3H4MA

Aaa atpase domain of the proteasome- activating nucleotidase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-activating nucleotidase
publication title Structural Insights into the Regulatory Particle of the Proteasome from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3h4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h4mA01
2A5FA 1C1KA 3D31A 1YZQA 3LY5A 1E9RA 5IK2A 1IONA 1TF7A 2RMKA 3L0PA 2W6JD 2DYKA 4ARZA 4ZPXA 4ZO4A 4A8JA 2AD5A 2IUTA 5DI3A 5KDDA 2AK3A 5L3VA 2Y8EA 1ZD1A 2FGJA 4ARZB 4A8JB 1G64A 1QHHA 5DI3B 3BK7A 2D7DA 4PSAA 2AWOA 2YYZA 3ZDQA 3L82B 1QHHB 3NHAA 1G9XA 5DN6A 3G5UA 1AS0A 3RVBA 1CLUA 1RYHA 4V0KA 3MMPA 1WDTA 4LBZA 2Q6TA 3SC3A 1UJ2A 3IUYA 1TU3A 2X8AA 2QMUA 4HUTA 3GLHE 3ZQ6A 2ZAOA 1OXXK 3HDTA 3ADKA 5B58C 1M7BA 1JQJC 1U99A 2NGRA 2C03A 4DLWA 1AQUA 4LWZA 4PPQA 2PCJA 4DSTA 3CKLA 1ZNWA 2P67A 3AP1A 1P6XA 2GJKA 2W58A 2B7CA 1X1SA 4S2EA 4Q1DA 1TMKA 1UF9A 3H0KA 3MAAC 4ZI3A 3IIJA 3NDBB 4NU0A 2ZAMA 5FPHA 4JMPA 4K46A 4C0KA 3QY0A 4L8GA 3A1WA 1ZCBA 4UKDA 1TUIA 5CJ2A 2EWVA 1F5NA 3VAAA 2B6HA 3QE0A 2MSDB 4AKIA 2DHRA 2OM2A 3B2EA 3GEIA 1QHSA 3CF2A 4BUJA 1PV4A 2ZRLA 3CPHA 4LRWA 1GUAA 4I1VA 2F7SA 4IOLA 1L4YA 2FJUA 4Q1CA 4UXHA 2R6AA 4X8LA 1R7RA 3SQXA 1L4UA 3QG1A 3RAPR 4ZKDA 1P9WA 2DFLA 1KKMA 1E9CA 2REBA 4LX0A 4I1OA 5BWMA 4O3MA 2J9RA 5JJKA 2RGNA 5TXGA 2QU8A 2JJ8A 4XSGA 2VSOA 3IGFA 1MO4A 2VYFA 2YC4C 2V54A 1Q44A 1SKQA 3KB2A 2F3TA 3BIFA 1JECA 4NYJQ 3X1XA 3QPVA 4BZQA 3KUCA 4HUQB 4MYCA 4JBWA 1J70A 3E2IA 5K8TA 4R98A 1KMQA 2WPDA 2GAOA 1HY3A 3DMDA 3W5IA 1QHGA 3QF4A 2OXRA 5C18A 1ZYUA 4HYYA 3VNVA 2EFHB 1XCPA 1XD2A 3QF4B 3HU2A 1R0YA 4HZIA 3AVUA 2FEMA 3THXB 4CZ2A 1XD2B 2J0VA 1U94A 1R5OA 3TUIC 1G7SA 1KDTA 1HQYE 3TLXA 4E5UA 5G3ZA 4QG7A 3QJYA 3NBXX 4I1SA 5J5CA 121PA 1WA5A 1OKKA 3T12A 3W9YA 4LJAA 2OEPA 3WRYC 5KHOC 4NCKA 1ZINA 1A2BA 4A3VB 2GZHA 2P5TB 2XSZD 5F3WB 3QKUA 2Z43A 3Q7PA 2ZE8A 1W4CA 4AKEA 2GCOA 4FMCF 1N0WA 1X8LA 1Q1QA 4QXAA 1E2PA 4QKQA 1JALA 1OSNA 3CWQA 2VF8A 2GCOB 3VR2A 1AK2A 2CL0X 1QVRA 1I4LD 3PUZA 1GKIA 2Q21A 1OF1A 4BFSA 4H1UA 2GEUA 2YINC 1FQKA 4LYJA 3ZS8A 2IYYA 3CONA 2JJ2D 3BFKA 4YMVA 3TGPA 4NCHA 1XMJA 3VR4A 2QPAA 1NMZA 4IOMA 2VA8A 4HSEA 4L9WA 3RS5A 2XITA 3B9PA 1RKBA 2FSIA 3KJEA 1KMHA 5HPYB 4KODA 4RCYA 1OT3A 1KMHB 3GLHA 4KFTA 5EP1A 1N6LA 5AUOB 3NEJA 4JVLA 5KDOA 1D9XA 2HCBA 4V0ME 4QOSA 5E7MA 3AM1A 1PVOA 1YE8A 5J40A 5EP3A 5UKDA 4KAXA 2ZRDA 5AWFC 2ZI6A 3ZLJA 2H8KA 3IIKA 4FIDA 2IXFA 3IHLA 3PEYA 1GRNA 2FSFA 2O8BA 3IHWA 5DO9A 2QROA 2H92A 4V0OA 1D2EA 4R2HA 1MRSA 2R8RA 2YC2C 4C9BA 1TEVA 4G3XA 2O8BB 1OXSC 3A37A 3R9WA 1W2HA 2I1QA 2IUUA 1DELA 3BGWA 1RVDA 4TT3D 3P32A 2HXSA 2JLVA 1E9BA 1NI3A 2NPIA 4D2IA 1SVWA 4EPXA 1XZPA 3B78A 5FOTA 4KI0A 3WBJA 2RKOA 4W5JA 3WNDA 2YOHA 4EDHA 1ZD9A 3SI7A 3RRYA 5FUXA 1QDEA 5EXXA 1GITA 2PJZA 3GQBA 1XTQA 5B57C 2KE5A 8OHMA 4PTLA 2J5XA 2VLIA 1TUEA 4JVNA 1A82A 3KXIA 3FVQA 4EQ6A 1B0UA 2GF9A 2FDCA 4BZXA 3T1VA 1BIFA 1H8HA 1VCMA 4EQ6B 4QNMA 2CEAA 1WBDA 1W0KD 2QUZA 5FBWB 2WOJA 5FR1A 1X8KA 1KDRA 2V4ZA 1XWIA 2CBZA 4B6EA 4FW9A 3R8FA 2KJQA 1TQ4A 3PG5A 4EPRA 1NN3A 4HATA 1W0JA 2REOA 4L4UA 2D2FA 4EIWA 5KDLA 4L5BA 3AKEA 2J45A 4EJSA 2FWRA 4MYTA 5EP2A 4NP6A 2DFKB 5CDFE 3AH8A 4UNQA 4EJSB 3P20A 4LHZA 1R5NA 4OK3A 2IYTA 3NH9A 1GL7A 1G8PA 1U0JA 1X8JA 2BV3A 4NYIR 3VMFA 1SXJD 1XJCA 2PLFA 2HLDA 5DHAA 2IS6A 5JRJA 3DL0A 5GJCA 2WWIA 1YZKA 2IK8A 2LKCA 1E2KA 2NO7A 3OEHD 1N6PA 1YJ5A 4CT5A 3NC0C 4G0NA 1U0LA 2N46A 3CF6R 3ASYA 2QE7A 3AVQA 1IY0A 2VHJA 1DS6A 1N5JA 1OB5A 1XPUA 4ILEA 1VPLA 5FI0B 2BDTA 1IN7A 5IDVA 3QKSA 1RRGA 3GJ3A 3QXCA 1NL3A 5KUTA 1G3MA 5BN4A 5CB8A 1IN8A 2GEVA 5KU1A 3NKVA 4TL9A 3QKSB 3C41J 5LB4A 2H16A 2H57A 3FFAA 3EW9A 1D6JA 3PCRB 2J7KA 1KNQA 5TY0A 5KYKA 3OEEA 4DWJA 3K0CC 1HURA 2IEZA 3AKYA 4QGHA 5J4LA 3QPWA 2NMVA 1E9EA 4PHGA 3VU9A 1BKDR 1Z83A 1G6OA 5L3QA 3NDPA 2JLWA 2BIFA 2RCNA 4IDHA 1QRAA 3CNNA 1VHLA 3W34A 4LUCA 3VU9B 3T06B 5L3QB 3AF0A 3HP1A 2QSYA 5FBVB 4D80A 1OFTA 3KQKA 1OFIA 1XTRA 3QI2A 1P9RA 1XFAA 3GJ6A 2GZDA 2P3SA 3MJRA 3VTKA 3WYFA 4V0MA 1Q1BA 4NCNA 4ZCMA 4Q4JA 2W6JA 4B34A 2GETA 4DBLC 3AVTA 1FZQA 2WWWA 1GDDA 4TYPA 4URZR 1Q0UA 2L0XA 4Q4JB 2Z5FA 2QP9X 1PLKA 3KFVA 2XNSA 1EFHA 4XVRA 3DKVA 3H84A 4JZKA 4NH0A 3MGCA 5K8LA 1RJ9A 1JNYA 5FTLA 1KOFA 1Q1EA 1VECA 4KBFA 3CPEA 1ZUHA 4UXJA 1RJ9B 1CBUA 3GJ0A 1JQLB 1JB1A 3C8UA 5DIFA 1HE8B 4HB0A 2MMGA 4FMDF 2QN6A 4BECA 1EFRD 1KK0A 3SNHA 3A1VA 1EX6A 1GSIA 4QNRA 1N25A 5LD2B 1QZMA 1U0HC 1N2CE 2BWJA 221PA 3VX4A 4A9AA 2QAGC 1XMIA 1OIWA 2WJJA 4IXNA 5LDDC 3U7FB 3U7HB 2VEDA 1OPXA 2JCSA 1ZC3A 4MRNA 4DSUA 3GLFE 1KSJA 4IVQA 2VSFA 2JIZD 3ADDA 2ZR7A 4JJZA 3MWKA 4BEBA 4TQUS 1G3UA 4Q1EA 4I81A 3U4QA 1DAFA 2DB3A 4EAQA 2OT3B 1LY1A 1N3BA 1VCOA 3BFVA 5JMTA 4C0LA 4JBXA 2ANCA 2ZS9A 5HKKD 5FPKA 3U4QB 2RGEA 1S4QA 1KI1A 3UANA 1I2DA 3CRVA 3AV0B 4HAWA 3C4JA 3H1TA 2V6ZM 1MT0A 2QGNA 1G4UR 2XTNA 5B30A 1TQ2A 3N2EA 1TPZA 2WSSD 5JLJA 2GZAA 3RS7A 3TUJC 5DISB 2E9SA 5CDFA 1OFHA 4LV5B 2OILA 4GP7A 1G3IA 2V6IA 1N6OA 2C77A 4WW0A 4UJ3A 2ECKA 4AYTA 3VNUA 1OIVA 1L2TA 5HR5A 3A4MA 4V03A 1NY5A 1Z63A 1A2KC 2NO6A 