 A;  5I4T G;  2PEJ A;  1YJN P;  2LIU A;  1MZ8 A;  3RG2 A;  2N50 A;  2Z45 A;  2VLO A;  2M8P A;  1QVG O;  1Q86 Q;  4U0D A;  2LL8 A;  2PEO A;  2MR8 A;  3CXC O;  2WLV B;  1VQ4 P;  1M9Y C;  7CEI A;  2AF8 A;  1M9F C;  2OAR A;  1YIJ P;  1YJ9 P;  1ZMB A;  2LPK A;  2N5I A;  5DCK A;  3DPH A;  1A43 A;  2PEK A;  4E92 A;  2ERH A;  3CME P;  2XV6 A;  3I56 P;  2JYG A;  1RO2 A;  4XRO A;  3G4S P;  2X82 A;  1F80 D;  2FHS C;  3MGE A;  2PEN A;  3U43 A;  4PWV B;  1G03 A;  3GZL A;  2ONT A;  3LMO A;  1VQM P;  3DTJ A;  2XZ1 C;  1BXI A;  3G26 A;  1HY8 A;  4QNB A;  2GDX A;  1M9X C;  4DGE C;  1AUM A;  2E1M A;  3CCS P;  2N5H A;  2PXR C;  2GOL B;  1GWP A;  3EJE A;  3BP9 A;  3CD6 P;  4GR2 A;  2JPR A;  3GJN A;  2WLV A;  2XZ0 D;  5HGM A;  1T8K A;  3HZQ A;  4NX4 C;  2K0X A;  3CCL P;  3G21 A;  1VQN P;  1W2B O;  4PXH B;  2BHV A;  5HGK A;  3CCR P;  1AFV A;  1D1D A;  4QKO A;  4NEO A;  5HGL A;  1U7K A;  3NY7 B;  3WBH A;  1VQ7 P;  2CWO A;  2KOS A;  2K93 A;  1K8A Q;  2VSQ A;  1N8R Q;  1VQ8 P;  3CCM P;  5HV8 A;  3OW2 O;  2XGV A;  4PH0 A;  1YIT P;  3CPW O;  2K0Y A;  1AK4 C;  2FVE A;  3I55 P;  2PY8 A;  3NTE A;  1M9D C;  2QNW A;  3CCE P;  1K9M Q;  4HTW A;  2PWO A;  5F2N A;  1KQS O;  2X83 A;  3CE7 A;  2L4B A;  2LOL A;  4BPH A;  4XFY A;  2VLP A;  1A8O A;  1VQO P;  5HGN A;  2FVF A;  2WPT A;  2K5X A;  1YI2 P;  4PH2 A;  1Z6M A;  4XRQ A;  1Q81 Q;  1E0H A;  1GXH A;  2JB0 A;  4XFX A;  1M90 Q;  2KGA A;  2GZE A;  2FAC A;  5KP7 B;  1RO0 A;  5CZD B;  3DS5 A;  5KP8 B;  1Q7Y Q;  5KP6 B;  3CCQ P;  1UJZ A;  2EHT A;  2EFJ A;  1M6N A;  2M5R A;  2LIW A;  2KG8 A;  2N6Y A;  3GKL C;  2KGE A;  3G6E P;  4U0B A;  5HVC A;  2PEI A;  4DG9 A;  2VLN A;  1VKU A;  2M8N A;  1S72 P;  2N98 A;  3EJB A;  3CC7 P;  2KR5 A;  1EMV A;  2KG6 A;  2XGY A;  1VQP P;  1L0I A;  4F37 A;  2CNR A;  1EOQ A;  2LF4 A;  1M74 A;  2KOO A;  2FVA A;  1IMQ A;  1AYI A;  3G29 A;  3G1G A;  2GZI A;  2KW2 A;  2AFE A;  4M0I A;  3DS1 A;  3H47 A;  3LRY A;  1DV5 A;  2X2D D;  2VLQ A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 1QVG O;  1Q86 Q;  4U0D A;  3I55 P;  2PY8 A;  1M6E X;  3G0V A;  4J93 