3H47A

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 71
structure length 201
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h47A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h47A02
1AFVA 2EIAA 2XT1A 1M9FC 2XXMA 3LRYA 1A8OA 2XDEA 4XROA 1G03A 2WLVA 4WYMA 2ONTA 2XV6A 4IPYA 5I4TG 3G0VA 3G26A 3MGEA 3DTJA 4PH2A 2XGYA 2X83A 4E92A 3DS1A 4U0BA 1L6NA 2M8PA 3P05A 2X82A 3DS4A 2XGVA 1EIAA 4U0CA 3G1GA 2PXRC 4B4NA 4U0DA 2JYGA 3NTEA 1EM9A 1M9YC 2L6EA 1AUMA 3H47A 2JPRA 4XFZA 4DGAC 4E91A 4XFXA 4LQWC 3DS2A 3G1IA 5DCKA 4U0EA 2PWMA 1U7KA 2M8NA 1M9CC 4M0IA 3BP9A 3G21A 2GONA 3H4EA 4XFYA 1EOQA 4HTWA 1AK4C 2JYLA 2JO0A 1D1DA 1A43A 4U0AA 4COPA 2X2DD 5HGOA 2BUOA 3DPHA 4QNBA 5HGLA 1M9EC 2GOLB 3DS3A 1QRJA 1GWPA 2KODA 2XGUA 3DS5A 2V4XA 4INBA 2KGFA 4XRQA 1M9XC 4PH0A 3VRLC 5JPAA 2Y4ZA 4NX4C 2M8LA 5HGMA 4U0FA 5HGNA 5HGKA 4DGEC 1BAJA 2WLVB 4COCA 4J93A 2PWOA 1M9DC 1P7NA 3G29A 4PH1A 3DS0A 1E6JP 4PH3A 3G28A 2LF4A
chains in the Genus database with same CATH superfamily
2XT1A 2LTEA 3LMOA 2KGDA 3LRYA 2AFEA 3CMAP 4XROA 2XV6A 2QA4P 2LIWA 2QEXP 1ZMBA 2N50A 2EG5A 1OR5A 2XZ0D 2VSQA 2GDYA 2KGEA 1UNKA 3P05A 2LOLA 3DS4A 5CZDB 4U0CA 3G1GA 4B4NA 2Z45A 2PEQA 2JYGA 1EM9A 1YJ9P 1HY8A 4HKGA 3CCUP 1AUMA 3CCMP 2QNWA 4XFZA 4XFXA 4R0MA 3DS2A 1KQSO 2JU1A 2KG9A 1DV5A 4NEOA 2GZIA 1W2BO 4M0IA 2VLQA 3G21A 3CCLP 4XFYA 1EOQA 2JO0A 3U43A 1D1DA 2KOQA 2JB0A 4COPA 5KP8B 3CCRP 3DPHA 3B4QA 5F2OA 3DS3A 2GOLB 1JJ2O 2FVFA 1KC8Q 1KLPA 2V4XA 1K73Q 2OARA 3CXCO 4XRQA 1T8KA 3CCEP 1IMPA 1KD1Q 2K0YA 5HGMA 4GR6A 3CCQP 5BS2A 2AFDA 2WLVB 1M1KQ 2PWOA 1AF8A 2KG8A 1YHQP 1M9DC 3GJNA 3G29A 1YJNP 2ROQA 2KGAA 1L0IA 1M9FC 2XXMA 2MD9A 2N5IA 1UJZA 3E2DA 4WYMA 2KR5A 1BXIA 3CCSP 2GZJA 2EHTA 3MGEA 2GDXA 1YI2P 2FADA 2KOOA 2FQ2A 4E92A 1Q7YQ 3Q20A 2PY8A 1E0HA 3CPWO 2LL8A 1VQ7P 2GYKA 1GXGA 3GKLC 3G6EP 4U0DA 2MR7A 4GR2A 4H2XC 1S72P 3I55P 3CC2P 2L6EA 1L0HA 2LMLA 2JPRA 1DNYA 1K9MQ 2OTJP 1AYIA 2GZGA 2CQ8A 4BPFA 1NJIQ 2M8NA 1M9CC 3BP9A 2CWOA 4HTWA 1AK4C 2JYLA 3CE7A 1A43A 5KP6B 1HQBA 4U0AA 2Z46A 