3H47A

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
201
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 71
structure length 201
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h47A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h47A02
2KGFA 5HGNA 1EOQA 2M8NA 4J93A 4IPYA 5I4TG 1AK4C 5HGMA 1GWPA 2JYLA 4PH1A 4NX4C 4DGAC 3G1IA 1M9CC 1M9EC 4U0BA 1M9YC 3P05A 2EIAA 2XXMA 3NTEA 2KODA 4E92A 3VRLC 2WLVB 5HGLA 2XV6A 4XFZA 2PXRC 2GONA 2WLVA 4PH3A 2GOLB 3G28A 1M9DC 4B4NA 2PWMA 3DS4A 4XFYA 1AUMA 5HGOA 2X2DD 2XGUA 4M0IA 2XGVA 3G21A 1BAJA 4XROA 2L6EA 4PH0A 1E6JP 3H4EA 3DPHA 4XRQA 1M9XC 3G1GA 2M8LA 4PH2A 1AFVA 2LF4A 4DGEC 2ONTA 4XFXA 2XT1A 4COPA 1P7NA 1U7KA 3BP9A 3G26A 4U0AA 4HTWA 1M9FC 3DS1A 3DS5A 2XGYA 2BUOA 3MGEA 3H47A 4U0EA 1L6NA 4U0FA 5JPAA 2X82A 3DTJA 2Y4ZA 5DCKA 3DS3A 4QNBA 4COCA 1EM9A 2M8PA 1QRJA 4U0DA 2JO0A 4LQWC 2PWOA 2V4XA 3LRYA 4U0CA 5HGKA 1A43A 1G03A 2X83A 3G29A 3G0VA 1A8OA 1EIAA 2XDEA 1D1DA 2JYGA 3DS0A 3DS2A 2JPRA 4E91A 4WYMA 4INBA
chains in the Genus database with same CATH superfamily
2FADA 2FHSC 1EOQA 1VQ7P 4J93A 2MR7A 4IPYA 5I4TG 2LPKA 5HGMA 2PEJA 4H2XC 4NX4C 2AFEA 1QVGO 3P05A 2EIAA 1VQMP 2N5IA 1CEIA 2XXMA 1L0IA 2EHTA 2NO8A 2PEIA 2K0DX 1VQLP 1KLPA 2PXRC 3M1MA 1S72P 2GDWA 1M9DC 2XZ1C 1M90Q 2Z44A 2JB0A 5HGOA 2KGAA 2KOQA 1VQ9P 2VLPA 2Z45A 2XGUA 4M0IA 3G21A 1BAJA 2L6EA 2VSQA 1YJWP 4PH0A 3EJBA 3CD6P 2KOPA 4H2YC 1YHQP 2GZEA 2LIWA 3GZMA 1M9XC 2M8LA 1AFVA 5CZDB 1VKUA 1YJNP 4COPA 2FACA 3BP9A 1Z6MA 3CCMP 4U0AA 1M9FC 7CEIA 2JU2A 3DS1A 3G4SP 3MGEA 2PEKA 2FQ2A 5BS2A 1L6NA 2L4BA 2AVAA 2X82A 1IMQA 1GXGA 2K93A 5DCKA 2ROQA 4MRTC 2GDYA 1HQBA 4LQWC 2V4XA 1A43A 1G03A 1UNKA 1A8OA 1ZMBA 3CCJP 1ACPA 1M1KQ 3DS2A 2FQ1A 4E91A 2DNWA 1W2BO 1DNYA 2KGFA 2PENA 3LMOA 2MVUA 3EJDA 2K94A 5HVCA 1YITP 3CCRP 1K9MQ 3G1IA 2KOOA 2CGQA 3CCSP 1RO0A 2KODA 1KQSO 2M5RA 2EFJA 4PH3A 2P9XA 2GOLB 3I56P 3G6EP 1YJ9P 1YI2P 2K92A 1K8AQ 3CCEP 1DV5A 2OTJP 3OW2O 4NEOA 3CC7P 2N6ZA 2VLQA 2KG6A 2CWOA 2LF4A 4PWVB 2ONTA 2PEQA 4XFXA 2XT1A 4BPHA 4UHPB 1HY8A 