3H4IA

Chimeric glycosyltransferase for the generation of novel natural products
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
399
structure length
392
Chain Sequence
GVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAGAREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYRYTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLAADPVLSPLRPTDLGTVQTGAWILPDQRPLSAELEGFLRAGSPPVYVGFGSGPAPAEAARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLFGRVAAVVHHGGAGTTTAVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTPTVESLSAALATALTPGIRARAAAVAGTIRTDGTTVAAKLLLEAISRAKLAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chimeric glycosyltransferases for the generation of hybrid glycopeptides
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
molecule keywords Glycosyltransferase GtfA, Glycosyltransferase
total genus 134
structure length 392
sequence length 399
ec nomenclature ec 2.4.1.311: dTDP-epi-vancosaminyltransferase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4iA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4iA02
2G9RA 3T3GA 2AMVA 2VCHA 3MQFA 1AHPA 3NC4A 1C8KA 1P4HA 1GFZA 3CUUA 5JTTA 1JIXA 3COPA 2QN9A 2R60A 2FETA 1KTIA 2XGMA 2C4MA 2JLBA 4MHOA 3QHPA 1YA6A 2XMPA 1QKJA 3NP7A 3OTGA 1Y8ZA 3NCHA 1XC7A 3C48A 2F3QA 3L01A 1NZFA 5I45A 5D00A 3ZCUA 3NB0A 4GZ6A 5HXAA 1WW2A 3VUEA 5DLDA 3IA7A 3OKCA 2PYDA 2GPBA 3T3IA 2AZDA 4AY6A 3T7DA 3PE3A 3T3EA 3DDSA 1WUYA 2F3PA 2ECPA 1J39A 3WAGA 3CEHA 3VDMA 4M7PA 4GPBA 4RIGA 2OFFA 3S28A 4MI6A 1HLFA 1BX3A 3G2KA 4YI5A 1L5RA 3MRVA 2QRMA 4EKEA 4CTNA 1F0KA 4EL0A 1RZVA 1L7XA 1JIVA 3HBMA 3VDNB 3BCSA 3E3NA 4NESA 1GPAA 1Y6GA 3AMVA 1P2GA 3Q3EA 3CUTA 3BD6A 3TSAA 1NOJA 3EBPA 2R68A 2QN3A 4GZ5A 3DZCA 1FU8A 1RRVA 2C1XA 2FF5A 4KQ2A 1UZUA 2QN7A 4M83A 2QRHA 3GUHA 1SXQA 2ZB2A 3BCUA 1JG6A 2XGSA 5LQDA 1P4JA 4GYYA 4F97A 1Z6QA 3RSCA 2GPAA 1SXPA 2GPNA 1RZUA 1LWOA 1P29A 4X7PA 2XCIA 3O3CA 2QN2A 1C50A 4EJ2A 2QN1A 4AMGA 2AW3A 1K08A 3NPAA 3OT5A 1C3JA 3S2UA 2QLMA 3OY2A 1L5VA 2X0DA 3ZCTA 5JTUA 2IYFA 2QRPA 1PYGA 1Z62A 3L7DA 3C4QA 3OTIA 5TMDA 2QZSA 6GPBA 1PNVA 1O6CA 2XA2A 1LWNA 1C8LA 2PQ6A 4PQGA 4LDPA 4BQEA 1GGNA 4MI9A 4WACA 1H5UA 1B4DA 4RELA 3C4VA 4GZ3A 4RIIA 3MS2A 3MTBA 1FU7A 3HBJA 2AV6A 3CUVA 4BQFA 1UQUA 2ATIA 1NOIA 3CUYA 4RIHA 4GYWA 4KQ1A 4RBNA 8GPBA 4YI3A 1AXRA 5IKPA 2ACVA 4N3AA 3EBOA 5TMEA 3GPBA 3MRXA 4MHSA 3BD8A 4AN4A 4F96A 2BISA 4EL5A 1L5WA 1F6DA 3G2NA 2VG8A 3DD1A 1V4VA 3CX4A 2XA1A 3L7CA 1QM5A 2IEGA 1NOKA 4KQMA 3Q3HA 2GT1A 1GPYA 4G2TA 3OY7A 3PE4A 4L22A 2VSNA 1E1YA 4XI9A 3H4IA 3D1JA 1XL1A 2VCEA 1GZ5A 4BFCA 3HBFA 1YGPA 2IUYA 3IAAA 3Q3IA 5IKOA 1IIRA 1JIUA 4CDRA 1Z6PA 2C9ZA 3T5TA 1K06A 4REMA 1NLMA 3MTAA 3H4TA 1JG7A 2ACWA 1IXYA 3SYRA 3NAZA 3VUFA 3L7BA 1XV5A 2GEKA 5TVGA 1EXVA 3G2LA 3WC4A 2VSYA 3S29A 3DDWA 2SKDA 1XL0A 2QRQA 3ZCRA 1E4OA 1WV1A 3BD7A 3D0QA 4RIEA 3MT9A 2JJMA 3QKWA 3BCRA 4QLBA 3RT1A 3TAXA 4EKYA 2F3SA 3BDAA 2F3UA 1GG8A 3MTDA 5C1DA 2C1ZA 1UQTA 2GEJA 2QLLA 2G9UA 1PN3A 4MRAA 2QLNA 4X7MA 3E3LA 3CEJA 4AMBA 9GPBA 4RIFA 2KS6A 4N39A 2IEIA 2PRJA 2SKEA 1FTYA 3L79A 1XOIA 2F9FA 2R4TA 1XKXA 3OTHA 1GPBA 1L5QA 2BGTA 3OKAA 4AY5A 4WADA 1WV0A 2YJNA 3RSZA 2IV7A 3UYLA 1FTWA 3CEMA 4CTOA 1M5RA 4X7RA 5D01A 4FKZA 2ASVA 2X6RA 3HBNA 1FC0A 4XIFA 1FS4A 4W6QA 3NP9A 4X6LA 2XCUA 2BGUA 2O6LA 3FROA 4WHMA 2IYAA 2G9QA 4YUAA 3SYMA 2BFWA 1EM6A 3CUWA 2H1HA 2P6PA 3MS4A 4N3CA 1Z8DA 2WTXA 1FU4A 3MT7A 4NC9A 1Y6FA 2SKCA 2X0EA 1A8IA 3G2JA 4N3BA 3E3OA 3OKPA 3WADA 2QN8A 4MI3A 3MBOA 1WUTA 3MRTA 3ZCSA 1NZDA 2HY7A 2FFRA 2G9VA 2X6QA 1L6IA 5TMBA 2IV3A 3T3HA 1JEJA 3ZCVA 4BQIA 2PYIA 3G2IA 3CV3A 1FA9A 1P2BA 1VGVA 3MSCA 1PSWA 5GPBA 3S0JA 3T3DA 4NEQA 2GJ4A 3ZCPA 2XGOA 4M60A 4MICA 1ABBA 5DU2A 3G2HA 2Q6VA 1FTQA 2PRIA 2XA9A 2X0FA 5DXFA 3S27A 2GM9A 3D0RA 1P2DA 3TOVA 2R66A 1WW3A 7GPBA 3MT8A 1L5SA 4Z5XA 5BNWA 2R4UA 2QNBA 3UYKA 2H1FA 4HWGA 3ZCQA 2JZCA 3RHZA 1P4GA 5ENZA 1NVKA 3BEOA 3L7AA 2IW1A 4N9WA 4RENA 4F9FA 2QRGA 3MS7A 4FZRA 4HLNA 4LEIA 4CTMA
chains in the Genus database with same CATH superfamily
2H2IA 2AMVA 4MQEB 2E1RA 4R6XA 4EARA 5KWSA 4B09A 1FTSA 3QE4A 5KVVA 1AHHA 1W4ZA 3ZGXA 4NYIR 5J2UA 3GJQA 1KQGA 1JIXA 1FVXA 1NVXQ 3KDSE 4QJIA 5AKHA 1H4TA 4YQEA 3W5DA 4CN9A 3VJRA 4DA9A 1MA0A 2FETA 4Z7JA 2EJTA 5FR1A 2JGDA 4JB3A 3L7NA 2PH7A 3SYKA 2DF8A 1ZVVA 1EB9A 3GA5A 4XX0A 4IY1A 3FTNA 1NXSA 1YUNA 3WO1A 3M9XA 1B8OA 2AMLA 1I94B 2NUAB 3KJZA 4ZV7A 4YAEA 3WZMA 5AW7A 3WGQA 5LU8A 1J49A 3CTMA 4GQAA 5BUSA 1SELA 2YOFA 3R74A 3V1UA 1DMRA 4I1IA 4UXIA 2G25A 3E58A 1RHKA 3I39X 4JOBA 1UJ2A 2Z04A 4UATA 1IJBA 2OYRA 3WRXC 2NV6A 2O2HA 1AK1A 4NJEB 3ZWCA 3ZIDA 3AY6A 5ALHA 3A7EA 221PA 5FPTA 4DV2B 3K0FB 1QQTA 1ZEJA 2VXOA 1YRQA 4XSGA 2GFHA 4TV9B 1VYTA 1Q1NA 3PE3A 3T3EA 4Z2AA 2B1QA 1VLJA 4FJ1A 4PYOA 1JHOA 2B69A 4B3BA 4FOTA 2EERA 4RDIA 1FDRA 4GICA 1CS0B 4P58A 1KIAA 3NIGB 1E4EB 1G6KA 2GUGA 2XYPA 1MRNA 4RIGA 3WLJA 4DLTA 1M6NA 6Q21A 3VAZA 5GMOA 4OL9A 3LL7A 5D86A 1LVHA 3IIIA 1L8QA 4MPDA 2TSYB 5JFTA 5L4LA 2QAIA 4IDOA 1Y3IA 4JLBA 5B1DA 5TJ9A 4HUTA 1GLVA 3M1LA 1LS1A 5ILQA 4RZXA 1KC1A 1CUFA 4Q1CA 2HYDA 4TVBA 1FYXA 1K2VN 2ZIWB 5ITVA 2HBZA 5ESWA 3N1UA 5FKJA 