3H4MA

Aaa atpase domain of the proteasome- activating nucleotidase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
b'AMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-activating nucleotidase
publication title Structural Insights into the Regulatory Particle of the Proteasome from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3h4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h4mA01
4IXMA 2IYQA 4B3DA 1ZNXA 2GZAA 4NL4H 4OQXA 3EWAA 1E9RA 1DEKA 3QF4B 4JLNA 4HAZA 3UXMA 1KI6B 4C0LA 4ZIRA 3O8RA 3C16C 1G1MA 1XDBA 1JNYA 4B43A 5P21A 4KBFA 4LDJA 4Q5IA 4YXWD 2JATA 4TSFD 3WNCA 5TARA 4BFVA 3VU9A 2VP4A 1XZPA 2J7PA 4B32A 3QXCA 2WWGA 4BWYA 3BORA 1R8QA 3A4NA 1DBSA 2IS2A 1UKZA 1CR1A 2YC4C 1M2OB 1N5KA 3A4LA 5EP1A 4XOIA 5DIFA 4AKIA 2OO7A 5KDDA 2BJWA 1G6HA 3K09A 4WXPA 4A8JB 3SJBA 3H4MA 2EYUA 2VSXA 1E2JA 2PMKA 1E1RD 1TQDA 4IDPA 2PZFA 1G3IA 1II9A 2D3WA 2RMKA 3AKDA 3OEHA 3C5HA 2GILA 1W0JD 3D31A 3I8XA 3FOZA 4IHQA 3SHWA 4BZPA 3ECCA 3KXKA 2ONKA 3CPHA 1NVWQ 2HEIA 4OI0A 3LO5A 4ZKEA 5K8UA 2AL7A 4JL5A 3OAAD 1CBUA 3SFVA 5J5CA 1KK3A 1EG7A 4DLWA 5AUNB 5FOTA 4EPVA 1NKTA 2HYDA 1CRQA 4LI0A 3D6TB 5L8VA 2J41A 3OZXA 4FCTA 4BLRA 2R62A 3AGPA 4TL7A 2QPAA 2BC9A 2ZRBA 1NLYA 5KYKA 4EQ6A 4PSAA 3QG5A 1E2EA 3P4YA 4ACBA 5JJLA 2EFGA 4G1UC 2W2XA 1E0AA 5CJPA 3ONWA 4QXAA 1KZ7B 2NQ2C 4V0OA 1BS1A 1TPZA 4U02A 1KI4A 3UKDA 4PAOA 2QPOA 1LF5A 1NY5A 3OFND 2VF7A 3FMOB 1JBKA 2YOFA 3KZ1E 1CJVC 5A5GA 1YZNA 1SVLA 4KCGA 4DBLC 3BB1A 4WW0A 4Z8YA 3WRYC 3PCRB 3EX7C 1RPZA 1PV4A 1GP2A 3SQWA 3RWOA 3MWYW 3CRRA 3I32A 2H1LA 1P4SA 1P62B 1IXRC 5JECA 1YZQA 4C3ZA 2RB4A 3G5UA 1R5BA 3EXAA 3I62A 1LFDB 4B33A 3QXHA 1KZGB 4AD8A 2JLYA 1MABB 1QRAA 5FL3A 4BZXA 2IYWA 1UBCA 4OYHA 1TMKA 4BEJA 1OXTA 2HT6A 3REFA 1WXQA 1PLKA 4ZCIA 4MYTA 4NYIR 3GFTA 3P4XA 4N0DA 4ZI2A 2VHTA 3CO5A 1KI9A 2ZRFA 1B0UA 1OV4A 2CJWB 2CL6X 2IYSA 3VR6A 1CXZA 1G9XA 2VSOA 3AJIB 1FOEB 1XX6A 3AF0A 2VF8A 1FQJA 1NLFA 1XMVA 5FBRB 3KKNA 4ARZB 5KO2A 1T3LA 1NRJB 5FTKA 1Q20A 5A0FA 1J7KA 5SZKB 4KXFB 1RW4A 4WIAA 1W48A 1RRCA 4RZXA 2BM1A 3FMPB 2R65A 4Q4LA 2WSSD 1A7JA 1E9SA 1TF2A 4R2HA 3GFPA 1XEFA 4AC9A 4EQ6B 1LS1A 2ZVQX 4M8NE 1WQ1R 1KDRA 5IRCD 4D2IA 2JJ1A 4QBIA 2A5FA 3UMFA 4FXPA 1KDOA 2ZJ5A 2H5EA 1E2MA 2O0HA 3NBXX 5KHOC 4FINA 1FNMA 3I3SR 3I8SA 2WMNB 4EJSC 4LJ6A 5JHGB 4LHVA 4HUTA 2EQBA 1W5SA 5FOWA 1BMFA 2QMUA 1IN6A 4PPQA 4L9SA 3LH5A 1ESMA 5IDVA 4FCWA 1KO4A 4S2EA 1TL7C 1R10A 3IO3A 5JI3E 1NMYA 1KMHB 2DFKB 4PC6A 4CEHA 4OK6A 2J7PD 3LD9A 1JR3E 4US2R 5HKKA 5KSZA 1E4YA 1FX0A 1N5LA 3ZVMA 1G20E 1GAJA 2O0JA 1F2TB 2GEUA 3O47A 1VYTA 4URYR 3P20A 5KU1A 2R2AA 1X86B 2ANBA 2E1RA 4V0MA 4PQRA 2QNRA 1K6MA 4DIDA 2JDIA 2EU8A 5LD2C 1UKEA 3BB3A 1SVKA 1ZC4A 2CHQA 3OEHD 4KFSA 8OHMA 4EKDA 1VCNA 2PBRA 2QBYA 4JBWA 2TMKA 3QKSB 3D8BA 1II8A 1NP6A 1OLOA 3A1VA 4PQYA 3A58B 4QGAA 1G4UR 2JLUA 2XTMA 4OBEA 1KKMA 1DAEA 4MRVA 1ZCAA 4HAVA 1SKQA 4LV6A 2F43B 4A1FA 5KNBA 3L8ZA 1KK2A 2J0UA 4PAQA 2BM0A 3AF4A 2VEDA 4Q1BA 5FUVA 2IWRA 1YHNA 1Q57A 5ANRB 4A9AA 2ZI7A 3K70C 2ZI6A 4PPGA 1E9DA 2OCYC 4M1MA 5FPSA 4C0HA 3HPQA 1NVVR 2C5LA 3HJNA 3V9PA 3L0IB 3W8RA 4E03A 2LKDA 3EPJA 3NC0C 1SXJA 2GCNA 3HU1A 4Q18A 1UBGA 4HZIA 4FW9A 2NG1A 3U5ZB 3P1JA 2CNWA 2N42A 1R2QA 3PXGA 2FU5C 1Z47A 4MUBA 4IDQA 4YMUA 1LW7A 1U98A 1N6IA 1U0LA 2ORIA 4P4SB 1ZYUA 2QMOA 2XXAA 4ZCMA 2GCOA 1D6JA 4II7A 4C0AC 4IDOA 5AUQA 3K0SA 2A7QA 1COWD 2WV9A 3ZIAA 2K5UA 4A82A 2JLXA 4CEHB 5DO9A 1OXVA 5CIWA 2IXEA 3GLIB 1VHTA 2LCFA 4L16A 1GG2A 2WBLC 5EXPA 2A5GA 4KI0A 4BPBA 5AK0A 3K0EA 4O25A 4N3NA 1E9BA 2WHXA 1QHNA 3BH7A 2QAGC 3BFXA 4PQFA 3N70A 4EPWA 4QFMA 1UM8A 4QNRA 3JZMA 4C0BA 1CTQA 1QHHB 4YQFA 3VFDA 3BXZA 1DVRA 3AP2A 2AKAB 4FMCF 4JKIA 3SJAA 4DUGA 2V6JA 2QE7A 5H68A 1BYUA 3FHCB 3UG7A 1GKUB 1II8B 3EC1A 2B7CA 1PLJA 3DKPA 3HU2A 4AYTA 4ZI3A 2R8RA 2CCKA 2CE7A 2OAP1 4ON9A 3U6BA 4NPHA 1MV5A 3I72A 1TUIA 1HUQA 1J90A 5JEDA 1LY1A 2ODNA 4RY2A 1K5GA 1P72A 2HJVA 3DL0A 4ERNA 2AWNA 3BBPA 2GAOA 2WJYA 1L4YA 4O2RA 3AQ4A 4WAUA 3ETLA 2ZPTX 4M2LA 2JJ1D 2N1BA 1OB5A 5EQTA 1JJVA 2XNDA 4XWKA 3RAPR 2Q3MA 2Q6TA 4UJ3A 1J8MF 2UKDA 3GLGE 4ACAA 4WA7A 1IJFA 2YHSA 4W5WA 1BMFD 5BN3A 2C77A 2BCGY 4GZLA 1DTSA 1F3OA 2W6JA 1S8FA 2GCOB 4GI7A 3GEIA 3ZDQA 5FH9A 3IHLA 5C46F 1UPTA 4D0NA 1JAIA 3CNOA 1AS3A 2KWIA 1TTTA 1E9CA 4LK2A 1YR7A 3UMSA 1FW6A 2HXSA 5HKKD 2UZ3A 3EA0A 4B6FA 1RRGA 4CVNA 2BBTA 4ITRC 1J70A 1H8EA 3I4LA 1KKLA 2RGAA 4HATA 2ZJZA 4V03A 4U00A 1MKYA 4M53A 4LZZA 2JDID 1Q1ZA 2O8CB 3CZQA 2YC2C 2KI5A 4FWTA 5IK2A 3IO5A 2G3YA 4KV9A 4Q7MB 2IYYA 1SKYE 3ZGXA 4GP7A 4PC7A 1MRSA 1CJKC 2ZI9A 4PSKA 2OUKA 4QL3A 4DB2A 1W7AA 1XXHB 4JVMA 3QXSA 1AA9A 1RRPA 2IYTA 2Q9AA 4HB2A 3QF7A 4PHFA 3F5FA 5E7JA 4TYNA 4V0LA 3M4YA 4TLEA 1CR2A 3IQXA 5GVRA 1X1RA 1GWNA 1W47A 3SBEA 2ZSDA 1XTQA 2D62A 3LNCA 3N2EA 1T3SA 4OJKA 2J0VA 4DCNA 2AX4A 3SQXA 4QG7A 4JVNA 5L3VA 4TZ0A 4X8HA 2F55A 3RYTC 4KITB 1IXSB 4HLCA 4Q9HA 1IN7A 4EPXA 5J4YA 2ZS7A 3FHTA 3VHLB 2QM7A 2CBZA 2WICA 4XWOA 4ESVA 3U4QA 3TR5A 5EXSA 3U60B 2V9PA 3QG1A 1T3HA 1MRNA 4CEJB 3Q3JB 2CNWD 2ZR0A 2BHRA 4TLBA 4GMXA 4Q1CA 2QN6A 1V43A 3DOEA 4QGGA 2XZPA 