2CNWD 2DFTA 2ZITA 4GT1A 5EZ6B 2IXGA 3Q5EA 4G01B 4Q03A 2Z0MA 4N3NA 3FWYA 4YXWA 2R62A 1UAAA 4CGZA 3KW6A 1CS4C 1P9NA 3L2OB 1VG8A 1AS2A 3QENA 3QIAA 1Y63A 2DY1A 2V55B 2QMHA 3IQWA 4X8OA 3CPJB 4RZ2A 4MDFA 1NVVR 2IHBA 2ZRBA 4BLPA 1CJMA 1N5KA 3LBIA 5GADl 1ZIPA 2IXEA 4D81A 2KI5A 1Z29A 3TSZA 2OCPA 2FPMA 4QBIA 1G8YA 1GFIA 1LW7A 4A0HA 1HV8A 1VHTA 3K0AB 3KJGA 2B7BA 2UZIR 2ZU6A 1W47A 4D0NA 1MOZA 1QHNA 3AVXA 1KI3A 5FBQB 3MSXA 1T5IA 1WXQA 1SZPA 3NBFA 4DLVA 1PLLA 2DCUA 1XD9A 2FA9A 2XSZA 4LGMA 1Q1ZA 5KNCA 2LKDA 2XTMA 4LJ4A 3HU1A 1CJUC 3B5JA 4Q9IA 2ZE6A 5CLLA 5AJYA 3B7GA 2ZJOA 5FOVA 1JEEA 2XB2A 2F1RA 1ZD8A 2ZE5A 4NYIQ 4URYR 2WMNB 4RSGA 2F1IA 3BH0A 5BN5A 5EE9A 4O25A 1DAKA 1OXTA 2XTZA 3BB1A 4IOKA 3ADCA 3FYHA 2YNMA 4FWTA 1IOZA 2ZU0C 4OI4A 4G5RA 1CEEA 2J3EA 1TL7C 2JJ2A 4A2WA 2GRJA 2XZPA 1WQ1R 2P65A 2CK3D 4QBHA 2IA5A 5A4JA 1YU9A 2ZUBA 5C4GB 4PXAA 3ZIAD 2GVZC 3KKPA 1C1YA 3FHOA 2ERYA 3W8NA 3LA6A 4Q1AA 5BXQC 3NEYA 4RD4A 4QHTA 3SDZA 2G83A 2XNDA 1M34E 2ZRKA 3ZYCA 4FWHA 2E87A 2F6RA 3AQ4A 3IEUA 1UBCA 3BC1A 4OQNA 2JLUA 1KJYA 3VHLB 4JLDA 2JLSA 1FP6A 2J0UA 2PL3A 5P21A 1K6MA 4IDPA 3HR7A 3LV8A 1IHUA 2XB4A 2J0UB 5FPTA 1U8AA 1T0HB 3I62A 3GLFA 1NVWQ 2YZ2A 3K9GA 2WBLC 3QVVA 5HE9A 1NY6A 2TMKA 2D2EA 4UJ5A 3GLFB 2OFXA 5KNBA 2EVWX 5FUWA 4TZ6A 2PT7A 1TADA 4TT3A 4PC3A 4BLSA 2QBYA 3ZGXA 3U6KA 2WKPA 4C3ZA 2AX4A 3BFXA 1IY1A 1ZMXA 4WIAA 2QBYB 4YMWA 4A2QA 5JS7A 2QL6A 3MWLA 1ZC4A 3EPKA 3LWNA 4KBGA 4L9SA 1F60A 2C2HA 5JHGB 3LH5A 3RS3A 1SVIA 1ZCAA 2ZYWX 2ZRGA 4LJ6A 3AVOA 2BEJA 4U02A 2ZM5A 2BKEA 1RRFA 1OFUX 4BFVA 4P31A 2BM1A 4KLNA 1NP6A 2P0EA 4B3XA 5JHHB 4UXIA 4KYIB 1YRBA 4OI1A 2IS2A 1IM2A 5JBQA 1OHHD 3BS4A 3WY9A 4JLAA 1W0KA 2AK2A 1YZTA 1DG1G 1ZU4A 3MLEA 4FD2A 1X37A 1BH2A 2ODWA 3LO5A 2PT5A 2QORA 1R4AA 1SHKA 2PX0A 4ZDJA 3KUDA 2QM7A 4ABYA 3JZMA 3FHTA 1AM4D 2IYRA 1PLJA 4HLUA 3SYNA 1S96A 1KI2A 3U3JA 2GILA 4PX9A 1NN1A 3D3QA 1G7TA 5D3QA 1NIJA 2ZR9A 3Q8XB 2FV8A 2CLCX 1W44A 3I92A 1E1QD 3NTUA 1UPTA 4Y0AA 4GMXA 2JLYA 3U7GA 2IHYA 5TB5A 4DCUA 4BFZA 4UNRA 1KNXA 1G17A 1P72A 2RGBA 5F2EA 4BLQA 5AUQA 3T1TA 1GM5A 2ATXA 2EFDB 3AP3A 5JS8A 1SXJA 1XTJA 1KY3A 4LJ7A 1NLFA 1OIXA 3RANA 4RVCA 4L16A 1SXJB 1IBRA 4LDJA 4ASUD 2ZI7A 1P2VA 2F9MA 3OEHA 5FPSA 3NIBA 1E2LA 2RGXA 1KO5A 2A78A 2FEOA 1VG1A 3W6NA 1PUIA 4PHFA 3ADBA 4DJTA 1DADA 1DBSA 3FB4A 1YR6A 4DSNA 1D8TA 4Q1BA 1I4DD 2HXYA 4HZUA 1KSHA 3I72A 4PZZA 2IWHA 3OIYA 4KO8A 2HDNB 2OG2A 1JXMA 2C98A 2O8EA 5TMPA 4LJYA 5KOYA 1NVVQ 2FSGA 4R7ZA 1BMFA 5K8IA 2O8EB 4GP6A 4ZIRA 1UBGA 3LBNA 4U5XA 5BQ5A 4OL0A 3AVPA 1GRQA 3RDPA 2A5JA 4DLSA 1VYTA 4ZIRB 3K70C 1XD8A 3WNBA 2VO1A 2YOGA 4XTCS 4ERNA 3GJXC 2ZRAA 1FTNA 1UKYA 2VQSA 2A3RA 3K9LA 5DYIA 4TSFD 4MGYR 1LVGA 2H17A 2LWIA 3LXRA 3ONWA 4BASA 4DZZA 1W5SA 3U44A 2WMOB 1CP2A 2QP3A 4C4PA 1FPMA 1FX0A 1K5DA 3H86A 1S2MA 1AKYA 2ZPTX 3A1UA 2NO0A 1FMJA 3KQHA 1W4RA 3U44B 3C5HA 5KPDA 2H1LA 5E7IA 1FX0B 2VP2A 2ZE7A 1KIMA 3HWSA 3JVVA 4TMTA 3KZ1E 4TTRA 4O0MA 4MRRA 2O8CA 3BORA 2XOKD 3PVSA 3R9IA 2ZSDA 2C99A 2CCJA 4GDFA 2RGDA 2C5LA 2O8CB 1M6NA 3A36A 1JJ7A 4P4UA 1Q3HA 2CLSA 2I4IA 4C0QC 2G1KA 2WM9B 1SULA 1EFCA 1UEIA 4ACBA 2CL6X 3B85A 1W48A 1JR6A 3CUEF 4F4IA 3QOFA 2ZROA 4FN5A 4MRPA 3CLVA 3EPJA 5DI9A 1J99A 1LB1B 3A1TA 4LK2A 2J7PA 1VDZA 4MUAA 4BQSA 2OLKA 4DLYA 1KKLA 1QBKC 4A92A 5HKKA 4NKRA 2X1VA 2G3YA 1U8ZA 4DDWA 2BMEA 2WJHA 1NG9A 2QTVB 5BYKA 2VP0A 1G18A 4KVAA 5CIQA 2OFWA 2JLZA 4LSGA 4Q9LA 1R10A 3VR1A 4WAUA 2DFNA 5EXTA 3UWOA 2WWXA 3QXJA 4NMMA 1MO3A 1GZSA 2O8DA 2WSSA 4QC2A 4URVR 4HLQB 4MGKR 1YRAA 1KZGB 4MQBA 2DZNB 1T8TA 1MH1A 3AJIB 2O8DB 1DEKA 4RD2A 1NVMA 4Q4AA 4ZCLA 2V9PA 6Q21A 4JT4A 4KXFB 3MD0A 1ZBDA 1NNEA 2R65A 4Q4AB 4NCIA 2CNWA 2ZEJA 5JI2E 3QEOA 2WIAA 3L8ZA 4P0TA 521PA 3CR7A 4HUQA 3SE0A 2FG5A 4AY2A 1Z0IA 4H1VA 3Q85A 1E4VA 4LHVA 3KXKA 2OFOA 4TL7A 5AK0A 3BBPA 3LX8A 4RD6A 1QHYA 4U7DA 2BEKA 4M53A 4URUR 4PAMA 2ZJ8A 2O52A 3AP2A 2KWIA 5EUMA 3U3OA 5EE1A 5CITA 1NG1A 4TLAA 2QI9C 4Q5IA 5FI1B 1KO4A 4A15A 4FWDA 3EARA 3THXA 4W5HA 2C04A 2G88A 1XPRA 1JJVA 2DVWB 5C1BA 4GOKA 1QF9A 2ZRNA 1NMYA 4DLZA 2NZ8A 2WTUA 1KI7A 3X1DA 1Z07A 4CRWB 4IDOA 3CH5A 4IEIA 4PSVA 4HAVA 1Z28A 4Q7LA 3M4YA 2CE7A 4MKIA 2WZQA 3EIQA 1EWRA 4URXR 5J4YA 3W90A 1XRJA 3B6EA 4DKXA 3WMEA 1HEIA 5CIWA 2GXSA 3NBZC 4Z1MD 2DWZB 1MR3F 2W6ID 3KXLA 3UMSA 5KO2A 4CEHA 3AGQA 2FN4A 2ZVPX 1FOEB 4A1FA 3B1ZA 3FMPB 1QVAA 1Z0KA 4CEHB 2WWYA 3U3MA 2CK3A 1W2GA 2UKDA 4XWKA 1QG4A 4BGDA 2A30A 3SJAA 3ZIAA 1IN4A 2IEYA 1DVRA 3GFOA 3F8TA 3SZRA 5FOSA 4N1AA 4DDTA 2R6GA 1Z3IX 3KL4A 4BFTA 1S8FA 1T3LA 2BBTA 1OH8A 2EYQA 5ELXA 4ZDIA 1Z0FA 2QGZA 4IW3B 4QJ3A 3LLMA 1NKTA 4DLXA 2CHVA 2FF7A 2ANBA 4NL4H 3TQFA 2J46A 3W8RA 4D26A 1KAOA 2H18A 2IX3A 2P5SA 2QTHA 1UKVY 5FL3A 1XNJA 4MKFA 4QBFA 5M04A 4A0FA 3BH7A 4OQLA 4C0AC 1Z6YA 1CTQA 3CR8A 3KKMA 4TMWA 3RLFA 5HZHA 2EW1A 5JZVA 4Z8YA 1S1CA 4DT1A 2PCLA 1X3SA 1S3SA 1CR4A 2ONKA 2DWQA 3UG7A 5AR1A 2G6BA 3C16C 1UADA 4DT1B 3BE4A 4TYNA 3FGNA 3A1SA 4HB2A 2J41A 2AR7A 2D06A 2G0TA 2YJTD 4M0LA 1K8RA 2ZI3A 1E2DA 1WF3A 3NVAA 1XU4A 3ECCA 1NJFA 1U9IC 5DH9A 1RRPA 2X77A 3CRW1 2JDID 4I99A 5EUQB 1XX6A 