1UKEA 2OFWA 3ONWA 4H60A 2VATA 4BU0A 3MLBA 2GNAA 2X4DA 2GXSA 3CXRA 4QRDA 3T3OA 4NE2A 2YZ2A 1V95A 5ECDA 3VDNB 3W3AD 1SXJA 1FP4A 4W63A 1EFRD 2XTNA 4NBKA 1I80A 2YIDA 1FDIA 5CVEA 1U9JA 2Q5CA 5M7EA 2OCAA 2YINC 1RCUA 2LV8A 2BH9A 3KQOA 3RYCB 1W7AA 1NP7A 5JHGB 3PTAA 2QTRA 3JQBA 4ZVKA 1PLLA 4IYRA 5E2BA 1XEAA 2O48X 2P6UA 5ILOA 4NKRA 4NNPA 1Y8QB 5LP6A 2AD1A 3NS7A 2UVDA 3AHHA 1NI4A 2P90A 3AEUB 1AGXA 3DKKA 1SXIA 3M6UA 1E2GA 2EG9A 2JH3A 3QU2A 2ZIXB 4RA6B 4BWGA 1SKYB 1O54A 5A9TA 5EP3A 1ADFA 3VZQA 3QLUC 2VP3A 2IXGA 2VPWA 2O2GA 2ZRFA 4OQ4A 3VYUB 1Z5NA 2OZLA 4MOWA 3RVBA 1PVVA 3L4KA 3W9UA 3PFFA 4AKEA 1JQEA 1MB4A 1F9AA 1UINA 2QD3A 2R6ZA 1TZMA 2FH5B 4RD2A 1RAHA 4RHFA 2NUBA 4L0DA 4GOLD 1VL1A 4UCXA 4OI0A 1P0MA 4HY3A 3AI2A 3RT7A 4U2EA 2BMDA 1QB7A 3DMTC 4K6OA 4LHWA 1DUSA 3T34A 3N6VA 3IERA 3Q9LA 5J4KA 1EFLA 4DXDA 4KNYA 3CNHA 1I14A 1CRWG 3C6ZA 4PTZA 4FQ8A 3GLIB 5JBQA 1L7MA 3LCRA 3MYYA 2OHJA 2CJXA 1W0JD 1WXXA 1TQ2A 2FFQA 4KO4S 2MSWA 1O96A 1IHYA 4HBZA 2IZ5A 1NW9B 5AKZA 1NP3A 1Y5MA 4C21A 1E1KA 1ZINA 5JSKA 2W6MA 4A0FA 4DSNA 2AB0A 2FP4B 4KVZA 3S4YA 3O3CA 4R2IA 5HILA 4QGBA 2B8EA 2QN1A 1TQHA 2ZYIA 1DCKA 2XF8A 4BP1A 5C8YA 1V8OA 4Z0TA 4JBGA 4CKEB 1P8AA 4JJGA 2W2XA 5IJWA 1SVUA 4O4JB 4WY8A 4X62B 4BASA 4INPA 1JJAA 1NJ5A 2R6JA 4ZK2A 3E1KA 1TD9A 4MUHA 3FWPA 3W8DA 3CHYA 4Y0VA 3Q7PA 4ARAA 1FZQA 1Z28A 1CY6A 2JZNA 2PVSA 1TA9A 1YI1A 3D4PA 3NVMB 3OPYI 1JI0A 3QMPA 1P73A 1CVIA 2OBFA 2AYXA 3LT5A 5JZSA 4LGCA 4X45A 2ZTHA 2KWIA 4RTSA 4LRYA 1GZSA 3B53X 4E94A 1W6UA 1U3DA 3C14C 4KAXA 1V1JA 1M2EA 3DZDA 1JKJA 3RC2A 3L4BC 2YFHA 4OL0A 3EZFA 1WS6A 3PQ4A 4BJ5A 2I2WA 3BHIA 5GINE 4FNGA 1BJKA 3EXG2 3GVIA 3UIEA 5A4DA 1H3NA 1ILEA 3OX1A 1TU3A 2CYCA 3EDMA 4R31A 5DJ5A 1L9KA 4EKGA 4ES6A 2FN3A 3AVWA 2O52A 5J1TB 4U63A 1J22A 1GQSA 2W2TA 4GZLA 3RKUA 1JEOA 4BV9A 1EFPB 2ZBDA 4RQUA 3LDGA 4R01A 1FFDA 2XNHA 2PCLA 3U5ZB 4W1SA 1WY5A 4U00A 3VPFA 3N59A 2RKOA 1AXRA 2PSEA 1REQB 1GN9A 1V39A 2X9VA 2IUTA 2QENA 3G17A 3KZ1E 2EKBA 1VPDA 1JAYA 4IFBA 3FOAA 3LECA 4LYDA 4WNAB 2G4LA 2Q5QA 2E4ZA 2IYNA 3AG6A 3MJVA 5G0TA 4GM0A 3WIDA 5A04A 1BWPA 3SXJA 1V8DA 4S0XA 5HJ5A 2G70A 3SS9X 1HO3A 1ZY2A 5GOZA 4D4IA 1WU8A 1ZOIA 2LKCA 1TUBB 4OHYA 2ZIVB 2Z5GA 4AKTA 1KK1A 1BX0A 4UBMA 3RLFA 3ZDYB 5KTRA 3K9BA 2GAIA 4AU1A 2YWJA 4NULA 1YONA 2IY9A 3ICWA 1V4VA 2E48A 4PEVA 1TJNA 2VAWA 5M2QA 2ET6A 3IVGA 2QIPA 1E3TA 4TS1A 2H31A 3TMAA 1NULA 3QEOA 1AHNA 3GMDA 4IPTA 4PLYA 4EHLA 2CLDX 1XYYA 1GV1A 3COJA 3ASVA 1NNUA 4GLFA 2XNSA 3CO5A 3O4RA 4G37A 4BU1A 4C7JA 4ENTA 3KWMA 5BXQC 3ZJVA 2EW2A 4PFQA 1AS3A 2IL1A 1JPVA 3EA5A 1W4AA 2PZEA 3R8CA 3K5WA 2NUAA 2OILA 3NDRA 4JELA 1U31A 3TPFA 1OXMA 4FDTA 4CV2A 3AOEC 3EXG1 3K9GA 4X66B 3BSWA 1N4AA 1B6SA 4Q7LA 1NVEA 2HQ1A 3V3TA 4KTVE 2IIBA 4MKHA 3ZXXA 5HKKA 2VJCA 3PWZA 4J29A 3UK1A 4DFDA 5BWLA 2I4OA 4QFMA 1SN7A 4AULA 2R85A 2R7NA 4P86A 2Y0EA 3PDWA 5E9WA 2WA1A 2Q3JA 1M10A 3ISTA 4HDRA 1Q0QA 4LHVA 4B4OA 1G3QA 4YJ3A 3T7SA 3HCPA 2WINI 3C16C 1CUIA 4REMA 1V45E 5J59A 2YZ7A 1K9SA 4PIMA 3RE1A 3D9QX 1TXGA 3PLRA 3GJ4A 4ENWA 4CEHB 2FEMA 2FPIB 2G08A 1A0OA 4GI2A 4GO1A 2BUBA 2Y1KA 1A9TA 3EPPA 3EIFA 4PPFA 3VUFA 3EGXB 2Q3EA 1ZRSA 1EFCA 1FQJA 1SUAA 3PD1A 3E0XA 2AOUB 4JJ7A 4QJBA 5K6AA 3K0CA 5H1YA 1V16B 1I30A 1VLHA 3CH4B 3KZOA 5AKXA 4UASA 1ZD2P 5CYOA 1FMFA 3HLYA 2DSTA 3C6YA 4WCDA 5IKXA 2Z6UA 1PX2A 3VJMA 4L9SA 4FN4A 1NJSA 1U8EA 4A73A 2FE1A 4QHTA 2R8RA 4QJ3A 3HDHA 4BKRA 4BX0A 3IBGA 1D1SA 4LXTA 2FSHA 1PZXA 4RGQA 1CDOA 4M86A 2ZJOA 2HSJA 3ZHBA 4XPZA 5MN5A 1V6CA 1T6BY 2DPGA 4WV3A 4ZARA 3MGBA 3VKHA 3ND7A 1EWQA 2V6BA 3NHRA 5JROA 4D6XA 4TSFD 4ZAFA 5K0FA 2NX2A 2KW5A 5DH9A 4Q12A 4X61A 1I3NA 1NF2A 4JVSB 3C74A 3KPWA 3VMFA 5LQAA 5FA6A 4LOJA 3Q87B 3Q88A 3CVWA 1HGXA 3BC1A 4ZRMA 2X3YA 3WL8A 3K8OE 4OLHA 3UICA 4RA6A 4B5LA 4C03A 2XQVA 3HK2A 5EWLB 3A6FA 2BLNA 1XLUA 1X8LA 4CMHA 3PWKA 3SS8A 1LBEA 2EZTA 4H6VA 1N3YA 1VHTA 4B7UA 5JEEA 1JPUA 1GAXA 3HA7A 5DIFA 5J4LA 5F9FA 5AVQA 2L42A 2G1PA 3HO1A 2PWPA 2O5CA 3LUCA 1NMXA 4CM9D 2NXWA 1GSIA 3G2MA 9GPBA 5JCXA 1GTJ1 3T7IA 4LWOA 4JEUA 2QUKA 3P27A 1JHQA 3CNBA 3THSA 5JJKA 3PXDA 4S1PA 1Q7TA 3SOZA 1DU4A 1PDWA 2PIDA 3K6KA 4XR4A 3RRYA 4RF5A 1PT9A 2RKWA 3EEYA 5KOHA 1EBUA 1PLJA 2Y76A 5C3UA 1UOOA 3CX8A 4QGHA 4MVWA 5LZ8A 3HJCA 1JIIA 3HNPA 1E64A 4KLRA 4YO7A 2IH4A 5ICCA 1DV2A 2Z95A 2CV0A 5E3JA 2PKRA 2WG2A 2BGTA 4QTYA 5DTQA 1WMFA 3VNBA 1MCZA 3RPEA 1FLNA 1H0KA 2CXXA 1JHAA 5BW4A 3PR3A 1ODKA 2C2OA 4S2UA 1DCTA 1FYVA 1XVUA 4A16A 3QOFA 4KAFA 1WSDA 2ARKA 4QIHA 1UPAA 5GIPE 3ZKAA 5I8ZA 4F7DA 3I8XA 4IEFB 5ALTA 1GNSA 3WGNA 2NNLD 3ESRA 2JGLA 4CMCA 3C3JA 2DEUA 3KKOA 4L0QA 1CLUA 4BNDB 3VAYA 2OECA 4FMCB 3FJYA 4J0IA 4RESA 4X7RA 1GKLA 1PFUA 3SX4A 4FKZA 1E92A 4FWBA 3GLHB 2BR3A 5E6SA 2V0NA 5HBRA 3TLZA 3VO9A 3K6SA 2YYAA 4EENA 2WC1A 2Q1YA 5KSPA 1JZSA 2GVDC 4XIFA 1ZZEA 3MIZA 1XCPA 4UTZA 5JAUA 3OOYA 2I62A 2Y0BA 4TTAA 2FK8A 4X3PA 3E4CA 3DMPA 4GDMA 4AI6A 4K05A 3NWPA 3E03A 1DJLA 4BFSA 2DKNA 2ZIZA 3LL4A 3QW4B 1UWVA 1N7GA 2NVUA 5JAZA 3CVVA 1P1FA 3I6IA 2RB4A 1GFWA 2C2XA 2P9YA 5BNFA 3RTEA 2XE6A 4U2BA 4YRIA 3AKYA 3LP6A 4N3CA 1L7EA 1MQ8B 3W77A 2XKJE 4L7VA 3GJ5A 4JODA 1HZJA 2F3RA 2J0UB 3AV0B 4M6WA 1OXSC 1A8QA 4B32A 4DCJA 3X1ZA 4DYHA 5DB4A 