3H47A

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 71
structure length 201
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h47A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h47A02
3NTEA 2JYGA 2XXMA 1EOQA 2WLVB 4NX4C 2M8NA 2Y4ZA 3H4EA 3DS5A 4COPA 1E6JP 1M9YC 2XGVA 2JPRA 4WYMA 4XFZA 5HGOA 4U0AA 4U0DA 4DGEC 3LRYA 2GOLB 2WLVA 3G29A 3VRLC 3G26A 3MGEA 1AUMA 2PXRC 3G0VA 2ONTA 2XDEA 1M9CC 2EIAA 2XT1A 2GONA 3DPHA 4PH1A 4U0BA 2BUOA 4XFXA 4HTWA 1M9DC 4PH2A 5HGNA 3P05A 3DS4A 4E92A 5I4TG 2M8PA 4U0FA 4J93A 3DS3A 1A43A 4E91A 3DS0A 5HGKA 4M0IA 1M9EC 1BAJA 2V4XA 2XGYA 2JO0A 2PWOA 3G1GA 4COCA 3H47A 1QRJA 5JPAA 2X83A 4QNBA 2JYLA 1L6NA 2M8LA 1A8OA 3DTJA 2LF4A 4LQWC 2L6EA 1GWPA 4B4NA 2X2DD 5HGMA 1M9XC 3DS2A 3DS1A 4XFYA 1AFVA 2KGFA 2X82A 4DGAC 4U0EA 4IPYA 1M9FC 3BP9A 4PH3A 4PH0A 4XRQA 1EM9A 1EIAA 3G28A 1AK4C 3G21A 2PWMA 2XV6A 1D1DA 3G1IA 4XROA 5DCKA 2XGUA 2KODA 4INBA 1P7NA 4U0CA 1U7KA 5HGLA 1G03A
chains in the Genus database with same CATH superfamily
1Q86Q 2JYGA 2XXMA 2Z45A 2KG9A 3GKLC 5KP7B 2KGDA 2XGVA 2AFEA 1BXIA 1K73Q 1VKUA 4U0AA 4U0DA 3LRYA 3G26A 3MGEA 5BS1A 2GZJA 1HQBA 3G0VA 1N8RQ 2XDEA 3RG6C 3CCMP 4HKGA 4IZ6A 2GONA 1MZ8A 4GR6A 4BPGA 4PWVB 2GZEA 1VHNA 4XFXA 4HTWA 1L0IA 1M9DC 4BPHA 3P05A 4R0MA 3DS4A 1QVFO 2K0XA 3DS0A 2N50A 2DNWA 2N6ZA 2FQ1A 2VLQA 2V4XA 2XGYA 2MR7A 2VLNA 2KOPA 3CD6P 3CXCO 2PEQA 2OTJP 2M8LA 3DTJA 1RO0A 4MRTC 3CC4P 4DG9A 3CCUP 1VQMP 4NEOA 2MF4A 1RNIA 4B4NA 2N6YA 2K2QA 5KP6B 2QEXP 3CPWO 3DS1A 2LIUA 2P9XA 1YJNP 4XFYA 2CGQA 2L0QA 2OARA 3BP9A 1AYIA 2JB0A 2K5XA 1NQ4A 1F80D 1W2BO 2JU2A 2DGYA 2XV6A 2NO8A 3G1IA 2N98A 3RG2A 1Z6MA 2KW2A 3CE7A 1EOQA 2GZFA 3EJDA 2M8NA 2Y4ZA 3H4EA 1E6JP 1ZMBA 2VSQA 5HGOA 3EJBA 4UHPB 2GOLB 2K93A 1VQPP 2PY8A 1KD1Q 1EMVA 2GDWA 3CCRP 2PXRC 1Q82Q 2ONTA 2L9FA 1QVGO 2JU1A 1M9CC 2L4BA 1M74A 2LTEA 4PH1A 1YJ9P 4U0BA 2BUOA 2N5HA 2LL8A 2FVAA 3LMOA 2MVUA 3E2DA 5HGNA 2GDYA 2PENA 2VLOA 2GDXA 4E92A 2PEOA 2KGEA 3I56P 4J93A 3OW2O 2FACA 1VQKP 5HGKA 2X2BA 2PWOA 2FHSC 2GYKA 4COCA 1QRJA 5JPAA 