2GVDC 3NHBA 5SZJA 3HYTA 3KQNA 1M1YE 1ZNYA 2AKYA 3IBYA 1KJWA 2ODBA 2V8OA 1OYYA 4OQXA 3U7EB 2BJVA 3GJ7A 1FFHA 1DOAA 4EPWA 4M21A 2ZREA 4EPYA 1SKYB 2R2AA 4OHZA 2FFAA 4DVGA 1NF3A 4F4JA 1RFLA 1R0ZA 1N6NA 1UBFA 4DC9A 2IC5A 4RZXA 1OHHA 4NBSA 1WB9A 4A0RA 1J2JA 1LV7A 1FTSA 2A5GA 3TAUA 5DGXA 1J90A 4Q48A 2VP4A 1JAHA 1RPZA 2CL7X 2XEXA 3HJNA 1MRNA 4LYFA 5E3HA 4KSBA 1P2SA 3PIRA 5KNDA 2QENA 3V4RA 4O2LA 1Q57A 2FNAA 3D7MA 2BBSA 3BH6A 1E2MA 4X8MA 1KHTA 3EPLA 2V7QD 3MHVC 2F43A 5CM8B 4NTZA 4C0BA 1EK0A 1TX4B 3QXXA 1GNRA 2BC9A 4EKDA 2F43B 2QAJA 4GPTA 2PZGA 3SYKA 2DR3A 4OHXA 3EIEA 1NVUQ 3U61B 5EE3A 1AN0A 2V6JA 5JCZA 1QG2A 3K0CA 3GFTA 1XDBA 3BRWD 4LYAA 1VYVA 1G19A 3UMFA 3VKHA 1E2IA 1G5PA 2V1XA 4KV9A 1CU1A 2ZXUA 3KKOA 3ZVNA 2DWPA 3PEWA 3K70D 2QT1A 2O8FA 2QPOA 4AURA 3TJZA 3GJ4A 1Q12A 4QHSA 1E2FA 4TL6A 3VR5A 2O8FB 1KK3A 2X19A 1ZJ6A 3LVRE 3KFXA 4POAA 1J8MF 3T35A 3B1WA 4D4KA 4BPBA 3BERA 2YHSA 1E9SA 1DAHA 1Z0DA 1P3JA 1Z5ZA 3QKRA 3UMRA 2XGJA 2IYVA 1RRCA 2AHOA 1US8A 1XMVA 4LY6A 3QKRB 1OJLA 2O5VA 4CYMA 1ETUA 3EXAA 1A4RA 1US8B 2OSBA 3AUXA 4D0GA 1W4AA 2D4HA 2OXCA 4TSFA 1J7KA 3I4LA 1PZNA 4D4MA 1VCIA 1KSFX 1GNPA 1X86B 1M8PA 3B8HA 4E22A 2ORVA 1MO5A 5BYJA 3T15A 2QAGA 1Q22A 2CHGA 3Q7QA 2VPPA 1SVMA 2WV9A 4M9XA 3ZVLA 2EWWA 2Q0HA 4BRWA 4DCVA 3OFND 3SOPA 2QAGB 4M4SA 3GPLA 1M7GA 4P4SB 4BE7B 3H4MA 4G5QA 1D9ZA 2XOKA 2G1JA 2H7VA 3M1IA 3PUXA 1KJZA 1CULC 4QJ5A 3TBKA 4A2PA 4DCNA 4I4LA 4G5GA 3TSWA 2PEYA 1T5LA 3ZZTA 4Q7KA 1P5ZB 1ZRHA 3SHFA 1NVXQ 2QMEA 3OIUA 3RABA 1ZU5A 4G1UC 4MUBA 5IK2D 3TMKA 1UM8A 1KO7A 3QKTA 1UFQA 2YV5A 1DO2A 4G5SA 4F92B 4B2LA 4DCTA 3SQWA 4DCSA 1XTIA 3I61A 3IIMA 4IOJA 4MGZR 4DB2A 1YHNA 5EE0A 3TH5A 4W9MC 3EC1A 1N0UA 2GJAA 3DOFA 5AJXA 1JPJA 4B2IA 2IS4A 3NWJA 4QRHA 3G82C 2CHQA 2P6UA 4D82A 1E9FA 1YQTA 1GIAA 3UK6A 2VHCA 5EZ5A 1UEJA 1VYUA 4RD3A 1Z47A 4QBGB 1OW3B 1IXRC 2WSMA 3L0SA 3AKDA 1NLZA 5G53C 1M7HA 2AKAB 4QL3A 4JIMA 1G4AE 4DSOA 2FPLA 4OKSA 4Q01A 1NSTA 4RZUA 1WP9A 3P4YA 4KYUA 1P75A 4TN1A 3WHKA 1DAMA 2PX3A 2ZI5A 1W36C 3OIWA 4B75A 3QG5A 3W6OA 1N6RA 1YKSA 2GHIA 2CDNA 1P2UA 2GNOA 4F93B 4U00A 2ZUCA 3QUSA 4OHWA 3CRQA 2JASA 2OLJA 4PHTA 3SYLA 4JS0A 2FGKA 3GJ5A 3VKWA 3J81k 2QG6A 3QF7A 1T3HA 2D3WA 3C7KA 4MKHA 4LRSA 3W3AA 1OH6A 4B2PA 2HT1A 1JBKA 1XEFA 2MSCB 4EUNA 4A6XA 3PEUA 1JEDA 1AS3A 2YWHA 2DZOB 2BKUA 3LXXA 2ZQ5A 1NN0A 3P26A 4JT2A 3DO6A 4TQAA 4B74A 2RHDA 3WXMA 1NN5A 1XEXA 1HUQA 3O47A 3PUWA 4PFSA 2UVQA 1JAIA 1XEWY 3C15C 1XEXB 3K0AA 4NDZA 3BOSA 1WRBA 1Z2AA 5C4MA 3E5HA 5JWRA 4WXRA 4TMZA 5FTJA 1DAEA 3LBHA 2GCNA 1Z6AA 3O8DA 2PLRA 3GLIB 1SXJE 3NXSA 3WP1B 4PO1A 4B44A 4BLOA 2AWNA 5FUVA 1TU4A 3RSOA 1D5CA 4GI7A 4F7WA 1XP8A 4HAUA 2WPDD 3Q5DA 4Z1MA 5KPJA 5JSZA 1EXMA 2W6IA 2YWFA 2ZJ5A 3NBYC 4PAOA 2C95A 1AZTA 1E4YA 1AQYA 1E0KA 4AYXA 1P4SA 5JSZB 2NG1A 4KSCA 3DZDA 2AXNA 1OV4A 3WYGA 5J4HA 2QM8A 2GA8A 5JEEA 1CF4A 1G291 3W6PA 4BFUA 2WWHA 2GJ9A 5CM9C 3LQRA 4AKGA 2ZS7A 2GEDA 4OI2A 5IRCD 4TYYA 4HDOB 4JLOA 1BO6A 1GTVA 1P62B 2A9KA 1KI4A 2AXPA 3EA0A 3Q3JB 4B71A 1TF2A 1G21E 3VX3A 4QGAA 5FFMA 2WVJA 2VP5A 3PENA 5EXSA 2I1VB 4DEYA 4FXPA 1R0WA 3CWZA 2B92A 4WA7A 3PUVA 3K1JA 1SHZA 3MFYA 4NONA 4IHQA 2V3CC 2Q9BA 4EFMA 3AGPA 3PEVA 5EP4A 1N6IA 2QRZA 1XMSA 2F3RA 2QP4A 2J0SA 2R6CA 3AF3A 1AGRA 2HJVA 3BWDD 1ZM9A 3K09C 4HAYA 3V4FA 2EYUA 1Z0AA 5JWHA 1E98A 3OZXA 3KTAA 2NZJA 1VCNA 4HLCA 4B3DA 1I4TD 4CF7A 2C96A 3DM9B 3KTAB 1DPFA 2Z6VA 2GDJA 2NTYC 1A1VA 2ORWA 2SHKA 1CJKC 4BZPA 2JDIA 1KY2A 4HB4A 4B6FA 1VG9B 2ZSAA 4KLZA 1Z8FA 5F9HA 3WMFA 2IF0A 3CIOA 2ZR0A 4DEXA 4V0LA 2KBFA 2GBLC 4MKGA 4PQFA 2OCBA 2BHRA 4DLTA 3CX6A 4ZV4A 4F38A 2HYIC 2XXAA 4GL2A 1GKUB 2CLDX 4IXMA 1ESNA 4PO9A 3TK1A 3VFDA 3VHXA 3B60A 2XXAB 3HR8A 4XVUA 2CE2X 4RKFA 1T3SA 2H5EA 1WBBA 4DDUA 1GP2A 4XWOA 1FW6A 2W00A 4Z54A 2ZJ2A 1G1MA 4BLTA 2REXB 4RFSA 2OV2A 1S9DA 2ZJYA 1LS6A 4OJQA 2GAAA 2IYLD 2RH5A 2RGCA 5CYOA 4LBVA 3K9HA 2Z83A 4ITRC 4RFSB 3THYA 2HYDA 2F55A 1HT2E 1UBEA 4JKYA 1TF5A 4Q21A 3THYB 3CZPA 5J47A 4ZDWA 2YOFA 4LBYA 4Q02A 4RJLA 1E1RD 2V7QA 4B3CA 2JAQA 3PJRA 2FFQA 1IN6A 4KFRA 3BD9A 2BCJQ 3UKDA 2CXXA 3BJIC 4ZI2A 4YMTA 5GJVC 3L8YA 2P6NA 4KFSA 1IY2A 4YQFA 1YR7A 2HT6A 1F48A 4OHYA 2FX3A 4PQYA 1ZIOA 4J0QA 3X1ZA 3HU3A 4OBEA 2QEQA 1W46A 1KTVA 2ZRIA 1WMSA 4QGFA 1IJFA 3C5CA 3K9NA 5CK5A 5H8WA 2A2ZA 4DB4A 1RYFA 1A5TA 1Q21A 4TTPA 4KVGA 4F91B 1NLYA 2PMDA 2VHQA 1E0JA 1G20E 2HF9A 4JSTA 1XZQA 5J4VA 2GXQA 1ZAKA 3EZ9A 2JLQA 2OZEA 2ZYVX 4I1UA 4LJ5A 2OCYC 3K70B 3R7WB 1KI9A 3IDQA 4BLRA 2PJRA 1E2QA 2D74A 1W4BA 1P2TA 4LPSA 2F9LA 2G9NA 2VIIA 3ETLA 3RC3A 3WMGA 5KTYA 2BJWA 3PFIA 1PUJA 4DLRA 3A4NA 1T6NA 3C14C 4WXPA 3ZH9B 2VHTA 3AF1A 1Z08A 3F3YA 5E7JA 2HLDD 1OXUA 1F2TA 3GEHA 5L3RA 4BWYA 4DUGD 1CR2A 1JXOA 4Z8XA 421PA 4GBMA 3HYRA 4LBWA 1T8UA 4PC1A 4LYHA 1R5BA 2JLRA 1F2TB 1HYQA 1II8A 4C2UA 4JLJA 1HTWA 1WE2A 2QE7D 2R9VA 1YVDA 1BYUA 1II8B 2DPXA 3N2IA 4R2IA 1QHXA 1U98A 2GF0A 3DHWC 4E07A 2C9CA 4B3BA 3A8TA 3OF5A 3A4LA 1ONBA 3FMIA 2QTFA 4M1KA 1ZUNB 3FKQA 1JPNA 3EZ7A 2WICA 4MH0R 2OAP1 3OFNA 4AG5A 1E9DA 3IPXA 3ZD7A 2PZEA 5D3MA 3OE7D 3B1YA 3OEED 2OE2A 4TTQA 1G8FA 1MV5A 