1VQ6P 2PEMA 4QKOA 4DG9A 2KODA 2X2BA 3DS5A 5KP7B 2LIUA 1Q81Q 3M1MA 2FAEA 1M90Q 1M6EX 4NX4C 2M8LA 4PWVB 1VQKP 4DGEC 1GPJA 1BAJA 2N98A 2JBGA 1VHNA 4PH1A 3DS0A 2LF4A 1FR2A 4IZ6A 1A8OA 2K92A 2KG6A 1M6NA 1MZ8A 2N6ZA 2WLVA 1F80D 2ONTA 3CD6P 5I4TG 2FQ1A 3G0VA 3G26A 3B5IA 2GZEA 3DTJA 3EJBA 2K93A 1YIJP 2L0QA 1GXHA 2XGYA 3HZQA 2LKIA 4U0BA 1YITP 2OTLP 2CNRA 3NY7B 2KGCA 3RG2A 2M8PA 1QVGO 2MR8A 2X82A 2XGVA 2EHSA 1YJWP 2EFJA 2P9XA 1EIAA 2PXRC 5F2KA 2VLOA 3H0DA 2K0DX 1M9YC 2DNWA 2AF8A 2K5XA 4DGAC 2DGYA 4E91A 4LQWC 2CG5B 4H2YC 5DCKA 2PWMA 1U7KA 2PEJA 3CMEP 3H4EA 1VQ8P 5HVCA 2N5HA 1N8RQ 1VQ9P 2X2DD 5HGOA 2BUOA 1RO2A 1M9EC 2KW2A 3GZLA 1K8AQ 5EW5E 1VKUA 1QVFO 4INBA 2KOSA 2FVEA 2KGFA 2XZ1C 3I56P 5JPAA 2MVUA 2VLNA 4U0FA 1ACPA 5HGNA 2MF4A 2FVAA 4J93A 2L9FA 3HYBA 1VQMP 1Z6MA 2L22A 1E6JP 4PH3A 1AFVA 2EIAA 5HV8A 3GZMA 3CCJP 2K2QA 2KORA 2XDEA 3RG6C 2PEKA 1G03A 4BPHA 2GZFA 2VLPA 4IPYA 1Q86Q 2M5RA 2JGPA 1VQNP 4PH2A 2FACA 3EJEA 2X83A 3DS1A 2PENA 3CC4P 3OW2O 2KWLA 1K30A 1L6NA 2ERHA 1VQ5P 1IUQA 2PNGA 1EMVA 1VQPP 1RNIA 3NTEA 5F2NA 2K0XA 1CEIA 3H47A 2AVAA 2L4BA 2NO8A 3G1IA 4U0EA 5BS1A 2PEIA 1IMQA 2K94A 2E1MA 3CC7P 3WBHA 1X3OA 2PEOA 3G4SP 4H2WC 2GONA 2JQ4A 2MY5A 2WPTA 2JAZA 2N6YA 4BPGA 1VQLP 4UHPB 2MVVA 2Z44A 2CGQA 1VQOP 4QNBA 3CCVP 1Q82Q 5HGLA 1QRJA 1GWPA 2XGUA 1M74A 2GDWA 4MRTC 1ZNVA 2JU2A 1M9XC 4PH0A 3VRLC 1RO0A 2KOPA 2Y4ZA 2FHSC 4CA3A 3EJDA 7CEIA 2LPKA 5HGKA 2BHVA 5EJDA 4COCA 2FQ0A 1NQ4A 3G71P 1P7NA 1VQ4P 4F37A 4PXHB 3G28A
chains in the Genus database with same CATH topology
1AFVA 2EIAA 2XT1A 1M9FC 2XXMA 3LRYA 1A8OA 3CCJP 3CMAP 1M6NA 3RG6C 2XDEA 4XROA 2PEKA 1G03A 2WLVA 3E2DA 4WYMA 2ONTA 3CD6P 2XV6A 4IPYA 5I4TG 3CCSP 1Q86Q 3G0VA 3G26A 1VQNP 2QA4P 3MGEA 3B5IA 3DTJA 4PH2A 1YIJP 2QEXP 1YI2P 1ZMBA 2XGYA 3HZQA 2X83A 2EG5A 4E92A 3DS1A 1Q7YQ 4U0BA 2PY8A 3Q20A 2PENA 1YITP 3CC4P 3CPWO 2OTLP 3OW2O 1VQ7P 1K30A 1L6NA 2M8PA 1QVGO 3P05A 2X82A 3DS4A 2XGVA 1VQ5P 1YJWP 2EFJA 2P9XA 1EIAA 4U0CA 3G1GA 1IUQA 2PXRC 4B4NA 2Z45A 5F2KA 3G6EP 4U0DA 2PEQA 4GR2A 1VQPP 2JYGA 