4P34A 1FDWA 1OA0A 3D2LA 4KIFA 4P82A 2YHSA 3H6HA 4EKDA 2CFIA 6ABPA 3JZFA 1K8QA 1CZUA 2REQA 4YASA 3T7CA 3FNEA 2CF5A 4M9QA 2FEOA 1WHSA 4MDEA 5JANA 5E7JA 1WULS 2VK4A 2AUTA 2DFPA 2G0NA 3K70B 2L69A 3ACBA 4M0MA 3AM5A 2BF4A 4HFMA 4BZZA 3PB3A 4FMPA 2GN9A 1Z5OA 2IEBA 1NC1A 4HH1A 4I9NA 2HK8A 4F5DA 2FFRA 1XKLA 4CDGA 1RJDA 4JI8B 1K63A 2H9AA 2X13A 3GJXC 4FCTA 4L9WA 2CY0A 4UCWA 2PMEA 3DCNA 3WIEA 3ORHA 2WIAA 2QEQA 1QO7A 1KXJA 1YS9A 2MSLA 3V8QA 5LLDA 3VNVA 2FPPB 2QM8A 3NOOA 4IM7A 4NOMA 5JXHA 3P45A 2P4UA 4DA6A 4LF9B 5B57C 4ZEXA 4FZ3A 3G2IA 4CM9A 2QE7A 4M76B 2NU6A 2D1RA 1MG0A 4WDQA 3OPVA 2DTXA 2X23A 5H16A 1M2HA 5LBTA 3S0JA 4FE3A 3S2YA 5A9SB 1ML3A 4LGMA 5JSYA 2AKEA 2BTOA 4MR7B 3ZCPA 1NPDA 4TLCA 3HDJA 5AOCA 3TGPA 5EUBA 4QYIB 2P5SA 4AG3A 1FYDA 3PUXA 4LJLA 4DC1A 4YDHB 2BFAA 5AUPB 3N2YA 1GDTA 3CINA 1OUMA 4G1VA 4KQXA 2PRIA 4LV6A 1Y8AA 2NWQA 4QTZA 1WQ4A 1T3HA 2RC5A 4EMUA 3GLGA 2PGJA 4E11A 2N75A 4NZ9A 1YDGA 4CIBA 2IOFK 2YHAA 1OLUA 3W7VA 3PX7A 1KI3A 2JI7A 1C7IA 3T1VA 3ZXUB 1AH2A 3UT5A 2KB0A 1GZ4A 1I4DD 1Z33A 1R9NA 4IP0A 2QSUA 2CK3A 2OM2A 1QOPB 2QBYA 2QMEA 2Z83A 2IVFA 2B25A 1P0QA 3GW8A 4B8ZA 5JNRA 4G5OA 5EFZA 3T7KA 3WE7A 3JRNA 4A0GA 3LVFO 1T0UA 1QIIA 4L5BA 5FUVA 3VC3A 3B1KA 3P0IA 1TOAA 4MARA 4HDSB 3L77A 4R40A 3CRW1 3UMJA 5K01A 2NSLA 3MVEA 3REFA 5E9JA 3RI3A 4LRTB 4DMRA 5KQSA 2QHXA 4IBOA 4MS1A 2VSXA 1KAQA 3SF8A 3UF0A 3ZI0A 1ZMTA 3KQHA 3N5CA 1YBMA 3OCUA 4CEJB 5F3WB 3HWSA 4W99A 1QQAA 1WXGA 3CB4A 2E21A 4M2LA 5FL7D 3JQPA 3MWYW 4ZYVA 1C8KA 2QYOA 1XP5A 3D7LA 4PYRA 1V7CA 1FRFS 2OVBA 2WHYA 3I76A 4WA8A 1RHQA 2WP0A 1P31A 1EFRA 1Q74A 1QV7A 3GCXA 4IIVA 1NT4A 2D59A 1LCIA 3JPWA 1G8KA 3M7IA 1XD9A 1G59A 3DH0A 3ESAA 4YRKA 2ZCJA 1TT7A 4NABA 2RSLA 3KQSA 4G36A 4PLTA 3G1WA 1NN3A 1X0XA 3ZHRA 3EXEA 1CF2O 5EJ8A 2IVZA 5JO0A 4LFAB 3NP7A 2GEBA 4HVAA 1CY1A 2K2WA 1XC7A 2YYSA 3BGVA 3FPFA 3GRFA 3IV7A 3N7AA 4FN5A 4LSZA 1UOPA 4DMKA 4EWLA 3AFGA 3FWYA 4FMDF 3TCNA 1RRKA 1PL6A 3VNQA 1QYRA 4GKAA 4Z9FA 4MW6A 4ZA2A 1VTKA 3LE8A 1DAKA 1ODLA 1P1JA 3X1XA 3MIIA 1P6QA 2I9PA 4LHXA 2OQIA 1JKJB 1V2HE 2WSSA 3BKXA 2RG7A 2WSIA 4GXNA 4WLNA 4QM6A 4MKRA 5D5PA 4UE3S 5H81A 2QM7A 4B2IA 1X15A 2VAMA 3C8UA 4KXLA 3VPSA 4Q4LA 3TQIA 3KYCA 1OLOA 5IFKA 4B85A 2PVCA 5LDHA 1W34A 1L3IA 3NEAA 3HA2A 1E58A 1E0DA 4MK4A 2CMDA 3VBCA 1JDBC 1PQPA 1MB3A 1WB5A 2HA7A 1O97C 3NQ41 5T5QA 4JBXA 1PV4A 1HSZA 3VDMA 1KNQA 2W4MA 3OOEA 2IDKA 1EGAA 2R7AA 4HN4B 3WLQA 3VSEA 1TE2A 2QUHA 1G17A 1AY0A 1WF3A 2X22A 1GA6A 3IHLA 3OQBA 4RKRA 4WKNA 5FTNA 2AYZA 2B8NA 1BX3A 1REQA 2CJPA 3C2QA 1SBNE 3AETA 4Q21A 1IOWA 4RCZA 3T61A 3I2IA 3ES9A 1USWA 1J8YF 4TWIA 4R3WA 5IDXA 1O95C 2VNAA 4H4CA 2XYVA 4KODA 3V4FA 2J6HA 1WE2A 1Y37A 2E4YA 3DVQX 1QBGA 4BJHB 2PJRA 1T4GA 2V74B 3R3WA 3SE7A 1RVDA 2IA5A 4HK4A 1RKBA 1ECFA 1CQWA 1ZNXA 2O7SA 3D2BA 1KJNA 5LJIA 2HUPA 3KEQA 2X1HA 3COWA 2VPQA 5FCDA 1GLNA 2HLPA 4ZOLF 3UA4A 5C8DA 1Q0RA 2GETA 5J4VA 3ZZMA 3R7FA 1IWBB 2V7PA 3O75A 1B8PA 2GS9A 1A2QA 3USES 2O8DA 3ZWMA 4H15A 4WZBB 1QPGA 1LTQA 3ZXSA 3Q6NA 4Q93A 4F5ZA 5B2EA 1D1TA 2R68A 3O82A 4FYPA 3L6DA 1BHQ1 1O89A 4GZ5A 2IGBA 3AHJA 4MQ6A 1RQ2A 3PUIA 3RUIA 1QIGA 2CW5A 2ZE7A 2PX3A 5ALFA 4A91A 4RZ2A 4BGEA 2BYTA 4RE6A 2PN1A 2M32A 1CR1A 4KEAA 3AB7A 2ODAA 2P0AA 3SYNA 1NW4A 4R7GA 3AR3A 3G8AA 3I04A 4OQPA 3T1HB 5FJJA 2NSJA 4UQPA 3WGMA 2OBMA 4JT4A 3IHTA 3DEAA 4HH0A 1EESA 2AC2A 4L73A 4BNMA 3WJAA 5B1YA 2WVAA 5DULA 2IHVA 4JJAA 1DXOA 1QTNA 5TGZA 2ZUCA 3JARB 4NYMQ 3UENA 5JSHA 3JALA 5HZHA 4A6PA 1WHSB 1QK4A 2A67A 2DJ5A 1X8KA 4FC7A 4ERNA 3TLGA 4DV6B 1MZPA 1M5UA 2ZKIA 4YCDA 4FGWA 1BMQA 4JLNA 5I7RA 4KR6A 2DP4E 1S1CA 2HLDA 4N7BA 5FORA 2B8JA 4DKXA 5LIPA 3T1TA 1B8VA 2H1IA 2K87A 1H65A 4Q3CA 1Z4NA 1ZGZA 1QCZA 2AOUA 4I08A 2JI8A 2CE2X 1XDSA 3QNMA 1GNQA 5EVCA 4KTTE 1RM5A 5WRFA 3AVOA 3I53A 5CB4F 3L92A 3SBDA 4N47A 1KO1A 4JC8A 2C5EA 3A10A 2C5HA 1R66A 3PV0A 3ZBUA 3E1SA 2NXNA 4J90A 4PANA 1F51E 2XUFA 4P92A 1PNVA 1GQOA 2XMGA 3I2YX 5CJJA 1CZNA 3IIKA 2PD6A 4M1WA 4J0FA 4YNBA 5B6JA 3LYHA 1B6GA 3KNZA 3FNQA 4GOJA 3EQZA 5AVTA 4KRFA 1WMDA 2KBFA 1NXVA 1WRBA 3U7FB 3O8BA 4PSUA 2VT3A 3DE2X 3K72B 3BAFA 4HTFA 4I50F 4NZYA 1KU0A 1T15A 4RY0A 3UOGA 4CF3A 3D31A 3SVZA 4D9CA 3HGTA 3F9CA 1B2LA 4QUIA 1Z6ZA 4F1WA 2HCBA 4U7GA 1JHZA 1JQKA 3JTEA 1GL6A 1LVUA 4LXGA 1OLUB 3HGMA 1SCUB 4H18A 2AV6A 1I3CA 3DT6A 4O4HB 4ZOAA 4TS3A 3KPJA 3U81A 4PIVA 3UATA 3VKVA 1OXBB 3FFTA 1ODTC 2EDAA 5FL3A 3UMYA 5AM3A 4ND1A 1ZJ4A 4BKQA 5GJCA 4A8JB 4CF5A 3A3YA 1L4KA 3UJCA 1OHHA 1Z17A 2B8WA 2GN1A 3EUEA 3P0HA 3EZLA 1HDEA 1L3BA 5BWMA 1NUPA 3EHDA 4RBNA 2IOHA 3EIXA 4I19A 3B9PA 4HDSA 4Z53A 2QX7A 1A97A 3H1AA 4RSGA 3S99A 4HQOA 4DL9A 1XRQA 4BBPA 5JS1A 4EQZA 3QK7A 4AZ0B 2IZ6A 3HCBA 3MUNA 5TMEA 3RRFA 1CSEE 1UKAA 1U6JA 5JS6A 3ZQUA 4MDHA 1G8MA 121PA 1XFDA 2AX4A 2NTVA 2WIJA 3HUTA 3OJWA 3DQZA 4U8HA 4ZREA 5F23A 1NAHA 1YCHA 1MX1A 3P2KA 4G8JA 4HZUA 4OHRA 4PX3A 4LWZA 4CMIB 1CIPA 1DTEA 3C5CA 3ZVKA 1DQZA 2VDPB 1KFJB 2OV8A 4RM2A 2JGRA 1MR3F 4Y8VA 3DBLB 2NZUG 3R20A 1N8TA 3LC7O 3HVIA 4L4ZA 5BYAA 3AZOA 4G01B 3HJUA 1F5SA 1ZCFA 1XEXB 2WM9B 3PR2B 3SZGA 4BQOA 3EEFA 1ZK2A 2ACKA 2WZDA 3V7NA 4N41A 2NYUA 1JT9A 4K9RA 2ON6A 4IGFA 1MV5A 2H7VA 2ONYA 4EYOA 4JFRA 4R1TA 1BHSA 4LYHA 