1K30A 2CQ8A 2WPTA 3GJNA 2X83A 3HZQA 2LF4A 4PXHB 3CCQP 1M1KQ 3NY7B 2KWLA 5F2OA 1OR5A 2CG5B 2Z46A 1AFVA 2X82A 2CNRA 2Z44A 4IPYA 3U43A 2AVAA 1IMPA 1M9FC 4PH3A 2FVFA 1EIAA 1YHQP 3GZLA 1D1DA 1HY8A 5DCKA 2EFJA 2LIWA 5CZDB 2K0DX 2XGUA 1ACPA 2AF8A 1M6EX 1GPJA 4U0CA 4GR2A 1KC8Q 1T8KA 3NTEA 3G71P 1IUQA 2FQ0A 2KR5A 2MY5A 3G4SP 3DS5A 1Q81Q 2EG5A 2M5RA 2K92A 3CMAP 3EJEA 2JPRA 2LOLA 1VQLP 2JQ4A 4DGEC 2WLVA 1RO2A 3G29A 3VRLC 1VQ6P 2EHSA 4H2WC 1FR2A 4QKOA 5F2NA 2PNGA 2EIAA 2XT1A 1UNKA 5EJDA 1YITP 1CEIA 4PH2A 2M8PA 4U0FA 1A43A 2KORA 4E91A 1M9EC 2JO0A 3GZMA 3CC2P 2LPKA 3G1GA 1VQOP 2MD9A 3CCVP 2PEMA 3G6EP 1VQNP 2JYLA 3H0DA 1L6NA 4LQWC 2L6EA 4H2XC 3CC7P 1GWPA 2PEJA 2XZ1C 1S72P 1YJWP 1AF8A 2FAEA 5HGMA 1M9XC 1DNYA 3DS2A 3I55P 1L0HA 2KGFA 1GXGA 4DGAC 4U0EA 1ZNVA 2KOSA 2JAZA 2GZGA 2FQ2A 1Q7YQ 3G28A 1VQ9P 3G21A 2OTLP 2PWMA 2FVEA 1GXHA 2PEIA 4XROA 3CMEP 2E1MA 2XZ0D 2MVVA 2KODA 1YIJP 1U7KA 3M1MA 2LMLA 5HV8A 1G03A 2FADA 2WLVB 1KLPA 4NX4C 4COPA 1M9YC 2KOOA 4WYMA 2MR8A 2QA4P 4XFZA 1YI2P 3WBHA 1AUMA 3Q20A 2K0YA 2EHTA 2KGCA 3HYBA 2LKIA 1VQ5P 3CCSP 2JGPA 2ERHA 3CCEP 1K8AQ 3DPHA 1X3OA 5HVCA 2QNWA 3CCLP 5I4TG 1KQSO 1M90Q 2N5IA 4CA3A 3DS3A 1IMQA 4M0IA 1BAJA 4BPFA 2GZIA 3H47A 2L22A 3CCJP 1UJZA 2PEKA 2ROQA 4QNBA 1A8OA 1NJIQ 1K9MQ 2KG6A 3B4QA 2KGAA 2K94A 5KP8B 2X2DD 1JJ2O 5F2KA 4H2YC 5BS2A 4F37A 2BHVA 4PH0A 4XRQA 1EM9A 1DV5A 2JBGA 1VQ8P 1AK4C 3B5IA 1E0HA 7CEIA 1VQ7P 5EW5E 2KOQA 2KG8A 2AFDA 2VLPA 1M6NA 4INBA 1P7NA 2CWOA 5HGLA 1VQ4P
chains in the Genus database with same CATH topology
3NTEA 3G71P 1Q86Q 2JYGA 2XXMA 1IUQA 2Z45A 1EOQA 2WLVB 4NX4C 2M8NA 3G4SP 2Y4ZA 3H4EA 2EG5A 3DS5A 4COPA 1Q81Q 1E6JP 1M9YC 3CMAP 2XGVA 2JPRA 4WYMA 1VQLP 1K73Q 1ZMBA 2QA4P 4XFZA 5HGOA 4U0AA 4U0DA 4DGEC 1YI2P 3LRYA 2GOLB 2WLVA 1VQPP 3WBHA 2PY8A 1KD1Q 1RO2A 3G29A 3VRLC 3G26A 1VQ6P 3MGEA 1AUMA 3Q20A 3CCRP 5BS1A 2PXRC 3G0VA 1Q82Q 2ONTA 1N8RQ 5F2NA 2XDEA 3RG6C 1QVGO 3CCMP 1M9CC 3HYBA 2EIAA 1M74A 1VQ5P 3CCSP 2XT1A 3CCEP 1K8AQ 2GONA 3DPHA 4PH1A 1YJ9P 4GR6A 1YITP 4U0BA 2BUOA 4XFXA 