3H4MA

Aaa atpase domain of the proteasome- activating nucleotidase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteasome-activating nucleotidase
publication title Structural Insights into the Regulatory Particle of the Proteasome from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3h4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h4mA01
5EXXA 5P21A 1YZUA 4PC6A 1GUAA 3ZIAA 4HB0A 1AN0A 3TUIC 3T1QA 2ZSAA 5GVSA 3B7GA 3DEFA 1Z0KA 2R44A 4URVR 5JI3E 1VHTA 1HT2E 1KI7A 1OFUX 2W2XA 3K0AB 2R2AA 2JA1A 1W4BA 3BC1A 2C8VA 1CJKC 5FR1A 3B13B 1E0AA 3ZVMA 2FE4A 1VCMA 4QHTA 1RC8A 4MRVA 3AF3A 5E3HA 3J81k 3VNVA 2FFAA 1G3QA 4TMKA 2FG5A 2BC9A 4JJZA 4MH0R 4PAQA 5FPSA 1B0UA 2BCGY 5CYOA 2FMXA 1H8ED 3IEUA 1JPJA 4LK2A 3X1ZA 4IRUB 4B35A 1ZNYA 2D4HA 5FBQB 5L3RA 5A4JA 3X1YA 4I81A 2QENA 2G1KA 5KOYA 1XJ0A 2C04A 2IYUA 4WBSA 1KDOA 3V00A 1LB1B 3ZIAD 4F38A 2JASA 3EAQA 4WA7A 4NPHA 3T5GA 1A1VA 2E87A 3Q5EA 3RC8A 1Q1EA 3VFDA 4PHHA 1CBUA 2ZI5A 3NWJA 4IJMA 1ZCBA 4HATA 1MO3A 4YLGA 3A8TA 4CEHB 3OIUA 3QBTA 4BFWA 4M1KA 2XOKD 5FR2A 2FSIA 2DFLA 1MRNA 5LB2A 1AA9A 4QBGB 2ZITA 3FMIA 3N70A 4LYAA 5K8IA 2WJIA 4NYJQ 2AD1A 1A4RA 5JEEA 1JALA 4DXAA 1G19A 4BPBA 1E1RA 2FDCA 2QA5A 4FINA 2ODEA 1II8A 1C1KA 5E7IA 1ZNWA 2CK3A 1JEDA 1HV8A 1D8TA 2NO1A 3K0FB 4NYJR 4Q00A 4WZ6A 3F3YA 2ZE5A 2FX3A 1ZM7A 1ZM4A 2CLSA 3I8XA 4BZQA 5DIFA 3U44A 2C5LA 1RW4A 2QM7A 2YYZA 5A0FA 5AJWA 2JEOA 4U02A 2WJJA 1G17A 2HJGA 2XNSA 2V54A 2V7QA 3I92A 5UKDA 2W6JA 3UWKA 2IYZA 2CBZA 2WBLC 4TTPA 2J46A 2OBLA 1FP6A 2AN9A 3T12A 1UF9A 3B1ZA 1E1RD 2PJRA 3CRW1 1X8KA 3S1AA 1VECA 4BQSA 2CK3D 5EP3A 1XEWY 4DHEA 3W5JA 2PZGA 5JWRA 1KDRA 4LRSA 2G3YA 2C03A 1E9DA 3DKVA 4DRZA 4EJSA 2R6GA 4GDFA 4GOXA 2QY9A 1DG1G 2IA5A 2ZJYA 4C4PA 5F9FA 4U00A 1GNPA 4YMUA 1A7JA 4FWHA 4LGMA 1YQTA 4F93B 1MO5A 4HYYA 4JL5A 4B2LA 2HDNB 1GL6A 1G7RA 2BKEA 2W6JD 3NH6A 3BD9A 1JAHA 1BKDR 4TT3A 3BH0A 3LH5A 1ZIOA 4I1OA 1C9KA 1W36D 5E95A 2ZYVX 4AURA 1II0A 3FOZA 2IYQA 2F3TA 3HPRA 1RPZA 3AJIB 3CR8A 3ADDA 4MKHA 4C0QC 2JLWA 1TQ6A 3QXXA 4CYMA 3K09C 1Q21A 1E79A 3MD0A 1IXSB 2ZR7A 3PUZA 2VHJA 4Q19A 4X8MA 1M34E 2VP4A 3RS4A 3W5IA 3H1TA 3PXGA 5KNBA 3SBEA 1RE0A 2BBTA 1E2KA 2V6JA 2XZLA 3M1IA 4WXRA 1JXOA 2Q9AA 4ZIRA 1JBKA 2OLJA 4RD4A 4C0LA 1QRAA 3QOFA 2BMFA 