3G26A 2JAZA 5F2NA 2EG5A 2WPTA 3GKLC 1VQPP 2LIUA 2JU1A 5F2OA 1T8KA 3CPWO 2EHSA 2XGYA 1M6EX 4U0EA 4BPFA 2KWLA 2BHVA 4U0FA 2KGDA 2GZJA 1VQ5P 4H2WC 4COCA 1JJ2O 2K2QA 1GPJA 4U0DA 4BPGA 2CNRA 2MD9A 2QNWA 2MVVA 1IMPA 3G0VA 2L0QA 1EIAA 2KG9A 2JYGA 2PNGA 1Q82Q 3DS0A 4WYMA 1FR2A 2K0YA 1KC8Q 3CCLP 2N50A 3GZLA 1E0HA 1X3OA 1AK4C 2JYLA 2KGEA 2X2BA 1M9CC 1M9EC 3CE7A 4R0MA 2WLVB 4XFZA 2GONA 2WLVA 2PEOA 5F2KA 2KR5A 4XFYA 1AUMA 2CG5B 2GZIA 1M6NA 1GXHA 2FVEA 4CA3A 2XGVA 2MF4A 4PXHB 2K0XA 2QEXP 1VQKP 5BS1A 3EJEA 3G1GA 3RG2A 2DGYA 1Q7YQ 4DGEC 1OR5A 2KGCA 2FVFA 2LKIA 1P7NA 2N6YA 1BXIA 2GDXA 3CC4P 1YIJP 3DS5A 2CQ8A 3H47A 2GZGA 1Q81Q 2GZFA 3CCUP 2AF8A 5KP7B 5JPAA 3U43A 2AFDA 2ERHA 3DS3A 4QNBA 5EW5E 3Q20A 3H0DA 1EM9A 2VLOA 1L0HA 1EMVA 2FVAA 2GYKA 2OTLP 3CMAP 2PWOA 3LRYA 3G29A 2XZ0D 4U0CA 5HGKA 2X83A 1IUQA 1K30A 1VQOP 1KD1Q 3B5IA 1D1DA 2FAEA 1ZNVA 2JPRA 4INBA 3G71P 5HGNA 2N98A 2JBGA 2M8NA 1QVFO 5HV8A 2PY8A 3HZQA 1GWPA 4HKGA 4PH1A 2MR8A 5KP8B 2LL8A 4DGAC 2LTEA 4U0BA 1VQ4P 3WBHA 2JQ4A 1M9YC 1AYIA 3NTEA 4E92A 3VRLC 5HGLA 3E2DA 2XV6A 2KORA 2KOSA 1NJIQ 1Q86Q 3G28A 4GR6A 4B4NA 2PWMA 3DS4A 3I55P 2L9FA 2PEMA 3CXCO 2X2DD 1VQ8P 1MZ8A 2MY5A 1NQ4A 4IZ6A 4F37A 2Z46A 4XROA 3CMEP 3HYBA 1E6JP 3H4EA 5KP6B 3DPHA 4XRQA 4PH2A 2OARA 3GJNA 1VQ6P 5EJDA 1K73Q 1U7KA 2L22A 2QA4P 4HTWA 3B4QA 2K5XA 2N5HA 2KG8A 1VQNP 2BUOA 2E1MA 2KW2A 1M74A 2FQ0A 1UJZA 1F80D 2LOLA 3DTJA 3NY7B 2Y4ZA 3RG6C 3CCVP 1RO2A 3CC2P 2M8PA 2LMLA 1QRJA 2JO0A 4DG9A 4GR2A 2JGPA 3CCQP 4QKOA 2VLNA 2XDEA 1RNIA 1N8RQ 1VHNA 1AF8A
chains in the Genus database with same CATH topology
3G71P 2KGFA 5HGNA 2PENA 1EOQA 1KC8Q 3CCLP 2M8NA 1VQ7P 4J93A 1QVFO 4IPYA 2PY8A 3HZQA 5I4TG 1AK4C 1YITP 5HGMA 1GWPA 2JYLA 2PEJA 4PH1A 4NX4C 3CCRP 1K9MQ 4DGAC 3G1IA 1M9CC 1M9EC 4U0BA 1VQ4P 3WBHA 1QVGO 1M9YC 3P05A 2EIAA 1VQMP 3CCSP 2XXMA 1RO0A 3NTEA 2KODA 4E92A 3VRLC 2WLVB 2PEIA 5HGLA 1KQSO 3E2DA 1VQLP 2XV6A 4XFZA 2PXRC 2EFJA 2GONA 3M1MA 1NJIQ 2WLVA 4PH3A 1Q86Q 2P9XA 2GOLB 3G28A 1S72P 2PEOA 4GR6A 1M9DC 4B4NA 1M90Q 2PWMA 2Z44A 3I56P 5F2KA 3G6EP 