4HTWA 1M9DC 4PH2A 3E2DA 5HGNA 2PENA 3P05A 1VQ4P 3DS4A 3CCLP 4E92A 2PEOA 5I4TG 1KQSO 2M8PA 1M90Q 1QVFO 4U0FA 3I56P 4J93A 3DS3A 3OW2O 1A43A 4E91A 3DS0A 1VQKP 5HGKA 4M0IA 1M9EC 1BAJA 2V4XA 2XGYA 2JO0A 2PWOA 3CC2P 3G1GA 4COCA 3H47A 1QRJA 1VQOP 5JPAA 1K30A 3CCJP 3CD6P 3CCVP 2PEKA 2PEMA 3CXCO 2PEQA 3G6EP 2X83A 1VQNP 4QNBA 2JYLA 3HZQA 2OTJP 3H0DA 1L6NA 2M8LA 1A8OA 3DTJA 1RO0A 3CC4P 2LF4A 4LQWC 2L6EA 3CCUP 1VQMP 1NJIQ 1K9MQ 3CC7P 1GWPA 2PEJA 3CCQP 1RNIA 1YJWP 1S72P 4B4NA 1M1KQ 2X2DD 1JJ2O 5HGMA 5F2OA 1M9XC 2QEXP 3CPWO 3DS2A 5F2KA 3DS1A 2P9XA 2Z46A 4XFYA 3I55P 1AFVA 1YJNP 2KGFA 5BS2A 2X82A 4DGAC 2Z44A 4U0EA 4IPYA 2OARA 1M9FC 2BHVA 3BP9A 4PH3A 1Q7YQ 4PH0A 4XRQA 1EM9A 1VQ8P 1EIAA 3G28A 1W2BO 1AK4C 1VQ9P 3G21A 3B5IA 1YHQP 2OTLP 2PWMA 2DGYA 2XV6A 2PEIA 1D1DA 1VQ7P 3G1IA 4XROA 5DCKA 2EFJA 3CMEP 2E1MA 2XGUA 2KODA 1M6NA 1YIJP 1M6EX 4INBA 1P7NA 2CWOA 4U0CA 1U7KA 5HGLA 4GR2A 3M1MA 1G03A 1KC8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  2JYG A;  2XXM A;  1EOQ A;  2WLV B;  4NX4 C;  2M8N A;  2Y4Z A;  3H4E A;  3DS5 A;  4COP A;  1E6J P;  1M9Y C;  2XGV A;  2JPR A;  4WYM A;  4XFZ A;  5HGO A;  4U0A A;  4U0D A;  4DGE C;  3LRY A;  2GOL B;  2WLV A;  3G29 A;  3VRL C;  3G26 A;  3MGE A;  1AUM A;  2PXR C;  3G0V A;  2ONT A;  2XDE A;  1M9C C;  2EIA A;  2XT1 A;  2GON A;  3DPH A;  4PH1 A;  4U0B A;  2BUO A;  4XFX A;  4HTW A;  1M9D C;  4PH2 A;  5HGN A;  3P05 A;  3DS4 A;  4E92 A;  5I4T G;  2M8P A;  4U0F A;  4J93 A;  3DS3 A;  1A43 A;  4E91 A;  3DS0 A;  5HGK A;  4M0I A;  1M9E C;  1BAJ A;  2V4X A;  2XGY A;  2JO0 A;  2PWO A;  3G1G A;  4COC A;  3H47 A;  1QRJ A;  5JPA A;  2X83 A;  4QNB A;  2JYL A;  1L6N A;  2M8L A;  1A8O A;  3DTJ A;  2LF4 A;  4LQW C;  2L6E A;  1GWP A;  4B4N A;  2X2D D;  5HGM A;  1M9X C;  3DS2 A;  3DS1 A;  4XFY A;  1AFV A;  2KGF A;  2X82 A;  4DGA C;  4U0E A;  4IPY A;  1M9F C;  3BP9 A;  4PH3 A;  4PH0 A;  4XRQ A;  1EM9 A;  1EIA A;  3G28 A;  1AK4 C;  3G21 A;  2PWM A;  2XV6 A;  1D1D A;  3G1I A;  4XRO A;  5DCK A;  2XGU A;  2KOD A;  4INB A;  1P7N A;  4U0C A;  1U7K A;  5HGL A;  1G03 A; 