2GXAA 3QXJA 1Z6XA 4IOKA 4JMPA 2HF9A 2RGXA 4NYJR 3ZIAD 1TQ4A 3VR5A 3UK6A 4GT1A 4OJQA 3C7KA 5EP4A 1VHLA 3A8TA 4B2IA 3NXSA 1VCMA 2EFEB 2JA1A 1XNJA 2WOOA 5KDLA 1YZGA 3NBZC 4JLVA 4NE2A 2G9NA 4LGMA 1CKEA 4RD3A 2C95A 4URWR 3DOFA 3LX5A 3TAUA 4EAQA 4PC2A 4Q4HA 2B7BA 2EWVA 1ESNA 1UEJA 4QHYA 2WWFA 4OL0A 3X1YA 5EE0A 1DAMA 1BO6A 3EIQA 3GLFE 4DUGD 2QAJA 1EX7A 3VR4A 2P6UA 4B3XA 1G5TA 1XU4A 4W5JA 2IUTA 4TMWA 2WJJA 2GBLC 4NYMQ 2FFBA 5J47A 4XWAA 1HE1C 2I1QA 3IEVA 4LHYA 1S0UA 1IHUA 4KSBA 2FSHA 4RD2A 1G7SA 1WP9A 3GJXC 3EWSA 5FUWA 3MJHA 1NBME 2F1RA 3W5IA 1EXMA 3EIHA 3TVDA 5AJVB 3R8FA 2ZITA 1DS6A 3PUWA 1AS2A 1M1YE 4D6PA 3JVUA 3PEWA 2FE4A 3U4QB 1E2GA 4XJXA 2ZM5A 1SZPA 2ZANA 4HB0A 4CF7A 1E9FA 1XEXA 2H17A 3GMTA 5JWHA 2JLQA 3TUIC 2XNDD 2ECKA 5FR2A 1UBFA 1UBEA 1M8PA 4LPKA 2IYVA 3CR7A 2PZEA 4QNMA 5FPTA 1XMIA 1G8GA 2WAXA 5CB8A 2W6JD 2REXB 3LA6A 4AYWA 2ZYVX 2W2TA 3DVLA 2GJAA 2YV5A 2VBCA 3LW7A 4AK9A 4RVCA 2R6CA 1HH4A 4TLDA 2BWJA 121PA 4NKRA 3K0CA 3SI7A 2FF7A 1XTRA 3D3QA 3GJ8A 4KVGA 4E5UA 1AZSC 4HLUC 3KQKA 3ND8A 4OKSA 3KKQA 2LWIA 1RC8A 2WPDA 4JLAA 4CDGA 1G6OA 4D81A 4JIMA 2E87A 2XTNA 721PA 5IK2D 4Q4HB 2WKRA 1TX4B 4JN6A 1OXXK 3IBYA 4FWHA 2D2FA 1G291 2OBMA 3QOFA 2WIBA 4JSYA 5KNCA 2CCGA 3WRXC 4LWZA 2ZSFA 2PMDA 1GOTA 2YINC 3GLHB 3AKYA 2YYZA 4MRRA 4PZLA 5JI2E 4Z1MA 1GITA 1WRBA 3IKJA 1EFRA 3BOSA 4N0EA 621PA 2GRJA 1G64A 2JJ8A 3X1WA 2WWWA 4R7ZA 2BVNA 3PENA 5JCPA 2W58A 1I2MA 4G5GA 3WYAA 2J0SA 1E69A 3T5GA 2FSGA 2PT5A 2YWGA 3I5YA 1VG1A 2FZ4A 4B3BA 2OEPA 3AV0B 1US8B 3H2YA 4MKHA 3CZPA 4URUR 4TL6A 2WWHA 4LYFA 1OXUA 2Z5FA 3FFAA 4B76A 1QF9A 3F3YA 5CLQA 4G5OA 3RANA 3TNFA 3WHLA 1XEXB 2H18A 1RZ3A 2I4IA 4LJ7A 2HCBA 2ZSBA 2IUUA 1TAGA 1GIAA 3DMDA 4YONB 3FGNA 2H8KA 1CJTC 3E2IA 4BECA 1W4BA 2OFWA 3SS8A 2WJVA 1TQ6A 4JLOA 3MLEA 1Q22A 4W7SA 3QQ5A 4XSHA 5G41A 3WP0A 1QHGA 5TV2A 2H57A 2ORWA 4TYPA 1TNDA 4JLKA 4Z54A 3B9QA 1Q1EA 3VKGA 1NY6A 3SYKA 4KO8A 1U0HC 1R5OA 1ZRHA 3BB4A 3IQWA 2YOGA 4LBYA 421PA 4B2LA 2JLZA 4TZ6A 2YJTD 2NZ8A 3B1XA 3BH0A 3OFNA 4DLSA 5J4HA 3VNUA 3CM0A 2GVZC 2GJ9A 3CRQA 3CB4A 1CRPA 3GJ0A 1SVMA 4JBXA 3AUXA 3NWJA 2ODBA 1IY2A 1Z6AA 3FMFA 4Z8XA 2GK6A 4Y0AA 2NO0A 4XH9B 3E5HA 1JEDA 1Q21A 1OE0A 2ZQ5A 2KE5A 5CM8B 4EFNA 1R0XA 2XB4A 2VHQA 1E2NA 1GSIA 3LWNA 2QP3A 2VP0A 2YWFA 1BOFA 4A8JA 4EJSA 4AKHA 2AN9A 2V6ZM 3NIBA 2KSQA 4NYIQ 3MJRA 2ZSAA 5B30A 5DLQC 3AVOA 2W6IA 1NMXA 1GRNA 2WZQA 4US0R 1ZD9A 2FPMA 2WKQA 4L15A 1VCOA 2KJQA 4FWGA 3KJIA 2EWWA 1KSGA 3EZ9A 4I4LA 4MYHA 4PC3A 3RS3A 2ATXA 3I92A 3LBIA 3SHFA 5LPNA 3TSWA 2ZJBA 5HZKA 1M74A 2G0NA 4LJYA 2QP9X 3PUVA 3MUFA 2QQEA 5LB2A 3T35A 2REBA 1NSFA 1II0A 3SN6A 1M7BA 2MSDB 1XCPA 4TLAA 2NO9A 2XJ9A 3BWDD 2Q3FA 1FTSA 2GXSA 4A0HA 1KAGA 2O8BB 3CLVA 4I1OA 3GPLA 2FDCA 1H8HA 2OM2A 4ZKDA 4Q4JA 5M04A 2AWOA 1G19A 4V0KA 5KSYA 4B73A 4NCNA 3R9IA 4GL2A 1NIJA 4Q19A 2J46A 4A0FA 1O3YA 4DSNA 4HEJA 3TR0A 2OFXA 5GJBA 3NG1A 5GVSA 4AY2A 5GJCA 2VPPA 3KW6A 3SYNA 1P2UA 3ADCA 4TYQA 2ZUDA 3RDPA 4CEIB 2FOLA 3WYFA 3LXRA 2X19A 2QEQA 5FUYA 4ZDKA 1G7TA 2WPDD 4N1AA 2QSZA 3HWSA 4Q9LA 4B34A 1Q12A 4CW7A 5L3SA 5E3HA 1KGDA 2VYFA 3P32A 3BAFA 4HDQB 1I4LD 2WJGA 5H8WA 2DBYA 2WIAA 1HT2E 2ZE5A 3EPHA 2LKCA 1GRRA 1DG3A 4KFRA 5EE5B 1Z2CA 3DM9B 1I4TD 5BQ5A 2RGBA 2QGZA 5HE8A 5DSZA 1GNRA 2ZRNA 1MABA 3KFXA 4Z1MD 1AGRA 2ZRMA 2ZUBA 4EJSB 1EFRD 3HYTA 3CH5A 1XTIA 1S1MA 1FQKA 1OFUX 4NONA 3UANA 4FWIB 4JT4A 4HI0E 2GHIA 1R8SA 4C9BA 3BFKA 1KI1A 3LFUA 2CJWA 5E7MA 2E9SA 2ZJYA 3ZVRA 2FFQA 2A30A 1NN0A 4M22A 2J0QA 5JSZA 4G0NA 4TL8A 4FMDF 4X8OA 4BLTA 4H1UA 4ARZA 5E4FA 5J4VA 1D5CA 2J45A 3GFOA 4OK3A 3NH9A 4NCIA 3V00A 3MWJA 1FP7A 1IAQA 1N6KA 4IEEA 4XSGA 2QUZA 4WXRA 4DLYA 5LD2B 2QAGA 2RHDA 1N6LA 1NVVQ 3WBJA 4RD4A 3TUZC 3MRSA 4Q4JB 2NO7A 2B8WA 2IL1A 1JI0A 3LBNA 1YJ5A 4MRNA 3GJ4A 3TVTA 2FFAA 2IYUA 3MD0A 4L5BA 4YDSA 3VR2A 4HLDA 1F2UB 4BFSA 5CDFE 1SVIA 2AK2A 2BMDA 3V4FA 3C5CA 1E0SA 3SFZA 4LX0A 5HZHA 1Z6GA 2RAPA 1TEXA 2XJ4A 5L3SB 5EUMA 3CF2A 4KLNA 1W46A 3EASA 4D82A 3L8YA 4FMCB 4DLVA 3TW8B 1KMHA 3TH5A 4JLDA 2ZROA 1KHTA 2GJSA 1COWA 4PPNA 1NIPA 3TW4A 3U2QA 3K70B 3PQCA 3KB2A 1OJLA 3O8DA 1Q3TA 5BN5A 1DADA 4BFZA 4X8MA 1F2TA 4HAWA 5DGXA 3UG6A 3DEFA 2RGCA 4TL9A 3BJIC 2GTPA 5TMPA 1KY3A 4F92B 2W83A 5D3MB 3T1VA 1HEIA 2VHJA 2W6ID 3KJEA 2ZJAA 1XPRA 3WNBA 2XTZA 2A5DA 3FE2A 3KKOA 1S96A 4K46A 3QKSA 4IOJA 4FCVA 3WXMA 2C9OA 3B78A 3P27A 1WBDA 3CUEF 3B5JA 2VRWA 4IKEA 5JSZB 5C18A 4A0GA 1OKKA 1QVRA 4D0GA 3U3OA 2F43A 1FZQA 4RSGA 1AZTA 1D9XA 2ZRLA 3ZQJA 1G7RA 4Q03A 4LC0A 1H8HD 2F1JA 2QT0A 1W4AA 3JZAA 4TYWA 1XP8A 2QAGB 3B1ZA 1T5IA 3CWQA 3R7WB 2C9YA 2Z0MA 4DEXA 3CNNA 4MKIA 5HCIA 3E70C 3KXLA 3BC1A 2Q9CA 4MGZR 1KI2A 2RGNA 1QZXA 3FKSA 3GCGA 4QM7A 2ZR7A 4S35A 2JLRA 4E09A 2WTUA 4GITA 4H9GA 5B2ZA 3TMKA 2F6RA 4MH0R 1G5PA 1L2TA 1LNZA 4LV5B 4CT5A 2GNOA 5CYOA 1EWQA 1P2VA 2VLIA 4P4SA 4B3CA 2KBEA 4QBFA 1AK2A 2O8EA 2WWYA 3RNLA 3WY9A 4RJLA 2NIPA 2JGNA 4IEIA 3ZVLA 3K70D 4TMZA 4JVLA 4HLQB 1E2QA 3SE0A 5BWMA 3F0TA 4DLZA 4OHWA 3GLIA 1EFTA 2GETA 4LHZA 4A0RA 4DJTA 3AVUA 1AGPA 3LY5A 2PT7A 1WF3A 1Z8FA 2R9VA 4IXNA 4D80A 1LTQA 3WMGA 5C2JB 5CM9C 1WB9A 1Z0KA 