3ZQJA 4I5GA 1OPRA 4XI9A 1Y9ZA 4X1IB 5HOEA 1KP2A 1LC3A 1M6YA 3IQGX 3EFOA 2LRHA 4IHQA 4UU7A 1ODCA 1MEEA 4ZKEA 3WWEA 3ZZ1A 3GGGA 4BNVA 4GEGA 1E8MA 4BNWA 5IC6A 4YVFA 1C9YA 3DFZA 4S1TA 4BAZA 1KE2A 2PUFA 2ZUSA 4BVEA 3N2GB 3AJRA 3RREA 5C51B 1T36A 2Q5EA 4MW4A 3L6UA 4C4ZA 2FPKA 3Q0TA 4LY0A 5FAXA 1XJ0A 4YMHA 3OEEA 1E1CA 2RHBA 2BDUA 2PS3A 3WL5A 2EKPA 4L2IB 1CRQA 5CM8B 4FHCA 2DBZA 3GT4A 3N9IA 5JNSA 3GFBA 2OT3B 4FU0A 1XZCA 5T8KA 3WA6A 2J0UA 4M6WB 1UPXA 2KMLA 1D2RA 4JX8A 2ZT6A 4OI4A 3HKDA 4OXXA 4TMZA 5MHTA 2AN4A 1XMQB 1CUGA 4HXYA 4OXIA 1DBIA 4U2DA 1LTKA 4YUYA 3U44B 4MNTA 5CHYA 1FNBA 1H2EA 1TM4E 5ALRA 3B3GA 2NZYA 3G6KA 1YUBA 1ZM4A 2AXEA 2CDAA 3RJZA 1XTBA 3NT2A 4FVTA 5G1OA 3M3PA 1NM5C 1E2QA 1WG8A 2Y2VA 5K6TA 3SFVA 4N8DA 3T7TA 4YJ2A 1U5AA 2E5FA 2QRJA 4JI2B 1T5DX 3WL3A 3HWWA 5TARA 4JQZA 1LLUA 4R2XA 3UCFA 1MJNA 5B7GA 3AB3A 3QE2A 1UK9A 2GNOA 1A2OA 2CHGA 3VU0A 3FBGA 4A8JC 3AP3A 2BTQA 3SZOA 4RPIA 2YYYA 3CKYA 2OXFA 3ABOB 3G0DA 5DBGA 1N9GB 1YSCA 2XMDA 5DLYA 3FXAA 3ZU2A 2BR4A 4AWXA 3PCTA 1QIKA 1S89A 4J16A 5IUNC 4I1VA 2AC7A 3AEQA 3ONNA 4QYIA 1UDCA 1U2DA 1EK5A 2NG1A 3CLVA 3WKCA 2XWQA 1F2VA 4CM4A 4XIYA 4YV0A 3KQVA 5TB5A 2FTKE 2ZQ5A 4JSYA 5FOSA 2ZANA 2PUEA 3L05A 1C4WA 1IN4A 2YY5A 3NG1A 2DFKB 2NVWA 1OBCA 3MGGA 2B4RO 3H19A 5HCNA 2IPNA 3T94A 5AW5A 1SIOA 3IEVA 2GOYA 1KYIA 1H2AS 1Z6XA 2GN4A 4WLFA 3K1JA 1LB1B 1NQTA 1YDMA 2LTAA 1JR6A 4Q4JB 1NQVA 4X00A 1KMNA 5UKDA 3V48A 2M2IA 4AJEA 5KOJB 1N2IA 1CV2A 2SKEA 2PXCA 4KN9S 5FTWA 2ZTVA 4HADA 3LFTA 1QF7A 2R1ZA 3LZ6A 2QDXA 4KQJA 3QKSB 5KVQA 1XKXA 4URUR 5A6SB 5LBUA 4YRMA 1KBOA 3SD7A 3U4GA 3HDYA 1AUPA 1DG1G 3IEIA 3FTFA 3SP1A 4L6IA 1XLVA 4BN0A 3MG9A 3TD2A 3GJ3A 4EJMA 1YJAA 3NH9A 3OU6A 2QGFA 4EY7A 1YRLA 2XRYA 5BURA 1IZYA 3OIDA 4DPLA 1YZTA 1D1QA 4FLEA 1VHDA 1ZVMA 2HO5A 1S96A 1N7HA 1W581 1I3LA 2PAAA 3EQ2A 4UD2A 3G79A 3SYTA 3V7FA 4BTLA 1XZHA 4CEJA 1E2LA 3D5TA 5KREA 2QR5A 1MGPA 3PYLA 3UV3A 1EJBA 4HGQA 1JALA 4CMJA 2HJSA 1IBKB 3OIYA 4KFRA 4W1RA 2MYTA 4US1R 3RUAA 2V4UA 1IY0A 3RC7A 3DAYA 1L6RA 1PR5A 2JCXA 1CB7A 1EVQA 3E5NA 3I6MA 1TRHA 3P96A 3RYCA 4MV3A 4DG8A 1B3RA 3NV7A 3ICPA 4N0MA 4YHBA 1MC5A 2A0UA 1KARA 4R5MA 2FDCA 3CUSA 4BVJA 3NBZC 1G7SA 2R8PA 2XCUA 1QWSA 2HSDA 2OY0A 2ZYVX 3AONB 2XQKA 4RHTA 1SVOA 3OM0A 4WTOA 5LP6B 2J6CA 1XDGA 1W94A 2PGLA 3UFXA 5BSWA 2DUNA 4IZIA 2QTBA 3W6NA 1K7EB 5DCUA 3GEIA 3FUXA 2D1TA 4Q82A 1QRSA 5KYWA 4BMOB 2JKVA 3IEPA 1CUWA 2HXGA 2EQAA 1NTOA 1YS7A 3LQ2A 4GT1A 3KKLA 3UUFA 5BV2P 1NIPA 3ZE1B 3W0LB 5ALLA 4CI0B 2NLOA 3NRCA 2CDRA 2QG4A 2VXCA 3QWBA 1YR9A 2P9ZA 4X65B 2ZSUA 1J09A 3ESBA 3QX8A 4LC0A 4Y9UA 1EUZA 1D5CA 1TZCA 4MW2A 5HFJA 4B46A 5CVJA 4UOEA 1JLMA 1AF7A 2NZVG 3OD5A 4RK5A 5C35A 1R8XA 4CQNA 3K9QO 4E14A 3IP7A 3RRJA 1Y7IA 1IM8A 1CULC 1DG9A 1JWBB 2X0KA 3GLSA 1AVTA 2JRCA 3OCVA 5EIWA 3FWKA 4BKPA 1QH9A 4BPRA 1N2EA 1JLHA 3D2CA 2QRKA 4GW3A 4ME6A 3EVDA 3CCFA 4NMHA 1CIVA 1N92A 2VH1A 4RCYA 4YWHA 2ZS7A 1XDUA 3U9TA 4DANA 4KO3S 5CURA 5DRYA 2ES4A 1W48A 3QPCA 2Z2KA 2IV3A 3DAFA 1RRPA 4F5WA 1P7ZA 3IBTA 2R8ZA 4X24A 2PYIA 5DBEX 2J0VA 2OHIA 3TG8A 1P1BA 1SBCA 3VR6D 1USIA 4LE0A 2Q4RA 2HRCA 1EB8A 3MBIA 1ZIXA 3PI7A 4ZCQA 4DPKA 4NYJR 1IU9A 2V65A 4J0CA 4C7MA 2GWHA 2OO5C 5JS8A 1CR6A 2JGKA 2SHKA 4H7EA 4TYMA 5ICFA 4V03A 3BWMA 2RBKA 4MUBA 4M9CA 4XWOA 4DVGA 2GUWA 4IHKA 2R6GA 1EVLA 1ZX1A 2O5VA 2ZFUA 2ZAYA 2ZBPA 4OAOA 2Q6VA 1NVAA 2QRZA 4BNUA 1E2EA 4OBXA 3WR5A 2DQYA 1NJGA 2H52A 1DCMA 1II0A 3PNBA 3PRHA 3GRKA 3L8CA 3R0QA 2EKQA 4MV9A 3WK6A 3FIUA 1KFCB 2GM9A 4MVJF 3PFCA 4W82A 3VNAA 2EW1A 1T3GA 4U7DA 1AB5A 1NMZA 2MDTA 2RI0A 3LX8A 4GNKA 2JLWA 2IYPA 5IDVA 3RRMA 4Z5XA 1RKUA 1BVYF 3BL6A 1HORA 3DDUA 4G4SO 4WMLA 2H1FA 4MJ7A 2NO1A 2A94A 3DPIA 4L28A 1JBEA 4OXRA 3BB1A 5FYDA 3HQ4O 4EITA 4E5UA 1IONA 4Q3EA 3PZBA 4UUPA 1U9IC 4TXMA 3VZDA 4PX9A 3NFRA 1ST2A 3L7AA 1RWOA 1UL1X 2DETA 4OU5A 1Q15A 4CKCA 4N1AA 5TC4A 5JMWA 3RJ9A 1QNFA 1QHHB 4R16A 3TKAA 1QZ3A 2C31A 2EGGA 2OP1A 3LHIA 4ISCA 5GONA 5H3LA 1S02A 2QPOA 3Q8XB 3RVMA 1CDZA 4ZJPA 2UUBB 3TH5A 2RHHA 5DZSA 1JU4A 1XZIA 4MCHA 4LJRA 1G16A 4BP8A 2H4HA 2FZLA 2OB1A 3AIIA 1NE7A 1T9DA 4MYHA 2G9RA 4OJNA 3GGDA 5KYTA 3VR2D 1CR0A 3M4NA 4X92A 3EGOA 3EQ8A 3OQPA 1RYBA 4L4RA 4QDUA 3ZE2B 4BMNA 2C97A 5KZMB 1UMBB 1P6XA 3FZQA 1CUCA 3S1LA 4EJFA 1RXVA 1ETHA 3A1SA 3PUJA 1SCKA 2QN9A 3OT1A 1Y80A 6CHYA 1PIWA 1YZKA 2BD0A 2W00A 2RAVA 3G6WA 1YBFA 3IMFA 4QGFA 1DOAA 4RD0A 2C4MA 4L5CA 2Q50A 4TRNA 4YJHA 5DHRA 2O2YA 5L53A 4N4AA 3L46A 5HF8A 1QQ6A 2A0KA 2CHUA 3WDLA 3K70D 1T0HB 2VQFB 5JRDS 3T38A 3IAS6 2GF0A 1JG4A 4PIPA 3GHYA 4E33A 5AO9A 4OSEA 1EP3B 2HQRA 1WO8A 3L5OA 3L9XA 4NK4A 2DLCX 3CE6A 1MW9X 5YASA 3DQQA 1KZ9A 3CNLA 1ZAYA 2ASEA 3O91A 3AVVA 1ZXXA 2NPIA 3UV6A 4EEZA 2FPWA 4X0EA 4CHGA 1CXZA 4YJGB 2WSLA 3VNRA 1P3DA 3OQ1A 5AIAA 1W85B 3WQRA 4EAQA 5TT1A 2JHFA 3V55A 4OHMA 1IBMB 5BQFA 4BCDA 1QMPA 2ZB3A 4IH4A 3U7QB 4D9FA 3BJEA 4TZ6A 1CY4A 3ME5A 5KOJA 3ZBQA 4ENUA 1M3SA 2PT7A 4EBBA 4YLYA 3F3YA 4L07A 1MJGA 1J39A 2P30A 3F5QA 5LUAA 5IK2A 3COZA 2SICE 4M7PA 2BKUA 4DXAA 1VCIA 2AQIA 1EP2B 4YQZA 3QTBA 4V0KA 2PS9A 3EVZA 1K7FB 3DW3X 4ILKA 1L4FA 3KFLA 3PQ6A 4OQQA 5C8YF 1QDEA 2PR7A 4A26A 5C5DA 4BC1A 2FN8A 3FOEC 1ZW1A 1ZC3A 2BOVA 4W5HA 