3DOEA 4ON9A 4RCZA 3VR3A 1UKEA 5IF9A 4Y0VA 1CIPA 2W0SA 1NIPA 2ZJZA 3SJBA 5D3MB 2G77B 1KO1A 4Q9HA 1NBMD 3CF0A 2QY9A 2FSHA 2HEIA 5CK4A 1FNNA 1V5WA 4IFBA 1ESMA 1RZ3A 1EFRA 1F2UA 4RD0A 4IDQA 2CCKA 4EFNA 2IUSA 4QHYA 4Q7JB 4HZUB 1MO6A 2CMKA 621PA 5CB6A 1F2UB 4M1WA 1DE0A 2VP6A 5FTMA 3PXGA 4K8OA 1SGWA 2E1RA 3I1FA 4YDHB 2HCJB 3UIEA 2RGAA 1W36D 4DRZA 1CR1A 1M74A 3I32A 1MKYA 3PITA 2JIZA 4XH9B 3RRMA 1PJRA 3WBKA 2AD1A 1KYIA 1E32A 3TKLA 3DEFA 3FOZA 3IKJA 4IEEA 2QMOA 4FMCB 3EWSA 4MA4A 4QM7A 5FPYA 2FZLA 2AFHE 3WP0A 4TMKA 1U8YA 2BBWA 4N0EA 4US2R 3WHLA 5EE5B 3SJCA 3RS0A 4DIEA 2J59A 2O0KA 3FKSD 1RC8A 1YR8A 4A6PA 1OYWA 1IJEA 2HV8A 3FMFA 1E96A 1Q3TA 2A5YB 1HT1E 4A8JC 3QVUA 4DHEA 4R71A 2BMDA 3LLUA 3RC8A 1SKYE 1N6KA 3AVYA 3RS2A 2WAYA 4B43A 4IVRA 3B9QA 5IHPA 1UKZA 4GMDA 4GOXA 4B33A 4IFEA 1UDXA 2K5UA 4JYCA 2I3BA 2IF2A 2Q9AA 3S1AA 5LB2A 4FWGA 1I2MA 2QT0A 5G41A 4CT4B 3QEJA 2ODEA 2IYQA 3S1AB 1T9HA 1TQDA 1BS1A 4CEJA 4C7OA 1YR9A 2ZYTX 4XD7D 5DYGA 2IYSA 4CEJB 5FL7D 4C7OB 3UG6A 4IVPA 4NPHA 3BXZA 4KFUA 4Q66C 2GESA 3LQQA 1W1WA 1ZW6A 4UNPA 2D62A 1W5TA 2EFCB 2Q3MA 2FU5C 1VG0B 3IO3A 4LC1A 2ONJA 1EG7A 1NJGA 3EAQA 4AG6A 4TYWA 4FMBB 4MRSA 2KRKA 5GVRA 1U2RA 3SFZA 1XTKA 2QQ0A 1JR3D 1WCV1 1G16A 4WBSA 5FOWA 1COWD 4XOIA 4MITA 3RYTC 4YXWD 5HCNA 1ANKA 4JKIA 5BW8A 1E2GA 4QM6A 3EZFA 3SEAA 4Q9KA 3RHFA 2WWFA 3RWMB 3CM0A 2ZTSA 1E3MA 3EC2A 5LBIA 3TNFA 5FTKA 1CJVC 2JJ1D 2O0JA 4Q4HA 3WYAA 2RGNC 3GFPA 2AL7A 5AJWA 4MYUA 4P33A 4OYHA 4B3FX 2VTKA 2ZJBA 3LD9A 4Q4HB 1ZP6A 2HJGA 2R44A 1AJEA 4E09A 3QXHA 2IS1A 3MWYW 4LRTA 2B21A 4TYQA 2CCGA 2BMFA 3BB4A 4NZYA 3UWKA 1GNQA 2XJ9A 3RS4A 5TARA 1EFUA 5KSOA 3ICEA 1E0AA 1A7JA 2FFBA 2JA1A 3QBTA 1GKYA 1G3RA 3VR6A 2Z4RA 1NMXA 2G0NA 3GEEA 1P60A 4PR0A 1OH5A 1D2MA 2B8TA 2V1UA 4AC9A 1U9IA 4TLEA 3HPQA 1GRRA 3U60B 4Z51A 3EIHA 3E70C 2GJ8A 3KKNA 3CH4B 5SZHB 4LOAA 3CB4A 3EZ6A 3REFA 1D2NA 4C0JA 4UQOA 4PZLA 3DMNA 3H2YA 4GRAA 5FTNA 4LV6A 1IXSB 1B23P 2CJWA 3SBDA 1YZUA 2PZFA 1CRPA 1LTQA 4B73A 3OAAD 2OAQ1 3V00A 3U5ZB 2VH5R 4YDSA 2CJWB 1U81A 2VL7A 1NBME 3VKGA 4D4LA 2RGGA 2XNDD 3FMOB 4YLGA 5ANRB 3Q9LA 3D8BA 3FHCB 4Q7MB 1S1MA 4MGIR 1U90A 4TLDA 4AI6A 5L3SA 3GLGE 1Z0JA 3OHMA 4AWXA 4YMUA 1SVKA 3KJIA 3SR0A 3GLHB 5L3SB 4ESVA 2OO7A 4JBYA 5E95A 1DG3A 3TRFA 3JZAA 4ESHA 4JL6A 2ZS8A 5KSYA 4AD8A 1HH4A 1AGPA 2IYWA 5KSPA 4DLUA 3FTQA 5C2JB 2W2TA 4D25A 3TUZC 3T1OA 4QJ4A 4Q47A 3K53A 2ATVA 2OCAA 5CJPA 1EESA 3M0EA 2NO1A 3NC1C 2KBEA 4GITA 1YZLA 2VSXA 4WZ6A 1DO0A 1FUKA 1ZNZA 3AVWA 1KZ7B 4OK6A 1XF9A 5GVSA 1VIYA 4KCGA 1CXZA 3L0IB 2WIBA 4RZ3A 3REGA 3KX2A 4US0R 5HZKA 1EGAA 3K0FA 1KSGA 2IYZA 1Z22A 4DXAA 2EFEB 1E1RA 5AJVB 5JJIA 1T0JB 1G41A 1G5RA 1NRJB 3K0FB 2VHUA 1GVNB 4JN6A 1E1QA 2AFIE 4PAQA 2JATA 5KSZA 1FL9A 2YWGA 2BCGY 4JVSB 4B3GA 1HE1C 1TQ6A 1EWQA 4NE2A 4FMDB 2Q3HA 1ZUIA 1FUUA 4ASUA 1LNZA 1XEWX 4GOJA 4ZKEA 3IQXA 1FP7A 3BB3A 1IN5A 3A58B 4B76A 1ZNXA 1II9A 1NKSA 5JI3E 2R6FA 4B48A 1RE0A 4C0HA 3LVQE 1VTKA 2QQEA 4B32A 4RFVA 4LV8B 2ZRFA 2OHFA 5FR2A 4HEJA 2GXUA 5A0FA 4LC0A 2Z4SA 3RRZA 2GCPA 3DPUA 4B47A 1SVLA 1CKEA 3ZD6A 1YZNA 3BAFA 2F1HA 3DZ8A 3U3KA 4R9UC 1OXVA 5FUYA 1Z6XA 2O0HA 1V43A 3GLIE 1G8GA 2WHXA 1RIFA 4Q1FA 4FCTA 4P32A 1JR3E 3MJHA 4DUGA 2WAXA 1CJTC 3WRXC 2XAUA 4ZCIA 1AZSC 2DWOA 4PQRA 1E79D 4JLKA 5B64A 4OHVA 2VRWA 1H8ED 1FMLA 1ODFA 5HCIA 5JCPA 1RW4A 4M22A 4MRVA 4H9GA 2W0MA 3PV0A 3O8BA 4PHHA 4HLDA 3B82A 2YWEA 3L43A 3THOA 3JVUA 4EJSC 1BYIA 2FZ4A 3DM5A 1XPOA 3W5JA 4LHWA 4HAXA 1Z6TA 4HB3A 1P73A 5JRZA 3CW2A 5HTKA 3KJHA 1Q20A 2IBMA 3F0TA 3TR5A 3AF4A 3I8SA 4JL5A 3WNCA 3Q72A 3OE7A 3SFVA 4P4SA 2BOVA 1BMFD 4CIDA 5JJLA 2WKQA 4GZMA 2N42A 3CNLA 3DVLA 3TE6A 3TSOA 3MG9A 4BFWA 4BRUA 1UDWA 4PC6A 1OH7A 1NBMA 1E94E 4FCWA 3ZVMA 2A5DA 3G0HA 4OQMA 1GL6A 3RWOA 4K81B 4C0SA 3MCAA 4TMXA 3RRNA 3ZQJA 4GFDA 3RSLA 3GLGA 5H68A 1O3YA 2RAPA 3AKCA 2ZRMA 3CX7A 4Q19A 2MSEB 4EFLA 4JLMA 2HUPA 1VIAA 3IBGA 3GLGB 1LFDB 4V02A 1E99A 3LFUA 4XJXA 5EXPA 1FQJA 2PBRA 3K8YA 5H70A 3I5YA 1C4OA 1TTTA 2JLXA 2ZRCA 1DARA 4IJMA 3NG1A 4XIGS 2OBNA 4CEIA 3EX7C 1XCMA 1BOFA 2UZ3A 4GZLA 1S3GA 2JEOA 4UNSA 3TAHA 1W36B 4HDQB 4CEIB 4HAZA 4LPKA 4Q00A 2VF7A 3EG5A 5DN6D 1K5GA 4G5OA 5LPNA 1AIPA 4US1R 1DAGA 2NQ2C 4WOPA 3OESA 5JWOA 3W3ZB 3GCGA 3KQUA 1CRQA 3LW7A 821PA 3FKSA 2ZUDA 3I3SR 4XVQA 4IDNA 4UNNA 2ZIAA 1L7VC 3QBVA 1ELOA 2A7QA 3TVTA 2BM0A 2ZRPA 4P3YA 3EWAA 3CNOA 1X1RA 1ZM2A 1M2OB 3ZZ0A 1E6CA 1KDPA 2ZRHA 5AJZA 4RD1A 4BFXA 4C2TA 2QA5A 3LW8A 2EQBA 1SVOA 5FH9A 3F5FA 2EU8A 3TIFA 1II0A 1NSFA 4PC2A 1R0XA 1KGDA 3CBQA 4M1MA 3PR1A 2NPFA 3D6TB 3QPUA 3M6AA 4HDCA 5A5GA 4DDVA 4RY2A 2J7PD 4XWAA 4F4CA 3U3RA 1GWNA 3CX8A 4V0NA 3KDSE 1Z6GA 4N0DA 1KI6A 4X8HA 1L8QA 3AB3A 3UATA 5LD2C 4MYHA 1MABA 4XD7A 2W83A 4IKEA 1KI6B 3OIVA 4TQ9A 1XB2A 4Q4LA 4TLBA 3RNLA 2OBLA 5JECA 5FL7A 1MABB 3U2QA 2IYUA 4IRUB 2ZVQX 3SS8A 2P6RA 1XJ0A 3A6PC 5F98A 2IW3A 721PA 4PPNA 5JEDA 3LX5A 4II7A 4D4JA 4LJ8A 3IPYA 4PC7A 2YKGA 5G40A 5TDHA 3MUFA 3VQTA 2OBMA 1G7RA 2GK6A 5B2ZA 3GLIA 4URWR 2B8WA 2W2XA 3CO5A 3QQ5A 3QXSA 1JR3A 3X1WA 3SBEA 5EJEA 2NOAA 1COWA 3AUYA 4JSYA 3I8XA 1HQCA 2OESA 3O8RA 4QFMA 2ZSBA 4OQFA 3GD7A 1KO8A 2XJ4A 3NH6A 5SZKB 4YONB 1CR0A 3P27A 3TW4A 1XXHE 4AK9A 2C78A 4JJKA 1SVSA 2VBCA 2C8VA 1R6BX 5FBLB 3K0SA 1E2JA 5BN3A 3FE2A 3B13B 1AKEA 1E2EA 2JJ1A 1N6HA 2GWHA 4WVFA 2ZSEA 3B1XA 1DAIA 5FOXA 2FFHA 1P7CA 2PH1A 3CRRA 5FOUA 1Z2CA 3KB1A 3K09A 2ZRJA 2CVFA 2ERXA 2WJIA 4JLNA 4O2RA 4NYMR 1R8QA 2MMCA 2D7CA 4JLBA 1XJQA 3TR0A 1XBTA 2KB0A 4A82A 3EZ2A 2ZI9A 1OKKD 4PPFA 5AUPB 1N0VC 1O87A 4WZAE 4JYBA 3T61A 3MWJA 4M1TA 3X1YA 2XX3A 3IO5A 5TVKA 1G3QA 3HPRA 1LF0A 3E1SA 3K0EA 1KI8A 4LJ9A 3P4XA 2Q9CA 4NCJA 3ND9A 1ZM3A 4EPVA 3QSYA 2GJSA 3R20A 4JL8A 4D0LB 4EPTA 2GK7A 3SJZA 5CYPA 3GMTA 4ZDKA 2ZJAA 2GBLA 2ZANA 3V9PA 3U6BA 1KDOA 1ZVQA 4LI0A 4PO8A 1ZM4A 1F3OA 3ICQB 1G8HA 5DSZA 2BVNA 3OAAA 3T1QA 1GL9B 4M9QA 1F6BA 4MDEA 5E4FA 4OJKA 3T34A 1W7AA 4JVMA 3LNCA 5DNYB 2P2LA 1J8YF 2ZETA 1LS1A 1FNMA 4BFYA 1XCGB 5K8UA 3LAWA 2F1JA 2FOLA 1E69A 3SU8A 4PSKA 1P61B 3SHWA 2XZLA 1E9AA 2IT1A 2C9YA 3UPUA 4A36A 2JGNA 2RHMA 2J0QA 5EQTA 2X2EA 1N5LA 1KK2A 2PEZA 1VMAA 3LDAA 3PQCA 4AYWA 2R6DA 1H65A 1S0UA 5HE8A 4M8NE 2J87A 2WJGA 1R8SA 3FDIA 4TLCA 4TL8A 2LCFA 4A4DA 3X2SA 4PPGA 4NHOA 2FPKA 4TMVA 4WZBE 3PUYA 5SZIA 5GJWC 1IQPA 3SN6A 1Z06A 3N5CA 2KSQA 4YMSA 1R2QA 4M9ZA 1XTSA 4JLPA 4PZYA 5TV2A 5H1YA 2ORIA 1IAQA 2HF8A 1OLOA 3TQCA 4ACAA 4B35A 4KJZA 3ASZA 2C9OA 1HA3A 4Q18A 3THWA 2QPTA 3N70A 2FMXA 2YVUA 3AF2A 1AA9A 2AN9A 3THWB 2CVHA 1EX7A 1TNDA 3T5DA 4BEJA 2NIPA 1Y3AA 4FI3C 4CW7A 2GKSA 1QZXA 2Q3FA 4DIDA 4NYJR 4AIIA 2GXAA 1KK1A 4JLVA 1GOTA 3ND8A 4M2LA 3GP8A 1H8HD 2BBOA 2N1BA 2WJYA 4A0GA 3MRSA 4M1SA 3R9XA 3AVVA 1EFTA 1G5TA 4FINA 2RB4A 3GJ8A 4KHZA 3I73A 2ZSFA 4P4TA 1T91A 3UXMA 1XXHA 3IEVA 2W2VA 4GSYA 4LZZA 3EA5A 4AKHA 1GG2A 5FBRB 1XXHB 2QNRA 2GTPA 4M1YA 1W0JD 3R7WA 1JI0A 5JFGA 3DDCA 2ODNA 3VLFB 1T4GA 3R8CA 2XZOA 2ZI4A 1VKJA 2PMKA 3EASA 3L0OA 4LHYA 4TZ0A 4FWIB 3B1VA 5DLQC 5F9FA 4L15A 2WOOA 4HI0E 3ZS9A 4LCBA 1X6VA 4LHXA 3ZVRA 1OE0A 4RKEA 2QZ4A 1E2HA 2IWRA 3T5GA 3ZZUA 3CZQA 5CLQA 3LRPA 1LF5A 1E79A 4CVNA 4PANA 1W49A 3ZJYA 1H8EA 2IYXA 5L8VA 4QGGA 2QSZA 2EFGA 1TEXA 4E03A 1G6HA 3TW8B 3EPHA 4GNKA 3O8CA 4KU4A 4M1OA 4HLUC 1QHIA 2ZYUX 1GILA 1E2NA 5AUNB 3KQLA 5G3YA 2VP9A 4TWZA 1ZM7A 3P1JA 1E0SA 2ASEA 4C30A 4D6PA 1DTSA 4XSHA 1S9HA 1N5IA 2BMJA 4KITB 4OI0A 4M9SA 3I5XA 1SXJC 4W5WA 3FPAA 4OK5A 2WWGA 4FCVA 3DKPA 2WJVA 1GAJA 1YZGA 3AEZA 5DE3A 1OB2A 2FH5B 4YC7A 1KAGA 3CRMA 3QNUA 2J1LA 1TAGA 5DHFA 5C46F 5J4KA 2FE4A 2QRNA 2WKRA 4Q9JA 1IXZA 2IL1A 4NYMQ 2NO9A 4W7SA 4CDGA 5GJBA 1G7CA 2DBYA 4XTRA 2X2FA 3TVDA 1SQ5A 2OUKA 5IT5A 4S35A 3KKQA 3FFBA 3IILA 1C9KA
chains in the Genus database with same CATH superfamily
3WGZA 4RKYA 2EZTA 2O2JA 5DI3A 5L3VA 3RS8A 1SOMA 4JYPA 4YCMA 1SCNE 1AS0A 3DQQA 3MMPA 2YIVX 3WQSB 3B7PA 4UM9D 3STYA 5KKCA 4AWBA 3CTWB 4L8FA 1R0SA 3UB2A 3AP1A 1M1NB 1VL0A 1LBIA 3N8HA 4S2EA 2R6ZA 1U7UA 4ZAZA 4YUAA 4ZK6A 1YBFA 5AW1A 5CJ2A 3IBFA 2DHRA 2WM2A 1GUAA 4JWTA 4Q1CA 4UXHA 2CDAA 4X8LA 4MV1A 1P9WA 2C9ZA 4LX0A 1HNWB 2JCBA 8CATA 5BSGA 5K2OA 3NO4A 4PNHA 4U6QA 2VEOA 2ORYA 1CFJA 5ARBA 2XOXA 4R31A 4YMLA 2YJ3A 4PYOA 2XUGA 3TUIC 3ELWA 2MU1A 4AP6A 1MQ9A 2Q4BA 4Q3DA 3D4LA 3LHDA 1I51A 1GSOA 2GLUA 3ECAA 1VQ1A 1AK2A 3JYHA 3PGA1 2GEUA 1F4PA 1OV6A 1HL3A 4LY3A 1XMJA 1KXZA 3BWMA 4G5XA 4HSEA 3RKUA 2H2WA 3K1AA 2O2ZA 2XITA 1G8KA 3B9PA 2V9ZA 1GNTA 2FSIA 2QI9F 3D1VA 2XZTA 2BJHA 3PK0A 3A98B 5DEIA 1MEEA 2ZRDA 1WKCA 4RMNA 4YYZA 2DJIA 2AMJA 4G5FA 3CT6A 4LVOA 3IUJA 1E9BA 4EPXA 1USKA 4B0PA 5KTKA 2J9XB 2QNJA 5B57C 2KX7A 4IH4A 4ZJUA 1YCHA 2PUJA 1RKUA 1GJSA 1NX9A 4UC0A 4RV5A 1L7NA 5FR1A 4Y9RA 2UYCA 5KYWB 5CEFA 5FO0A 2VK1A 3AZOA 2WHEA 4XCVA 2IDMA 1U2SA 2M1ZA 1Z33A 3GWZA 1YL5A 5EMMA 4CUJA 3CEMA 3PHHA 3A2MA 3A3PA 3U6SA 3DP7A 4ALNA 2OLEA 1ZI8A 4DOMA 2ZKLA 3BCUA 2N46A 4GLFA 3WJAA 2QE7A 1A4XA 2X2PA 2X6QA 5FI0B 5KTPA 1SQGA 5H3LA 4TL9A 5IASA 3GNQA 2PKXA 4N18A 5TY0A 3LA8A 5ENDA 4OFZA 1Q2XA 2JLWA 1OTRA 3AF0A 3AIKA 5TIIA 1OFIA 1XFAA 3DFKA 5CXSA 4W1SA 4PYJA 1PDOA 3TD6A 4YT5A 2L0XA 3LKBA 4BO0A 3HB7A 5T3UA 1MZVA 3NFYA 1XDGA 3R0XA 2WD9A 1SCQA 3GCZA 5AI4A 1MGPA 3FSEA 2A0FA 1QZMA 4BFLA 221PA 2F9FA 2HTEA 2O2HA 3ADOA 1UFOA 1ONOA 1I7PA 1BXGA 5LXTA 1R3DA 3W9BA 4DR1B 3U4QB 3VVCA 3IHPA 2BE9A 3AV0B 1QMPA 4M6WB 4F9TA 2XTNA 3P2OA 4ATNA 1KWGA 3VH4A 1JTEA 3FIUA 3A4MA 3PFGA 4CQNA 1OX6A 2ZITA 1NFFA 4OLHA 3KZNA 2Z0MA 4N3NA 1YR1A 3ZHYA 2HJ9A 1AS2A 2V55B 3LRXA 3KSMA 1KGSA 4YREA 1LQTA 3STTA 1MV8A 4QBIA 2X0JA 3AVXA 3NAGA 3GRAA 1LWOA 4W1QA 3SWWA 1Y80A 3L8EA 5CLLA 1B6TA 1D7OA 5AQ1A 2C9MA 4IJUA 4QECA 4QBHA 3K15A 5B7QA 3AINA 3ZIAD 5KQRA 3FHOA 5KQSA 3D3NA 4L75A 1KZ1A 3RK0A 5JDCA 4LF5M 2EX4A 3SDSA 1ODJA 2EAUA 3J80S 1WIWA 5P21A 1FDOA 1SN7A 3ZHSA 2XA2A 2XB4A 4MI9A 1SEPA 1Z8HA 3FSGA 1UPFA 1K8QA 1XTUA 3IUSA 3ZGXA 5JTUA 3QVLA 1T8SA 3DH0A 1TRHA 1BHSA 5EWMB 2R7AA 4EQZA 4WXHA 5JHGB 2OQIA 3RS3A 1YF3A 3AVOA 3REOA 1WSAA 4AP5A 1A8PA 3X0DA 2WFLB 3MLBA 3IMKA 1QG0A 1R4AA 4MW7A 3O2JA 1BU5A 5K4HA 1AQLA 1KI2A 3IURA 4ARUA 5FFNA 2A0WA 5A7GA 3SXUB 1U1FA 4Y0AA 2NZXA 3GLUA 2ZIVB 1X7ZA 4L72A 5JS8A 3GGGA 1NLFA 1LBSA 4B6GA 4YJ2B 4ASUD 2B5WA 3DCYA 5FTWA 5KNDH 