#chains in the Genus database with same CATH topology
 1Q86 Q;  2JYG A;  2XXM A;  2Z45 A;  2KG9 A;  3GKL C;  5KP7 B;  2KGD A;  2XGV A;  2AFE A;  1BXI A;  1K73 Q;  1VKU A;  4U0A A;  4U0D A;  3LRY A;  3G26 A;  3MGE A;  5BS1 A;  2GZJ A;  1HQB A;  3G0V A;  1N8R Q;  2XDE A;  3RG6 C;  3CCM P;  4HKG A;  4IZ6 A;  2GON A;  1MZ8 A;  4GR6 A;  4BPG A;  4PWV B;  2GZE A;  1VHN A;  4XFX A;  4HTW A;  1L0I A;  1M9D C;  4BPH A;  3P05 A;  4R0M A;  3DS4 A;  1QVF O;  2K0X A;  3DS0 A;  2N50 A;  2DNW A;  2N6Z A;  2FQ1 A;  2VLQ A;  2V4X A;  2XGY A;  2MR7 A;  2VLN A;  2KOP A;  3CD6 P;  3CXC O;  2PEQ A;  2OTJ P;  2M8L A;  3DTJ A;  1RO0 A;  4MRT C;  3CC4 P;  4DG9 A;  3CCU P;  1VQM P;  4NEO A;  2MF4 A;  1RNI A;  4B4N A;  2N6Y A;  2K2Q A;  5KP6 B;  2QEX P;  3CPW O;  3DS1 A;  2LIU A;  2P9X A;  1YJN P;  4XFY A;  2CGQ A;  2L0Q A;  2OAR A;  3BP9 A;  1AYI A;  2JB0 A;  2K5X A;  1NQ4 A;  1F80 D;  1W2B O;  2JU2 A;  2DGY A;  2XV6 A;  2NO8 A;  3G1I A;  2N98 A;  3RG2 A;  1Z6M A;  2KW2 A;  3CE7 A;  1EOQ A;  2GZF A;  3EJD A;  2M8N A;  2Y4Z A;  3H4E A;  1E6J P;  1ZMB A;  2VSQ A;  5HGO A;  3EJB A;  4UHP B;  2GOL B;  2K93 A;  1VQP P;  2PY8 A;  1KD1 Q;  1EMV A;  2GDW A;  3CCR P;  2PXR C;  1Q82 Q;  2ONT A;  2L9F A;  1QVG O;  2JU1 A;  1M9C C;  2L4B A;  1M74 A;  2LTE A;  4PH1 A;  1YJ9 P;  4U0B A;  2BUO A;  2N5H A;  2LL8 A;  2FVA A;  3LMO A;  2MVU A;  3E2D A;  5HGN A;  2GDY A;  2PEN A;  2VLO A;  2GDX A;  4E92 A;  2PEO A;  2KGE A;  3I56 P;  4J93 A;  3OW2 O;  2FAC A;  1VQK P;  5HGK A;  2X2B A;  2PWO A;  2FHS C;  2GYK A;  4COC A;  1QRJ A;  5JPA A;  1K30 A;  2CQ8 A;  2WPT A;  3GJN A;  2X83 A;  3HZQ A;  2LF4 A;  4PXH B;  3CCQ P;  1M1K Q;  3NY7 B;  2KWL A;  5F2O A;  1OR5 A;  2CG5 B;  2Z46 A;  1AFV A;  2X82 A;  2CNR A;  2Z44 A;  4IPY A;  3U43 A;  2AVA A;  1IMP A;  1M9F C;  4PH3 A;  2FVF A;  1EIA A;  1YHQ P;  3GZL A;  1D1D A;  1HY8 A;  5DCK A;  2EFJ A;  2LIW A;  5CZD B;  2K0D X;  2XGU A;  1ACP A;  2AF8 A;  1M6E X;  1GPJ A;  4U0C A;  4GR2 A;  1KC8 Q;  1T8K A;  3NTE A;  3G71 P;  1IUQ A;  2FQ0 A;  2KR5 A;  2MY5 A;  3G4S P;  3DS5 A;  1Q81 Q;  2EG5 A;  2M5R A;  2K92 A;  3CMA P;  3EJE A;  2JPR A;  2LOL A;  1VQL P;  2JQ4 A;  4DGE C;  2WLV A;  1RO2 A;  3G29 A;  3VRL C;  1VQ6 P;  2EHS A;  4H2W C;  1FR2 A;  4QKO A;  5F2N A;  2PNG A;  2EIA A;  2XT1 A;  1UNK A;  5EJD A;  1YIT P;  1CEI A;  4PH2 A;  2M8P A;  4U0F A;  1A43 A;  2KOR A;  4E91 A;  1M9E C;  2JO0 A;  3GZM A;  3CC2 P;  2LPK A;  3G1G A;  1VQO P;  2MD9 A;  3CCV P;  2PEM A;  3G6E P;  1VQN P;  2JYL A;  3H0D A;  1L6N A;  4LQW C;  2L6E A;  4H2X C;  3CC7 P;  1GWP A;  2PEJ A;  2XZ1 C;  1S72 P;  1YJW P;  1AF8 A;  2FAE A;  5HGM A;  1M9X C;  1DNY A;  3DS2 A;  3I55 P;  1L0H A;  2KGF A;  1GXG A;  4DGA C;  4U0E A;  1ZNV A;  2KOS A;  2JAZ A;  2GZG A;  2FQ2 A;  1Q7Y Q;  3G28 A;  1VQ9 P;  3G21 A;  2OTL P;  2PWM A;  2FVE A;  1GXH A;  2PEI A;  4XRO A;  3CME P;  2E1M A;  2XZ0 D;  2MVV A;  2KOD A;  1YIJ P;  1U7K A;  3M1M A;  2LML A;  5HV8 A;  1G03 A;  2FAD A;  2WLV B;  1KLP A;  4NX4 C;  4COP A;  1M9Y C;  2KOO A;  4WYM A;  2MR8 A;  2QA4 P;  4XFZ A;  1YI2 P;  3WBH A;  1AUM A;  3Q20 A;  2K0Y A;  2EHT A;  2KGC A;  3HYB A;  2LKI A;  1VQ5 P;  3CCS P;  2JGP A;  2ERH A;  3CCE P;  1K8A Q;  3DPH A;  1X3O A;  5HVC A;  2QNW A;  3CCL P;  5I4T G;  1KQS O;  1M90 Q;  2N5I A;  4CA3 A;  3DS3 A;  1IMQ A;  4M0I A;  1BAJ A;  4BPF A;  2GZI A;  3H47 A;  2L22 A;  3CCJ P;  1UJZ A;  2PEK A;  2ROQ A;  4QNB A;  1A8O A;  1NJI Q;  1K9M Q;  2KG6 A;  3B4Q A;  2KGA A;  2K94 A;  5KP8 B;  2X2D D;  1JJ2 O;  5F2K A;  4H2Y C;  5BS2 A;  4F37 A;  2BHV A;  4PH0 A;  4XRQ A;  1EM9 A;  1DV5 A;  2JBG A;  1VQ8 P;  1AK4 C;  3B5I A;  1E0H A;  7CEI A;  1VQ7 P;  5EW5 E;  2KOQ A;  2KG8 A;  2AFD A;  2VLP A;  1M6N A;  4INB A;  1P7N A;  2CWO A;  5HGL A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 3NTE A;  3G71 P;  1Q86 Q;  2JYG A;  2XXM A;  1IUQ A;  2Z45 A;  1EOQ A;  2WLV B;  4NX4 C;  2M8N A;  3G4S P;  2Y4Z A;  3H4E A;  2EG5 A;  3DS5 A;  4COP