4I1UA 5F9FA 1VMAA 1KMQA 1SHZA 1W49A 4P31A 5JJKA 1QHHA 2CVHA 4O3MA 3RS2A 1QDEA 1T9HA 5EXTA 1DAHA 4TMKA 2C2HA 5EE1A 1GZSA 1ZD8A 1E2DA 3GLGB 1OHHA 2V8OA 1K5DA 2GESA 4ZDJA 1R4AA 2WOJA 3WMEA 2KRKA 4URVR 1YZKA 4GOJA 4L8GA 5AUPB 1A1VA 4QKQA 1D2NA 1SVSA 4RZ2A 1ZMXA 3T06B 1F5NA 3T61A 2V4ZA 5H1YA 3CIOA 3RABA 1YKSA 2P5TB 2Z4SA 4IOLA 4XTRA 3I73A 3T1QA 3UWKA 1IQPA 2Z6VA 4A6XA 2ZJ8A 4B6EA 5EJEA 1ZM7A 2PH1A 3KJGA 1HTWA 2XX3A 1DPFA 3QNUA 4JZKA 5KNDA 2PEYA 3FFBA 3MSXA 3NHAA 4YMVA 4DZZA 4PO1A 4Q7KA 4HDOB 5LDDC 3VKWA 3TGPA 2EYQA 2AD5A 1W0KD 2F3RA 1XTJA 3QSYA 4QJ5A 1N0VC 2MSCB 4OQMA 1SQ5A 1E2IA 4M9SA 4QGFA 4NYJQ 2DWPA 2W0SA 2ZRKA 4J0QA 3F8TA 4A36A 1E3MA 3RSLA 2O8EB 2D7CA 4QM6A 1P9NA 2MSEB 2EW1A 3KDSE 2VSFA 2PCLA 3IPYA 1N6HA 5EP3A 3IIJA 5K8IA 2HLDA 5JFGA 2L0XA 2C9CA 2REOA 2QENA 2IYZA 2P65A 1E32A 2MMGA 5C1BA 1N0WA 2WKPA 4MDFA 3K0FA 3SEAA 3SNHA 3K09C 2C8VA 4LPSA 2O8CA 4F4IA 5L3QA 2G77B 3AGQA 3TSOA 4A92A 3AF2A 1Q44A 4UQOA 2CEAA 1NVMA 2ZJ2A 2BMEA 2FSIA 3VR1A 1CP2A 1N2CE 4LYJA 2CLCX 2J87A 3TKLA 4MITA 5K8LA 1XXHA 3THWB 4DCSA 3EG5A 4PTLA 2BKUA 3ADBA 4KBGA 3GEHA 1M6NA 3ND9A 5JS7A 1OKKD 4HLUA 4LJAA 2IS1A 4EFLA 1TUEA 3SU8A 4IVQA 3KUCA 1DE0A 2BEJA 4LBVA 3CRMA 4XVRA 1N5IA 1ONBA 2J7KA 4IDNA 4CYMA 2HT1A 2C03A 3Q8XB 4K81B 2BMFA 4JLMA 1U8AA 1P5ZB 1HYQA 1TEVA 4BEBA 2AHOA 1G3UA 3AUYA 3FKSD 2ZS9A 3KTAB 3TQCA 5KUTA 1ZP6A 2IEZA 2AKYA 3NC1C 4V02A 4CEJA 4KSCA 1I2DA 2X2FA 2DB3A 2R6DA 4PZZA 1S4QA 3W5JA 5HPYB 2IX3A 2PCJA 3Q5DA 1QG2A 2BV3A 4POAA 5EE9A 4PSVA 1A82A 1KO5A 1OH8A 5DHFA 2C99A 2DYKA 4BZQA 2JLWA 1F48A 2O8FB 3BGWA 3IPXA 2DZOB 4FN5A 5JCZA 4MDEA 3K0FB 4ZDWA 1KO1A 2ZRCA 4HDCA 4GMDA 4M1TA 3NBFA 5FOUA 1X6VA 5FFMA 1ZUNB 3HP1A 4NH0A 3RS5A 5L3QB 3EIEA 1YR8A 3ASYA 3MMPA 1G8FA 4PANA 4C0JA 3DDCA 1OHHD 1UKYA 5DN6A 2XITA 2QY9A 5CYPA 1XFAA 4F38A 2IT1A 2VP5A 3ZS9A 4P0TA 3G0HA 3IILA 3H1TA 1AJEA 2FNAA 3W3ZB 2AD1A 2G83A 3W34A 2OV2A 4D4JA 4F91B 2WWIA 1MH1A 1DAIA 1ZUIA 4TT3D 3THYA 3AEZA 3NHBA 3QPUA 3M0EA 4JLJA 1HE8B 4BE7B 5B57C 3T5DA 4Z51A 4JJKA 1YR9A 1U0JA 1YRAA 2DWQA 1YE8A 4Q00A 2ZUCA 4TQAA 4RZ3A 4FI3C 4JT2A 1Z07A 1YRBA 5DYGA 3AM1A 1P6XA 4TWZA 3IEUA 5FTNA 4D0LB 3IDQA 2G1KA 3K0AA 1OF1A 2IF2A 1KK0A 1V5WA 4M1SA 2QMEA 2J1LA 1G17A 5BXQC 1G8PA 1Z0JA 3PR1A 3REGA 4WZ6A 4K8OA 3CF6R 3QKRB 2V7QA 3W8NA 4AYXA 2XZOA 3FPAA 4JYBA 3HU3A 1J8YF 5FTJA 1NKSA 2ATVA 2QMHA 1XD8A 1Q0UA 2OG2A 1DARA 4FIDA 4V0ME 2FEOA 2HLDD 1Z5ZA 5CLLA 2I3BA 2VIIA 1XPUA 3SZRA 3K9LA 3QVVA 4BFYA 1Z28A 1H65A 2V1XA 4Q01A 3EC2A 2JIZD 1FUUA 2ZSEA 3LV8A 4YC7A 4BQSA 4WVFA 5GJVC 3U61B 4AG6A 3WP1B 1OSNA 3H0KA 2QI9C 4JLBA 4M1YA 3VAAA 5JHHB 3ICEA 1E2FA 1HQYE 3UWOA 4IJMA 2BBSA 2ZE6A 1DOAA 2QZ4A 1EFHA 2VA8A 4UXIA 1TU4A 4D4KA 4GBMA 4NCKA 3GLHA 4P4TA 3A6PC 2P3SA 4TMTA 1KSHA 1JXMA 5F98A 3GEEA 2FSFA 3O8BA 3B1WA 2KB0A 4M21A 2D4HA 4BRUA 3I61A 3KQNA 2OCPA 3O8CA 4DB4A 1NF3A 2JASA 3THYB 4OQNA 1SXJE 4XD7A 1Z6YA 1VG8A 3ZD7A 1TADA 2V54A 2OCBA 1EWRA 4XVUA 1US8A 2ANCA 3C41J 1EESA 3NTUA 1JECA 1NN1A 1SXJC 4Q7LA 4DCTA 3OESA 4GOKA 4DDWA 4NBSA 2GF0A 4HB4A 4Q1AA 2ZI4A 3ZLJA 2UZIR 3AVYA 3W90A 3RRMA 4LYHA 2CXXA 3K0AB 2ZRHA 3CPEA 4QHSA 3AP3A 1VKJA 4D4LA 1XZQA 2GAAA 4DCVA 4MQBA 2D2EA 1IXZA 5JWRA 1GL9B 4C7OB 1BYIA 2G6BA 2DCUA 2DZNB 3RLFA 3KQHA 3ZVNA 1T8TA 4JS0A 1KI8A 2A9KA 2OAQ1 4RCZA 1GKIA 1MO4A 2F3TA 1O87A 1QHXA 2P67A 3K9HA 3SYLA 1BKDR 3L0SA 1SGWA 3A1UA 1NSTA 3B1VA 5BYJA 3EW9A 2AFHE 2GJ8A 2D06A 4OHVA 3BFVA 2HJGA 2QU8A 4MRPA 1OPXA 4Q21A 2JEOA 1FTNA 3WMFA 4HAYA 2YZ2A 1TU3A 5JEEA 3DZ8A 4Q48A 1OFTA 5G3YA 2IC5A 5DN6D 4LJ5A 1EX6A 1P2SA 3FYHA 1LVGA 5IT5A 4Q1DA 1KIMA 2ZRJA 5SZHB 3OEEA 1WE2A 5DISB 2CVFA 4Y0VA 5G40A 2B6HA 1AQYA 4QBGB 2AXPA 5UKDA 3QY0A 2I1VB 4RFVA 2R6GA 5FBLB 2Z4RA 3L43A 4F4JA 1G3MA 3CX8A 2IA5A 3M1IA 3SR0A 1P2TA 2PJRA 1U94A 2NPIA 1CJUC 5J4KA 5AJZA 3A1SA 3BH6A 1HY3A 5EZ6B 1ANKA 1Z83A 2OT3B 5JJIA 2OBLA 5G3ZA 3PEVA 1E98A 3IIMA 1KTVA 2FEMA 2W2VA 1W2HA 5C4GB 1PVOA 1GKYA 3LVQE 2O8BA 2O8DA 5FOXA 3QBTA 2X8AA 4G5SA 3KXIA 4RD6A 3NDBB 4MA4A 4WBSA 1NN3A 2JAQA 4Q4AA 2PZGA 2ZI5A 1WMSA 3SC3A 1KDTA 2SHKA 2VP6A 4OK5A 5JWOA 5HR5A 4PO8A 4ILEA 5EZ5A 3PUZA 5DHAA 1RFLA 2V7QD 1MO3A 3AP1A 3RSOA 2D74A 3C8UA 3QUSA 1OIWA 4PHHA 2D7DA 1G21E 2OESA 4CIDA 1U99A 1ZVQA 3W6OA 3QJYA 4HYYA 3E1SA 3B13B 4IVPA 4HZUA 5FBWB 4CEIA 5AJYA 1JEEA 2XOKA 3RRZA 1R5NA 3DMNA 3MAAC 4EFMA 3HR7A 4UNNA 3W6PA 1GNPA 1Q1QA 4B35A 3ZH9B 1JB1A 1OH5A 1NG9A 2GCPA 1C4OA 4DLRA 5DYIA 4GOXA 1QHSA 4AURA 2FPLA 4OI4A 1WBBA 3I5XA 1X1SA 3TAHA 3S1AA 3M6AA 1G5RA 3MWLA 3ZYCA 4GP6A 3BS4A 1U9IC 4XTCS 1VYUA 2JLVA 4PZYA 5SZJA 1CULC 1OB2A 4QC2A 1SULA 4TQUS 3VLFB 1C1YA 2ZYWX 1XPOA 3RC8A 4HSEA 1ZAKA 2RCNA 3U3KA 1KNXA 4XD7D 2GF9A 1XJQA 4KYUA 4DLUA 2RH5A 3H86A 4KFTA 5A4JA 1OYWA 1W36C 1Z06A 5L3RA 4MGKR 2Q0HA 2A3RA 4Q7JB 1U8YA 2NOAA 1U90A 3A4MA 2ZAMA 1XMSA 4B2PA 1JR3A 1E6CA 4R71A 2O8DB 2IUSA 1OIXA 5HTKA 4DIEA 3LRPA 3ZD6A 2ODWA 2AR7A 2Q21A 3ADDA 1GNQA 4LJ9A 5KPJA 4Q4AB 1JXOA 2WVJA 2Z83A 4M0LA 3KUDA 2IYLD 2RGDA 1OXSC 1VIAA 2A78A 4P4UA 4V0NA 4OHXA 4F7WA 4DXAA 1F2UA 4TQ9A 2FGJA 1ZBDA 2FN4A 1DO0A 4HZUB 2FWRA 5F3WB 3B9PA 4W5HA 