1W19A 3I72A 4Y30A 4TXHA 5TMPA 4LJYA 5DZSA 5KOYA 3FDZB 2OZPA 1UBGA 1RM5A 5BQ5A 1BFUA 1GAEO 1XD8A 2JFVA 3HYNA 4YRDA 1P6QA 1NW6A 4ENSA 1XZ8A 3U44A 1XNRB 4K3VA 2NO0A 2OV4A 5TPZD 3AFOA 2WC1A 5DM2A 1WDMA 3T3HA 1EFCA 4NBLA 3H4TA 4K1XA 4Y98A 5BO5A 3B85A 1JYEA 1PL7A 3QOFA 4U2CA 4CQMA 1UK8A 1CD5A 4AUKA 4DLYA 2ISQA 1V4NA 4FZRA 1NG9A 2ENWA 4PAGA 4INOA 1F8GA 3PHCA 2O8DA 4URVR 4YFYA 2DH5A 4CMIA 4R4JA 2V9PA 2WTNA 1PR6A 3MD0A 4NCIA 4V24A 1HG0A 4M76B 3H3JA 2P30A 2CSUA 2WILA 2OFOA 1X9IA 1YZHA 2XZFA 1VGRA 4F1KA 4Q5IA 1KO4A 4A15A 4OP2A 2C04A 3ET4A 5EIBC 1FRNA 2ODQA 3WMRA 1SUCA 2VF4X 2B99A 1DG9A 3KR1A 3OJEA 1XRJA 3SHGB 1XTPA 3BA6A 5BUQA 4K6GA 1FOEB 5JYDA 3A3YA 3T5MA 2Z6QA 1V5IA 1K75A 1K7SN 4DBLE 3OM1A 4ZT6A 4XIFA 3D3EA 4QASA 3NMUF 3A2LA 3OLQA 4OQLA 1CTQA 3A1FA 1TTEA 2YWCA 4Y67A 4HQNA 2Q6VA 2G6BA 3SZOA 3DZGA 2H65A 1YIOA 2ZI3A 1K63A 1XKLA 4NCXA 2VTBB 5LQKA 1YH3A 3GJ7A 2YW9A 1HGXA 4DVGA 2I67A 1WZNA 2IC5A 4NBTA 5JRDS 2G5GX 1I14A 2XUQA 3GEMA 2X6RA 4EB3A 4F12A 2FNAA 1YUBA 2NADA 2UXCB 4EMTA 5HKBA 2V7QD 2IKSA 2LVPC 5K8JB 3JQFC 1DTWB 3AR9A 3RVRA 1FVHA 1FW8A 2ZXUA 4YRKA 4LZWA 4TL6A 3C3KA 3ICOA 3KFXA 4CQLA 1E3TA 2YHSA 3JVEA 1RHRA 3LF1A 3ZDCA 4NABA 1MB2A 1XNQM 4LOJA 2GLXA 2C5AA 5EHXA 1U0NA 4JUDX 1GNPA 1T1SA 4E22A 1SIBE 2FXVA 1K2VN 4GD3Q 1WPXA 1R16A 1TZJA 2XOKA 2H7VA 2X5OA 2X49A 3TSWA 2PHZA 3TSAA 1HZJA 5D5HA 4QYSA 5IHXA 4MW4A 4BKPA 5KVCA 3TMKA 2Z2YA 1YS9A 4RANA 1XTIA 3CURA 3N7TA 1XC8A 4DAEA 5L4NA 4YALA 4QBGB 4DSAA 2N35A 1NLZA 1P0FA 5KCZA 2WAAA 3P4YA 4TN1A 5JJ5A 3A4VA 3QG5A 2WFZA 9MHTA 1UK9A 2BMAA 2NXNA 3LRTA 1NUQA 2AMFA 3RVOA 2D5CA 3PEUA 4NU6A 2BHSA 4HADA 1NN5A 1HUQA 4PFSA 1AKVA 1XEXB 4ZYTA 1WRBA 4QYMA 3GLIB 3H9QA 2X4GA 3R4CA 5NULA 5FUVA 2AMVA 3RLIA 1VKNA 2GUGA 2VOEA 5CX1A 5C34B 1OV4A 3NBIA 5AVYA 1X2EA 2VHEA 4O8CA 1UXGA 1NU6A 4HDOB 1V16A 4IQ4A 1X42A 1GTVA 2AXPA 3EA0A 1U2GA 3HEAA 1TF2A 2NZWA 3RRJA 1F06A 2WVAA 1IY9A 2WVJA 1AXEA 1R0WA 1GYRA 2YV3A 3PUVA 1SHZA 4F9GA 4F6RA 1BW9B 3C1OA 3OA0A 2HPHA 5TJHA 3KVWA 4LXYA 4BAGA 3LOQA 1E98A 1I4TD 2QL9A 3D1JA 1D2CA 1NVEA 3O4IA 5I7SA 4DEXA 4OUDA 4M8IA 1CQWA 3LMKA 1WBJB 5E6SA 7GPBA 1LBEA 1CY0A 3OZWA 5J3JA 3HUEA 4Q7QA 4KQXA 2FSVA 3TL2A 1ABEA 2O1XA 4YAGA 4YCBA 1DLJA 3U49A 1NBHA 1BH6A 2VR1A 4ZI2A 3E05A 4MIEA 2XA9A 3WO1A 5FEUA 1IJFA 1LJUA 5BNTA 3OQNA 1NLYA 2A86A 2PU7A 1EVYA 3E81A 1JFFB 4IQGA 4RK1A 4NY1A 1S8OA 4XVCA 4LPSA 3IP6A 1PJBA 3RC3A 4R0NA 4WBNF 2BPOA 3EULA 1QFZA 1V39A 4MW5A 4LBWA 4IV0A 1F2TB 4CM4B 3H65A 1YVDA 2GF0A 1A77A 1ONBA 2OHGA 3OE7D 4RIIA 2OQRA 2QZSA 5D3MB 4RVHA 2QM0A 1JKMA 5CK4A 4D4IA 1NW5A 2CUKA 5JG7A 4HEHA 2Y99A 3QLEA 2RGAA 3EN0A 2VQDA 2GKGA 1FJGM 3FOZA 2QMOA 1R15A 1P44A 1Z73A 3S2UA 3WHLA 2PO5A 3WOHA 1K3UB 5DLEA 3FNEA 2HV8A 4GF5A 4QATA 5ES4B 1IY8A 2XT6A 1VL8A 1RT9A 4MB6A 4C78A 4GMDA 3I28A 4HYEA 3E4DA 1AK9A 5I3ZA 4ZO8A 3HN7A 1T9HA 1GJTA 4MO2A 5IJAA 3OZGA 1Z5CA 2NSYA 5FL7D 4C7OB 3IQFA 4HH1A 3LQQA 2ZTCA 1W5TA 4GZ3A 1JR4A 5GVRA 4E5NA 1I1NA 1JR3D 1K8XB 4IJFA 4N6NA 2IXBA 3G6KA 4Y2VA 2F48A 2XQGA 2QCUA 2X9VA 3GFPA 4P33A 1V9SA 2C2BA 3GA0A 4NULA 3F7OA 2W98A 2R2GA 4XEHA 4G81A 1A2OA 3FRIA 1OFUA 1JFSA 3RS4A 3PPVA 3QBTA 1GKYA 5FF9A 3K32A 1WMAA 1RBMA 2ID8A 1DRKA 1VMIA 3JASA 4FB4A 4QOZC 3IIEA 2MJLA 4XXHA 3CB4A 2FWPA 4LRQA 4OF4A 1RI1A 4GRAA 5FTNA 1O95D 4CWAA 2O8NA 2VH5R 3E0XA 3KVNA 2RGGA 2AFHA 4UZFA 2XMPA 1IHPA 3A1DA 3R5KA 3N0VA 4AD8A 3Q1KA 2XE8A 5LQRA 1VPWA 3TUZC 3VPGA 4Q3OA 2RI6A 3F8SA 3HUFA 3U16A 3U26A 1MGOA 1XA3A 1XF9A 1CXZA 1E4OA 4GW3A 4YP9A 3SVZA 1NRJB 4Z1OA 2YHIB 3ZQ4A 4MQLA 1W6UA 2MGWA 5F33A 4M9CA 3GGSA 1DIRA 4AF7A 5AM5A 1VSVA 4GOJA 4Z7JA 4R2XA 3A58B 2GASA 3ESQA 4JI1M 5ALNA 4A8HA 4P5DA 3Q15C 1Z6XA 2MR5A 1EJBA 4PGFA 4AZ0A 3KKZA 2C29D 1EPUA 3H8SA 4ZCIA 5BOVA 2IQ5A 2FZ4A 4MJ7A 4KREA 1WUKS 2DBQA 3I2IA 3AC0A 1STOA 4GECA 3S8YA 3FVVA 1JHDA 1LLCA 3N76A 1P18A 4MPDA 1X87A 3DVLA 4BFWA 2RHOA 4FCWA 3CUWA 4X1IA 5AHOA 5LWQA 5M2QA 4K81B 1PK9A 1CZUA 3AKCA 3M4NA 3CX7A 4JLMA 3D59A 4ENVA 3GRUA 2LDBA 1MCZA 3TX6A 2KHHA 1BJRE 4R54A 4TM7A 1NHWA 1I80A 3DHNA 1T8PA 3EG5A 3R2JA 2HMSA 1BGXT 3QIVA 1SXGA 3TVTA 4YAUA 2BM0A 1X1RA 1UKCA 1OC2A 1FSFA 4YTEA 5FH9A 1II0A 4K9RA 1Z35A 4F4CA 4N0DA 4G6ZA 4HTAA 2G09A 3SHQA 1NW7A 1ADJA 5B6JA 1NXVA 2GQ0A 3IAS1 4JV5B 4C05A 4ND5A 4Q3LA 1O0BA 3MUFA 3CO5A 1GGVA 5EWJA 4ISCA 1XTZA 2NOAA 4G9EA 1BDJA 4YONB 3P27A 3QVGA 4GVLA 1DAIA 2BFDA 1K88A 4MQFB 1R3UA 2PH1A 2WJ3A 1Z2CA 3VU1A 1BAPA 1RBZA 2WMYA 3NX4A 3CJTA 3GFRA 3ZU4A 4AZWA 1E1MA 4XA8A 5J23A 2H4ZA 4X7RA 4IIJB 5BV0A 5K8CA 3GMTA 1S2NA 3DE4X 2CD7A 5JDIA 2Q5HA 1YHYA 4DN6A 4C4ZA 5IJZA 2AN3A 4NATA 5IJ9B 5E4FA 2P4QA 4R9SA 1YRWA 2JH9A 5J2UB 1DXOA 3REQB 1IUOA 3PHIA 1GGMA 3FCCA 4M8NE 2CXQA 1X2BA 1PFQA 2WABA 1CG6A 1XTSA 2ORIA 3THWA 4OGKA 4I55F 3NLLA 1AA9A 1L5HA 2P11A 4KGDA 4CW7A 4WY2A 4OXYA 2LDXA 1H8HD 1TVMA 1W35A 1DC5A 3GDHA 1BQ3A 1TMGE 5GAJA 2ZSFA 1XXHA 5D6NA 3M5CA 2M9MA 2ZI4A 3JARA 2ODPA 1DHTA 3UJ3X 2BI8A 1GHTA 3MJVA 3ZVRA 3K2QA 3KSZO 2O2YA 3VTFA 3RV3A 4E03A 1CRLA 4IXTA 1ECFA 1JSXA 5JUWA 3TNLA 2VP9A 3RGPA 5CMLA 4UOEA 5C3MA 3JQ6A 1FSSA 4IAOA 4W5WA 4BMSA 2LZ0A 1LBHA 