4QHSA 4B73A 2FEMA 4AYTA 3SJZA 3GJXC 1TMKA 1E2FA 4HDQB 1R5BA 2ZRGA 4DJTA 4CEIA 1TF5A 3TSOA 5KDOA 1R0YA 4DKXA 4MDFA 3BJIC 4GSYA 4JVLA 1E9BA 3MWJA 2OE2A 4DEXA 2WICA 1GVNB 4QFMA 5FUWA 3AP1A 1AKEA 2JDIA 3AUYA 3MCAA 4TT3D 2BHRA 4ZDIA 1AJEA 3PUXA 2PLFA 3LBHA 5BYJA 4D81A 2A5YB 4QKQA 3HDTA 5C18A 1Z0FA 3U44B 1E79D 5FOTA 4XWKA 4C0HA 1Z5ZA 3TSWA 2HJVA 2J0UB 4PR0A 2ZANA 3KW6A 4AI6A 1GL7A 4ESVA 1XJQA 3CIOA 4MRSA 3RWMB 1E9FA 1VHLA 3BFXA 3ZZUA 2A30A 3I3SR 4RD0A 2FF7A 2NO9A 1E2QA 2KRKA 3OE7A 5TB5A 3SJCA 4F4JA 1W36B 3AVPA 1W36C 4PXAA 3CH4B 2ZM5A 2NZJA 1UFQA 3VR6A 3ZDQA 1OFIA 3LY5A 1N5LA 2VPPA 1U9IA 4HAXA 2JDID 4W5WA 2IT1A 2RMKA 3LXRA 4M9ZA 3T34A 2W0SA 2C9YA 4KAXA 3WXMA 1NLFA 3BB1A 3W6OA 3R8CA 1EFUA 5F3WB 2O8FA 1EX6A 1OH8A 3ZS9A 4EJSB 2YKGA 5E4FA 3B9PA 2FSGA 1G3UA 3NBZC 4EJSC 4D82A 2A9KA 2ZS7A 1MO6A 1VG9B 4NYIR 2VHUA 1KO7A 1S4QA 1YZQA 1U2RA 5FTLA 2Z0MA 4BFVA 4R98A 2XAUA 2GXSA 4MUBA 2HXSA 3CPEA 2WMOB 4A2WA 3SDZA 2Z6VA 3OE7D 4P32A 2YWGA 3PR1A 4QM7A 4QJ3A 4M9SA 1KZGB 2VF8A 3QG5A 4JLJA 4X8HA 4K8OA 1VCIA 1NNEA 3FFAA 4F92B 1E2PA 1KJYA 2J9RA 1ZD8A 4TYWA 4PHTA 5EP2A 1XXHE 4LJ5A 2PCJA 3EPJA 1IN4A 2JLVA 1W0JA 1QZMA 4ZIRB 5FOXA 3AKCA 1EX7A 1KIMA 4BE7B 3NC0C 3GPLA 4EPVA 5C4MA 2ZSEA 3E1SA 4CEIB 1WF3A 1G3MA 3GJ7A 3D6TB 1U8AA 1CR0A 1W4AA 2BM1A 2N46A 3IKJA 3L2OB 2CLDX 4KSBA 5FFMA 3NBYC 2NMVA 4DB4A 3NKVA 1GNQA 2RHMA 2P2LA 1SVOA 3SYNA 3LLUA 5F2EA 3U3OA 2QRNA 2R65A 1QVAA 3VU9B 4CEJA 1UEIA 1GITA 2PJZA 2IXFA 1XPOA 1GZSA 1J7KA 3B2EA 4LWZA 1WP9A 4YMSA 1W0JD 4M0LA 1E96A 1B23P 3WP1B 4HAYA 3AGQA 1DEKA 2O0HA 3ZVLA 2AHOA 4LYHA 3HU3A 2GILA 1FL9A 4QNMA 3SNHA 4MYCA 1NLZA 5JRZA 3KX2A 3THOA 4F91B 5DGXA 1GOTA 1EG7A 1KK1A 5CJPA 5CM9C 4DVGA 2DFNA 5JSZA 2CCGA 4GMXA 3A37A 2O8FB 2BCJQ 5KTYA 5EXSA 3JZMA 3SN6A 1QHIA 3SFVA 1OH5A 1U0JA 2BM0A 4DLYA 4MITA 4PO9A 4PC3A 3HYTA 4RSGA 2B21A 3EIQA 3UPUA 1G5RA 2WMNB 1P3JA 2F6RA 1XPUA 2QSYA 1FX0A 4D4LA 1G9XA 1RFLA 1U0HC 4Q1FA 2HYDA 1OT3A 3DPUA 2H18A 1HTWA 4LY6A 3DOFA 4M53A 3THXA 1N5KA 2JJ1A 3R9IA 1XTRA 4BLRA 2FV8A 5TXGA 1Z2CA 5TMPA 1Z2AA 2QAGB 3K9HA 2GNOA 4A0HA 1T4GA 3P4XA 3TJZA 5KSPA 4QC2A 4IVQA 2WWIA 1O87A 1NMZA 3AV0B 2GJSA 2FNAA 5F9HA 3JVUA 5ANRB 3LVRE 1ZW6A 2ODNA 2GK7A 1DTSA 3IIJA 1E9CA 1N6KA 1OXXK 4Q9IA 4OQNA 1KSHA 2DYKA 4MRPA 