3H0DA 1RNIA 3NTEA 1EM9A 1S72P 1M9YC 1YJ9P 5F2NA 3I55P 3CCUP 3CC2P 2L6EA 1AUMA 3CCMP 3H47A 2JPRA 4XFZA 4DGAC 2DGYA 4E91A 4XFXA 4LQWC 3DS2A 1K9MQ 3G1IA 1KQSO 5DCKA 4U0EA 5BS1A 2PEIA 2OTJP 2E1MA 3CC7P 2PWMA 3WBHA 1U7KA 2PEOA 1NJIQ 1W2BO 2M8NA 1M9CC 4M0IA 3G4SP 2PEJA 3CMEP 3BP9A 3G21A 2GONA 3H4EA 2CWOA 1VQ8P 3CCLP 4XFYA 1EOQA 4HTWA 1AK4C 2JYLA 2JO0A 1D1DA 1A43A 4U0AA 2Z46A 4COPA 1N8RQ 1VQLP 1VQ9P 2X2DD 2Z44A 5HGOA 3CCRP 2BUOA 2PEMA 4QNBA 3DPHA 1VQOP 1VQ6P 5F2OA 3CCVP 1RO2A 1Q82Q 5HGLA 1M9EC 2GOLB 3DS3A 1JJ2O 1QRJA 1GWPA 2KODA 1K8AQ 2XGUA 1KC8Q 1M74A 3DS5A 1QVFO 2V4XA 4INBA 1Q81Q 3M1MA 2OARA 1K73Q 3CXCO 2KGFA 4XRQA 1M9XC 4PH0A 3I56P 1M90Q 3CCEP 3VRLC 5JPAA 1RO0A 1M6EX 2Y4ZA 4NX4C 1KD1Q 2M8LA 5HGMA 4GR6A 4U0FA 5HGNA 5HGKA 4DGEC 1BAJA 1VQKP 3CCQP 2WLVB 2BHVA 5BS2A 1M1KQ 4COCA 4J93A 2PWOA 3HYBA 1YHQP 1M9DC 1P7NA 3G71P 1VQMP 3G29A 4PH1A 1VQ4P 1YJNP 3DS0A 1E6JP 4PH3A 3G28A 2LF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  2EIA A;  2XT1 A;  1M9F C;  2XXM A;  3LRY A;  1A8O A;  2XDE A;  4XRO A;  1G03 A;  2WLV A;  4WYM A;  2ONT A;  2XV6 A;  4IPY A;  5I4T G;  3G0V A;  3G26 A;  3MGE A;  3DTJ A;  4PH2 A;  2XGY A;  2X83 A;  4E92 A;  3DS1 A;  4U0B A;  1L6N A;  2M8P A;  3P05 A;  2X82 A;  3DS4 A;  2XGV A;  1EIA A;  4U0C A;  3G1G A;  2PXR C;  4B4N A;  4U0D A;  2JYG A;  3NTE A;  1EM9 A;  1M9Y C;  2L6E A;  1AUM A;  3H47 A;  2JPR A;  4XFZ A;  4DGA C;  4E91 A;  4XFX A;  4LQW C;  3DS2 A;  3G1I A;  5DCK A;  4U0E A;  2PWM A;  1U7K A;  2M8N A;  1M9C C;  4M0I A;  3BP9 A;  3G21 A;  2GON A;  3H4E A;  4XFY A;  1EOQ A;  4HTW A;  1AK4 C;  2JYL A;  2JO0 A;  1D1D A;  1A43 A;  4U0A A;  4COP A;  2X2D D;  5HGO A;  2BUO A;  3DPH A;  4QNB A;  5HGL A;  1M9E C;  2GOL B;  3DS3 A;  1QRJ A;  1GWP A;  2KOD A;  2XGU A;  3DS5 A;  2V4X A;  4INB A;  2KGF A;  4XRQ A;  1M9X C;  4PH0 A;  3VRL C;  5JPA A;  2Y4Z A;  4NX4 C;  2M8L A;  5HGM A;  4U0F A;  5HGN A;  5HGK A;  4DGE C;  1BAJ A;  2WLV B;  4COC A;  4J93 A;  2PWO A;  1M9D C;  1P7N A;  3G29 A;  4PH1 A;  3DS0 A;  1E6J P;  4PH3 A;  3G28 A;  2LF4 A; 