A;  1Q81 Q;  1E6J P;  1M9Y C;  3CMA P;  2XGV A;  2JPR A;  4WYM A;  1VQL P;  1K73 Q;  1ZMB A;  2QA4 P;  4XFZ A;  5HGO A;  4U0A A;  4U0D A;  4DGE C;  1YI2 P;  3LRY A;  2GOL B;  2WLV A;  1VQP P;  3WBH A;  2PY8 A;  1KD1 Q;  1RO2 A;  3G29 A;  3VRL C;  3G26 A;  1VQ6 P;  3MGE A;  1AUM A;  3Q20 A;  3CCR P;  5BS1 A;  2PXR C;  3G0V A;  1Q82 Q;  2ONT A;  1N8R Q;  5F2N A;  2XDE A;  3RG6 C;  1QVG O;  3CCM P;  1M9C C;  3HYB A;  2EIA A;  1M74 A;  1VQ5 P;  3CCS P;  2XT1 A;  3CCE P;  1K8A Q;  2GON A;  3DPH A;  4PH1 A;  1YJ9 P;  4GR6 A;  1YIT P;  4U0B A;  2BUO A;  4XFX A;  4HTW A;  1M9D C;  4PH2 A;  3E2D A;  5HGN A;  2PEN A;  3P05 A;  1VQ4 P;  3DS4 A;  3CCL P;  4E92 A;  2PEO A;  5I4T G;  1KQS O;  2M8P A;  1M90 Q;  1QVF O;  4U0F A;  3I56 P;  4J93 A;  3DS3 A;  3OW2 O;  1A43 A;  4E91 A;  3DS0 A;  1VQK P;  5HGK A;  4M0I A;  1M9E C;  1BAJ A;  2V4X A;  2XGY A;  2JO0 A;  2PWO A;  3CC2 P;  3G1G A;  4COC A;  3H47 A;  1QRJ A;  1VQO P;  5JPA A;  1K30 A;  3CCJ P;  3CD6 P;  3CCV P;  2PEK A;  2PEM A;  3CXC O;  2PEQ A;  3G6E P;  2X83 A;  1VQN P;  4QNB A;  2JYL A;  3HZQ A;  2OTJ P;  3H0D A;  1L6N A;  2M8L A;  1A8O A;  3DTJ A;  1RO0 A;  3CC4 P;  2LF4 A;  4LQW C;  2L6E A;  3CCU P;  1VQM P;  1NJI Q;  1K9M Q;  3CC7 P;  1GWP A;  2PEJ A;  3CCQ P;  1RNI A;  1YJW P;  1S72 P;  4B4N A;  1M1K Q;  2X2D D;  1JJ2 O;  5HGM A;  5F2O A;  1M9X C;  2QEX P;  3CPW O;  3DS2 A;  5F2K A;  3DS1 A;  2P9X A;  2Z46 A;  4XFY A;  3I55 P;  1AFV A;  1YJN P;  2KGF A;  5BS2 A;  2X82 A;  4DGA C;  2Z44 A;  4U0E A;  4IPY A;  2OAR A;  1M9F C;  2BHV A;  3BP9 A;  4PH3 A;  1Q7Y Q;  4PH0 A;  4XRQ A;  1EM9 A;  1VQ8 P;  1EIA A;  3G28 A;  1W2B O;  1AK4 C;  1VQ9 P;  3G21 A;  3B5I A;  1YHQ P;  2OTL P;  2PWM A;  2DGY A;  2XV6 A;  2PEI A;  1D1D A;  1VQ7 P;  3G1I A;  4XRO A;  5DCK A;  2EFJ A;  3CME P;  2E1M A;  2XGU A;  2KOD A;  1M6N A;  1YIJ P;  1M6E X;  4INB A;  1P7N A;  2CWO A;  4U0C A;  1U7K A;  5HGL A;  4GR2 A;  3M1M A;  1G03 A;  1KC8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...