5L3VA 1CF4A 4XJXA 5D3MA 3FE2A 1N6LA 2W58A 1XWIA 3EIHA 4IOJA 3A4LA 3D31A 1YJ5A 4XSGA 3WNBA 4ZDKA 1DPFA 2ODBA 3CWQA 4ACBA 4DIDA 2JJ1D 3GFPA 4UNNA 1Q12A 4UNRA 4RCYA 1R5NA 2CDNA 1SULA 3GLFA 4PQRA 3LXXA 4UXIA 4B6EA 3KQNA 2FFHA 4HLUA 4M8NE 1U0LA 2WIBA 4C7OA 2RHDA 4KFSA 4DDTA 4NZYA 2WWYA 4QGFA 1FZQA 1GRNA 4W5HA 1L8QA 2GF0A 4FMCB 1N6NA 4FXPA 2NG1A 4BFXA 2BWJA 3KXLA 3SHFA 1SKYB 1Z6TA 4MYHA 1SQ5A 3W6NA 3TIFA 3NHBA 5SZJA 1R4AA 1AGRA 4O0MA 2P6RA 1G3RA 1JECA 5CK5A 1BYUA 2XZOA 2YINC 4OQXA 4DEYA 5JSZB 1DAGA 4TLBA 2ZJ5A 2YWHA 3QJYA 3AF2A 2PMDA 3A1UA 5CK4A 1KI9A 2ZYWX 2VSOA 4DIEA 1R8SA 3HPQA 5EQTA 2OXRA 2OAQ1 2B7BA 4PTLA 3LLMA 4XOIA 4D4JA 5JCZA 4TMWA 4MGKR 4QL3A 1U8YA 1CR1A 5IDVA 4KBGA 4US2R 2GCNA 4I4LA 4TL7A 4HAZA 1L7VC 1FX0B 4MQBA 1FNMA 1LS6A 4MYTA 3NEJA 4A2PA 3AGPA 3QNUA 2AD5A 4NCHA 5EZ5A 3AKEA 3AVYA 2BJVA 1BOFA 1RVDA 1GG2A 2RGCA 1IXRC 3IDQA 3N5CA 2A78A 2AKYA 3O8BA 4XVQA 3IGFA 1MH1A 5EE1A 3THXB 4PANA 4II7A 5CIQA 4LSGA 2RGGA 1G8FA 2O52A 1COWA 3W6PA 4A6PA 1N25A 4OI4A 4OK3A 1UPTA 2NQ2C 1Z29A 3PIRA 5EZ6B 4ASUD 1HURA 3EXAA 5G40A 1YU9A 1OW3B 3QE0A 1ZNZA 3U7GA 4PPNA 3DMNA 2F1IA 4IDQA 1KKMA 4U5XA 3FHCB 1NN5A 2MSEB 3PUVA 3IPYA 2I3BA 3BWDD 821PA 1GNRA 2ZRBA 1IJEA 1GL9B 4A0FA 1WQ1R 2ZJ2A 1EWRA 3FKSA 4D26A 5AJVB 1NMXA 5D3MB 3RLFA 3BOSA 3QXHA 1XCGB 2BBWA 5FOWA 2RB4A 1IBRA 1ZUNB 4P33A 1E69A 4QBIA 5FOUA 1SVSA 2BV3A 1GILA 1DARA 1SVKA 4BLTA 3EARA 2OFXA 3QKTA 2IHBA 4Q9JA 2CJWA 1COWD 1M7GA 1NKSA 4HLUC 2FWRA 4C7OB 3Q8XB 1ZC4A 1SXJA 2P3SA 1VTKA 4HB3A 2FSFA 1XMSA 4WZAE 5L3SA 4FCVA 2HCBA 1OF1A 4IFEA 5SZIA 2IS2A 2P5SA 1BMFA 4ITRC 4Z8XA 1G5PA 3QG1A 1D9XA 4ZV4A 1F2TB 1HA3A 3FKSD 1U98A 2VBCA 2Z43A 4N1AA 1UBGA 4Q1BA 2O8CA 5AUOB 1CU1A 1QDEA 1G291 1ZYUA 2YWFA 3I8SA 5C46F 1DVRA 2ZUDA 4DSOA 3WYGA 1DAMA 3QXSA 3BXZA 2R6FA 1XD2A 5H8WA 1SHKA 2O0JA 4LHWA 4LHYA 1KI2A 1J99A 3LV8A 3SC3A 3MMPA 2XTZA 2QN6A 4TMVA 5HTKA 1SXJD 1T0HB 1VKJA 1KNQA 3T1OA 4PX9A 1XMJA 1VDZA 3CPJB 4RKFA 2BIFA 3OEEA 4DCNA 3SYLA 1XCPA 3B1VA 3NG1A 4JN6A 3PEYA 1BMFD 2H57A 4DCVA 3GJ4A 5BN3A 4Q4AA 4LJAA 5JHHB 1QBKC 2QEQA 1BIFA 3M0EA 3WY9A 1X1SA 5HZKA 1NI3A 3IHWA 3RSOA 1E2HA 5BN4A 4IW3B 4JL8A 1EFHA 5CYPA 2ONKA 1KSFX 1ODFA 1YVDA 3W3AA 2ZRAA 2JLSA 2ZRPA 1JPNA 2IYLD 1GAJA 3LDAA 3O47A 4TLDA 3FWYA 3ZGXA 