3H05A 1GAJA 5P8WA 1Q11A 2AEFA 1OB2A 1MRZA 1AD2A 1L9KA 4X3OA 2ZDQA 1SQ5A 3BIOA 3COSA 4DR7B 4HWSA 2B9EA 2GM3A 4QFDA 2LCQA 4X24A 1OBCA 1IHYA 1T9BA 2NQ8A 1UXJA 3L4BA 3FYUC 3ZDQA 5DN6A 5LR6A 4G67A 2G8NA 2Q6TA 4H3VA 5AVUA 1QCCA 1OZGA 2C5EA 5CFOA 1O77A 1YONA 4AMZA 1UZUA 4EUFA 4JR2A 4LMBA 4ALIA 4CR6A 5DNAA 1UF9A 5KI6A 4NU0A 1V5FA 3I9V1 2EWVA 3HYLA 2GEKA 3GEIA 3H0EA 2X5JO 3H8VA 2PWPA 5HS4A 4CIZA 4N01A 4FDMA 3V1YA 1L4UA 4X0EA 4BNFA 5B4VA 1JU3A 3IGFA 2VYFA 5K3FA 1UIRA 2B1GA 2ACWA 1Z88A 4P6VF 2WVHA 3JAWB 3KUCA 5JTTA 4JBWA 2FDXA 3IAM1 1NJ1A 2OQ4A 3QF4A 3NZEA 4Y3UA 1JIXA 4P35A 5BSUA 4NBUA 4AJLA 1WA5A 3DYVA 2FX5A 2A94A 5KNCD 2HHHB 1G42A 2GCOA 1RWBA 2REQB 4WH0A 3SAWA 1GKIA 4MWCA 1IXSA 2JJ2D 1P3QQ 2ZLBA 5DN9A 3JD0A 5IPFA 1DIHA 3JZFA 1ECCA 3KM0A 1E9VA 3TOVA 4LFCM 1ESCA 1KRXA 1VPDA 4P5EA 5HPYB 5L53A 1MEJA 4UDNA 3KSJA 2JGAA 3V6LA 1QFJA 4AN0A 2P9FA 3G2HA 4MRMB 2IXFA 3HRIA 4TPKA 1M75A 1XCLA 2I4RA 4EHDA 4CMJA 1T6XA 2PIDA 1TAHA 5EJ7A 2Z8YA 3LX6A 3JAMS 1QHEA 3O4GA 3T6KA 1A82A 3GQBB 3JRWA 2EDAA 4PS1A 1QYCA 4BZXA 1VBMA 1RP7A 4B3IA 1W0KD 1KQGA 4MXDA 4EW3A 3C3YA 3IX7A 3R40A 4TKUA 2Y21A 1IDN1 4QUEA 3ESDA 3SKVA 1DCTA 4EJSB 1Z25A 1Z7EA 2HCFA 3HJAA 4TKVA 1YDFA 3MINA 5EJIA 3MTBA 1RFGE 1TJYA 2X13A 2LKCA 2DQKA 4RVUA 4LVUA 2IU0A 1XZHA 3MCWA 4ILEA 2BDTA 4J90A 4IQ0A 4CIAA 1IN8A 1LXCA 4V0RA 2PZAA 4D8WA 2QR3A 1TI7A 2G82A 4FCCA 4HDSB 3W34A 2AR9A 2QSYA 4D80A 1OLSB 2YICA 2O6LA 5E1OA 3WYFA 2EQAA 4V0MA 2DNAA 3PHGA 3LBYA 4MVJH 5CTJA 4GIPA 4J6EA 3KPWA 1KOFA 4C08A 2OD2A 1RJ9B 3C1UA 1VBFA 1HE8B 1RI4A 1JSZA 1P5FA 4Y9TA 1GSIA 3HJHA 4J0HA 1A5ZA 3PGVA 3I3OA 4WJKB 5K5EA 2VBIA 5IN4A 4I81A 4EAQA 1LY1A 1N3BA 4IIGA 4C0LA 5FPKA 1OR8A 4M98A 3V4SA 3W2EA 2SCUA 3PFCA 3CISA 1MT0A 2QGNA 1TQ2A 4DMFA 1OFHA 4LV5B 2WG1A 4MKXA 2KNAA 3DOJA 1VFPA 4WFQA 3T4EA 1FXSA 1G9SA 1CUXA 9ATCA 1GU1A 1NXSA 4GT1A 2BP7A 4GI2A 4KXNA 3BMCA 3G1TA 3F5QA 1UFZA 1T9DA 4CTKA 1PR2A 3EY9A 3VPCA 3RYCB 1MOZA 1UXHA 4JU8A 4RMJA 4DQKA 1YOVA 3HCWA 1NR7A 2ZJOA 1MNQA 3OPMA 4O25A 1OA0A 3LYAA 4MVJE 1IK6A 1K0UA 2GRJA 2XZPA 3AM3A 1LPSA 1WQ1R 4PXAA 4IWNA 2ERYA 4GPAA 3L02A 1VRVA 4I9NA 3M9XA 3ZYCA 3AM4A 1TD9A 1GG5A 3GUVA 5L6LB 2Q5OA 2NP7A 1IHUA 4XAQA 3OZCA 2QPLA 4AROA 4V38A 5LMNM 5HEKA 3ZI0A 4D9JA 4J76A 1JAZA 1OI2A 4C3ZA 3R3SA 5AK3A 2QB5A 2R7LA 5ALVA 1H1LA 2XH8A 2WYVA 2GN0A 5JASA 3L77A 2CEKA 1RRFA 3WADA 1A8QA 4B3XA 4KYIB 3RT9A 2NUBA 1DG1G 1UC8A 4FD2A 4JCCA 1CB7A 4NENB 2QORA 4ZDJA 1CB0A 2BY4A 1F7VA 2IYRA 4Q6BA 5TC4A 2ZR9A 2G7MC 4C6TB 4NE7A 3NTUA 4AUMA 4JEMA 3LDFA 1XAGA 3LWDA 4JI7M 1NJ5A 5MGBA 1A71A 5CBPA 1VDMA 1WVIA 3IQZA 4F4UA 3C6MA 4OM7A 1PK7A 2PBZA 5DGIA 1PE0A 4PZZA 1U8EA 2Z1NA 2EJWA 3ER8A 3DOHA 2QMZA 3BTSA 4R7ZA 4OGWA 4MUHA 5A05A 3IAUA 2AHMA 3K6SB 3R5HA 3K70C 4XTCS 1EX9A 1Y37A 4MGYR 1LVGA 1ZIXA 1TH2A 2FQ1A 2N1MA 3H1FA 1I6LA 2ZAYA 1R8YA 3BZWA 2F5QA 2C3MA 1KIMA 3KZ1E 1W9MA 5FX2A 4MRRA 3CNEA 4OFBA 4DSZA 3V1UA 4WK6A 3IEMA 4GDFA 4CU5A 3GRKA 1NVTA 3QFTA 4DA4A 4DXHA 3IA2A 4ZI7B 3V76A 3KKLA 3U7QB 2HJHA 3Q6MA 4Z5XA 5LYYA 3MJDA 3OCYA 5FNVA 1UP6A 3A1TA 2JH3A 4QBTA 4HRVA 1QBKC 1TYCA 5FQOA 1WEKA 3ON5A 2X1VA 1OX4B 4MR8B 2PXAA 1U8ZA 2VJCA 2WYOA 2B4TO 4KVAA 1SRRA 1YCGA 1O97D 5EXTA 3QXJA 2FUKA 4BVLA 4CLRB 4FT2A 3TX2A 1YB1A 1A0OA 4H0FA 4Q4AA 4J94A 3ABIA 1MUUA 4YQEA 4AXBA 4RHXA 4L08A 2YVAA 2NU9A 4LDNA 2V9CA 5CPBA 4DNOA 1FMFA 2XOEA 3EARA 1TW3A 2VJAA 3O90A 4GEKA 4P7GA 1NMYA 1JEYA 3WKCA 3RODA 3L18A 4E2FA 1GPH1 2WZQA 4OOEA 5J4YA 2L4FA 1KP9A 2GD6A 1QP0A 2OY0A 2ZVPX 5BR1A 1QDRA 1DRJA 4CEHB 2WWYA 2UKDA 4MUNA 4AMBA 3L1HA 1JTVA 1Z75A 3F7NA 1Z3IX 3R3WA 1OH8A 2VVTA 2ANBA 4S1PA 2AV6A 2I8LA 3OX1A 1OLXA 4IIHA 4EL0A 3WX0A 3CR8A 2EL9A 2EW1A 3GRCA 4WN9A 1POWA 2VAXA 3PNOA 4JI5B 1V35A 2FCAA 1XCBA 4H0CA 4RM2A 4I99A 2QN3A 5BMVB 1WAMA 3K5PA 3KQNA 4WX2B 4E3ZA 1SCBA 2EJSA 4YR7A 2FFAA 2EJVA 4U9HS 4U6SA 2X9NA 1ZD5A 1T2FA 4HNSA 3G88A 1WUJS 4LHSA 5DGXA 1SUWA 2SKCA 4WESB 4KSBA 2IHUA 3QVOA 4X6UA 2QN1A 1E2UA 4C0BA 3RUCA 4LK3A 4KRFA 2PZGA 2VJMA 1GVHA 4OHXA 3IMGA 2OXTA 4KMMA 3K0CA 3KVRA 1C8KA 2L82A 1E2IA 1NUTA 1YFJA 4IBGA 3T1YB 2IQIA 4MVJI 4J2TA 5K9ZA 4QPNA 2D0DA 3JQAB 3NYIA 3PE4A 3UMRA 3MK31 3QKRB 4BO3A 2KEBA 3IG8A 4U8HA 5HSGA 2Z8XA 1QDUA 1B73A 3TMYA 4QOGA 1XP5A 3UICA 2O25A 3TOSA 4IGKA 2CHGA 2VTEA 3X1MA 2Y2VA 3GJRA 5HJ5A 3GT3A 4BE7B 3W9UA 3C7CB 2PEYA 1PTJC 3V8QA 1MBZA 2QQ5A 5E9JA 3G79A 3UWSA 1Y33E 1UM8A 1UFQA 3VYVA 3DR5A 1L7QA 3JWPA 3UV3A 5J43A 5EE0A 4W9MC 2Q1XA 1GTL1 5AJXA 2O2CA 5JPDA 1YQTA 1GIAA 1ZVMA 2FHPA 4HOYA 4OVZB 2J32A 4U0JA 4EK9A 3LLCA 2JEZA 1NSTA 1X15A 2PA3A 2ZI5A 4B75A 3GMSA 4NOJA 1S7CA 4TVSA 2GK4A 1QZUA 3W3AA 3K2BA 5IWAM 4NICA 3FVWA 4IXWA 4DM3A 1QCYA 1QWSA 4TKMA 4WEOA 1KQPA 3IDOA 3SBOA 3H9CA 3ESBA 3SC2A 4M0MA 5C4MA 1RDFA 3VYRB 1TIKA 4HRAA 2PPLA 5I5GA 2XBUA 4BLOA 4DYDA 2A1UA 4M89A 4XLLA 3M6UA 4XWGA 4HAUA 4UMDA 2BFOA 4WOBA 5AHWA 4KSCA 4L8LA 1XKTA 3UV6A 5AOVA 3NP9A 3VX3A 4QGAA 1ZN2A 2I1VB 2I99A 2EATA 1TQ8A 1JLKA 1QGZA 5ILQA 3IAEA 4K6MA 2P2GA 1N6IA 5EFOA 3SF8A 4XEUA 4RPCA 1XZJA 4K9MA 2A57A 4CF7A 4LXUA 2ORWA 4BZPA 2JDIA 1K0FA 1PFYA 1NRXA 1GAXA 2JFHA 