3DS4A 4XFYA 1AUMA 5HGOA 1YJ9P 3I55P 1YI2P 2PEMA 3CXCO 1K8AQ 1M6NA 1VQ9P 2Z45A 2X2DD 2XGUA 3CCEP 4M0IA 1VQ8P 2Z46A 2XGVA 3G21A 1BAJA 4XROA 2OTJP 2L6EA 1W2BO 3OW2O 1YJWP 3CMEP 4PH0A 3HYBA 1E6JP 3H4EA 2QEXP 1VQKP 3CD6P 5BS1A 3CC7P 3DPHA 1YHQP 4XRQA 1M9XC 3G1GA 2M8LA 4PH2A 2CWOA 1AFVA 2DGYA 2LF4A 2OARA 1Q7YQ 4DGEC 2ONTA 2PEQA 4XFXA 2XT1A 1YJNP 4COPA 1VQ6P 1P7NA 1U7KA 3BP9A 3G26A 3CCMP 2QA4P 4U0AA 1K73Q 4HTWA 2EG5A 5F2NA 1M9FC 1VQPP 1VQNP 3DS1A 5F2OA 3CPWO 3CC4P 1YIJP 3DS5A 2XGYA 2BUOA 3MGEA 2PEKA 3G4SP 3H47A 2E1MA 1M6EX 4U0EA 5BS2A 1L6NA 1Q81Q 2BHVA 1M74A 3CCUP 4U0FA 5JPAA 2X82A 1VQ5P 3DTJA 2Y4ZA 5DCKA 3DS3A 4QNBA 3RG6C 4COCA 3CCVP 1JJ2O 1RO2A 3H0DA 3Q20A 3CC2P 1EM9A 2M8PA 1QRJA 4U0DA 2JO0A 4GR2A 4LQWC 3CMAP 2PWOA 3CCQP 2OTLP 2V4XA 3LRYA 4U0CA 5HGKA 1A43A 1G03A 2X83A 1IUQA 1K30A 3G0VA 3G29A 1A8OA 1VQOP 1KD1Q 1EIAA 2XDEA 1RNIA 1ZMBA 3CCJP 3B5IA 1D1DA 2JYGA 1Q82Q 1N8RQ 3DS0A 1M1KQ 3DS2A 2JPRA 4E91A 4WYMA 4INBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGF A;  5HGN A;  1EOQ A;  2M8N A;  4J93 A;  4IPY A;  5I4T G;  1AK4 C;  5HGM A;  1GWP A;  2JYL A;  4PH1 A;  4NX4 C;  4DGA C;  3G1I A;  1M9C C;  1M9E C;  4U0B A;  1M9Y C;  3P05 A;  2EIA A;  2XXM A;  3NTE A;  2KOD A;  4E92 A;  3VRL C;  2WLV B;  5HGL A;  2XV6 A;  4XFZ A;  2PXR C;  2GON A;  2WLV A;  4PH3 A;  2GOL B;  3G28 A;  1M9D C;  4B4N A;  2PWM A;  3DS4 A;  4XFY A;  1AUM A;  5HGO A;  2X2D D;  2XGU A;  4M0I A;  2XGV A;  3G21 A;  1BAJ A;  4XRO A;  2L6E A;  4PH0 A;  1E6J P;  3H4E A;  3DPH A;  4XRQ A;  1M9X C;  3G1G A;  2M8L A;  4PH2 A;  1AFV A;  2LF4 A;  4DGE C;  2ONT A;  4XFX A;  2XT1 A;  4COP A;  1P7N A;  1U7K A;  3BP9 A;  3G26 A;  4U0A A;  4HTW A;  1M9F C;  3DS1 A;  3DS5 A;  2XGY A;  2BUO A;  3MGE A;  3H47 A;  4U0E A;  1L6N A;  4U0F A;  5JPA A;  2X82 A;  3DTJ A;  2Y4Z A;  5DCK A;  3DS3 A;  4QNB A;  4COC A;  1EM9 A;  2M8P A;  1QRJ A;  4U0D A;  2JO0 A;  4LQW C;  2PWO A;  2V4X A;  3LRY A;  4U0C A;  5HGK A;  1A43 A;  1G03 A;  2X83 A;  3G29 A;  3G0V A;  1A8O A;  1EIA A;  2XDE A;  1D1D A;  2JYG A;  3DS0 A;  3DS2 A;  2JPR A;  4E91 A;  4WYM A;  4INB A; 