1QHNA 2QNRA 2QTHA 2C77A 1GKUB 3NTUA 3KKMA 1DBSA 1Q1BA 1X86B 2ZAMA 3OEED 1PVOA 4CGZA 5AUNB 2DPXA 3CX8A 1XTIA 3SR0A 8OHMA 4HAUA 1XEWX 1ZCAA 2VSFA 3CNOA 4DSNA 3WHLA 1OSNA 1Z08A 2ZETA 2XITA 1XZPA 1F2UA 1S96A 2GWHA 1YR8A 1M1YE 2GBLA 1Q22A 4TMZA 1VG1A 4A1FA 4FWGA 2CJWB 1KY3A 4HZIA 3KZ1E 3TGPA 4AKGA 2ZREA 1SXJB 3CRMA 3EASA 2LCFA 3H86A 1KO4A 3UMRA 2BKUA 1TF7A 1SXJC 1Z07A 4FI3C 1D9ZA 3AQ4A 4JIMA 4ERNA 5L3SB 1I2DA 3ADCA 2WSSA 2YHSA 3P27A 2J0VA 3BAFA 2ZUBA 4MKGA 1ZIPA 3HR8A 4BLQA 4KFTA 1SGWA 4RFVA 2ZRMA 4KJZA 1UEJA 2ORVA 2ZRNA 1E2MA 4JZKA 1RRPA 4ZI2A 2QRZA 2O8CB 2XXAA 1IN7A 3DM9B 1XTSA 2QMOA 3L0PA 2QTVB 3MJRA 4LYJA 721PA 1KI1A 5AK0A 1HYQA 3RS7A 3EA5A 4EPRA 3OIWA 3ONWA 4YC7A 1KGDA 2FZ4A 4Q47A 1XD2B 4E5UA 1Z6XA 2X2FA 3QEJA 2JLRA 2CCJA 4EFLA 1ZD9A 5SZHB 1II9A 3GFOA 1HQYE 2VO1A 4G5OA 4EDHA 3KDSE 4K46A 3ICEA 2B8TA 2NIPA 4C0KA 1VIYA 1AKYA 3REGA 2WSSD 1KJZA 2KB0A 4XVRA 1JR3D 1KJWA 1M8PA 1ZAKA 2CL0X 4TYQA 5J40A 4Q4AB 3R9WA 2ATVA 5FTNA 4LC0A 4WIAA 1F6BA 3BRWD 1KY2A 4LJ4A 3GEIA 1KHTA 1P2SA 1G6HA 3AVQA 3C16C 3F0TA 4JSYA 4LBWA 5HCIA 1US8A 1Y3AA 3Q7PA 1W47A 1R7RA 4ZPXA 4NBSA 3CRRA 1PJRA 3BFVA 2FPMA 1OIWA 4URZR 2FA9A 2GF9A 3ZVRA 4TZ0A 3PG5A 1EFTA 2R62A 2VTKA 2ZJZA 4B3DA 4A3VB 1P9WA 3CONA 3QQ5A 2OO7A 1IAQA 3UG6A 2GEUA 1AM4D 1IONA 2AXNA 4JVNA 2ERXA 1ZUIA 2WKQA 4UJ5A 1UADA 3CNNA 4OQLA 4GFDA 4Q7KA 1P9RA 5HE8A 1JQJC 3FHTA 3ASZA 2PBRA 4I1UA 1YZTA 2AKAB 4ZKDA 3QKSA 1E9AA 1WA5A 1N6IA 2ZE7A 1F2UB 4GOJA 3K09A 2BVNA 3K9LA 2QU8A 4JBXA 1YKSA 3OF5A 4MRRA 3BB3A 1WRBA 2J5XA 3EZ6A 2GBLC 4LDJA 4GT1A 5IHPA 1HY3A 1D6JA 1U94A 4G0NA 3A1VA 5FPHA 4KLNA 1GKIA 1N5JA 2OCYC 1WE2A 3KQLA 1KMQA 1YR6A 4XTRA 4FCTA 1FOEB 3FDIA 3QIAA 2X19A 1P60A 1Z0JA 2QP3A 4C0JA 3VHLB 5BWMA 2J87A 3BK7A 4B3GA 2C9CA 1DAIA 1DAEA 2BBOA 2RGNA 2XXAB 1E9EA 3RNLA 1T5LA 4KO8A 2MMGA 2NO0A 1F60A 3LO5A 1M6NA 4JVMA 1AZTA 2PH1A 3ND8A 1KAGA 4KSCA 2OFWA 3WMGA 3CW2A 2H92A 2ZI3A 4Q5IA 2IL1A 3AF4A 4C9BA 5JWHA 2J0UA 4NCIA 3UATA 2KI5A 4ON9A 5JWOA 5FL3A 2DHRA 1OHHA 2PZEA 3GQBA 4MGYR 5EXPA 2XJ9A 5FUXA 3PV0A 2HF9A 4MUAA 421PA 5KSOA 4FCWA 1DS6A 3ZS8A 2CVFA 4G5GA 1ZRHA 5FBLB 2QAJA 4NCKA 2OLKA 3I5XA 2QP4A 1MKYA 1ESNA 1OIXA 2CHQA 1NKTA 1X37A 3T61A 3LW7A 5K8LA 2GXQA 3VAAA 2F43B 1ZM2A 2CL6X 1A5TA 2VP2A 4N0EA 3NC1C 4LHVA 