3TSZA 1HQCA 1J2JA 1E1QA 1UDXA 2IBMA 1Z2AA 4JL8A 4TTQA 2FH5B 2O52A 1UFQA 4Q9IA 1ZM2A 2ONJA 4F93B 2P5SA 4CRWB 1WCV1 3U7HB 3FTQA 2VP9A 4PHGA 5AUOB 2Q3HA 2HUPA 1HURA 1QVAA 3K8YA 4Q02A 4RZUA 1A2BA 1HT1E 2BJVA 2W00A 4B47A 1YZUA 2HCJB 2ZS8A 3S1AB 2V55B 4Q47A 2ZVPX 1E0JA 4MKFA 1F6BA 2YNMA 3OEED 1YQTA 3AVQA 4P33A 1ZM9A 221PA 5D3MA 3WBKA 1ZNWA 4U5XA 2ZREA 3H84A 2JLSA 3ZZUA 1D8TA 1KI7A 1ZUHA 2KBFA 4YMSA 4DDTA 3Q5EA 5JMTA 821PA 5CITA 4ZDIA 1ZU4A 4AI6A 5DNYB 2WMOB 4DT1A 2ZRAA 4LC1A 2RGEA 3R9XA 1K8RA 2R44A 4LUCA 3W3AA 5K8TA 5AJWA 3RRYA 4C30A 3PJRA 1W5TA 1R7RA 4Q1FA 2ERYA 1UKVY 4BUJA 1KJZA 4IOMA 1VCIA 2ODEA 4LRSA 4O0MA 4AWXA 4NU0A 1A4RA 3RRNA 4P3YA 1MO6A 3R7WA 3AVWA 1FPMA 3LLMA 5JZVA 3WNDA 3BIFA 1ZU5A 2WAYA 4MRSA 3LAWA 3DO6A 3MFYA 3NKVA 1QHYA 5IHPA 1QBKC 1E0KA 2OCAA 1RKBA 2IYRA 3QEJA 2PLFA 3B2EA 2QTHA 4KYIB 4NP6A 1MOZA 2DFNA 1ZIPA 3RS7A 3SJZA 4QOSA 2P0EA 3CX7A 3ZZTA 1VTKA 2F1HA 3K0CC 4BASA 1X37A 1N6RA 2A2ZA 4DSUA 4EUNA 2BKEA 3KL4A 5KDOA 1FL9A 1W0KA 1RJ9B 1KJWA 3X1XA 1S3GA 1VPLA 1Z29A 1E79A 2XOKD 1ZNYA 5H70A 2YKGA 4NHOA 1T0JB 4BLPA 1UAAA 3QKUA 1NG1A 2DY1A 2QSYA 2ZE7A 3TE6A 4KHZA 5LBIA 5FTLA 1LB1B 2NTYC 1OYYA 1D2EA 1T91A 3IGFA 4ZCLA 1WDTA 4LBZA 5CIQA 1Q1BA 1R0ZA 1GUAA 2IXGA 2CK3A 1E2PA 2AFIE 2P6NA 3DM5A 1NNEA 2IHBA 1BIFA 2PLRA 4YMTA 2ZRDA 1P61B 3CWZA 1A5TA 4L9WA 3A36A 4ZIRB 2IYXA 3EZ6A 4US1R 5JBQA 4BLOA 2CDNA 4URZR 4GRAA 4YLGA 4AIIA 2Y8EA 4OI1A 3EZFA 3BE4A 3GLGA 3FWYA 1MO5A 3VU9B 2NPFA 4DT1B 4EDHA 4JYCA 3X1DA 1XEWX 1S3SA 2PJZA 3A37A 1DG1G 2VTKA 1ZJ6A 3MGCA 3U7GA 4DLTA 1JR3D 2RGGA 3ZS8A 2PX0A 1KOFA 3OIVA 3BERA 3OIUA 3AF1A 4B44A 1NLZA 3WYGA 5FTMA 3A1TA 2CL0X 3KKMA 4B48A 2VO1A 3FVQA 1HV8A 4C0QC 2FX3A 1R0WA 2FJUA 2N46A 3CW2A 1GFIA 1GL7A 3U3JA 1KO7A 2W0MA 1BH2A 2H7VA 3EZ2A 4DHEA 3B6EA 4GDFA 1Z3IX 2BCJQ 4LHXA 4IDHA 2GWHA 3PITA 2FGKA 3PEYA 1E1QD 1G7CA 4P32A 1P60A 3L82B 2J5XA 3EAQA 4UKDA 6Q21A 5E7IA 1S9DA 2WSMA 1Y63A 4GSYA 5CB6A 4MYCA 4B3FX 4B3GA 1W4RA 3ZJYA 4DWJA 1IONA 1LV7A 1OIVA 2FMXA 2BBOA 4C2TA 1XWIA 1Z0IA 3I1FA 3C15C 1CIPA 1XD9A 2DFTA 4KLZA 3U3RA 1JR6A 2QORA 4KVAA 4A8JC 4HB3A 3JVVA 1IN5A 3B60A 4PO9A 1FNNA 2RHMA 2ZU6A 4KJZA 2IWHA 4A2QA 1XJCA 3NH6A 2GVDC 2DPXA 3THWA 1AKYA 2QROA 1NVUQ 2ORVA 1CLUA 2XZLA 1OH6A 1FUKA 1XMJA 4TMXA 1GTVA 5CJ2A 4E22A 3AVPA 3QXXA 1ZCBA 2BDTA 1AM4D 1FMJA 4EPRA 1GILA 2QGNA 4UXJA 2DFLA 1W2GA 1E96A 3K1JA 4RD1A 4LCBA 4RKFA 1T5LA 1TQ2A 3P26A 4TT3A 2VP2A 2GEDA 2Q9BA 4AKEA 2ZR9A 4IW3B 5JRZA 5EXXA 2OXCA 1MT0A 1XTKA 1P9RA 2GK7A 4FMBB 4LSGA 5B58C 4EIWA 3IIKA 3KTAA 1E4VA 4G5RA 1CF4A 1SKYB 4PAMA 1ZM3A 2GBLA 2B8TA 1DELA 3OIWA 4JL6A 3GLFA 3SOPA 2G0TA 2XNSA 3THOA 3CH4B 1E79D 3UPUA 2OSBA 3PVSA 3B7GA 3PUYA 3N2IA 4DSTA 4M1KA 4AKGA 2JJ2A 4X8LA 4PPFA 1KY2A 2QM8A 4GZMA 2X77A 4MGIR 2P2LA 3WHKA 2QPTA 1NBMA 4LJ8A 3EARA 1AN0A 2QT1A 3SBDA 1NVXQ 2O8FA 4PXAA 4JBYA 2CK3D 4TYYA 2JIZA 4GPTA 4UNQA 5KSOA 2B21A 3CKLA 4ZPXA 4ASUA 3TBKA 1CEEA 2ZU0C 2J3EA 2VH5R 3K53A 1P3JA 4RFSA 1A2KC 2QTFA 1G4AE 4O2LA 2XB2A 4DCUA 2ZXUA 2VHCA 1G3RA 2BIFA 1QZMA 1EFUA 3PUXA 1GDDA 3R8CA 2GKSA 2IS4A 1RVDA 3KJHA 1FX0B 5JS8A 1IN4A 3QBVA 2GZHA 1G41A 1G8HA 1DAGA 3VKHA 1J99A 2EVWX 1JJ7A 1RE0A 2F9MA 3G82C 4H1VA 2GEVA 4JLPA 1UADA 5TB5A 2OFOA 4QGHA 1CJMA 3VX4A 1IN8A 2OHFA 5FI0B 1M7HA 4DC9A 2P6RA 2RKOA 2IK8A 1F60A 1SVWA 3VMFA 1KAOA 3KX2A 5KTYA 2QBYB 2CHGA 2C04A 1VYVA 2UVQA 2WM9B 4G01B 3PIRA 3CONA 4GNKA 4WZAE 5J40A 4B71A 2ZYUX 3VQTA 2HDNB 4KU4A 4W9MC 2OE2A 4UNPA 1AS0A 1PJRA 3W6NA 1E9EA 1N5JA 2BBWA 1XD2A 1SHKA 3UMRA 3FB4A 4A3VB 3GLFB 3BD9A 3AVTA 1NJFA 3QIAA 5FL7A 1JAHA 3A1WA 3CRVA 2J0UB 1C1KA 2WJIA 3AB3A 2F1IA 4C0SA 3DZDA 1OFHA 1W44A 2CE2X 5F2EA 1NL3A 3BRWD 3V4RA 3QKRA 3U7EB 4QJ3A 3EZ7A 4FWDA 1CR0A 1ETUA 4PFSA 2NO1A 2ZRGA 2H92A 4NZYA 4OHYA 1S2MA 1C9KA 2QRNA 1SXJB 4CGZA 3CNLA 1XEWY 1LF0A 1N0UA 1YZTA 1JQLB 5FOSA 3MG9A 3VX3A 1B23P 2QTVB 3PEUA 4KFUA 1CR4A 5LB4A 1EGAA 4A6PA 4OQFA 2WJHA 3IHWA 2V6IA 4TN1A 5DH9A 3T1OA 2XXAB 2WWXA 5FOVA 4RFSB 2A5YB 2OBNA 1XCMA 5BN4A 3X2SA 3VNVA 1OFIA 1ZIOA 4YDHB 3B1YA 3QENA 4UJ5A 4BGDA 1IY0A 3EPLA 3HR8A 4JKYA 4IFBA 3TJZA 4EPYA 3CBQA 4TTPA 3SDZA 2IW3A 3HYRA 3RS0A 4ABYA 1MR3F 1UF9A 1QG4A 3GP8A 1HA3A 5J4LA 4KODA 1DO2A 5FBVB 1KI3A 3OF5A 4IFEA 2ERXA 1P75A 1Q3HA 3SJCA 3T12A 1G16A 3C4JA 3TK1A 1PUJA 5C4MA 1Z08A 2DR3A 5EE3A 3TIFA 3AVXA 3J81k 3RS4A 3AVVA 5GJWC 1KYIA 1E2KA 1YR6A 2RGNC 2ZYTX 4G5QA 1UDWA 2G88A 3GJ7A 4PX9A 2FZLA 4NMMA 1NJGA 1T6NA 1D9ZA 3D7MA 3U44A 5FPKA 1N3BA 1U9IA 2GDJA 3L0PA 4U7DA 1XD2B 1S1CA 2CHVA 1RYHA 1ZW6A 3AKCA 5FUXA 3GJ5A 3ICQB 1FMLA 3MWKA 2VQSA 3QKTA 1SVOA 2H16A 2YWEA 1I4DD 2B92A 2C78A 5BYKA 4C7OA 1DAKA 1VG9B 1XBTA 4A4DA 3GLIE 2FFHA 3LLUA 1KNQA 2JJ2D 1PZNA 1XRJA 2IEYA 3EPKA 4Q66C 4NCHA 4A2PA 1Z63A 4NCJA 4R2IA 1SXJD 1CS4C 1NBMD 4LV8B 3Q7PA 1LS6A 5DI3A 1U81A 1M7GA 1R0YA 4UXHA 4BLSA 3VTKA 1IOZA 3OE7A 4JJZA 2OLKA 4ASUD 3ZQ6A 1T8UA 1KK1A 2CLSA 3RVBA 4HAUA 1IBRA 2EFHB 4G3XA 2XAUA 3TUJC 2EFDB 2FPKA 5SZIA 4LJ4A 4I81A 3DPUA 4BLQA 1P7CA 3Q7QA 4EPTA 5HE9A 4C4PA 3FHOA 3X1ZA 1T4GA 2IF0A 3TLXA 4M1OA 3NEYA 4JVSB 3CX6A 3L0OA 4CZ2A 1NN5A 1NMZA 1X3SA 