#chains in the Genus database with same CATH topology
 2XT1 A;  2LTE A;  3LMO A;  2KGD A;  3LRY A;  2AFE A;  3CMA P;  4XRO A;  2XV6 A;  2QA4 P;  2LIW A;  2QEX P;  1ZMB A;  2N50 A;  2EG5 A;  1OR5 A;  2XZ0 D;  2VSQ A;  2GDY A;  2KGE A;  1UNK A;  3P05 A;  2LOL A;  3DS4 A;  5CZD B;  4U0C A;  3G1G A;  4B4N A;  2Z45 A;  2PEQ A;  2JYG A;  1EM9 A;  1YJ9 P;  1HY8 A;  4HKG A;  3CCU P;  1AUM A;  3CCM P;  2QNW A;  4XFZ A;  4XFX A;  4R0M A;  3DS2 A;  1KQS O;  2JU1 A;  2KG9 A;  1DV5 A;  4NEO A;  2GZI A;  1W2B O;  4M0I A;  2VLQ A;  3G21 A;  3CCL P;  4XFY A;  1EOQ A;  2JO0 A;  3U43 A;  1D1D A;  2KOQ A;  2JB0 A;  4COP A;  5KP8 B;  3CCR P;  3DPH A;  3B4Q A;  5F2O A;  3DS3 A;  2GOL B;  1JJ2 O;  2FVF A;  1KC8 Q;  1KLP A;  2V4X A;  1K73 Q;  2OAR A;  3CXC O;  4XRQ A;  1T8K A;  3CCE P;  1IMP A;  1KD1 Q;  2K0Y A;  5HGM A;  4GR6 A;  3CCQ P;  5BS2 A;  2AFD A;  2WLV B;  1M1K Q;  2PWO A;  1AF8 A;  2KG8 A;  1YHQ P;  1M9D C;  3GJN A;  3G29 A;  1YJN P;  2ROQ A;  2KGA A;  1L0I A;  1M9F C;  2XXM A;  2MD9 A;  2N5I A;  1UJZ A;  3E2D A;  4WYM A;  2KR5 A;  1BXI A;  3CCS P;  2GZJ A;  2EHT A;  3MGE A;  2GDX A;  1YI2 P;  2FAD A;  2KOO A;  2FQ2 A;  4E92 A;  1Q7Y Q;  3Q20 A;  2PY8 A;  1E0H A;  3CPW O;  2LL8 A;  1VQ7 P;  2GYK A;  1GXG A;  3GKL C;  3G6E P;  4U0D A;  2MR7 A;  4GR2 A;  4H2X C;  1S72 P;  3I55 P;  3CC2 P;  2L6E A;  1L0H A;  2LML A;  2JPR A;  1DNY A;  1K9M Q;  2OTJ P;  1AYI A;  2GZG A;  2CQ8 A;  4BPF A;  1NJI Q;  2M8N A;  1M9C C;  3BP9 A;  2CWO A;  4HTW A;  1AK4 C;  2JYL A;  3CE7 A;  1A43 A;  5KP6 B;  1HQB A;  4U0A A;  2Z46 A;  1VQ6 P;  2PEM A;  4QKO A;  4DG9 A;  2KOD A;  2X2B A;  3DS5 A;  5KP7 B;  2LIU A;  1Q81 Q;  3M1M A;  2FAE A;  1M90 Q;  1M6E X;  4NX4 C;  2M8L A;  4PWV B;  1VQK P;  4DGE C;  1GPJ A;  1BAJ A;  2N98 A;  2JBG A;  1VHN A;  4PH1 A;  3DS0 A;  2LF4 A;  1FR2 A;  4IZ6 A;  1A8O A;  2K92 A;  2KG6 A;  1M6N A;  1MZ8 A;  2N6Z A;  2WLV A;  1F80 D;  2ONT A;  3CD6 P;  5I4T G;  2FQ1 A;  3G0V A;  3G26 