2L2QA 3AK4A 5HIJA 2HH9A 1A7UA 4ESEA 1UIRA 1GVNB 4RVOA 4PICA 3ZV3A 3FNBA 3N70A 4GL2A 1U63A 3QF4B 3A05A 2PLRA 3AEKA 1XWFA 3AF1A 1R27A 4KDCA 4QXOA 5SY4A 3LU1A 1BEZA 1RPZA 1IVSA 2VYFA 3UAYA 3GRVA 4C7KA 4FYYA 2VK8A 5FWXB 5K0BA 3UCXA 3L7OA 1F8XA 4G5FA 1Z82A 1TVMA 3L4SO 4OOFA 3UHAA 3U09A 3KHKA 3ZWDA 4F2DA 3IMEA 4JVOA 3BD6A 4U7JA 3OECA 1A9XA 1UJBA 4TT8A 1X86B 2BHSA 1H2XA 4Z8XA 3SSNA 2FX2A 3ERCA 2IQIA 4PPYA 4KYTA 2WVHA 2GGSA 1D4ZA 3A4NA 3ZX4A 3WYDA 3ZIUA 3H04A 2N9UA 2Q3LA 4MX8A 3ADPA 1F06A 3HXKA 1W19A 3PGKA 4ENPA 3TN7A 4DABA 1EKXA 4XYMA 5E8JA 1F3OA 1WF6A 3D6VA 2IIPA 3H9UA 2ZZMA 4G0VA 1X7DA 3A6DA 4C0HA 4DY4A 1V8ZA 3KLNA 2ZB2A 3O0TA 4UVGA 4DN6A 4YXFA 2HADA 5BYKA 3BCUA 5BRNA 1EM8A 3WWZA 4ZEVA 1LLCA 1WX1A 1V25A 2EEPA 3X0DA 3D4NA 5J2TA 4LOAA 3L1UA 4JASB 1R50A 3QVVA 1DELA 2HBQA 2HSWA 2WMOB 1NNI1 5EVJA 3S2IA 2V9CA 4RZUA 4AT1A 4B6GA 1U0BB 4IZ6A 4JVLA 4ML3A 2AXNA 4N54A 5CU7A 2YW9A 3UOWA 4GUDA 1C81A 4QX6A 1IEVA 4HG2A 4BV8A 3LQYA 2JBAA 1RDFA 2O2IA 3V1MA 5JZVA 2M6RA 3DB2A 3QUCA 4IHJB 4TWRA 3F4LA 2G07A 1SCDA 2K7ZA 4WKBA 4Z1OA 1XF1A 3NDIA 4RORA 5BPHA 3FMFA 1C9NA 3EG9B 3EQ9A 1JB1A 5JTUA 1KYYA 3D3WB 1CW2B 5AHWA 2C9BA 4A2QA 3FCCA 3T1QA 2QTZA 5A3JA 2ZZKA 3REQB 2FHPA 4S3MA 2PQ6A 1OSNA 1YQWA 2SCUA 2Q9BA 4NAHA 2UZ0A 4YN3A 1ZH6A 1JIQA 5IVIA 2OV2A 2V5UA 3HEMA 2Y1GA 3DJFA 1OBFO 3C3EA 4HXEB 2POQX 3DWIA 1ZNYA 3H3XA 4B87A 1FU7A 5DGCA 3GQBA 3DBOB 5AQ1A 4FMCF 1WEKA 4HLUA 1YB1A 2WSMA 4QO8A 2P5YA 2VHJA 4I2VA 4GHWA 1KEUA 2P69A 4H31A 7AT1A 1SC4A 3JQQA 3KYDA 2X7JA 3H1PA 2VBCA 2ODQA 1QGAA 2XKKA 5FQOA 1VCOA 1P1KA 3V5NA 3LHSA 5LZ5A 1EVKA 5EE5B 2AEMA 1XTRA 3VBEA 1JS1X 5KMGA 1DQSA 2DKOA 1JXOA 4Q7MB 4US0R 4BQPA 5GV7A 3SE0A 3DZ8A 1Z5VA 4NK5A 4WT7A 1H4SA 4BMZA 1O08A 4HHEA 4CZ2A 4YRAA 2Q4OA 3LZDA 4OHWA 2GN2A 3KPYA 1D2NA 1PJZA 4LY9A 4QFCA 3EXFB 3KDPA 1JR3A 1XRSB 4UM7A 4Z6KA 3NIWA 3FVTA 2JJ2D 4GF5A 5TPZD 2I1QA 3M0EA 1ODJA 5BR7A 3QLVC 5F4ZA 3DNFA 2JFGA 4WVFA 4IWNA 2X5KO 4D82A 1QOQB 1JSCA 5A62A 4HAOA 1T5HX 3PXXA 4RK6A 1Q2UA 2W93A 4LXQA 1VRWA 5HM8A 3OT1B 4DYVA 1IUOA 5BOSB 4A3SA 1QHEA 4JBLA 4QOSA 1MO4A 2IEGA 2F62A 4YJHB 4CU5A 4DIBA 1FXUA 3P0RA 2BFEA 2I6FA 1GPYA 2KLHA 3A8TA 3MOGA 4FB5A 1YL5A 4B3HA 3Q0EA 2WILA 3L8MA 3RTCA 2N3ZA 3F3MA 4BKOA 2FLWA 2I8LA 2QQEA 4TPKA 3WVNA 4ALJA 3UJNA 1QSGA 2FZWA 3VTFA 1FUIA 4M0CA 1PGNA 3EAQA 4AZSA 2IY7A 3I04M 4LQCA 1YGPA 5DSXA 2VTBB 3ANTA 5A4JA 3QUAA 3OZEA 1I36A 1YNOA 4MH0R 4P4LA 4AJ4A 4CLHA 3Q3VA 4HP8A 4L5YA 3RGGA 1U3GA 1LJ8A 1OFIA 2O3RA 3H1GA 3T7RA 5BVGB 2FJPA 4QBIA 4NOKA 3I0MA 2UYYA 5HUQA 2OB2A 1W0KA 2JJYA 3U7QA 2IKSA 3COYA 2R48A 4HWKA 3N2IA 1V4NA 5K3FB 2V0CA 3L1KA 2Z3WA 1MD9A 3HRHA 1JH8A 4EVRA 2NQ2C 2B37A 2QLTA 4TQAA 4UJ5A 1NHWA 3CVXA 3FTCA 1R4NA 2VAPA 3KJNA 4II7A 5F12A 1YTUA 2H3EA 4BAGA 4ETIA 1NC3A 3HJFA 1ZNQO 2OCKA 2Z98A 4R8SA 4UBLA 5AKEA 2H51A 1ENZA 2D5LA 4QPPA 3MPUA 3WC4A 3ZY2A 2VSYA 4PZZA 5JAIA 5J5CA 5ICMA 1R8YA 4H4EA 4CCWA 4DNFA 4DLLA 4QWWA 4D0GA 4DCCA 3C3CA 5JCOC 4MJXA 4AS3A 2DQSA 3G9XA 3OLVA 2BJVA 1ZBDA 5ES3A 3FPAA 1N33B 3V46A 2D1FA 1IMJA 1N5IA 3A37A 4KPUA 4Z99A 4CM5A 4QREA 5IAAA 4WJLA 3BCRA 1XGKA 1CP3A 5F35A 1EXDA 3ZDFA 4W7SA 5EQFA 1RWNA 3JVVA 1J6UA 1U02A 3OZGA 4FSHA 5FWXA 3R7AA 1JUDA 2HRZA 5K3CA 1A5TA 1UOEA 2PT9A 3E05A 3ZVLA 2OQRA 3UJBA 2R8OA 3LKVA 3WGKA 1N0IA 1Z0KA 4JLOA 5J63A 2DPXA 4V0RA 2IEZA 2CNDA 4C3OB 3MWDA 3TE7A 1HQCA 3O21A 4EZIA 5KTPA 2C1ZA 1U9YA 2D4HA 1LRJA 1TEHA 2C2KA 4YBRA 5ALUA 4DUPA 3KSZO 4Q19A 3AVQA 5JWHA 4FIZA 1RBYA 2YXBA 3LT0A 4K9OA 4C0KA 3LRXA 5D3MB 1VIAA 4Q0MA 1Y1TA 2VT6A 4QBFA 1JYSA 4BNYA 3SFZA 3PPXA 4HDAA 4URZR 5TQ2B 1E2KA 4EX7A 4KN8A 1TX4B 1JLLA 2EX0A 1IHXA 1MC4A 3O9VA 4MA0A 3W8FA 2RK4A 2PZGA 2XT6A 2I2XB 3FVWA 4GVPA 2OWEA 1Q3HA 3ELDA 3PDIB 4IWYA 1EM8B 4MW0A 4P4NA 4R9VA 3VKGA 1PZNA 3DYVA 4NQZA 3EC7A 2Q3CA 2JI6A 2Y4NA 3CF4G 1VECA 2Z1MA 3KAQA 1FTYA 3PWSA 2EW8A 4OUDB 4P3YA 5TF0A 3I2JA 2ADFA 2WWTA 3O03A 2R4TA 3KC2A 4WA7A 4COOA 4LJ5A 1T3LA 3OZIA 4X90A 3A9TA 1NX9A 3EWNA 3IUSA 4JCCA 4WOJA 1TT5A 1XCOA 2AVDA 4MYSA 1SUDA 2NGRA 1I51A 3LZCA 1TEZA 4IRXA 5KJ1A 3UW3A 1E2BA 4HAWA 5HX7A 3A1DA 2HUNA 2BHNA 3TLYA 3LX5A 1WSWA 4GRAA 4MA5A 4X97A 3TCXB 3IB6A 2P2ZA 4IOJA 3W6UA 2PQ0A 4GQIA 3CW8X 3LDUA 3D3WA 3FMOB 3MA0A 1TYDE 4WZ6A 1HDRA 1C1HA 1WZCA 2C3MA 3IALA 1SUEA 3U39A 4ZYTA 4Z4EA 1SIBE 1TKCA 1ML4A 3T3PB 4XRGA 1GCGA 4LDJA 1AN0A 4D8XA 3H2SA 2PV0A 1NV8A 3IMCA 1GUFA 3K9FC 4UHHA 1LBHA 3U3ZA 4C0LA 1FDOA 4F3YA 1OF1A 4OTZA 2CDCA 3QV1A 4DS3A 4ZGWA 1PKEA 1W2HA 1CYDA 3F2IA 3HJAA 4LYEA 1QU3A 3CCBA 3PQ2A 3WIOA 1FVOA 4JVNA 5IXJA 1F7UA 3X1YA 3B8HA 5AJZA 1NZJA 3R6GA 1DOHA 5E6RB 3HXLA 3JRXA 5EHXA 3CIFA 3QVXA 4INAA 2O6LA 3IQIX 4PC2A 1AX9A 5B2FA 3L18A 3LC2O 4R0VA 5AWFC 2VHWA 3KUXA 2ZSIA 3LW8A 4C5CA 2J7PD 4EYGA 1XNRB 2OE2A 1R8SA 3OE5A 3PENA 3X1MA 1JJBA 2PUDA 2B4TO 4OP2A 1I10A 3IEMA 4KMMA 3O73A 1DQPA 3T0FA 4ZEMA 3U4CA 1Q50A 1XPOA 2R62A 3KYDB 5JD4A 1DRVA 4UU1A 3FE2A 4C2UA 1TNDA 4QATA 4XSHA 4C2TA 1G5QA 1UZLA 4JT2A 3BGDA 2VKTA 1GXSB 4BLSA 3SEFA 4QGSA 4KQIA 3P2JA 2YWEA 3PTLA 2X0EA 4JOQA 5ITZB 2OHVA 8OHMA 3UAVA 3TPCA 4QPDA 2LIPA 5HZKA 1SCAA 4CLOA 1IYZA 2UZIR 2PT5A 3EXFA 2IYWA 2G4CA 3M8KA 4FUTA 4X41A 3UGQA 4B4VA 5C53B 3VVCA 4FFBB 