#chains in the Genus database with same CATH topology
 2FAD A;  2FHS C;  1EOQ A;  1VQ7 P;  4J93 A;  2MR7 A;  4IPY A;  5I4T G;  2LPK A;  5HGM A;  2PEJ A;  4H2X C;  4NX4 C;  2AFE A;  1QVG O;  3P05 A;  2EIA A;  1VQM P;  2N5I A;  1CEI A;  2XXM A;  1L0I A;  2EHT A;  2NO8 A;  2PEI A;  2K0D X;  1VQL P;  1KLP A;  2PXR C;  3M1M A;  1S72 P;  2GDW A;  1M9D C;  2XZ1 C;  1M90 Q;  2Z44 A;  2JB0 A;  5HGO A;  2KGA A;  2KOQ A;  1VQ9 P;  2VLP A;  2Z45 A;  2XGU A;  4M0I A;  3G21 A;  1BAJ A;  2L6E A;  2VSQ A;  1YJW P;  4PH0 A;  3EJB A;  3CD6 P;  2KOP A;  4H2Y C;  1YHQ P;  2GZE A;  2LIW A;  3GZM A;  1M9X C;  2M8L A;  1AFV A;  5CZD B;  1VKU A;  1YJN P;  4COP A;  2FAC A;  3BP9 A;  1Z6M A;  3CCM P;  4U0A A;  1M9F C;  7CEI A;  2JU2 A;  3DS1 A;  3G4S P;  3MGE A;  2PEK A;  2FQ2 A;  5BS2 A;  1L6N A;  2L4B A;  2AVA A;  2X82 A;  1IMQ A;  1GXG A;  2K93 A;  5DCK A;  2ROQ A;  4MRT C;  2GDY A;  1HQB A;  4LQW C;  2V4X A;  1A43 A;  1G03 A;  1UNK A;  1A8O A;  1ZMB A;  3CCJ P;  1ACP A;  1M1K Q;  3DS2 A;  2FQ1 A;  4E91 A;  2DNW A;  1W2B O;  1DNY A;  2KGF A;  2PEN A;  3LMO A;  2MVU A;  3EJD A;  2K94 A;  5HVC A;  1YIT P;  3CCR P;  1K9M Q;  3G1I A;  2KOO A;  2CGQ A;  3CCS P;  1RO0 A;  2KOD A;  1KQS O;  2M5R A;  2EFJ A;  4PH3 A;  2P9X A;  2GOL B;  3I56 P;  3G6E P;  1YJ9 P;  1YI2 P;  2K92 A;  1K8A Q;  3CCE P;  1DV5 A;  2OTJ P;  3OW2 O;  4NEO A;  3CC7 P;  2N6Z A;  2VLQ A;  2KG6 A;  2CWO A;  2LF4 A;  4PWV B;  2ONT A;  2PEQ A;  4XFX A;  2XT1 A;  4BPH A;  4UHP B;  1HY8 A;  3G26 A;  2JAZ A;  5F2N A;  2EG5 A;  2WPT A;  3GKL C;  1VQP P;  2LIU A;  2JU1 A;  5F2O A;  1T8K A;  3CPW O;  2EHS A;  2XGY A;  1M6E X;  4U0E A;  4BPF A;  2KWL A;  2BHV A;  4U0F A;  2KGD A;  2GZJ A;  1VQ5 P;  4H2W C;  4COC A;  1JJ2 O;  2K2Q A;  1GPJ A;  4U0D A;  4BPG A;  2CNR A;  2MD9 A;  2QNW A;  2MVV A;  1IMP A;  3G0V A;  2L0Q A;  1EIA A;  2KG9 A;  2JYG A;  2PNG A;  1Q82 Q;  3DS0 A;  4WYM A;  1FR2 A;  2K0Y A;  1KC8 Q;  3CCL P;  