A;  3B5I A;  2GZE A;  3DTJ A;  3EJB A;  2K93 A;  1YIJ P;  2L0Q A;  1GXH A;  2XGY A;  3HZQ A;  2LKI A;  4U0B A;  1YIT P;  2OTL P;  2CNR A;  3NY7 B;  2KGC A;  3RG2 A;  2M8P A;  1QVG O;  2MR8 A;  2X82 A;  2XGV A;  2EHS A;  1YJW P;  2EFJ A;  2P9X A;  1EIA A;  2PXR C;  5F2K A;  2VLO A;  3H0D A;  2K0D X;  1M9Y C;  2DNW A;  2AF8 A;  2K5X A;  4DGA C;  2DGY A;  4E91 A;  4LQW C;  2CG5 B;  4H2Y C;  5DCK A;  2PWM A;  1U7K A;  2PEJ A;  3CME P;  3H4E A;  1VQ8 P;  5HVC A;  2N5H A;  1N8R Q;  1VQ9 P;  2X2D D;  5HGO A;  2BUO A;  1RO2 A;  1M9E C;  2KW2 A;  3GZL A;  1K8A Q;  5EW5 E;  1VKU A;  1QVF O;  4INB A;  2KOS A;  2FVE A;  2KGF A;  2XZ1 C;  3I56 P;  5JPA A;  2MVU A;  2VLN A;  4U0F A;  1ACP A;  5HGN A;  2MF4 A;  2FVA A;  4J93 A;  2L9F A;  3HYB A;  1VQM P;  1Z6M A;  2L22 A;  1E6J P;  4PH3 A;  1AFV A;  2EIA A;  5HV8 A;  3GZM A;  3CCJ P;  2K2Q A;  2KOR A;  2XDE A;  3RG6 C;  2PEK A;  1G03 A;  4BPH A;  2GZF A;  2VLP A;  4IPY A;  1Q86 Q;  2M5R A;  2JGP A;  1VQN P;  4PH2 A;  2FAC A;  3EJE A;  2X83 A;  3DS1 A;  2PEN A;  3CC4 P;  3OW2 O;  2KWL A;  1K30 A;  1L6N A;  2ERH A;  1VQ5 P;  1IUQ A;  2PNG A;  1EMV A;  1VQP P;  1RNI A;  3NTE A;  5F2N A;  2K0X A;  1CEI A;  3H47 A;  2AVA A;  2L4B A;  2NO8 A;  3G1I A;  4U0E A;  5BS1 A;  2PEI A;  1IMQ A;  2K94 A;  2E1M A;  3CC7 P;  3WBH A;  1X3O A;  2PEO A;  3G4S P;  4H2W C;  2GON A;  2JQ4 A;  2MY5 A;  2WPT A;  2JAZ A;  2N6Y A;  4BPG A;  1VQL P;  4UHP B;  2MVV A;  2Z44 A;  2CGQ A;  1VQO P;  4QNB A;  3CCV P;  1Q82 Q;  5HGL A;  1QRJ A;  1GWP A;  2XGU A;  1M74 A;  2GDW A;  4MRT C;  1ZNV A;  2JU2 A;  1M9X C;  4PH0 A;  3VRL C;  1RO0 A;  2KOP A;  2Y4Z A;  2FHS C;  4CA3 A;  3EJD A;  7CEI A;  2LPK A;  5HGK A;  2BHV A;  5EJD A;  4COC A;  2FQ0 A;  1NQ4 A;  3G71 P;  1P7N A;  1VQ4 P;  4F37 A;  4PXH B;  3G28 A; 
#chains in the Genus database with same CATH homology