A;  2PEO A;  3CXC O;  2XXM A;  2WLV B;  1K30 A;  2EG5 A;  1VQ4 P;  3NTE A;  1M9Y C;  1M9D C;  3CCE P;  1M9F C;  2DGY A;  1M9E C;  4HTW A;  4DGA C;  2OAR A;  1YIJ P;  1YJ9 P;  1QRJ A;  2PWO A;  1ZMB A;  3B5I A;  2KOD A;  5F2N A;  3DS3 A;  1K73 Q;  1KQS O;  2X83 A;  5DCK A;  3DPH A;  1A43 A;  2PEK A;  4E92 A;  2OTL P;  1VQ9 P;  4XFY A;  3CME P;  1A8O A;  2XV6 A;  1VQO P;  2V4X A;  2GON A;  4XFZ A;  3I56 P;  5HGN A;  2JYG A;  1M1K Q;  4LQW C;  2XGU A;  1RO2 A;  2P9X A;  4XRO A;  2JYL A;  3G4S P;  2M8L A;  2X82 A;  1VQ5 P;  5BS2 A;  3E2D A;  1YI2 P;  4PH2 A;  5BS1 A;  3MGE A;  4XRQ A;  1Q81 Q;  2PEN A;  4XFX A;  1G03 A;  1JJ2 O;  1M90 Q;  1L6N A;  2ONT A;  1NJI Q;  1VQM P;  3DTJ A;  4U0A A;  3H0D A;  4B4N A;  1RO0 A;  3RG6 C;  3G71 P;  2Z45 A;  3G26 A;  3DS5 A;  3CMA P;  3CCJ P;  1Q7Y Q;  2QEX P;  1YJW P;  1VQL P;  3CCQ P;  1VQ6 P;  5F2O A;  1K9M Q;  4QNB A;  3VRL C;  2PEQ A;  3G28 A;  1M9X C;  4DGE C;  5HGO A;  1AUM A;  4U0F A;  2EFJ A;  1M6N A;  2L6E A;  3G1I A;  2E1M A;  4PH1 A;  3CCS P;  2QA4 P;  5JPA A;  2PXR C;  1VQK P;  2GOL B;  2PEM A;  2OTJ P;  3G6E P;  4INB A;  4U0B A;  1GWP A;  2XT1 A;  3BP9 A;  2PEI A;  3CD6 P;  3DS4 A;  2M8N A;  4GR2 A;  2JPR A;  2Y4Z A;  1S72 P;  2KGF A;  2WLV A;  3CCU P;  5HGM A;  1EM9 A;  1RNI A;  3HZQ A;  4NX4 C;  3CC7 P;  3CCL P;  4WYM A;  1YHQ P;  3DS2 A;  3M1M A;  4PH3 A;  4COP A;  3G21 A;  1VQN P;  1W2B O;  2XGY A;  3H4E A;  1VQP P;  2BHV A;  1E6J P;  5HGK A;  3CCR P;  2EIA A;  4COC A;  4U0E A;  1AFV A;  1D1D A;  1KD1 Q;  1EOQ A;  3Q20 A;  4GR6 A;  1QVF O;  2LF4 A;  3CC2 P;  1M74 A;  4IPY A;  5F2K A;  5HGL A;  1P7N A;  1U7K A;  3P05 A;  2Z44 A;  4E91 A;  4U0C A;  3CC4 P;  3CCV P;  3G29 A;  1Q82 Q;  3G1G A;  3WBH A;  3HYB A;  1VQ7 P;  1KC8 Q;  2Z46 A;  1IUQ A;  1M9C C;  2CWO A;  1BAJ A;  1K8A Q;  5I4T G;  4M0I A;  1N8R Q;  3DS1 A;  2PEJ A;  2BUO A;  2XDE A;  1VQ8 P;  3CCM P;  1YJN P;  3H47 A;  2PWM A;  3LRY A;  3OW2 O;  2XGV A;  4PH0 A;  1YIT P;  3DS0 A;  2X2D D;  3CPW O;  1EIA A;  1AK4 C;  2M8P A;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...