5JT1A 1T0BA 3DVQX 4MKGA 1GKUB 3G7NA 1RHJA 5H80A 2XXAB 3HR8A 2HQBA 4PG6A 2V3VA 4JEUA 3T4PA 4BLTA 4RYDA 5KYUA 2M1XA 2G63A 3V1MA 2F55A 4R83A 4QREA 3RTEA 3CZPA 4DCCA 1R5JA 1DBQA 2CXXA 4FGKA 3O6VA 3KSUA 1LZKA 3L9WA 4PLHA 2PZKA 4NMXB 1WB5A 3QYFA 3HNPA 3IYLW 3TQOA 1IC6A 4D6XA 1JL3A 1C8VB 1MC4A 3PJFA 1G20E 4GWGA 3O03A 3IEPA 4I1UA 4R81A 2B36A 1KI9A 2C1XA 4NEGA 3ZIUA 3QI7A 3EGVA 1Q1GA 1QB7A 3IKMB 4MI6A 4CIWA 3BSWA 2HLDD 4BWYA 4GBMA 3HYRA 4QEZA 1T8UA 1U6KA 1II8B 3ZE1B 3CH7A 4JQZA 1JI3A 3CCFA 2KDLA 5AT1A 3PRKE 1W4ZA 1EEHA 1WDWB 1RKQA 3JWJA 2DOKA 4G4OA 3EZ7A 4MH0R 4E2WA 5IF9A 2W0SA 1JDSA 4EY5A 5EG5A 3RTCA 3DBRA 1H6DA 5JLAA 1F2UB 1LZLA 2C5BA 4K8OA 3I1FA 3QFSA 2FZEA 1M6HA 4TV9F 1GGEA 3E6AA 1HT0A 2VYQA 2RBGA 3WWPA 3WP0A 4TM8A 5EE5B 2O0KA 4N6GA 5DXAA 4D44A 3TGLA 1BDIA 2WLTA 3E8SA 4R71A 1N6KA 1HDXA 5HJ7A 1Q2UA 4B43A 4IVRA 5DHPA 3AFHA 4JITA 3T4UA 4IFEA 1UDXA 1AUOA 2FPOA 5LB2A 4A5OA 1AUVA 2ZYTX 4XD7D 1GPLA 3AXSA 5EA2A 1Z5VA 2WF7A 4FMPA 1TKBA 1W1WA 1D0MA 2XUPA 4PYNA 2IOQA 3AUKA 2ZWIA 5MGNA 3JWIA 2H2IA 3AM5A 1WCV1 1Z74A 3N2ZB 3SZMA 3UMVA 1YA8A 1AUXA 4NU5A 2Q8PA 2Z9DA 4C88A 2AL7A 1TUGA 4B3FX 1FRVA 1SUBA 1U4NA 4Q4HB 5EYPB 3IPCA 3ILYA 3MWYW 3GP3A 6NULA 3VRHA 4L9AA 1ICEA 4HHEA 1F4VA 1UBNA 5FRDA 1HRDA 3SBDA 3ZK8A 4ZK2A 3LUAA 5HX7A 3LY9A 1NBME 2XNDD 1N33B 3OLZA 2OVBA 1EWYA 3GNTA 3OHMA 3SBXA 1QV6A 4ESHA 3P45A 4E94A 3CX4A 2C9DA 4WZ6A 2QYHA 1BHQ1 3NKFA 1QIGA 2B4KA 1SOAA 1P1KA 4KCGA 4MV8A 3I53A 1E1DA 2JANA 3E9NA 3O4JA 5KWIA 4BVJA 2C2GA 4C76A 3OZUA 1RAHA 2BCGY 4I14A 1CQZA 2R1UA 3HA3A 4ER3A 4ASUA 5DTIA 4B76A 3U4IA 1BMTA 3LVQE 3KFUG 2O2EA 3O21A 2OHFA 4JZYA 1CWUA 4CMAA 2WHXA 2FQXA 4OKIA 3WRXC 1MVOA 4AZFA 4GR4A 5B64A 1N75A 4Z4GA 5IJ0A 4XR9A 4HLDA 4FNAA 2OHVA 3A6FA 4HB3A 3C4QA 1SRQA 5HTKA 3I8SA 5BN4B 5BQOA 5JJLA 2ZT5A 2WKQA 1DQZA 4OLFA 1ORYB 1J06A 4K0KB 5MN4A 1E94E 1VJ1A 3HCDA 5BXYA 1B3BA 4NBVA 4C0SA 3ZQJA 5H68A 4QRDA 5CT9A 3VPBA 2ZRMA 2MSEB 4KDEA 3E0QA 1ONPA 3IUBA 4BN0A 5ESRA 4NRVA 5HKOA 2C3PA 4QYXA 3E9EA 2QJOA 1VMEA 2BDUA 3KO8A 5CB0A 2JI7A 5LBUA 1ELOA 5ICFA 2I22A 1E6CA 1D03A 4N12A 2WP8J 2IZOA 1NSFA 3KSBC 1JLSA 2FWBA 3FYCA 3AB3A 3DYBA 1DEOA 4II3A 4G4SO 4M9RA 4DQDA 5JECA 3U4AA 3SS8A 3A9WA 4PN3A 1XKXA 3MMZA 3A6PC 1O4VA 2CYCA 5TDHA 3GZ4A 2W2XA 3QXSA 4W5QA 5EJEA 2Z6UA 3K6RA 4BO1A 1HNNA 5L4LA 1V1JA 1YGYA 1T3TA 4CCAA 3G2OA 2FMFA 1GPYA 1V8ZA 5KOIA 1LRLA 1AKEA 1E2EA 4IZHA 2QRLA 2GWHA 2LBPA 2ZSEA 3ZCBB 4IVNA 1FCJA 4ZA2A 4UHJA 4C5BA 5FOUA 3QTBA 5AIBA 4ER0A 5CA1A 4BX3A 3A9VA 4XGRA 2PVSA 3DWFA 1OAAA 2ZI9A 3KAQA 4B87A 4OYRA 4XWTA 4I9FA 5K0NA 2GFHA 3UQYS 5A62A 3UHJA 4XB6B 5CYPA 3C3EA 2X14A 1ZM4A 3ICQB 1XMQM 2QYSA 3EQ6A 4KQMA 3DBIA 5F7OA 4MDEA 3PQ4A 2IHTA 2I6FA 2ZPAA 2ZETA 1GADO 5EHGA 2D5BA 4MEBA 3LAWA 1F38A 4D9BA 1NJ2A 1T4CA 1K7CA 5D5PA 3UJPA 2PNJA 3IUMA 2EXXA 1KEZA 4P7FA 4EBBA 1Z06A 1V33A 2GCGA 2SBTA 3I42A 1VL5A 2DHYA 2CUZA 3MUOA 2NU7A 1OROA 4NJOA 2Q8QA 2BBOA 2N1BA 1Q84A 5DXJA 2CN1A 1SWVA 5B7NA 1L4EA 3BA1A 4LJKA 5FBRB 3F9IA 4CN8A 1TQHA 5ECDA 1NYLA 3JQRA 3V8MA 3B1VA 5I7AA 3W6ZA 4CTMA 5EZYA 1JBEA 2PQ2A 2OYRA 4M0EA 1Z7WA 4JLSA 2EFGA 3CNHA 4WY8A 4PYIA 1Q7RA 4RK5A 3AEYA 1OFVA 1S2GA 1L4KA 5I9NA 3KETA 3DKPA 1UJMA 2J1LA 3RFWA 4CCYA 4IPTA 2QRNA 4OXIA 2KHZA 4IL5A 1DXQA 1QTIA 5A9TA 3FGPA 2W6JD 1F9AA 3OPYA 2AK3A 5G0WA 3BK7A 3LCVB 3KU1A 1ND6A 4PIMA 1EFVA 3JQ9C 3LUDA 4EKEA 3KLOA 4DJAA 5IVIA 4MRAA 4KMOA 2FFRA 3UBMA 4DSTA 4OGFA 5LYJF 4GGMX 1QJ4A 2W42A 5FPHA 3R3VA 3UT6A 4L07A 2YJ4A 3QE0A 3AJEA 1HEYA 4LS3A 1ZMTA 4DV4B 1FJHA 3BRSA 3MS4A 2QD1A 4QLBA 1A27A 3U9SA 3HP7A 5C8ZA 2PX4A 3OD1A 4HDKB 3F92A 4RQUA 5LNK6 4N6OA 3TD2A 3WWZA 3JQ7A 3GAAA 1TCUA 3HU2A 1PGYA 3WZ2A 4JAVC 5J5CA 1FLDA 1N7HA 4A3VB 2CDCA 1QH8A 4KXVA 2EJBA 1E2PA 3JWHA 4KOAA 2P2YA 3VR2A 1ID1A 3JYOA 2FN3A 1I0LA 2IW1A 4KODA 2WE8A 4UOQA 4D8YA 1Z4LA 5FBKA 5AUOB 3L40A 1YE8A 4KAXA 3IV7A 4S1VA 4KR7A 4QWWA 5DO9A 2PGIA 1TB4A 3WYDA 3ERCA 2R5FA 2IUUA 4DIKA 4AZVA 2PH7A 2IX9A 4YJ3B 2NPIA 4DV6M 4HL4A 5JCOC 3DB2A 1G59A 4EDHA 2VYND 1DP4A 5E1DA 1XTQA 1OI4A 5TEVA 3FW1A 3U56A 2GRUA 5JNUA 4X7PA 3VJLA 3T1VA 2DF8A 2ZSKA 4KX3A 3EFEA 4BKOA 2DWCA 3M49A 4B6EA 1XQ6A 2NUTB 3NGMA 5KDLA 2Z2JA 3INGA 5HFJA 4N0QA 3ZWYA 1BJTA 1GL7A 3VMFA 5DBFA 2PLFA 1J2RA 1N5MA 1BC5A 3NCHA 4HT3B 2WU0A 4IDFA 3E2MA 1H0HA 3FLMA 2FYTA 3VMMA 1G3MA 1QK3A 2CMGA 4P92A 1P7YA 2PUVA 4NG4A 3EW9A 3TFWA 5F2NA 3V8PA 1HURA 1L5VA 4KE7A 2RGUA 1YDWA 3PBKA 2WU1A 3I2KA 2WU4A 5IJWA 4CL8A 4FIZA 2ZAIA 4OYYA 2Z5FA 1PNOA 4XVRA 3WGKA 1E3WA 3PNSA 3EFOB 4UXJA 3A04A 2JW5A 2MSLA 3CLRC 3DT6A 3VTAA 3R5SA 3MS2A 4ZVSA 3FJYA 4TTJA 3U7HB 2VEDA 4P1ZA 4WQMA 1OTHA 1XQ9A 3ANXA 3T8YA 4BEBA 4HRXA 3WL8A 2DB3A 2C20A 1E20A 4OX9B 2W4IA 4GMKA 4RHFA 3H1TA 5EZQA 1CUCA 2BZGA 3UJNA 2E6UX 5CDFA 3W4KA 4PZPA 3VNUA 4EB6B 1AIPC 4BX2A 4O5OA 1NXXA 2QRMA 2W4QA 4ZTUB 5ERXA 4BX0A 4GZ5A 1Q0TA 2DAGA 4HNGA 3QENA 3D7KA 3QIAA 4KLCA 1I30A 3H17A 1H3EA 2P4SA 2IHBA 2ZRBA 3R7LA 2P41A 2FPMA 2OZLB 3KJGA 1QHNA 4ZFNA 5BVHA 4W4TA 4WCFC 1G63A 4EKGA 1CEEA 3L3BA 4DTIA 4E4YA 5DM70 5C4GB 3L6RA 4YDRA 1C1YA 3LYLA 3QVXA 4KVZA 4QHTA 4KLAA 1Y1QA</