 1AFV A;  2EIA A;  2XT1 A;  1M9F C;  2XXM A;  3LRY A;  1A8O A;  3CCJ P;  3CMA P;  1M6N A;  3RG6 C;  2XDE A;  4XRO A;  2PEK A;  1G03 A;  2WLV A;  3E2D A;  4WYM A;  2ONT A;  3CD6 P;  2XV6 A;  4IPY A;  5I4T G;  3CCS P;  1Q86 Q;  3G0V A;  3G26 A;  1VQN P;  2QA4 P;  3MGE A;  3B5I A;  3DTJ A;  4PH2 A;  1YIJ P;  2QEX P;  1YI2 P;  1ZMB A;  2XGY A;  3HZQ A;  2X83 A;  2EG5 A;  4E92 A;  3DS1 A;  1Q7Y Q;  4U0B A;  2PY8 A;  3Q20 A;  2PEN A;  1YIT P;  3CC4 P;  3CPW O;  2OTL P;  3OW2 O;  1VQ7 P;  1K30 A;  1L6N A;  2M8P A;  1QVG O;  3P05 A;  2X82 A;  3DS4 A;  2XGV A;  1VQ5 P;  1YJW P;  2EFJ A;  2P9X A;  1EIA A;  4U0C A;  3G1G A;  1IUQ A;  2PXR C;  4B4N A;  2Z45 A;  5F2K A;  3G6E P;  4U0D A;  2PEQ A;  4GR2 A;  1VQP P;  2JYG A;  3H0D A;  1RNI A;  3NTE A;  1EM9 A;  1S72 P;  1M9Y C;  1YJ9 P;  5F2N A;  3I55 P;  3CCU P;  3CC2 P;  2L6E A;  1AUM A;  3CCM P;  3H47 A;  2JPR A;  4XFZ A;  4DGA C;  2DGY A;  4E91 A;  4XFX A;  4LQW C;  3DS2 A;  1K9M Q;  3G1I A;  1KQS O;  5DCK A;  4U0E A;  5BS1 A;  2PEI A;  2OTJ P;  2E1M A;  3CC7 P;  2PWM A;  3WBH A;  1U7K A;  2PEO A;  1NJI Q;  1W2B O;  2M8N A;  1M9C C;  4M0I A;  3G4S P;  2PEJ A;  3CME P;  3BP9 A;  3G21 A;  2GON A;  3H4E A;  2CWO A;  1VQ8 P;  3CCL P;  4XFY A;  1EOQ A;  4HTW A;  1AK4 C;  2JYL A;  2JO0 A;  1D1D A;  1A43 A;  4U0A A;  2Z46 A;  4COP A;  1N8R Q;  1VQL P;  1VQ9 P;  2X2D D;  2Z44 A;  5HGO A;  3CCR P;  2BUO A;  2PEM A;  4QNB A;  3DPH A;  1VQO P;  1VQ6 P;  5F2O A;  3CCV P;  1RO2 A;  1Q82 Q;  5HGL A;  1M9E C;  2GOL B;  3DS3 A;  1JJ2 O;  1QRJ A;  1GWP A;  2KOD A;  1K8A Q;  2XGU A;  1KC8 Q;  1M74 A;  3DS5 A;  1QVF O;  2V4X A;  4INB A;  1Q81 Q;  3M1M A;  2OAR A;  1K73 Q;  3CXC O;  2KGF A;  4XRQ A;  1M9X C;  4PH0 A;  3I56 P;  1M90 Q;  3CCE P;  3VRL C;  5JPA A;  1RO0 A;  1M6E X;  2Y4Z A;  4NX4 C;  1KD1 Q;  2M8L A;  5HGM A;  4GR6 A;  4U0F A;  5HGN A;  5HGK A;  4DGE C;  1BAJ A;  1VQK P;  3CCQ P;  2WLV B;  2BHV A;  5BS2 A;  1M1K Q;  4COC A;  4J93 A;  2PWO A;  3HYB A;  1YHQ P;  1M9D C;  1P7N A;  3G71 P;  1VQM P;  3G29 A;  4PH1 A;  1VQ4 P;  1YJN P;  3DS0 A;  1E6J P;  4PH3 A;  3G28 A;  2LF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...