2X1VA 4UNSA 5EP2A 2QL6A 1S9HA 3FKQA 4E07A 1X8LA 3LQQA 2BOVA 2GA8A 2HXYA 1WA5A 2HV8A 3BK7A 2QE7D 3CF0A 1VECA 1Z0AA 3HPRA 1XTSA 5FPYA 4WZBE 1KSFX 5CK5A 4A2WA 4XIGS 3U44B 2NZJA 4MYUA 3FDIA 5KSPA 1XF9A 5IF9A 4BRWA 2GZDA 5FL7D 4AG5A 1JPNA 4M9ZA 4L4UA 4C2UA 1JQJC 2VL7A 3KQUA 1GVNB 1OT3A 1XJ0A 2AXNA 3AF3A 2Z43A 4DVGA 2XSZA 2VHUA 2QQ0A 3MHVC 1G3QA 1ODFA 1W36B 1P9WA 4FD2A 3CRW1 3GJ6A 3FMIA 5FPHA 1RIFA 5DI3B 1L7VC 3ASZA 1YU9A 4TMVA 5KPDA 1UEIA 1TF7A 1N25A 1X8JA 4YMWA 1FFHA 1KO8A 3ZZ0A 4WOPA 1XXHE 4QRHA 4M9QA 1KDPA 3TRFA 4ZV4A 2PX3A 1W4CA 3GD7A 5JLJA 3CPJB 1G8YA 3ADKA 3LQRA 3N5CA 4M4SA 2ZEJA 5AJXA 1PUIA 5G53C 2NO6A 4RD0A 1PLLA 1U2RA 2XEXA 2ASEA 3LXXA 3NVAA 2YOHA 4TTRA 5AWFC 3IUYA 4FMDB 1NI3A 4QHTA 3CR8A 2G1JA 3B8HA 4R98A 3TQFA 2PEZA 5TXGA 3T1TA 4UNRA 4DDUA 3T15A 1XCGB 2O0KA 1GL6A 1H8ED 2QRZA 3QEOA 4MGYR 3LX8A 4PC1A 4MUAA 4OQLA 3B82A 3LBHA 5TDHA 4YXWA 5CDFA 2CLDX 5BW8A 4BFXA 3W9YA 2ZETA 4TSFA 2HF8A 1M34E 2YVUA 1D2MA 3B85A 3RC3A 3T34A 2R6AA 1Z0FA 2J9RA 3K9NA 4R9UC 5D3QA 2DWOA 4LOAA 4LBWA 1EK0A 4OHZA 3THXA 3KQLA 1IM2A 4I1SA 3NEJA 2OILA 3RWMB 4PR0A 1P73A 3MCAA 4C0KA 4NTZA 5FBQB 1E94E 2NGRA 2CCJA 1OH7A 1RYFA 3NBYC 4ESHA 2F7SA 3GQBA 1E1RA 1Z22A 2AK3A 4GFDA 4CT4B 2IXFA 4TLCA 4B75A 2ZIAA 2NMVA 4LHWA 1W0JA 5FR1A 1OW3B 521PA 4QBHA 4OI2A 3UIEA 3Q9LA 4I99A 1Z0DA 3K9GA 1TF5A 1YVDA 5B64A 1L8QA 1E9AA 1L4UA 2ZRIA 1XB2A 4IRUB 3OAAA 3VHXA 3U3MA 4M9XA 3QVUA 4LRWA 2X2EA 5JRJA 1ZD1A 2OZEA 3DKVA 4JSTA 5AR1A 1W36D 4M1WA 4LYAA 1ZM4A 3KFVA 1ZINA 1KSJA 5GADl 5DE3A 3EA5A 1W1WA 4F4CA 3OE7D 4URXR 4D26A 1EFCA 3AKEA 3QI2A 2V1UA 1U8ZA 3U6KA 1YZLA 4HUQA 1JPJA 1IJEA 4LY6A 3LDAA 2DWZB 4DDVA 2C96A 2GJKA 4NDZA 4D25A 4D4MA 2A5JA 2FG5A 3OIYA 2QG6A 4BFWA 5FI1B 1Z6TA 2ZE8A 4BFTA 1QHIA 1DAFA 1ZC3A 3PG5A 5TVKA 2FV8A 1AKEA 5EUQB 3QF4A 4RCYA 1IY1A 1KI6A 2EFCB 4Q9KA 1UJ2A 2CMKA 2HYIC 3R20A 5CK4A 4DKXA 3R9WA 1AIPA 3NDPA 2GXUA 4A15A 4MKGA 1E99A 3KKPA 1JALA 5E95A 2PL3A 3QE0A 4LRTA 5KOYA 3THXB 1N6NA 2J59A 4QJ4A 5TY0A 2GXQA 4Q1EA 1R6BX 4PHTA 3PFIA 3GJ3A 4B74A 1VDZA 1GRQA 2QP4A 3AH8A 3U7FB 5HCNA 2OXRA 2ZI3A 3OHMA 4NYMR 2QA5A 4RKEA 3VR3A 1FP6A 3DHWC 2YWHA 2DVWB 2JCSA 1X8KA 1RRFA 1VG0B 2IHYA 2ZRPA 1CU1A 3KB1A 2V3CC 1G18A 4BFUA 4KAXA 5ELXA 1N6OA 3Q72A 2XGJA 2XSZD 1GM5A 4DRZA 3QPWA 4DSOA 5F9HA 2IS6A 4I1VA 1RJ9A 2BMJA 1ZNZA 2BEKA 2DHRA 1E2LA 3LVRE 2C98A 1T0HB 3PV0A 4HAXA 1E2HA 3QPVA 2OLJA 2MMCA 4DLXA 3L2OB 4DEYA 2WSSA 3GLHE 4HUQB 1Y3AA 3HDTA 2ZAOA 1KJYA 2F9LA 2O5VA 1AQUA 2ZJOA 4XVQA 4Q9JA 3Q85A 3UATA 3LW8A 2R6FA 1VIYA 4ZO4A 4IVRA 1N6PA 5DI9A 3RHFA 1ELOA 2FA9A 2ZTSA 2CL7X 3IBGA 3C14C
chains in the Genus database with same CATH superfamily
2GZAA 1VHWA 1EA5A 1ADCA 1VE6A 3O2QB 2E89A 4Q5IA 2O4UX 2RHLA 4WN3A 2PMWB 2QMZA 4XOIA 2MH8A 3IDZA 2UZAA 1PJSA 2VSXA 4M98A 3OZTA 3UK1A 2OTCA 2GBFA 3L4KA 4EATA 5HOQA 1KK3A 1JDUA 3F90A 2XT6A 4BLRA 1NLYA 2FN8A 4EQ6A 4PSAA 1HBJA 3P4YA 5HIJA 2XYPA 1E0AA 2QXYA 4V0OA 3UKDA 1O5OA 1DDIA 4G0PA 3T3NA 1CVIA 2VF7A 3LQ1A 1CJVC 3PCRB 2O7QA 3ILXA 5IC4A 3I32A 3A9CA 3GNQA 3F9IA 5C8DA 3G5UA 3OT5A 2JIMA 1KZGB 4AD8A 1KJ9A 2BP7A 5K6RA 4REOA 3HEAA 3FXAA 1D0KA 4YCAA 3H5NA 1YNOA 1WXQA 2Y4OA 5G4KA 3GI1A 1O77A 5AXAA 2CN1A 1JFLA 1SR8A 1OAOA 3RKRA 5T57A 3N28A 2EATA 5DM4A 1TF2A 4EQ6B 1MC1A 4TXJA 5IRCD 4NXNB 3H4IA 1E2MA 1FNMA 3AZOA 2FN3A 3F3SA 2G06A 2OV1A 2EQBA 4IV8A 4Y2UA 4S2EA 4YDQA 2VHVA 4UVGA 2Z7JA 1AUQA 3TB6A 1YIAA 1C50A 3L92A 3Q11A 5KU1A 4ISBA 3ZBQA 4E21A 1LBQA 2BP7B 4WCFC 5CFNA 3NTRA 4FX2A 3SDSA 1JEYA 4KHPM 4DZTA 5TNXA 3E46A 1IRIA 1OLOA 3A1VA 2PKWA 4ZHQF 1G4UR 1PO7A 2XTMA 4LGCA 3WQSB 2C4VA 3AR9A 2X5OA 4LSWA 2YWRA 1ADJA 3I42A 1N9KA 1IAVA 1UFZA 2NG1A 4M0PA 3VO8A 2P4QA 2VN8A 1IG3A 4UDOA 8ATCA 1U98A 2Y1DA 1X7GA 5BWOA 4BMCA 4YHBA 5C81A 2X5KO 2HA5A 3K31A 5AI6A 1L7OA 3ZBUA 1A8PA 4DQKA 5AK0A 4B4DA 1QIJA 1AKQA 4X7BA 1JEYB 5HK9A 2H2FA 1DIGA 2R8OA 3SJAA 3B7QA 4RPKA 3WQBA 4IINA 2FJ0A 2GS9A 2PYZA 3OC0A 3ZXYA 2JJMA 1E61A 5JEDA 3SHTA 4EHIA 1K8QA 9MHTA 5TVGA 3AQ4A 3NIGB 5EQTA 4EP1A 4X62B 2ZJ3A 3DHNA 5GZ6A 1Y5RA 4WA7A 1Y7LA 4Y18A 2V4MA 5BN3A 5K8VA 3AI1A 3C3PA 3KFLA 2C0CA 2QRKA 4E1VA 1JAIA 4CE6A 2O7VA 3ES9A 2V7XA 1J70A 2VR1A 1Z34A 4FWTA 2JS7A 4F84A 2W98A 1RDFA 4IRXA 2HA6A 4MB2A 3E9DA 3JQCA 1WSWA 2XUIA 2ZSDA 2D62A 5JT1A 5CYFA 4V3BA 1X80A 2F55A 3K0HA 3RYTC 1H9CA 2SICE 4XWOA 2CBZA 2WKSA 5AKLA 5CAEA 2NU7A 5LU9A 4AMBA 5AI0A 4CEJB 4JJIA 2R0IA 3NFYA 3CFYA 4YUZA 3VVBA 3VGJA 4Q1CA 2ZT5A 3QOWA 3VR5A 3C7KA 1GQSA 3EULA 2JA1A 2Z8ZA 3ERCA 4TM8A 4NE2A 4RD3A 1ISFA 2BEUB 5G1OA 3UTDA 2HCFA 2K87A 2C3PA 2K7ZA 5EFOA 1JTFA 2OC9A 1XU4A 3I2HA 4WURA 2OENG 5KYXB 1ULUA 1SELA 3B1FA 3DOJA 3CW8X 4YTEA 4GH9A 2INGX 5COAA 4I36A 2FE4A 2NU7B 2ID9A 3GMTA 2W7TA 3TUIC 2XNDD 2GA9A 1GUBA 3E3NA 1N92A 2XVYA 4KK4A 3HZOA 3LF1A 3TOVA 3GCWA 1VBMA 4CWAA 4FOTA 1N5DA 1WMFA 1X9GA 1AZSC 1AF7A 2ZGVA 4C7VA 4JLAA 4BNTA 3DMFA 4PG4A 4BMNA 1TX4B 4Z49A 1TYBE 3ZDEA 2PDAA 5F1PA 1GOTA 3GLHB 4R7ZA 5ALZA 2BEVB 2PGXA 2J0SA 3OF3A 1B8VA 1VL6A 1GCOA 1OXUA 1ADYA 3PQ8A 3P0FA 2PWPA 1NA5A 5I7SA 5LDHA 2AE1A 3ZTWA 2B8EA 4K1XA 2V1CA 4B2LA 2YOGA 2QL7A 4G1BA 