2N50 A;  3GZL A;  1E0H A;  1X3O A;  1AK4 C;  2JYL A;  2KGE A;  2X2B A;  1M9C C;  1M9E C;  3CE7 A;  4R0M A;  2WLV B;  4XFZ A;  2GON A;  2WLV A;  2PEO A;  5F2K A;  2KR5 A;  4XFY A;  1AUM A;  2CG5 B;  2GZI A;  1M6N A;  1GXH A;  2FVE A;  4CA3 A;  2XGV A;  2MF4 A;  4PXH B;  2K0X A;  2QEX P;  1VQK P;  5BS1 A;  3EJE A;  3G1G A;  3RG2 A;  2DGY A;  1Q7Y Q;  4DGE C;  1OR5 A;  2KGC A;  2FVF A;  2LKI A;  1P7N A;  2N6Y A;  1BXI A;  2GDX A;  3CC4 P;  1YIJ P;  3DS5 A;  2CQ8 A;  3H47 A;  2GZG A;  1Q81 Q;  2GZF A;  3CCU P;  2AF8 A;  5KP7 B;  5JPA A;  3U43 A;  2AFD A;  2ERH A;  3DS3 A;  4QNB A;  5EW5 E;  3Q20 A;  3H0D A;  1EM9 A;  2VLO A;  1L0H A;  1EMV A;  2FVA A;  2GYK A;  2OTL P;  3CMA P;  2PWO A;  3LRY A;  3G29 A;  2XZ0 D;  4U0C A;  5HGK A;  2X83 A;  1IUQ A;  1K30 A;  1VQO P;  1KD1 Q;  3B5I A;  1D1D A;  2FAE A;  1ZNV A;  2JPR A;  4INB A;  3G71 P;  5HGN A;  2N98 A;  2JBG A;  2M8N A;  1QVF O;  5HV8 A;  2PY8 A;  3HZQ A;  1GWP A;  4HKG A;  4PH1 A;  2MR8 A;  5KP8 B;  2LL8 A;  4DGA C;  2LTE A;  4U0B A;  1VQ4 P;  3WBH A;  2JQ4 A;  1M9Y C;  1AYI A;  3NTE A;  4E92 A;  3VRL C;  5HGL A;  3E2D A;  2XV6 A;  2KOR A;  2KOS A;  1NJI Q;  1Q86 Q;  3G28 A;  4GR6 A;  4B4N A;  2PWM A;  3DS4 A;  3I55 P;  2L9F A;  2PEM A;  3CXC O;  2X2D D;  1VQ8 P;  1MZ8 A;  2MY5 A;  1NQ4 A;  4IZ6 A;  4F37 A;  2Z46 A;  4XRO A;  3CME P;  3HYB A;  1E6J P;  3H4E A;  5KP6 B;  3DPH A;  4XRQ A;  4PH2 A;  2OAR A;  3GJN A;  1VQ6 P;  5EJD A;  1K73 Q;  1U7K A;  2L22 A;  2QA4 P;  4HTW A;  3B4Q A;  2K5X A;  2N5H A;  2KG8 A;  1VQN P;  2BUO A;  2E1M A;  2KW2 A;  1M74 A;  2FQ0 A;  1UJZ A;  1F80 D;  2LOL A;  3DTJ A;  3NY7 B;  2Y4Z A;  3RG6 C;  3CCV P;  1RO2 A;  3CC2 P;  2M8P A;  2LML A;  1QRJ A;  2JO0 A;  4DG9 A;  4GR2 A;  2JGP A;  3CCQ P;  4QKO A;  2VLN A;  2XDE A;  1RNI A;  1N8R Q;  1VHN A;  1AF8 A; 
#chains in the Genus database with same CATH homology