4JLKA 4IDOA 1US8B 4RZUA 3DOEA 4MGZR 2JIZA 3QXJA 4ZCIA 2WAXA 1CJTC 3OHMA 3W9YA 4OI0A 3DZDA 1Q1ZA 2KWIA 3PJRA 4LBYA 3KL4A 1YRAA 3R9XA 1IY2A 621PA 2GTPA 5AUQA 1OHHD 1G8YA 2IUUA 2V7QD 1TADA 2IYXA 4JLOA 4R2IA 4AKEA 4D6PA 3K1JA 4IDPA 2DWPA 4FMDB 1KI6A 521PA 3D8BA 1OYYA 3QKSB 4MA4A 5TY0A 1DOAA 4QHYA 4A92A 2Q3HA 4Q48A 1R0WA 4D0LB 4JBWA 4QXAA 2EYUA 5KU1A 3KKOA 2YC4C 3MWKA 1E2EA 1W0KA 1Z22A 1E94E 2XZPA 3FGNA 4AG5A 1UJ2A 4PC2A 3AVWA 1G8GA 2EYQA 2CCKA 2HLDA 3DDCA 1DO0A 3L0IB 1E2IA 4EPXA 1W7AA 1G7CA 1R2QA 1S9HA 2JIZD 4PAMA 1XXHA 1NJFA 3EG5A 2IX3A 2J0QA 221PA 2V3CC 1NF3A 5TDHA 4POAA 2IF0A 3VTKA 2UKDA 4A9AA 5A5GA 2ZE6A 3WHKA 1TEVA 1SZPA 3U2QA 1NVUQ 1MABB 4W5JA 3BB4A 1YRBA 1NVWQ 1VIAA 3TVTA 2ECKA 1CRQA 2G83A 4XSHA 2ZI7A 3BE4A 3FMPB 2RGNC 1S0UA 3MG9A 2O8EA 4M1OA 4PAOA 4Z1MA 1N0UA 2GVZC 3L0OA 2ERYA 1F48A 4JLMA 1P7CA 1Z83A 3TH5A 2AL7A 2JATA 5L8VA 1W0KD 1E0KA 4KHZA 2VA8A 3VU9A 2ZPTX 3ZQJA 2HLDD 4YMTA 4DLRA 2NZ8A 4O25A 1Q20A 2WWXA 1GIAA 1Z3IX 4A82A 2JCSA 3T06B 1VYVA 1ZC3A 3H84A 4QGGA 5TVKA 1L4YA 2X1VA 2EFGA 2A5FA 4Z51A 3DL0A 3IILA 3U6BA 3EZ9A 3KJEA 4F7WA 4TLAA 2GEDA 2WKPA 5FBWB 4EIWA 3TW8B 1AQYA 1MT0A 4Z1MD 3MWYW 3CM0A 2FGKA 1F3OA 1NLYA 1P2VA 2FJUA 2ZU0C 1YHNA 3M4YA 4HAVA 4RZ2A 1KI4A 1ZM3A 4ZCLA 2ZEJA 4BLOA 5DO9A 2PEZA 3LQRA 2QTFA 2YWEA 3T15A 2IF2A 1E6CA 2F55A 1IY0A 3O8DA 3EPKA 1RKBA 1LF0A 2ZRDA 1UDXA 3CPHA 2IYRA 2IYSA 1KI6B 4RZ3A 1XDBA 5BQ5A 4PO1A 2WV9A 4CT5A 3UXMA 1XTQA 4GZLA 1XNJA 4BLPA 1Q3HA 3PUWA 4I99A 2ZYUX 2P67A 2WM9B 4IFBA 4QGHA 2QAGA 5KDLA 5M04A 3ZD7A 3V9PA 4TYPA 2IW3A 4D80A 3N2IA 4PPFA 1UKZA 3AVUA 1XTJA 2FPLA 1N5IA 1XXHB 2ZROA 3MLEA 4QRHA 5JEDA 3OFNA 2QMHA 1E2GA 4KCGA 4RD2A 3LFUA 5AJXA 3VLFB 4NL4H 3KJHA 4RCZA 3U3MA 2PMKA 3ETLA 5FPTA 3CB4A 4B34A 4XVUA 5H1YA 4TTQA 3I73A 3GJ8A 5KPDA 4R9UC 3ZZTA 2QROA 4V0ME 1NRJB 4OI2A 1E4VA 3PEWA 5GADl 2O8EB 1LW7A 4FMBB 1PUIA 5KYKA 5JMTA 4FN5A 4TQAA 1H65A 1KI3A 3ECCA 4B48A 2G1JA 3RRYA 4PSKA 2EFCB 4M22A 4URYR 4ILEA 1WDTA 2HT1A 3PITA 5AWFC 3MWLA 3ND9A 3KKQA 5K8UA 5CJ2A 3VR1A 1X8LA 2HUPA 2XJ4A 2PZFA 3B78A 3HP1A 1XP8A 2AXPA 1CS4C 4Q4LA 1GRQA 4Q4JA 1E99A 4HEJA 2F1JA 2EWVA 1R5OA 4P31A 4I1SA 1OIVA 4P0TA 2KJQA 2QGNA 3TAHA 4LYFA 2I1VB 3RRMA 2GXAA 3R8FA 3D3QA 3U3RA 4A15A 4JLPA 2OUKA 4ACAA 3AM1A 2NPIA 