4O6VA 1RRVA 2FUG1 2ODBA 9LDBA 3OOSA 1CNFA 4JBLA 1NUSA 4WK6A 3LHSA 1H4SA 4TVSA 1LDNA 3SHFA 4LF6B 4Z4GA 2F3QA 3PUVA 4HRYA 4AJLA 4TLAA 2GXSA 2BL4A 2PZKA 2VTDA 3LLCA 1G19A 4ZAFA 1PFQA 4Q19A 3DHVA 4UM9D 3NG1A 4KIFA 4U39A 1P2UA 4MR9A 1QUTA 1TLFA 1SWWA 4Q9LA 3TL4X 1Q12A 4BVLA 1W87A 2VYFA 2CKMA 1JLHA 1EFLA 4ZHQB 1WCIA 1DG3A 3KUKA 4D43A 2BNKA 1Z4NA 3OLYA 2X2PA 1DUSA 1XTIA 1HLDA 3ZHVA 1KI1A 4H6XA 1ODIA 3HG7A 5JSZA 3K3PA 1YV9A 2BHTA 4BVKA 5JNWA 2XYRA 4XSGA 4JT9A 1KERA 4RD4A 3GXBA 2V7PA 4KQ6A 1HG0A 1XKQA 3GJ4A 3TVTA 4L5BA 3S1LA 3JD3A 4HLDA 4XARA 3AU9A 2WE8A 2WB2A 1TGYA 3RJ9A 5HZHA 4DCGA 4MPRA 4JXXA 5IVHA 1KHTA 4EMUA 1Y6RA 1NULA 4N5MA 1WCIB 1GPH1 1NI4A 2O7RA 3BJIC 1UK6A 5ICEA 1VBFA 3P2OA 1GPLA 4W6QA 2A5DA 4RNDB 1L8OA 2F17A 4IKEA 5JSZB 3PX7A 4YMIA 1IIBA 4IXDA 2GK3A 4LC0A 1V92A 3B1ZA 4DEXA 2NTEA 2J48A 1PHRA 2ZR7A 4LF4B 4QE3A 4OMUA 3L8HA 2W42A 1U2SA 3EEIA 2NIPA 2QN7A 4ZT6A 4ROTA 4H1TA 3U39A 1K3WA 4GRDA 5LIRA 2OO5A 2GETA 2PT7A 1NI4B 1LTQA 3HADA 3L7LA 3DZKA 4NNOA 4ICIA 1PI3A 2PT6A 4W1QA 3ZW9A 1V5FA 5TPWA 3FSGD 1UJNA 2F67A 2JKVA 3QNUA 3UCEA 4TWAA 1JLLA 4RK0A 2R4EA 3TGPA 4DQDA 1W0KD 3VNQA 4E5VA 4BRSA 3UAWA 1DKNA 2FX2A 5DX8A 3I9FA 1EWYA 3UT5A 1GCUA 4CTKA 4K0RA 5IHXA 4ALMA 4K9MA 2HNAA 1PU2A 2REOA 2YW2A 3K09C 2Q41A 4BAZA 3W78A 3IL2A 3HCRA 5LQCA 4MLPA 4UHDA 3ET5A 3SC4A 1K97A 1XMOB 5TPWB 4B3SB 2PPLA 3EXHC 2HT1A 2JANA 1P5ZB 3LVVA 4W7IA 1THGA 3Q40A 4NDAA 1JLLB 3I9V6 2Q5QA 1ZA2A 1FMTA 3UT5B 3I52A 3VNRA 2QD2A 1A82A 1BGWA 2ARKA 2QYHA 1RWKA 3RREA 1NXXA 3MMPA 3ZHCA 4C0JA 3VYTB 4RMHA 3FFWA 3M83A 1RWNA 3IILA 2FNAA 2XWSA 5GY7A 1M0EA 1RBQA 4R1PA 1ZUIA 1EUCA 3PA6A 2Z1DA 4CBVA 4E94A 3G2JA 2PKXA 4RHYA 1ETHA 2CXTA 2JFOA 2FSPA 5KNDD 5EIBD 5L40A 3NHSA 4D0LB 5HIIA 3WO0A 1V5WA 3KOXE 1IUOA 3CBGA 3PF9A 3ZV5A 3OO0A 1LPNA 1VEKA 3HU3A 3COYA 1ODKA 1M67A 4YYZA 1MA3A 4DDHA 1NWHA 4WVFA 1FEZA 1REQA 5FJJA 2WTMA 1C8KA 1PEYA 2BBSA 4CL2A 2ASVA 1TU4A 1OT5A 4ZVMA 4EHNA 1NNI1 2X42A 3IALA 4CFSA 4DA4A 1EUCB 3O8CA 2JASA 4YMLA 1ENOA 4XD7A 1N5OX 3ZZNA 3NTUA 3E61A 4ITQA 3OESA 3R3YA 2ZI4A 3AVYA 3RRMA 3A3OA 2SCUB 4WFJA 2R8PA 3A1CA 1T9AA 3INRA 1DAPA 2F3TA 3STWA 3USCS 1Y81A 2L6OA 4XWGA 4WNIA 2JZ0A 4PIPA 3DV0A 4NICA 3UJ9A 4R2XA 3HJGA 4CMCA 4C06A 5E6SB 1YZFA 5SZHB 2ORED 4YCCA 1XI2A 2UXBM 1MT3A 3RARA 3L43A 3F4LA 1RWMA 4QYTA 2HIHA 3L6DA 3IIMA 1KTVA 1OBHA 4F85A 1GKYA 4G5SA 7MHTA 3NDBB 1V8PA 3FNFA 2Z2XA 3SIPA 1VE1A 5HR5A 4AKTA 4TMFA 2RJNA 3ZCSA 1U99A 1N2GA 1BXZA 5TEVA 2WJ3A 2O19A 1SUWA 3HZHA 3V55A 1GQQA 1ODTC 4YPVA 2Q6IA 1ZWKA 2ZZMA 2I7VA 3D6MA 2VBFA 5I45A 3DOHA 2R97A 5LYJF 4IHKA 3H2KA 4QPCA 2V9ZA 3RC8A 5JVDA 1LXCA 4R69A 3CNQS 5L3RA 2Q0HA 2IQIA 2NOAA 5LQAA 3FZQA 4YR7A 4HTAA 3ZD6A 4KRFA 2SKEA 1G5IA 1T15A 3ORFA 4TQ9A 4Y6GB 2R5WA 4IDBA 3PQFA 1HL3A 1T9CA 2NW6A 2ZUSA 2XUAA 3EFEA 2C00A 4IIYA 3FTQA 2FOIC 3K6SA 4RZUA 2HEGA 3ZY6A 3NT4A 1O94A 1ZM9A 2PU7A 1T6ZA 1VDMA 3TZQA 1U8FO 4WFIA 4DT1A 4LC1A 1RQLA 5AJWA 2P1ZA 4DL9A 3UAZA 3OQIB 4C0XA 1C3OA 4O4LF 4WFKA 4J7XA 1J8FA 2XADA 3LLMA 1H94A 5ERGB 1E0KA 1RKBA 1W96A 5HM8A 2BKXA 5BYAA 2I3GA 2I3ZA 5FJIA 2C57A 1RJ9B 1Z4IA 1V3TA 3S70A 4HDMA 2BGRA 1KMNA 5DSXA 2EP5A 3W2TA 4HLQA 2NXWA 2NTYC 3FPSA 4HN9A 5TS2A 3KAJA 1BIFA 1CZNA 5FLXS 1FYWA 4BLOA 2O4CA 1D5WA 2B8JA 2ZBEA 2Y8EA 1MO5A 5CLIA 3WRWA 4DT1B 5LMCA 1FDUA 1DG1G 4NQRA 3U7GA 2PX0A 3F5MA 3T7CA 4G63A 4XWWA 3KQOA 5KWVA 5I8PA 2OPFA 4A6DA 4C22A 4UW9A 1OQYA 4DGSA 3EZ2A 4GOMD 1O2DA 4CTOA 5IWCA 3TJMA 2VDWA 3KSXA 1GPMA 4ZICA 1W4RA 2FMXA 5AFSA 2DFTA 5C35A 3MXOA 3V1UA 4KVAA 3NAQA 3MJDA 4A8JC 4Y2SA 4HWKA 3JVVA 3B60A 1FS4A 4HRAA 4QOEA 3THWA 2QROA 1UWCA 2C4HA 2WJ6A 2ORVA 2JHCA 1FMJA 3ABOB 3R6LA 3EGVA 1XKXA 3AIMA 3TKAA 4AKEA 2QE6A 4XDGA 4MX8A 1F06A 4I4TF 4LSGA 1E1NA 2CJYA 2ONZA 5JCOC 2NT3A 4IXWA 1OX4B 2HBQA 2LTAA 4JEMA 4EO7A 3F7OA 4P4NA 1D2CA 2R60A 1GZDA 3E5MA 2P2LA 3MB5A 2NLOA 3SBDA 3LUDA 3EXG2 5ALWA 4U8GA 1T2NA 4AQ7A 5F76A 4P08A 1HDEA 1SVNA 2ZU0C 2XB2A 4LXGA 2IVZA 1V0JA 2PNFA 1WHSA 4ZRNA 1RVDA 1J99A 1JJ7A 1UADA 5GONA 1CJMA 1PFWA 4KQJA 2P6RA 5B1IA 5AJTA 1IC6A 5IT0A 1Z2DA 3KJFA 5C34B 2MT9A 4PNZA 3PPYA 3EQ7A 4RV9A 4UNPA 1A7KA 4UBIA 5ED4A 1XNHA 5AVJA 1HT0A 5FNZA 1TDJA 3DPSA 4LDRA 1ETUA 5JPIA 2CVPA 3UM9A 3GT0A 4OYLA 2MSKA 1JQLB 2WW8A 1SBQA 5DH9A 5EPOA 1KEPA 2C5HA 3O92A 3SVZA 4OXKA 3AEUA 1QQ7A 5MF6A 1X1DA 2ERXA 3KZKA 1Z08A 5FWYB 1UT5A 4EYEA 2M5ZA 1C0PA 1LC0A 3PHJA 4PE5B 1C80A 1KY4A 3MELA 4MI3A 1T6NA 1R6VA 1RC0A 4U7DA 1GYQA 1PX0A 4C0WA 1S1CA 4K8RB 4O02B 3ZLUA 3BGSA 3GHYA 3FYUC 7REQA 4Y98A 5LXTF 2ZQZA 4UBNA 2KRUA 4HJRA 5LYJB 1E1MA 1KH3A 4FFBB 2CFRA 1GUDA 5IVIA 4A8HA 3G59A 2EFHB 4DJFC 4MQ5A 1O57A 3PHHA 3UN1A 1NXOA 4B3RB 2XRMA 1YS1X 2ATEA 3AEUB 3WTCA 4N0MA 4UNSA 1X1QA 2HWJA 1X8LA 4YRCA 3HYNA 4IIHA 4JQSA 1UKAA 2DHQA 5EMHA 4BRWA 5NULA 3RGPA 4UUBA 5DYWA 1V8BA 4KTVE 3I04M 4EJMA 2QQ0A 5LKRA 3D3EA 1ODFA 1ISRA 3GJ6A 2OKGA 4FEGA 2P0AA 3YASA 2HHHB 5TMEA 1K5PA 3CPJB 4OQYA 5AJXA 1GQRA 4R98A 1YS4A 5F4BA 2YY6A 4MGYR 1CE8A 3UFXA 1NMQA 3BWYA 5IMSA 2BW0A 5CNMA 3KQLA 1GA1A 2XCQA 4X91A 1P73A 2AJ8A 2CCJA 4DFDA 1BN6A 4GFDA 4TLCA 4EGJA 4K26A 3OH8A 3FPGA 