 3G71 P;  2KGF A;  5HGN A;  2PEN A;  1EOQ A;  1KC8 Q;  3CCL P;  2M8N A;  1VQ7 P;  4J93 A;  1QVF O;  4IPY A;  2PY8 A;  3HZQ A;  5I4T G;  1AK4 C;  1YIT P;  5HGM A;  1GWP A;  2JYL A;  2PEJ A;  4PH1 A;  4NX4 C;  3CCR P;  1K9M Q;  4DGA C;  3G1I A;  1M9C C;  1M9E C;  4U0B A;  1VQ4 P;  3WBH A;  1QVG O;  1M9Y C;  3P05 A;  2EIA A;  1VQM P;  3CCS P;  2XXM A;  1RO0 A;  3NTE A;  2KOD A;  4E92 A;  3VRL C;  2WLV B;  2PEI A;  5HGL A;  1KQS O;  3E2D A;  1VQL P;  2XV6 A;  4XFZ A;  2PXR C;  2EFJ A;  2GON A;  3M1M A;  1NJI Q;  2WLV A;  4PH3 A;  1Q86 Q;  2P9X A;  2GOL B;  3G28 A;  1S72 P;  2PEO A;  4GR6 A;  1M9D C;  4B4N A;  1M90 Q;  2PWM A;  2Z44 A;  3I56 P;  5F2K A;  3G6E P;  3DS4 A;  4XFY A;  1AUM A;  5HGO A;  1YJ9 P;  3I55 P;  1YI2 P;  2PEM A;  3CXC O;  1K8A Q;  1M6N A;  1VQ9 P;  2Z45 A;  2X2D D;  2XGU A;  3CCE P;  4M0I A;  1VQ8 P;  2Z46 A;  2XGV A;  3G21 A;  1BAJ A;  4XRO A;  2OTJ P;  2L6E A;  1W2B O;  3OW2 O;  1YJW P;  3CME P;  4PH0 A;  3HYB A;  1E6J P;  3H4E A;  2QEX P;  1VQK P;  3CD6 P;  5BS1 A;  3CC7 P;  3DPH A;  1YHQ P;  4XRQ A;  1M9X C;  3G1G A;  2M8L A;  4PH2 A;  2CWO A;  1AFV A;  2DGY A;  2LF4 A;  2OAR A;  1Q7Y Q;  4DGE C;  2ONT A;  2PEQ A;  4XFX A;  2XT1 A;  1YJN P;  4COP A;  1VQ6 P;  1P7N A;  1U7K A;  3BP9 A;  3G26 A;  3CCM P;  2QA4 P;  4U0A A;  1K73 Q;  4HTW A;  2EG5 A;  5F2N A;  1M9F C;  1VQP P;  1VQN P;  3DS1 A;  5F2O A;  3CPW O;  3CC4 P;  1YIJ P;  3DS5 A;  2XGY A;  2BUO A;  3MGE A;  2PEK A;  3G4S P;  3H47 A;  2E1M A;  1M6E X;  4U0E A;  5BS2 A;  1L6N A;  1Q81 Q;  2BHV A;  1M74 A;  3CCU P;  4U0F A;  5JPA A;  2X82 A;  1VQ5 P;  3DTJ A;  2Y4Z A;  5DCK A;  3DS3 A;  4QNB A;  3RG6 C;  4COC A;  3CCV P;  1JJ2 O;  1RO2 A;  3H0D A;  3Q20 A;  3CC2 P;  1EM9 A;  2M8P A;  1QRJ A;  4U0D A;  2JO0 A;  4GR2 A;  4LQW C;  3CMA P;  2PWO A;  3CCQ P;  2OTL P;  2V4X A;  3LRY A;  4U0C A;  5HGK A;  1A43 A;  1G03 A;  2X83 A;  1IUQ A;  1K30 A;  3G0V A;  3G29 A;  1A8O A;  1VQO P;  1KD1 Q;  1EIA A;  2XDE A;  1RNI A;  1ZMB A;  3CCJ P;  3B5I A;  1D1D A;  2JYG A;  1Q82 Q;  1N8R Q;  3DS0 A;  1M1K Q;  3DS2 A;  2JPR A;  4E91 A;  4WYM A;  4INB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...