1OLOA 3CBQA 2W2VA 2RKOA 5K8TA 1T91A 2GJ8A 3K0EA 4F4IA 4OQMA 1G8HA 3W34A 3GLIA 2RGAA 3PENA 1FW6A 4Q9LA 3SJAA 4EQ6A 5EP4A 4A36A 4L4UA 1ELOA 3KKPA 4H1UA 3KXIA 4TQ9A 5B57C 1U8ZA 2C78A 2HF8A 3EWAA 2IBMA 2IK8A 4LBZA 1E2JA 1KOFA 2ZQ5A 4M1SA 1X1RA 3TR5A 1W2HA 2QQEA 4Q18A 2D2FA 4BZXA 4HUTA 2F9MA 1I4TD 2OZEA 2YC2C 1IOZA 3CNLA 3OEHA 3RSLA 4DLZA 3V4RA 1N3BA 1YZGA 2QAGC 3QPUA 3R20A 1IXZA 5G53C 4B32A 3KXKA 4Q1DA 1S1MA 2Q6TA 4RFSA 5FUVA 4HLCA 3SEAA 1YZKA 3ZVNA 3K0SA 2QUZA 1J8MF 4KITB 2QGZA 3G82C 3U4QA 1U90A 3MSXA 2V6ZM 3Q72A 3GLHE 4R2HA 2ZTSA 2ATXA 2OSBA 4LX0A 4YDHB 1W4CA 4B2PA 4RKEA 4TL8A 2VRWA 5EE5B 3RYTC 3CX7A 1P2TA 1LY1A 2E9SA 2FN4A 4NKRA 1TAGA 4IHQA 1KSJA 2AFIE 5DYIA 1UBFA 5TARA 3H2YA 3U3JA 3ADBA 1XMIA 3WMEA 3OEHD 1ZMXA 4B3CA 1E2DA 3CH5A 1CR2A 2C98A 2LKDA 4AKIA 4TL9A 5DHFA 2GDJA 3W8RA 5BW8A 3FFBA 1QHHA 2LWIA 4GMDA 2VIIA 4YQFA 2JJ2A 3EPLA 5HPYB 2F9LA 3OZXA 3WRYC 4KODA 1Z6AA 3UIEA 1K8RA 2QM8A 4GNKA 2RCNA 2O8DA 4Q4JB 1F2TA 4FWDA 4EKDA 2FU5C 1HE8B 4LOAA 1LFDB 2WJYA 3X1WA 2N1BA 2OXCA 4OHWA 5HZHA 5GVRA 2DY1A 5CLQA 2GA8A 3A4NA 1D5CA 1WXQA 4OHXA 1FQKA 4P4TA 4DLTA 1D2EA 2W6IA 1W46A 2J7PA 2VP0A 3KKNA 2XSZA 2W0MA 2FZLA 3RS5A 1XPRA 1N6PA 1OB2A 1QHYA 4JYBA 1RJ9A 2P6UA 3JVVA 3IO3A 3HYRA 4US1R 2CLCX 3IQWA 3GLIB 2VH5R 3IPXA 4WW0A 2A3RA 4EQ6B 2RGDA 4A4DA 2KE5A 4IDNA 5B30A 3EZ7A 2JJ2D 2IYVA 5TV2A 1HUQA 2G77B 3LBIA 5L3QB 1NBME 4IOMA 5DISB 3QKUA 4OHVA 2VP9A 3UKDA 4CIDA 2XTNA 1RIFA 5LPNA 4IOLA 4KBFA 5JZVA 3ZLJA 1XBTA 4GP7A 3W8NA 4NP6A 3B8HA 4TN1A 2W6ID 4RFSB 4GITA 1VYTA 2J7PD 4C2TA 4G5SA 4V0NA 2XSZD 3KFXA 4ARZA 4BZPA 1RRFA 1KYIA 2CMKA 2YVUA 4NCNA 3WYFA 5KHOC 4GRAA 4JLDA 3U4QB 1CP2A 3SBDA 1QZXA 2ZI6A 5G3ZA 2D74A 3CF2A 1HT1E 2RGEA 4QBFA 5IK2A 1ESMA 4PHFA 4B47A 1EFCA 2CHVA 4R71A 2WWGA 4IKEA 4D4KA 4N0DA 3DO6A 4U7DA 5AJYA 3NEYA 1KO1A 1WCV1 4B2IA 4JYCA 1HQCA 4D4MA 3BFKA 1FUUA 4UXHA 3C14C 5GJWC 1FPMA 3VKHA 3CRQA 3UWOA 1UM8A 2QBYB 2R6CA 1Q0UA 3C15C 5GJBA 1IHUA 4IVRA 4EPTA 3NVAA 3AF0A 1HEIA 2YOGA 1QHHB 2VLIA 2NO7A 2QQ0A 2QG6A 3VR2A 1X6VA 2EFHB 4DDWA 3IBGA 3LQQA 3LD9A 5H68A 3X2SA 2ZJAA 4L9SA 4BRWA 1LTQA 2W83A 2O8DB 4NTZA 1OXSC 1L4UA 3F8TA 1GFIA 4B43A 3GLFE 3B5JA 2GZDA 1CR4A 5IK2D 3NDBB 4UJ3A 1QHSA 2RGXA 3C7KA 4KXFB 5J4LA 4QM6A 3ZJYA 1E1QA 1ZJ6A 1X3SA 