1A04A 5F73A 3NC4A 1JHAA 2W11A 2WTXA 1OWLA 1XQXA 5K0JA 4M0EA 2GCIA 2B25A 1IJEA 3QLVA 4RCYA 1CE8B 1NTRA 3UFXB 2D5AA 5KOYA 4BKUA 1RQPA 3HM2A 1L5OA 5F21A 2CXQA 4E2XA 3HSKA 1NAHA 1FP6A 2ZYSA 1R4ZA 2I7PA 3EZGA 1X8KA 2I6GA 3BKWA 3FOFC 3E9ZA 4DSOA 2BEKA 2VQEM 1NGSA 1K92A 1QB8A 3RUFA 1QF6A 7MDHA 4DEYA 4UUOA 3GLHE 3FDJA 4C7XA 5L51A 1KEKA 2Q3DA 3NLLA 3ZNPA 1Z62A 5I47A 2E4ZA 3SICE 1QAOA 3ZKWA 5P21A 2A0XA 2OYCA 1DCFA 1MB2A 3V80A 1CR1A 3UAXA 1HZZC 5K9ZA 4XGNA 3R8XA 4N5LA 1TQDA 3OEHA 3C8DA 1UR5A 3F7TA 2HSDA 1GUYA 4ZZIA 2ONKA 3LO5A 4JL5A 2HRQA 4PEVA 3NOXA 4X65B 1EG7A 2X6TA 3KR2A 5FOTA 3LZDA 1JZQA 1XE3A 1N7IA 1YBVA 2RH4A 2POCA 2QPAA 4TV9B 2AUTA 3KT6A 3QG5A 1WY5A 3BCUA 1QYXA 4U02A 2QPOA 3RRXA 1QIIA 1HZJA 3ZKWB 4G97A 2X9LA 4RQAA 2DETA 4D96A 1KR2A 2RB4A 2UUCB 3EXAA 4D0RA 4I8DA 4M9RA 4KYVA 1UBCA 3I05A 3O7MA 3KWFA 3NVKI 2J3LA 3E82A 1CUHA 1B0UA 2OV3A 4KQIA 5IEJA 4PYNA 2AJLI 5LU8A 3OEWA 1GD1O 2XLCA 3OLCX 3RVMA 4ARIA 1LS1A 1G63A 1L9XA 2XCIA 3EBOA 1RWWA 3HJCA 1WB6A 4AUMA 5L53A 4CI0B 5CDGA 5ALOA 4PPQA 1FYXA 3ZWCA 4BQEA 4EI7A 2ATIA 3PFCA 1PFGA 4OPMA 2XH9A 1V2HE 1Q1AA 1ZC4A 2YN4A 5JAZA 5D5PA 4QGBA 4EKDA 5LXTB 2XKKA 4EW3A 4YVFA 4PV7A 4HAVA 3FR8A 3SBOA 2IWRA 2Y05A 3DFIA 1KYZA 4C5CA 3T94A 1DXHA 4Q18A 3SYRA 4HZIA 3VR2D 4B08A 4GYWA 1R2ZA 3DBLA 2QW1A 5CD9A 4II7A 1GQFA 4C0AC 1XLTA 3OKFA 1ECFA 3PQDA 1KEVA 3LJKA 3VSDA 4DSAA 4XA8A 4R2WA 2X4GA 1TRHA 1H2XA 2IH5A 3ZH2A 1CUVA 2XNCA 1BDBA 3JYQA 1XZ8A 4QNRA 2F5OA 2R4UA 3VFDA 3JASA 4JKIA 3R6DA 5BMVA 3P94A 4ZI3A 1SD2A 2B1JA 1J90A 3TL6A 1T0BA 3F2IA 3PX3A 3IHPA 1GGKA 3H5VA 4P5EA 4YECA 1QPBA 3WZLA 4FEAA 3P0HA 3BBPA 1S2LA 4B45A 1L4YA 2ZPTX 2X86A 4M2LA 2N1BA 3S2IA 2XD9A 3HXMA 3ZHOA 3DBLB 5DW0A 3MK31 1B8PA 3G2LA 3ZDQA 2WD7A 4C05A 3CNOA 4U8HA 2X8JA 4H7DA 4GDMA 1P31A 5HMLA 1MKYA 2OPBA 2G3YA 3I64A 5U9CA 2FZKA 3AJ9A 4ZQHA 5E6RA 1I13A 5BMVB 2VFAA 2WTNA 3FUTA 4CJXA 4UPEA 2VPZA 3SBEA 3V3TA 1FYVA 2FMUA 3ENVA 4FYPA 4HLCA 4EPXA 2J09A 3VHLB 2FZCA 3ASUA 3QG1A 1MB0A 1M8FA 3ETGA 3EZXA 2CWWA 4D9HA 2P9ZA 2OCGA 5KOHA 2XZPA 3VVMA 2APLA 3U0VA 2WD7B 4OUDB 4WNAA 3PKIA 1IFYA 1FTQA 2Q6LA 4KZKA 2EKQA 4UARA 1ESNA 4QHYA 1EHIA 3OZIA 3GRFA 5E6RB 3KSMA 4L6CA 3GJXC 3PCXA 4KXWA 3QTTA 4FGSA 2C7PA 1EXMA 4TTTS 4XUCA 3JVUA 2FCAA 4R3UC 4P17A 4JI6M 3RBVA 5KOHB 4GD3Q 2REXB 4KE7A 4D4HA 5K45A 4DCOA 4WNAB 2G63A 3KEOA 3DZJA 3HJ8A 2ACWA 1JG1A 1F6WA 1G6OA 4D81A 1ZIYA 5BSUA 1TYDE 2MHCA 1X3LA 3I6IA 1CJBA 4FWHA 5H9VA 4O8ZA 4C4OA 1EKXA 5ESRA 4PZLA 1A9XA 1KWGA 2ZKLA 3B20A 2Q27A 2AG5A 3O8LA 5A7GA 1OLSA 1VG1A 4ZQIA 4B3BA 2OEPA 1EHYA 4TL6A 3FFAA 3WHLA 5BXYA 3UF0A 1SUBA 1Y8CA 1U2GC 3E2IA 1CJTC 4NAVA 3RUAA 4S04A 1D09A 4E0BA 1U6JA 1C2YA 4K9QA 4CJ6A 2H08A 1XR3A 2ZIVB 1QHGA 4X41A 2R1TA 2ORWA 3TRHA 1T9DA 3WSWA 3S44A 4DLSA 5J4HA 2NV0A 3D4LA 2GJ9A 1WB4A 1Y3CE 1Z35A 3SWWA 4R8KA 1E6UA 2ZQ5A 2MYTA 2F8SA 1A9XB 2EOAA 1JLRA 2VAVA 1KVUA 4G1VA 1J2TA 1VCOA 3G2HA 4Q3DA 2G0NA 1SKAA 1UBHS 1NBHA 2Q3FA 2CUKA 1BA2A 3R9IA 4AJPA 1Y82A 4O1MA 1KZHA 4RVNA 5GVSA 1SEVA 2FETA 2D0PB 3KL2A 4TYQA 1CY7A 2X0RA 4N1AA 5L3SA 1GSOA 2APJA 5E3HA 1Y98A 2R8YA 2TRSB 1AC5A 3FWNA 4DF3A 3ER9A 1GNRA 1OU4A 1QZEA 4OAPA 3PXXA 3A9SA 1ATZA 1OFUX 1L5RA 4QYWA 1NPTO 2ZK7A 1NW4A 2CJWA 4WA8A 1J25A 3ZVRA 4C01A 1NN0A 3SJ7A 1PS9A 2DAIA 5IZCC 1U7XA 3R7BA 3WBJA 5E4TA 1TQ8A 1XDDA 4QUKA 3LBNA 2PVCA 3W77A 2RAPA 3CEJA 5L3SB 2X1LA 5EUMA 5DK4A 1XTPA 2NU9B 3MRVA 1BGXT 5T4BA 3PQCA 3O8DA 3BAZA 1Q83A 4FYIA 4AUKA 4W8GA 3T1YM 3UJ7A 1DQNA 3T1VA 4BO6A 3IR7A 3T3GA 2VHJA 4G0QA 4XRGA 1Q77A 5KWIA 3CUEF 3GP3A 2IEGA 4IBOA 6GPBA 5KQPA 3UENA 3O93A 2Y1GA 1D9XA 1G7RA 4YAKA 2P68A 5ES3A 1U65A 4S35A 3ZGNA 3P0RA 3AW9A 4Z4IA 2EEPA 4QBFA 3SNKA 1S8OA 3E35A 1RKVA 2WSIA 4DLZA 4K9SA 1ES9A 1QH1B 3LI2A 2BONA 4KRXA 3FUWA 2HMSA 3WMGA 4YAOA 3WSVA 3RASA 3QH4A 2Z8XA 3R5XA 2O3TA 1PQ4A 4ZDJA 1R4AA 2R5NA 4JI5M 1PFUA 3SDBA 1YONA 1YA4A 1BZYA 4DWOA 2Q0SA 3F8WA 2PX6A 1B6GA 1C7JA 1V9SA 2PEYA 1EGQA 3I83A 2H0QA 4DZZA 4R3NA 4Z9XA 2JGRA 4PX5A 4ADSG 3EXEB 1ZFNA 4QGFA 3H9JA 3ZEIA 2GM3A 1N34M 1VMKA 1LNQA 2HMYB 1QP8A 3EEBA 1T8SA 4ZVSA 3UHPA 2DT8A 5L3QA 3HV0A 3T54A 3ADPA 3IE2A 3QYPA 1TM1E 3DAHA 3ADBA 2OZLA 4OL9A 3KUCA 1DE0A 1A95A 1IXSA 3Q8XB 2ZTLA 4BGVA 1KYQA 3BWVA 4ZQEA 2Q2EB 3ILSA 4CM9D 1HQDA 1NHGC 3I9OA 3ONNA 3SX4A 3F97A 3RFVA 2PKCA 1O58A 5DHFA 2DFVA 1KQPA 2O8FB 5JCZA 1ZUWA 1QQBA 2O50A 3RS5A 5L3QB 3CT6A 1PT8A 4YWHA 5HBRA 1KVQA 2NSYA 3HI6A 5ICMA 1OHHD 1UKYA 1EFUB 2IT1A 4N4AA 3W67A 3B9BA 2OZLB 4FQ7A 3IP8A 4OB7A 3GRYA 1UPFA 2BUBA 3M0EA 4BE7B 4Z51A 3VXKA 3TTWA 4MGEA 1U0JA 4BGEA 5M3BA 5HJ7A 4JT2A 1Z07A 2G76A 1P6XA 3IEUA 5AIAA 2PRYA 1Q1NA 3K0AA 1C9MA 1HF3A 2QMEA 2LBPA 2QQ5A 1SUSA 3PR1A 3ZK8A 2V7QA 1NKSA 2ATVA 2P2CA 4G2NA 3CRNA 3WZMA 3QITA 2JIZD 1FLAA 4KPFC 4AG6A 4K6CA 1B0AA 4S0XA 3UWOA 2VA8A 3SCZA 1E3QA 3PFWO 1O95D 3M1AA 2C8LA 3LBYA 1DXYA 1XQWA 4H18A 1QK3A 4BNLA 2WE7A 1CEQA 5EOVA 2HA2A 2D1TA 2GPYA 3TX2A 1EWRA 4OAQA 2PSHA 4HQFA 2RC6A 1I30A 3JQDA 3K0AB 1YHYA 1GL9B 4QFDA 2OAQ1 4ARCA 2UYCA 3DE6X 2NUAA 2G9VA 2FY8A 1P8AA 3EFOA 1PE0A 3KBBA 3ROKA 1PG0A 1XA4A 5K1ZA 1U3UA 5CDTA 3WKEA 2FUEA 