2PZBA 2H48A 4O4LF 2DTEA 4Y6LA 1E4EA 5IVPA 3BS4A 3SYLA 3U6BA 4B33A 2D3TA 5IN5A 2AZMA 2FSVA 2YW2A 2FWRA 4XB6B 1XDBA 1RKVA 3F5SA 3VO8A 1YVUA 4GZMA 1XRRA 1HI9A 2GDZA 1CEXA 1QH8A 3D4IA 4C1BA 1YAJA 5B3AA 1TD1A 3MAJA 4RPKA 3VHRA 1RM0A 1N3IA 4J94A 1NUHA 4K88A 2R6FA 5GJBA 5HRAA 1QV6A 4YR9A 4H08A 1C0EA 3R3VA 1MQ9A 3AF6A 3A28A 4ITVA 5F51A 1CJTC 1K9VF 1X1AA 4ND4A 4FB4A 9LDBA 3ICQB 1FFHA 2DHEA 4GVXA 1A96A 4X1YA 4A2PA 4CQJA 5FI3A 2ZRHA 3D7KA 1QHYA 1A8UA 1ZD5A 2G17A 3I6ZA 2P8JA 2PXHA 2CNLA 5BRJA 1ABBA 1JU3A 4IAOA 1F38A 1E5TA 4X1KB 1B15A 2P9TA 3UV7A 5AW1A 3GQVA 3PWTA 3L4JA 2JKYA 3GT0A 1RLIA 1YHYA 1ESZA 2OBLA 2BZ1A 1X1CA 2XA9A 4X8LA 2X0FA 1T9ZA 1A9XB 2VUTA 3HN6A 4CHTA 1TYEB 1BG6A 1WXEA 4FBMA 4JUIA 1DKLA 5DHFA 4FYKA 4PZ0A 4M98A 1YR1A 1SWWA 3VR4H 1LQTA 5C2JB 2H1LA 4CL0A 1L5SA 1UP7A 2JARA 2QXUA 2V5VA 2XBLA 1XRMA 5SZKB 4A8JA 1Q16A 4I4IA 2B20A 5K3FA 2R4UA 3EVAA 3HWX1 5BSUA 3UM9A 4IVNA 3NR2A 2G7MC 4A6EA 2C7RA 1K2WA 2AL7A 3HFGA 2I7DA 3E8XA 1RQLA 1IZ8A 2NPOA 1J2YA 3C3AA 3CUEF 3EVCA 3JQAD 1NYRA 3MPOA 3ISJA 3G8BA 3MWLA 3R23A 2P75A 4J9UE 3RHZA 3RVQA 5CDGA 4Y1GA 3GCZA 2XAAA 3I1YA 2X4GA 4Q02A 3M1YA 1SWVA 2CJWA 3EVGA 1VXRA 2CXQA 3F71A 1UR5A 4QXAA 4RENA 4RGBA 1QC5B 3VR6H 4AMVA 3AKDA 1Q1ZA 3FF4A 1ZA2A 3WLTA 2FZGA 3QYFA 5KWVA 3TYXA 4OLAA 2PUAA 3QY0A 1YBAA 4CTMA 1T35A 4Y18A 1TAHA 4WXHA 1EJ2A 3DQPA 1FTGA 2PEYA 2V6FA 5TEWA 2VJMB 5JWOA 3CZAA 2FP4A 3KAPA 4IKOA 5G40A 1U7OA 5LZ4A 3P9RA 3UO8B 1R6UA 1FUUA 5AVWA 1UJ4A 2BCGY 3NEJA 4RYDA 1UDXA 5AVSA 1PEKE 2QI9C 2D5CA 4OHBA 3AB8A 1H8ED 4GX2A 3QRWA 1I24A 1QRDA 2CYAA 1YA6A 2BDTA 1DUIA 3W79A 3QVUA 3OTGA 4PG4A 5FUWA 1N7IA 1ZCBA 3W5CA 2LR0A 3FTQA 1QHNA 1X8JA 1MEJA 2LZ0A 2O23A 4A03A 4DA4A 3PFHA 4G8CA 5EWJA 3K5PA 3EFOB 5GV8A 1XJWA 2VJYA 3Q41A 2Y1CA 3AEZA 4M8NE 1HEYA 5IM4A 5BT8A 1NUUA 3DG9A 5EJGA 4L9AA 2R7LA 2GFQA 3FCEA 4N49A 4ZVQA 3TW4A 4BAUA 4C7VA 2FW9A 1XHLA 2DPHA 4QPZA 3TDNA 1G6Q1 3B2QA 4J91A 5IPFA 2MU1A 1E3EA 2YMLA 3CZQA 1KDOA 4GMHA 4IJKA 1NUQA 4EG3A 3LK6A 4HWSA 3RV4A 4CLRA 1CZOA 1XZNA 4WCVA 1PG0A 3PDIA 3TNFA 1S2LA 3GMSA 1QAQA 3KOUA 2ZYWX 1TQ8A 2P7HA 5GZ3A 3ZDBA 4L2IA 4JLWA 2WMNB 2C0PA 1NUAA 2NUPA 5TX7A 1NY5A 1ES9A 2A3RA 2EX1A 1ZJ6A 2OOSA 4TMWA 1Q0TA 1P2UA 1SU6A 3OM9A 1SBTA 2YQZA 4QVIA 2HYIC 4WY5A 4AWAA 5CGQB 1YL6A 1DX6A 1L7DA 3AHDA 4OK5A 3S28A 1E1DA 2EWVA 2D0PB 3ZLVA 1KEZA 2P41A 3C3XA 4DZTA 5AW2A 621PA 4UM8B 1AMUA 1NRXA 1K0FA 1QE5A 1URPA 2P6MA 3GZTB 4GMDA 3KE8A 5FTMA 2CLKB 3NV9A 4BLQA 1RXWA 1ZMOA 1N32B 1W87A 2GERA 2DY0A 3UA3A 3GZJA 1UOQA 1Y6JA 1M1XB 2OA0A 2EOAA 2ZAOA 2BLLA 3I5MA 3OWXA 1II8A 3DHYA 1D7AA 5TEVA 3VVBA 1R0LA 4P3OA 3IESA 2J3HA 1JIVA 4MZXA 4RK1A 4BO0A 3KQTA 1OE0A 2EJVA 1QP0A 3IVRA 1KH3A 2Y2UA 3HV2A 1UBEA 4FGKA 1JEDA 4HQ6A 4LXXA 3VU9B 1J5EB 1PJBA 2GXUA 3MLAA 1Z2EA 1EAMA 2CLLB 4M0KA 1NTRA 4PX5A 4QA9A 4J4TA 1NW5A 4HAZA 2C2BA 1H93A 3DPSA 3H5NA 4UHEA 3X1KA 1ZSYA 4QDJA 1AZWA 2RMKA 5IS2A 3PZRA 1DRJA 3AVYA 1FP2A 3FCAA 1RRVA 2Y92A 1KMIY 2C1XA 2DH6A 3VISA 4ZCMA 1DINA 1UBSB 4A7PA 4DDUA 1Q1AA 2REBA 1AXEA 3LUHA 2C4NA 1FSGA 1USGA 2HC9A 1A1SA 4XJVA 4JXXA 1WLYA 1FFWA 1B26A 1A04A 1SA0A 3EVFA 4KLAA 4D8YA 3TFWA 5A5DA 2ZSEA 5HQTA 2G9ZA 1W59A 1LSUA 1KTVA 1TIPA 3D02A 5BWBA 1MXFA 3QFRA 5D1NA 1Q84A 1IHDA 3OF3A 1HM5A 4YMLA 1G20B 2C7PA 3NHLA 3ZK8A 4BX8A 5CM9C 4QYSA 4WNIA 4U2FA 4HZIA 4MQ4A 4LRUA 3H87A 3R5HA 2OAQ1 5K2OA 4ZU6X 3FI0A 3NAGA 3RIYA 1R5JA 3DA8A 3AINA 4KNVA 4BYGA 1CRLA 4IDAA 2YMQA 3BE5A 1YDFA 2X3UA 1UPCA 2EL7A 3FUTA 5AHRA 4R41A 4I14A 3LXRA 3BGSA 4LBVA 3S70A 5B5SA 2VSFA 2ZQYA 4PPGA 1U8FO 2RHJA 4UAVA 2ZI6A 3I05A 4H7JA 3MAAC 3PPIA 5FTKA 1KSFX 1G20E 2Q1UA 4R84A 3AQIA 1H0RA 3HJTA 1MTOA 1W46A 2H92A 4E46A 1XT6A 4J1TA 2NV2B 1KYZA 1KMHA 4DIKA 3EODA 4AJ2A 2F43B 3V8VA 3I64A 2J46A 5K6AC 4Y9RA 5M3BA 5TV2A 3UKJA 2X2EA 4TLEA 1DS6A 2RGNA 5AK0A 4JK3A 5KO2A 3ESXA 3BPSA 1N2XA 3HY6A 3MS2A 4PSDA 2I2AA 3ABRB 5AJXA 1R7RA 3L3BA 4JR0A 4TMVA 4U3JA 2OV1A 4XQ0A 3W4KA 5AFSA 2CFRA 3C0KA 1LJLA 3N3AC 5DNAA 5KTYA 1IZ9A 2FSGA 5TDHA 3IBYA 1COWD 1E3SA 1R15A 1U4SA 3BB3A 4KX5A 5CW2A 3VAAA 3U61B 5KTOA 4NCNA 1C7QA 1S9DA 2YXDA 1OTYA 2EKLA 3AW8A 4RJJA 3COSA 3NHMA 4NBNA 2G63A 3SHVA 1W4BA 4JLMA 2XVXA 3DO6A 4MCJA 1Y3BE 2ZBVA 3A11A 3PGA1 3ZBTA 1L5FA 1W4CA 1I1OA 4KDFA 4UPDA 3FTEA 4X93A 1H69A 2ID7A 3WAKA 1OIVA 5A5GA 3AL3A 3QEAZ 1RU3A 1ZH0A 1LRLA 2YRWA 1JDZA 2QVXX 2R7MA 2YN0A 3DE0X 2VAVA 5JJBA 1YK0A 4JJ8A 3OCXA 3AUTA 4ZOBA 3WRXA 1ITZA 3RVJA 1I2ZA 3ENNA 2VDQB 2XYGA 2M1ZA 4EL5A 1Y6RA 3O47A 2QQ5A 3CRRA 1QHSA 1YZVA 3LUFA 3NHFA 1FP4B 1SVSA 1UK7A 3CF0A 5A2QA 2XA1A 2GR9A 1ATZA 1JTEA 2NMVA 4YMVA 2EHDA 1M2FA 4KE6A 1QRAA 2FRVA 5CVCA 5JG7A 2H2WA 2QXYA 2W4QA 3DCIA 2IYLD 3HL4A 4ODIA 3I9V1 4TUYF 3OY7A 4U7TB 4ZQGA 4DZZA 1V9LA 3WRYA 3ROTA 4EA8A 3OJLA 4XWKA 4D4JA 1T4DA 4O2BF 4DIEA 5AM0A 4ZQBA 2W58A 5EWJB 3QSGA 2JA2A 1GQYA 1GD1O 3VX4A 4ZZ0A 2I55A 4TROA 4UTOA 5LQSA 4BNXA 4JLAA 2IBTA 1UBFA 4PHFA 3QMMA 2KSQA 3W5JA 4S0ZA 3N8DA 3B1XA 1IXZA 4F2HA 2ZZNA 4QZVA 2QUBA 1YI8A 1O3YA 3ANNA 3M5DA 5IKOA 4TV8B 4OJQA 3ZGZA 3CJQA 2WWXA 5K1ZA 4LECA 4DEVA 3N07A 5EJ6A 5DE3A 3AX6A 3PRYA 4FDVA 3FR7A 3GLQA 4CLRB 1GQRA 1Y5LA 4G0OA 1Z5ZA 2GK3A 5EHGA 3SVLA 1HX7A 2QI9F 5LB2A 4Z0HO 5K6RA 