3NXSA 4JLNA 4D0GA 3FPAA 4KV9A 5JJLA 2GJAA 2Y8EA 2DFKB 4OL0A 4S2EA 4AKHA 2GETA 1ONBA 1DAHA 3UK6A 3NBXX 4DDUA 1BS1A 2ORWA 1RJ9B 1OH6A 3QI2A 2PT5A 1Z0AA 2AX4A 4HLQB 4P3YA 3WYAA 2ZR0A 5JBQA 4UNSA 4L8GA 3HU1A 5DYGA 1Q3TA 1RYHA 2AWOA 3AKYA 4QBHA 1E98A 1Z0IA 3AH8A 1LF5A 1VMAA 3ICQB 1VG0B 4URUR 4LV8B 2XNDA 3DHWC 2BOVA 3A4MA 2V8OA 3BORA 2OBNA 4JJKA 1NY6A 1R10A 2IYYA 3UANA 1G4UR 5C1BA 3VNUA 2NOAA 3QBVA 5E7JA 2GKSA 4A0RA 1E1QD 3CUEF 3A1WA 5FTJA 1M7HA 1T3SA 1JJVA 4S35A 5CDFE 4FD2A 1G7SA 3MFYA 4ARZB 2CE2X 2JLQA 2UZ3A 1E9RA 1XU4A 2F1HA 4KI0A 2DZOB 1P2UA 4UNPA 4V0OA 3TQCA 3VR5A 4Z8YA 5KNCA 2CVHA 5DI9A 3TRFA 2ZVPX 3Q3JB 2IUSA 2PCLA 1CKEA 1NL3A 5LDDC 4GI7A 5KPJA 5DHAA 4DCTA 1JQLB 1KAOA 4G3XA 2D06A 3KB2A 3GLGE 3WNCA 4L9WA 2XNDD 3WBJA 2A5JA 2EFEB 2V1UA 2ZRKA 3QKRB 5AJZA 2G0NA 5FOSA 5B58C 2UZIR 2N42A 4URXR 1EK0A 3EZ2A 3NHAA 4Q02A 4WOPA 2J0SA 2IEYA 4OYHA 4TL6A 5G3YA 4BFYA 3F5FA 3TBKA 3L43A 3WMFA 3GJ3A 1G3IA 4TSFA 3A36A 3FYHA 1R8QA 3OAAA 5CB6A 1T3HA 1KTVA 2ZYTX 3LA6A 3TW4A 4W7SA 4QJ4A 2PEYA 3GJ5A 2QT0A 2ANBA 3Q7QA 4Q01A 4ABYA 4HUQB 5HE9A 1GRRA 3SE0A 4LHXA 1OXVA 2ZRLA 1P4SA 1CJUC 2VP5A 5IRCD 4F4CA 1J90A 1E2NA 2O5VA 3LX8A 1NY5A 2EU8A 2KBFA 3LVQE 2FFQA 3OIVA 2BEKA 3AVTA 4EPYA 4ZCMA 5J4VA 1KK3A 4NHOA 1MO4A 4QJ5A 2GRJA 1VG8A 2DWOA 4Q66C 3THWA 3AEZA 4X8LA 1IJFA 3P20A 4TSFD 4LRTA 5JS7A 1GM5A 4XTCS 1T0JB 3B6EA 2AWNA 2GESA 3OAAD 2X2EA 1TPZA 3IEVA 1N6OA 2H16A 3QF4A 4FIDA 3C41J 1AIPA 3IIKA 1JI0A 2V4ZA 5H70A 3QVVA 5JCPA 1AGPA 4LCBA 2B8WA 3HU2A 2WKRA 2CNWA 4FW9A 1LVGA 4US0R 2F43A 2ZSDA 4QOSA 1X8JA 5DI3A 3I32A 2PT7A 2ZRIA 4O2RA 4WXPA 3T5DA 4NCJA 4JS0A 4OJKA 4CVNA 1NIJA 3B1XA 4ZI3A 3ZQ6A 1MV5A 5IF9A 5JJKA 1DADA 3GEEA 4GZMA 1JB1A 3KTAA 4B74A 1CJVC 1NG9A 3C4JA 1CRPA 4PC7A 3ZD6A 1WBBA 1EFRA 4FMCF 3TE6A 4DLWA 2DCUA 1T5IA 1YE8A 4KVGA 2Q3FA 2BJWA 3TR0A 4C30A 3REFA 2E1RA 4DLXA 1JEEA 3K53A 3BGWA 1I4DD 2IS1A 2XTMA 3VMFA 3O8RA 4MYUA 4L5BA 3P1JA 4LPSA 3A1TA 4WZBE 3WP0A 4DSUA 3EPHA 1Q1QA 1OKKA 3RAPR 2CNWD 2XOKA 2NO6A 1VYUA 2EQBA 4PSAA 4ESHA 2QORA 2GXUA 4AD8A 1UDWA 4B75A 2XEXA 1SVMA 2ZJ8A 4TWZA 4AYXA 3EA0A 3UMFA 3U5ZB 4WAUA 4M1WA 3L82B 4N3NA 4GPTA 3QXCA 4TMTA 2QMEA 1NP6A 1PLJA 4OK5A 1IY1A 1G4AE 1E3MA 1E9SA 4EFNA 1EFRD 3SYKA 2YOHA 3K9NA 1MABA 3B9QA 4Q1CA 1I4LD 