4BZZA 4OREX 2GLUA 2Z1NA 3A1SA 5EZ6B 4RNAA 5FBZA 1ZN2A 4F4DA 4M1QA 4C07A 3KXIA 4X45A 4R2LA 3IVGA 2H0AA 4DR3B 2PZGA 2NU8B 3H2JA 5DHAA 1YH3A 2IE8A 1EWVA 3A27A 3SQMA 1CSEE 1JDNA 1Q84A 3Q10A 2ZSIA 3IECA 2D4AA 3WDSA 3HR7A 3EFOB 3SSNA 2PUJA 1Y6JA 3ZH9B 2CBGA 2JK1A 2WVGA 4AURA 13PKA 3ND6A 4GWGA 4TSKA 3AG6A 4XTCS 4DJJA 1SULA 3LUJA 4B7XA 3D2AA 4FYHA 4R3DA 2D8MA 1K88A 3RC7A 1YBFA 2F4VM 1E6CA 3G7NA 4DIEA 2ODWA 1G20A 3ADDA 1W1IA 4W5TA 2MDTA 3FUUA 1MO2A 4L4SA 1DL5A 2VXCA 1R6DA 1E4OA 3WFIA 4PLHA 1JV2B 2AR9A 4EB8A 1RHMA 1TFUA 4EABA 2YZ7A 1E1QA 4G2TA 4EZEA 4KQFA 2JRCA 4P3KA 4NG5A 1HR0M 3LPAA 2KZSA 5CDHA 2PGJA 4GG1A 1K63A 2AOXA 1PEKE 3QVGA 3RSQA 3PNLA 1U2TA 1P7VA 3DDSA 1G8JA 2IIVA 4N3BA 1Z5OA 2VRCD 3RTEA 2A9RA 2ODEA 3R7WA 1G20B 5F2OA 1QHYA 3JTEA 5HFNA 4WXHA 3FOBA 4KYIB 4QOSA 1GG5A 2PJUA 4DSUA 1PJTA 3CZRA 1X39A 1H3NA 4GSKA 3RJMA 3N7TA 1XYYA 1EDOA 3F9CA 4FKZA 1A5TA 2XBMA 3EZFA 3K32A 4QQFA 1G9TA 2D2VA 1ZJ6A 2KHHA 4NC6A 3QV1A 1NW3A 4BIIA 3LY8A 2Z30A 2I55A 1Y8RA 2W0MA 2JFYA 5K6TA 3MTIA 1GZVA 4DV5B 4K88A 1G7CA 3B6MA 4NPAA 3VH1A 1DO8A 1FTWA 1Z0IA 5J43A 4BOYA 4ND4A 5BWBA 3UKOA 2XF2A 3U3RA 5E4JA 1FNNA 2X6RA 3H0CA 2IYAA 4HWOA 1FUKA 1ESCA 4NBLA 1MPXA 2WLTA 4RD1A 4LCBA 4QRIA 2CWDA 2ZR9A 5JRZA 5EXXA 4BV8A 5G4KB 4EIWA 1IDN1 3UUEA 4PAMA 1Y8RB 3FYCA 3OIWA 1EX1A 1IVNA 2CNOA 2COUA 3LPCA 3TL2A 3RYCA 5I7RA 1CC1S 1ZN8A 3O26A 5EUBA 3TBKA 1ID1A 3K53A 5FUQA 2YVQA 4WUTA 4G0UA 4OQEA 3R8CA 2IS4A 4B46A 4FQ8A 3L7BA 1G41A 2GEVA 4GM4A 5IASA 3OJWA 1DBIA 3HFSA 4DR6M 1JW9B 1TTQB 1VYVA 4JDUA 3HV2A 2O59A 4QOFA 1SCAA 1OV6A 3X44A 4X1YA 4C0SA 3GAMA 4BGIA 5F2EA 1D7AA 4K86A 3ICCA 3RYCB 4OMDA 1NJ2A 3P9NA 3O95A 1S2MA 2GNPA 3WK7A 4QU9A 5JNTA 1UQUA 3AESA 3PEUA 4KN9S 1EGAA 2E5FA 5BN4A 3VDNB 2PVPA 3HR8A 1NW9B 4B3TM 4ABYA 5FB3A 4KEAA 5F2KA 1O0BA 3OF5A 1I94B 4P92A 3RTBA 3TK1A 4OMFG 2DR3A 5EE3A 4ARUA 2OP1A 3PIDA 3X1MA 1QO0D 1NJGA 2QVCA 3L0PA 3BILA 1A4IA 3RSSA 4AUNA 4RIFA 4X1YB 3LLUA 4Y67A 5TX7A 1MGPA 3LT2A 4RTNA 3QNWA 1IM8A 1XRJA 2ZRQA 4RMGA 3DOIA 4BGUA 4YNBA 5BT8A 1EAYA 3DTVD 1QIFA 2VHYA 4X3CA 2QX4A 4LY3A 5BN3B 4CM7A 1KK1A 5C3MA 1A9QA 3P9RA 5BN4B 4LJ4A 2GZ2A 2FE1A 3Q7QA 2YV4A 1T4GA 9ATCA 1Y1RA 3NEYA 2EZUA 2FPSA 4NH4A 4KXQA 3ECAA 3FKQA 2HNBA 4HVLA 1RHQA 1MU5A 2I67A 1L5SA 1Z0AA 3DA1A 1XT6A 5FPYA 1H2AS 4Y2TA 4A2WA 3T3MB 5C8XA 3BGOS 5TF4A 1UC4B 2GH1A 4RKUF 3QEMA 5E4YA 1X80B 2Z43A 3U4MA 1VG5A 8CATA 3MHVC 5CAEB 1OFGA 5G02A 1W36B 4XB6B 4CKWA 4FD2A 2ODQA 1M10A 2P69A 2H7XA 2BR5A 1ABBA 3OZ7A 5JG7A 4MUYA 3ORQA 3CS3A 2GUGA 3GW8A 4F11A 3B8HA 1U8EA 2XUKA 1T3ZA 3VR4H 4YUXA 1NU8A 4D9FA 3GDOA 2R6AA 1W34A 1L1RA 1DFGA 4NTZA 3LRTA 2MTBA 1WY7A 2IXFA 5BRAA 1W0JA 4LOHA 2FPGA 3N59A 3N8IA 4LF8B 4HWGA 3ZJTA 3U3MA 3RFCA 1QYWA 2A5LA 2VS1A 1KBOA 1YRWA 4QZVA 4URXR 1ZITA 3TDNA 4D25A 4RVGA 2CXOA 3KSZO 5HIKA 1DAFA 1C9YA 3QELA 5H0IA 4J0GA 1E99A 1Y4UA 3QE0A 2QTAA 3I12A 3D6HA 3A7DA 4QJ4A 1POWA 3PFIA 1GRQA 1JU3A 5JH7A 5IF3A 1M1UA 2ZI3A 3RRJA 4RKEA 4HVAA 3VR3A 3DUWA 2GMWA 3GEGA 5IJ0A 2IHYA 4IWYA 2ODTX 4OIMA 3LMMA 2RHHA 1GUZA 4QDJA 2NT4A 5B58T 3PV0A 5CW2A 3IP3A 4N82A 3LPLA 4XVQA 2E3JA 1KP2A 4CUJA 1XZBA 4HXYA 4UU7A 3B70A 4M89A 4J9UE 1F38A 4FFMA 3QELB 3D43A 1PYGA 3MMNA 2E4WA 3BORA 3G2MA 3PFFA 2BJWA 3SJBA 4ND3A 5F7JA 1QLHA 1V25A 3C5HA 2I2CA 1N9ZA 2JFGA 1CBUA 4NCAA 2JH3A 3CEMA 3ONFA 4BZWA 4D0SA 1N2CA 3TZCA 1EXWA 5FYQA 2NPOA 2R751 1Z5WA 3LPDA 3U3ZA 2O5RA 2GN0A 4RS4A 4MH0E 4MR9B 1LF5A 4RHTA 4B81A 1D0SA 4DBLC 3CEHA 4Z8YA 5ELLA 2CVOA 1P4SA 3INTA 4MWBA 4N8DA 5EUCA 1OXTA 5KOJA 4DLKA 4ZCIA 3A9TA 3L01A 4ZI2A 5IM5A 4RF0A 1N2CB 2QQGA 1U7PA 3U19A 2R1VA 4TPKA 2FI1A 3V2IA 3D1LA 4K6KA 2BHNA 4EJSC 3PUJA 1IN6A 1CUWA 3V1LA 3WGLA 1SMKA 3G0DA 3LD9A 5HX7A 4H3VA 1GAJA 1SHUX 4C4RA 2E1RA 4YQYA 3P9QA 4BO3A 3PNQA 2FQXA 4ZMBA 4QTTB 5JZBA 3AMVA 3FZNA 2MGWA 5FO0A 1DAEA 4MRVA 3WHIA 3TI9A 2A0KA 2BM0A 4FFDA 5A04A 3ROMA 3BYZA 4IIVA 5DLPA 1P1HA 1BJTA 5JVDF 2CXRA 3EPJA 1SXJA 4CMAA 4ZO9A 4LGYA 1EQ2A 3O74A 2Q5HA 3ORSA 1R2QA 4ZOEA 1A0OA 2G1AA 1QCDA 5ARCA 2WZJA 1PR5A 3MHPA 1LDEA 3N7AA 5CW1A 1C7IA 3E5RA 4C4TA 2AS0A 2HSGA 1B2LA 4WK2B 4O0LA 1OTYA 2QPLA 1JAZA 2V9CA 4JA2A 3BFXA 1Q7TA 4KPYA 3JYLA 3PDCA 3WGHA 3UG7A 3EC1A 3VR6D 2AA3A 5AVUA 2BI8A 2CCKA 2OAP1 2I54A 3I72A 4D5EA 3CLRC 1K5GA 4RY2A 4MW4A 1AT1A 4YCJA 4ZMSA 5LQUA 2QJFA 3OG9A 2XNKA 1FUYB 2PQ2A 3WISA 3PQEA 2Q3MA 1WXEA 2I2WA 2UKDA 4ZAZA 1GDHA 1S8FA 3IXQA 4BNDA 3GEIA 2W2NA 1GY8A 1E3JA 1E9CA 3ZXXA 4OX9B 1R0BA 3EVAA 3I4LA 2V8BA 1G21A 1VEJA 5KYYA 4GX0A 2ZI9A 4TYMA 5K51A 3KOOA 3N0RA 3RI3A 2VHWA 3HWRA 4NS4A 4EA8A 2NXJA 4ZVNA 1N5RA 4EJ6A 2WRZA 2G72A 4Q9HA 4E30A 4QTZA 4LFBB 1XZLA 1DQPA 2N3ZA 1V43A 2QJWA 1QNLA 3T1NA 5KYVA 1LUAA 4B9AA 4BNDB 3IUPA 4EB6A 1X0XA 2YWCA 1XNJA 5TEWA 1KDZA 5F7ZA 1G21B 2P27A 5JYCA 4KUEA 3SC2A 4OL0A 3E8SA 3E2PA 2QAJA 4CFZA 2IH4A 4I19A 4NYMQ 5TGDA 3M70A 3BREA 3UT6A 1U0RA 3QMPA 3EWSA 3DW3X 2O8VA 3EIHA 1ZW1A 1EIWA 4QWMA 3SM3A 2AH5A 1FJ2A 1XCBA 2ZANA 4HB0A 1NFRA 3VR5H 3WLKX 3WL3A 3IR6A 3MFQA 2ZT7A 1KIFA 1GCIA 1XMIA 2I4MA 2VBCA 2WMYA 4EB6B 4NKRA 2B7LA 1RMYA 1BMQA 1OLUA 3HCFA 3SC2B 1REQB 3AW8A 1OX