4R7TA 3FYTA 4KRXA 5I3CA 5TLSA 1DTSA 4X9XA 1UM8A 2Q6TA 1KYTA 1XTKA 5JZBA 1PR2A 4Y6QA 8MHTA 3D8HA 1G8JA 5AI5A 3L7BA 1ZDMA 2PGIA 2CUTA 2VHUA 3ENKA 4V1CI 2O0KA 1KYWA 1GYPA 3I5UA 3QMVA 1SG9A 3LWBA 4G84A 4UBNA 2ZJ8A 3VDXA 4I46A 3TR6A 5DI9A 3PGLA 1V6SA 2GN6A 3QXSA 3HVKA 3LWDA 4CKEA 1YULA 3V33A 4URVR 4Y9DA 3RU3A 1INLA 4OB7A 1HQDA 1XI2A 5HTOA 4CT4B 3LXMA 1Q57A 3E82A 5DGIA 4QJ4A 2NUTB 2C5LA 5IJXA 5DNUA 1SB8A 2Q0QA 3HFJA 3QKWA 3VPXA 4OKIA 1VI5A 2J41A 3CO0S 3G88A 3ZWVA 5DBHX 4KPGA 1Y7PA 4YMGA 4M0DA 3KETA 1L8OA 4MLCA 4XGNA 3QV2A 3BDAA 1D2MA 3KLPX 3ABZA 3SJ7A 1U0HC 3DDOA 3KSDO 4L8FA 4DIDA 5FLYA 1KDZA 2A5JA 2QTLA 5BSVA 2Z3ZA 1GKIA 2HWWA 4BMVA 3N58A 3TGLA 5IH7A 4HQFA 1U0TA 4KPYA 1US8B 2NADA 4PBSA 1PL7A 2OZVA 1BIFA 4HQNA 2WAOA 1KFKB 4UOQA 1NLUA 1TAQA 1UFVA 4G0XA 4X7MA 5I7EA 4DQUA 5AQEA 2AJLI 4M88A 1DO8A 5CT8A 4B6JA 2EZ4A 3OHMA 5B1EA 4JP3A 4UZSA 2IHUA 5CIYA 1SCQA 4ASUD 2ODWA 1SG0A 5FULA 1DOZA 3EK2A 2ONKA 1IJKA 3L8HA 1E0JA 2PMWB 2FKNA 3KQMA 1G20A 3RWOA 3T52A 5IBRA 1KOFA 1G4AE 4ZYWA 1TL7C 1EIZA 3KLOA 4MYTA 3HCDA 3OIWA 4EMTA 2QBYB 3QU5A 5I7HA 3RUCA 1ADBA 2P9HA 1JJVA 1EQUA 1TK3A 2W2QA 5A3SA 1SOUA 1SD5A 1ZOPA 4RADA 2NTYC 4PQFA 3LTEA 3LV8A 2Z6QA 1YS4A 2NP7A 4M22A 2QGZA 2HF2A 1HKHA 1A50B 3MCWA 4PAWA 4C9BA 2YH2A 4OSOA 5FA5A 3WBBA 1SD1A 1X7HA 1XJCA 4R68A 5JZOA 1B0PA 3PLAE 1GQQA 1QQ5A 1RXCA 1EG7A 1VI2A 2OTCA 4LC1A 1W52X 4QICA 5FH9A 2QVBA 5IAGA 5K9ZA 4RS4A 1BHO1 1M34B 2ZIUB 2PNJA 1Z07A 2ORWA 2C9DA 1X1EA 2N1BA 1X38A 2WWFA 4WIAA 4GOMD 4B4UA 5F5NA 1UT6A 4AYWA 3OZDA 1XBTA 5D01A 3SZLA 3PEUA 2FLVA 2WTEA 2ZSAA 3Q6MA 4G41A 5DBFA 3QVWA 4G5YA 5T7BA 1E96A 2RH9B 1U7ZA 1B23P 5FP0A 2ID4A 2I3AA 5DM4A 2VDUE 3IKVA 3KIPA 4QT0A 4WPGA 3OOHA 1QVZA 3BMCA 3HYNA 4G65A 4ISBA 4ZN6A 5A6VA 1P7YA 3NP9A 4P35A 2BJWA 1HR0B 2H08A 3DPUA 2QJTA 2VN8A 5I9NA 3IQFA 2JHPA 2LBPA 2G9QA 4V38A 3HJGA 2D8AA 2CZCA 2ZVPX 3AUAA 3DE3X 4XOIA 4YJ3B 4CGYA 1SK8A 1NXPA 1ULHA 3IUJA 3G2PA 3DC7A 2Y27A 4CV3A 5KTSA 1T34A 2QD2A 2B2XA 4UNRA 4TQ9A 3VHXA 3I8OA 4P54A 4CEHA 5LXTA 4EDHA 3N7UA 1M1YE 5FUYA 4BNGA 1NXXA 2ST1A 4QU0A 3Q40A 1MJ5A 2H7CA 2PNFA 2VRWA 1DQRA 1RKXA 5CDFA 2C4TA 2HHAA 2F59A 5GONF 1WBBA 2AKYA 2GAJA 2PMBA 1BHJA 1YVRA 1Z25A 3A04A 3BMQB 4JBHA 2D4AA 3TIIA 4D0NA 1EHYA 1YU9A 4B7AA 2NP6A 2XZPA 4Q7JB 4NAVA 3W4JA 4A4DA 4RSHA 2RGDA 3JU3A 5EPUA 4N48A 5I51A 3CW9A 2FR0A 4UDYX 5FF9A 5LZ2A 1D6MA 1Y1LA 4OIFA 2N1MA 1A77A 1SOMA 2A8YA 4NCHA 5EL0A 1AMOA 1YQEA 2F55A 4NCJA 4QQNA 5ISMA 3M6MD 1V1RB 1CUYA 1N2CE 3VYTB 1BRTA 5JXGA 1E6KA 4BWYA 5DN6A 1JEJA 2IS1A 4HBGA 2JGJA 1C9DB 2CL5A 5CLQA 3EOAI 3IMKA 1T1IA 5HEKA 1N7JA 1POXA 3MSXA 5DHTA 1CS4C 3PF8A 1E0AA 4Q00A 3SQLA 2QYTA 5JAPA 5IFLA 2ZIGA 2ZBGA 3C7TA 4W8GA 3X1DA 2VPZA 2XLCA 4M21A 4NENB 4JXJA 1YOBA 2P35A 3N0XA 2UYGA 4PE5B 3SKXA 3OMXA 4B17A 4YAJA 3WMEA 2BM0A 1T1GA 5LZ9A 1MRSA 3KZMA 4RY8A 3ZI4A 1N2CB 1PFWA 3VDQA 4Q7QA 2WUGA 4LF6B 3MJTA 2KBEA 3MMNA 4XGKA 4F2PA 4R0MA 1P62B 4ZRDA 3IPYA 3S27A 4BWVA 3K96A 3PRJA 1CFZA 4BGUA 1B0UA 5C32A 3CISA 2P65A 5JCZA 4C04A 5A5FA 4Q4HA 3LOPA 3QEBZ 1Z0FA 5JD3A 5F1KA 4AJLA 4E13A 2WQ6A 1NQ5A 5H68A 5CJPA 1UANA 2XVMA 1T1SA 4TXHA 1FE8A 3KT3A 4HWGA 4I4TF 1X0VA 4RYLA 3G1TA 4W1PA 4N5MA 4C6TB 3PTZA 2X9LA 4OY3A 4RANA 4U6QA 1SKUA 3PP8A 3TTTA 3V42A 1C14A 3EZ6A 4D4KA 1YZGA 4CUJA 3NATA 2AA3A 1CJUC 1KAEA 5C4IA 2H2AA 1TQ4A 1I4EB 3EXHB 1EG2A 4F9FA 1E18A 1VL0A 1XCMA 2FUKA 2GRUA 2RJOA 1IHPA 3L07A 2EFGA 1VG9B 2GD0A 1D09A 1CUEA 3PYMA 3B85A 1JWAB 4OHXA 4XPIA 2C0CA 5CXUA 4BO6A 1PT8A 4L57A 2QZ4A 4M1QA 4EJ6A 5IASA 5AOBA 2DGDA 3O1HB 3ND5A 4RZIA 4RXMA 4W6ZA 1I6MA 2O14A 5FNZA 2PE5A 3P1JA 4MQFB 4KACA 4Q6WA 4HO1X 2QM0A 1R5BA 4NDAA 5J4HA 3WV5A 5E1OA 4RVDA 4E5SA 5CFMA 2Z57A 4OA5A 4KNWA 5A3RA 2WLSA 2YWHA 1VJGA 4AP5A 2AZXA 2GB4A 3RBXA 3VYRB 2WWWA 1MTZA 1ESCA 2XDQA 2JCSA 2ZP1A 2ORVA 2HM7A 2GMWA 3K70C 4G89A 3KEGA 4NE7A 1NPTO 3L8FA 2YJ3A 4EOGA 2NVUB 1FDUA 4EHIA 3G0HA 1KMHB 1MIOA 1KO5A 2CNKA 4U7PB 4XYBA 5K3SA 3NB0A 1DAIA 5U4QA 4B3JA 4YUZA 5IHXA 1BE8A 5KVAA 3MHPA 4P22A 2CXUA 5TE9A 1TJ5A 1CJKC 2R6HA 3N3BC 4YCAA 3DOJA 1KI6B 4I4NA 3U17A 3I61A 4UNPA 4P4SA 5KTKA 5DK6A 4AECA 3KVVA 3OPYB 2OCXA 1GYQA 3PPYA 2C8LA 1H6DA 4DLAA 1GZ3A 3ZWPA 4D8UA 2GEVA 4IIXA 4BEVA 1YAHA 1JMYA 3PCXA 4FYMA 4HL6A 1BU5A 1UXOA 4K6HA 3G89A 3SLGA 3UAZA 2OWDA 4DIOA 1ZD4A 4FSXA 2HQOA 1VPEA 1PLKA 3DWEX 4RK7A 1JAXA 2WHRA 2VZ9A 4Q1VA 5CFLA 4QFBA 1DEXA 3KXIA 1VGRA 4IR7A 1MO6A 2XUQA 5DYYA 1B93A 4KR0A 5EJFA 1MC1A 4UDXX 1I33A 1T5SA 5JZMA 3ZH2A 1KR5A 2QQ0A 3L04A 4W9NA 3ABQB 1MPXA 3KT6A 2VJAA 5BR8B 3BWCA 3ESZA 2JDID 3NGMA 1X1QA 1DKQA 2B78A 2WMYA 1T5OA 2X41A 4W7IA 5CB4A 3B38A 1QPZA 1EFTA 1G21B 3DL4A 1HOXA 5F2OA 3D7SA 3ADKA 3NCTA 4RFSB 3ASZA 4F12A 5LQCA 3ER8A 2P6RA 2VNHA 3WZLA 1JHMA 4PLHA 1ZESA 1T8WA 3U80A 1I5OA 1XZEA 2EIXA 2O3UA 3FUCA 3E5HA 3HBMA 4FR5A 4UHKA 4PN7A 5DNCA 1UXGA 1LX7A 3OHSX 1PZHA 2XNKA 1ZRMA 1B8NA 3T06B 4EHNA 3EZNA 4DUZB 4LZAA 2JLVA 5HKBA 1FJGB 2DBRA 3QG1A 2VJBA 4RMJA 1H8HA 4J4HA 4C43A 1CFJA 5HW0A 1VC2A 4GR4A 4I50A 4MTLA 4AQ7A 4CV1A 2NQTA 5KB3A 3C8MA 2FJUA 2IP2A 2ZYDA 2FWIA 4D97A 1PDVA 1D6JA 2HRQA 1NVUQ 2QN3A 2Y1LA 3B36A 3CLKA 4HOYA 3THWB 3WGTA 2VK1A 3WB2A 3IRVA 2O8FA 3AERA 1CUSA 1ZL0A 3G0IA 5D3MA 3PK0A 3GCGA 2P91A 4IIYA 1Q0SA 5BQOA 5LLTA 4J3NA 2DWPA 4X3OA 4IRMA 4M83A 3WTBA 2Q62A 3PBKA 4F7WA 5F5LA 1ZR4A 2P2GA 4TV8A 1N8KA 2Z56A 3QYAA 3I09A 4UE2A 4YB8A 4BLUA 4MEBA 4FQ7A 3TZBA 1ZU5A 4U6NA 5JSZA 1B16A 2A9QA 1UMDB 4PBTA 1SEVA 5SZIA 2OP0A 2X9QA 1Q12A 1SU8A 1V5EA 3CBGA 4O2AF 4UUNA 3URMA 2HJRA 2PU5A 5DT2A 1A69A 4JI5B 2J5BA 3MD9A 4N82A 3EAFA 2JJ8A 4Y6GB 4CWAA 1RPJA 1VZ3A 4RACA 1ZSVA 3G82C 3VPHA 3U9SA 3KQYA 2W2MA 5AJTA 2VDWA 1ZIPA 3A1CA 1JQ3A 1K4MA 2J3LA 5CA1B 2X40A 3ZU5A 2CL6X 5JXIA 3EZ9A 1XVLA 2GBCA 2QLBA 1U7XA 4HNTA 4AWBA 2GK6A 3ZCTA 2RHDA 5KNCD 3P9CA 3QE9Y 2FEPA 1PU2A 2OV3A 3EXEB 3FSEA 1IK6A 1PYGA 2JLUA 1EE1A 4DREA 2HTEA 3HXPA 1ZH8A 2W6IA 2NUTA 1M8PA 2XA2A 4QQ8A 3ZX5A 2XJ4A 2HQSA 3HEAA 4AY2A 1KFBB 3HS3A 1XXLA 5C1IA 1C2TA 2XVAA 3GFRA 4XJTA 4S1WA 1Z7YA 1DAPA 1TM7E 3NRJA 1Y3CE 1ACMA 4IX9A 1QHIA 1N2CA 2D8MA 2M98A 2YWRA 2JLAA 5DN9A 3UB2A 3KCQA 2Z43A 3JQAA 5DRTA 5CBPB 3QJYA 4HD8A 4DHWA 4D42A 4RIIA 2XODA 3RTBA 4FYJA 3VH4A 5REQB 3U4QA 3JQFA 1QG0A 2NO0A 3K2IA 4GPTA 1LDGA 4D3XA 1KI7A 1OAKA 2W2NA 2UAGA 2NACA 2QF7A 3FH0A 1HNNA 2W2LA 3PD0A 3PU6A 3QQ5A 4FFWA 3RHSA 4M37A 4DEXA 4C0SA 5KQPA 4WI1A 4MO2A 1RC8A 1Z4PX 4IO1A 5HQ3A 1O5TA 1Q2XA 5EKDA 2X58A 4ZOEA 3UWOA 1ORTA 4N5HX 1D5WA 3F78A 1T2CA 3LDHA 3K31A 4HNQA 1EK0A 5AKGA 1VHQA 3PITA 3GT7A 4HMQA 3EG5A 4ZO7A 1EHCA 4GI1A 1DCFA 2ZBFA 4EI9A 2FGKA 4DCTA 5D3ZA 2I7VA 2P9GA 3EXHA 2XT9A 1NFQA 4DSUA 4C06A 5IKPA 1BXGB 3EGCA 2BJHA 1N9ZA 2RI6A 1QK5A 2DECA 4P0TA 2V58A 5AM4A 1KAMA 1QRTA 2G8NA 1L7OA 4FFBA 4LYFA 1OU0A 1VDZA 2ZYUX 4KXUA 2QMHA 2QW8A 1BWQA 1CR2A 4U0JA 3MILA 1FUEA 4RQAA 3MTEA 3TOSA 5JAMA 3B7PA 4HTAA 2WU4A 3G2NA 4HVCA 1Z7EA 3SNKA 2ZRMA 1HLDA 4EABA 4F9EA 1V11A 1VG1A 2WUVA 3JQBC 5HS6A 5C34B 2XHZA 5BV0A 1QM5A 3PJFA 5L45A 5LDGA 1NOKA 2WK1A 3ZYZA 4KXQA 4LISA 4KQMA 1CDDA 4DB4A 2DCUA 4KR9A 1TEVA 4G0YA 1D2CA 2DFNA 4O4LB 4QODA 3CR7A 3QJGA 1R5NA 2IHNA 4E21A 2VSNA 1Q0LA 1BROA 4DOMA 5CFQA 5EIEA 3A4TA 4OQLA 2AJ8A 4EF4A 1OMOA 3B48A 2QUJA 4ZHQF 3AWIA 2BHLA 3WLPA 2VHQA 4BLRA 4AX8A 1JYEA 4CTKA 1NASA 4P4UA 3RSLA 4BB5A 2FPGA 2BT4A 4JVMA 5FOTA 3EAGA 1PS8A 1AM4D 4P4SB 3DVAB 4LSWA 3U26A 4EB6A 4QHYA 3OSUA 1L8LA 5A2GA 2EGUA 4HYTA 1H8HD 4UBIA 4EPVA 1IIRA 1UWLA 5C18A 3PA6A 1JJFA 2NZXA 4M1EA 4IJQA 1K0UA 4PHHA 4V0ME 5H80A 5B1SA 1K06A 4RDXA 3WHLA 4ER3A 3AOGA 1FK8A 1U3UA 4LZOA 1K5DA 5DXAA 4CXMA 3K94A 1I1HA 1Y5IA 2WU1A 3SLRA 3V8EA 4WCFB 4CLEA 1KHHA 2LWIA 1Y63A 2YUTA 3HMQA 4G26A 4Y1FA 5LXTB 3NAZA 3J80A 2EGHA 3FZEA 4JENA 4HWRA 2GEKA 1EXVA 1G5TA 5K0GA 2B9VA 1GWNA 2IBMA 3P94A 3KVNA 2COUA 4A8HA 1ND6A 2DWCA 2ZS9A 3DP7A 4H17A 5LOVB 1OKKD 1Z88A 2YHIB 1GNLA 1XA4A 4GMKA 4NU0A 4BIIA 4BPBA 1JAIA 2BGJA 1V7PC 3O4IA 2AOVA 3IPRA 5E4JA 1CRPA 4TRJA 2WJYA 4FKBA 4N0EA 3ZY4A 1Q1BA 2VJOA 4ND8A 4KIUA 4OYHA 4UNIA 1XZBA 4DWJA 5BMVA 1NBWB 3CJTA 3QUQA 1OU4A 2BC9A 2HBYA 2JJMA 3O8LA 1YHNA 4KMRA 1QUFA 3VFDA 3S40A 4K6FA 5DF1A 1SPBS 1RD4A 3FHTA 3TM4A 3L4BA 3EPKA 3RT1A 4X8HA 4LY3A 3WLNA 4I0WB 1QUEA 3AF2A 1QHGA 2JIPA 2B99A 2Z30A 3JCZA 4GRIA 3K3PA 2RDMA 3RIXA 3JVIA 1RFLA 3WOVA 2CV1A 1FFEA 1Y8QA 1PHRA 1HFJA 2Q5FA 5ELMA 3RVSA 1HYHA 5CHEA 3VV2A 5AVZA 1NI4B 2GEJA 2VL7A 3AEUA 3SG0A 2RE8A 4DR2B 3P0EA 1J2JA 2V6MA 3QF7A 1PN3A 1A27A 1SIWA 2R44A 2K5UA 3SJBA 1OH6A 1G3RA 1YR2A 1E7QA 3C43A 2CHEA 5GIOE 3CEJA 3H1EA 1UM9B 2Z58A 3FYHA 3HLKA 3TTSA 2OO5A 3H6KA 2GN8A 4TLLB 3R77A 4RIFA 4Z9BA 4BJ1A 2YWDA 5EFOA 5K8VA 1H2BA 1U7TA 3MW8A 3ILHA 4N39A 4RHUA 5JMOA 1J06A 1KC3A 2H57A 3IPXA 3OPNA 3K1ZA 1KI9A 5KOIA 2AFHA 4V24A 1C9JA 1Q7RA 2HHHB 3TTUA 3NHWA 5G1NA 2X8JA 4F60A 6YASA 3HHEA 5BNIA 5I8WA 1Z6TA 3GPCA 2WHQA 4L8LA 3EXAA 3G2QA 3GRAA 3OTHA 1GPBA 4LK2A 4QG7A 1L5QA 3HNOA 4Y7DA 1EFUA 1YH3A 1R1DA 4RQTA 1YRBA 4CKCB 2VXBA 1XRLA 4M1YA 4UUAA 2ZVQX 4NECA 2ZUVA 3EULA 2E37A 3TRHA 5BORA 4PVDA 4E5YA 1F14A 1ZBQA 3VPCA 1TMKA 1ECLA 3WAJA 1DARA 2P68A 4HDKA 3H86A 1T0BA 4H0NA 2C7GA 1XZFA 3QMWA 3RK0A 4BC0A 1NURA 2CKMA 2XMRA 1IVNA 5BQ5A 2DWUA 5I01A 4BVFA 4QTUB 5GTDA 3DOEA 1V5IA 2QU7A 4KK3A 4DR4B 4AIIA 4I9HA 2BPOA 5AVOA 2TS1A 5FA8A 3NT5A 1IBRA 2WKQA 4FEGA 4LJKA 1OWNA 3AH8A 1DE0A 5IEJA 1DVRA 3B1VA 3JATA 3RVKA 3FMGA 1ICEA 1ZUWA 1G9TA 4ZRNA 1GL9B 3FCXA 3IKJA 1TB4A 4REQB 5DTRA 1G5RA 3PQ5A 1IB0A 3KT8A 3PX3A 4DCGA 1K66A 2PKXA 3I92A 4KK4A 3QH4A 1JE1A 2WEKA 4EFLA 3QI7A 3B2NA 1EM6A 2FW6A 3TXAA 3UJ8A 1FBTA 4BBZA 3J81k 1S8NA 4L9RA 4OYYA 4Z54A 2XZLA 2WAMA 4G67A 3F6YA 3H2GA 2WG0A 1R4MB 2JLQA 1E7RA 1R6BX 1Z5PA 3DZKA 2GQ0A 4S2EA 4UU0A 5H3HA 4D4MA 4ZVSA 4W9MC 4WBNA 3H5OA 2GKOA 2WT9A 4JT8A 4WN9B 3HKDB 4FS8A 5HZGA 2G77B 3OLCX 5JI3E 5ILGA 3ZV5A 2XUOA 4NC9A 4OHKA 5DN6D 2CE7A 4JWTA 4OH7A 1GPH1 4UTNA 2A9PA 1J5PA 3G8CA 3DAGA 4K46A 4ERXA 4ZGBA 3DEYX 1BYUA 2AMJA 2GARA 1BXGA 1Y82A 3EOZA 3LX6A 3PGJA 4CG3A 2NSYA 1M66A 3RAJA 4EF6A 3QPAA 3WNZA 1XTVA 1SFRA 1L4EA 4GPD1 2O2CA 4ZXPA 3ZCSA 1RE0A 1T9GR 4MA4A 1GNVA 3SWWA 3VTZA 2CK3D 4WUVA 4OK6A 3CKKA 2PKWA 4EYKA 1X3LA 3ZGOA 4W5RA 3IO3A 5EXTA 3ZNOA 3OZSA 3RC1A 2HHJA 3E1GA 1U0FA 2Z5VA 4M1ZA 4CL3A 2J6BA 2QRNA 4BMSA 4CYMA 5HE9A 5M04A 4RD3A 3HUFA 4ZT6A 1VL8A 3R0ZA 1L0BA 3C1UA 3WK9A 2GPSA 4OQXA 2MR5A 2XGOA 1VKOA 4LG1A 1YE5A 1K5GA 3ICOA 3KTDA 3R6WA