5CLLA 3GLIE 1C4OA 1LV7A 3FMFA 4Z54A 3SQXA 4JL6A 1QG2A 3LRPA 3V4FA 2C96A 1G64A 4BFUA 4M1MA 3SS8A 1IQPA 4M21A 1ZBDA 3C5HA 5F98A 1SVIA 4M9QA 1KKLA 2B6HA 4PZYA 1OKKD 1NN0A 1NIPA 1GKYA 1AS3A 2UVQA 4IEEA 2Z5FA 3B85A 3TLXA 1JR3E 4AWXA 2L0XA 3THWB 3MGCA 2FFBA 4E07A 1XX6A 2OCPA 3T1VA 1K6MA 2R9VA 2QZ4A 5SZKB 2CL7X 4NH0A 5CB8A 3CWZA 3EZFA 4G1UC 3I72A 5FL7A 1WMSA 5C4GB 2ZJBA 2G9NA 2G0TA 5J4HA 1TX4B 1W44A 3BS4A 3QF4B 4NYMQ 4RZXA 2W00A 3I1FA 4OJQA 5G41A 4GL2A 4M2LA 3G5UA 1TL7C 2K5UA 3ZZ0A 2KBEA 2QPTA 3LW8A 3L8YA 2J3EA 4RD6A 1G6OA 4BGDA 4ZDWA 5HKKA 2ZXUA 5DI3B 1OFHA 3PCRB 4B3FX 4NYMR 2VSXA 2WSMA 4K81B 5E7MA 2D3WA 4NU0A 3RANA 3I61A 1CTQA 1JXMA 3ZH9B 1R0ZA 4XD7A 3KTAB 3G0HA 3QSYA 4CRWB 4B33A 2V6IA 2QE7A 3QF7A 3LNCA 5FI1B 1AZSC 1BYIA 2DFTA 2HEIA 1P72A 2IYWA 2Z83A 4BEBA 5JS8A 5FL7D 4MKFA 1CEEA 1BO6A 3HR7A 1CLUA 4BLSA 1T8TA 1S2MA 2WVJA 1N0VC 1Z28A 3H0KA 3IBYA 3A6PC 1FTNA 2VF7A 2ZSBA 4PQYA 1NJGA 3AKDA 2HXYA 2QMUA 2NTYC 2P65A 4CF7A 5HKKD 5JECA 2BBSA 2H17A 3VKWA 4BUJA 1NMYA 3AUXA 2DVWB 1OV4A 2ZRHA 5BXQC 3K8YA 1ZD1A 3PQCA 1FUKA 3Q9LA 3SOPA 2ZR9A 5J4YA 4LV6A 4XD7D 2HCJB 2ZS8A 4OI1A 5KSYA 1QVRA 2BMDA 2JLUA 2R8RA 2FOLA 1IN8A 6Q21A 4LJ8A 2QE7D 2D2EA 1PLLA 2A5DA 4PSVA 3L8ZA 4E22A 4A8JA 3FHOA 4LJYA 5DNYB 3EWSA 2REOA 4UQOA 1YR7A 1ANKA 2WJHA 2OT3B 1ZVQA 2NPFA 2IWRA 4O2LA 5DH9A 4V0MA 3EIEA 2DWQA 3B1WA 4R7ZA 1P62B 2OHFA 4V0KA 1G7TA 4Q9KA 3QENA 1NVMA 4C3ZA 1K5GA 3AB3A 2AK2A 4PO8A 3U61B 1VCNA 3AP2A 4L15A 2VHCA 4AYWA 1OXTA 2JLXA 3IO5A 1CULC 1TEXA 3KJIA 4LRWA 1OB5A 2R6AA 2WWWA 3U60B 4CZ2A 3E2IA 4G01B 2EFDB 3MRSA 4PZZA 1HE1C 4DZZA 1II8B 4X8OA 1K5DA 4Q1AA 2DZNB 2JGNA 4Q7JB 2FH5B 3GJ0A 1ZINA 4MKIA 2AFHE 4Y0VA 2YNMA 2D7DA 4DLVA 2QT1A 1Z6GA 3P4YA 2GAOA 3P32A 2C9OA 1AS2A 2IYTA 2EW1A 1Z6YA 1V5WA 2G6BA 1KK2A 1KMHA 2XGJA 2O8BA 2ZJOA 3THYA 3HJNA 4LV5B 3KQKA 1I2MA 3L0SA 1YR9A 2YOFA 4Q7MB 4UXJA 2FEOA 1SKQA 2GJ9A 2MSCB 2JJ8A 4D2IA 5FPKA 2RH5A 1ETUA 1QHXA 4PPQA 3BH6A 1U81A 4IOKA 2ONJA 4DLUA 4JT2A 1A2KC 3QEOA 1MOZA 1N6HA 1JR6A 1GDDA 3LX5A 4QG7A 1EXMA 3S1AB 2A7QA 3LWNA 5FTMA 1GP2A 3MAAC 2WZQA 4NYIQ 1KZ7B 4TTRA 1PZNA 4GOKA 3SU8A 1QHGA 2ZI9A 5FOVA 4UKDA 4C2UA 1TF2A 3N2EA 1T9HA 2IWHA 1NSFA 4D0NA 3AVVA 3O8CA 5BYKA 2RAPA 4JLBA 3SZRA 4AC9A 1Z06A 3PEUA 1P73A 3H4MA 4LJ6A 1TUIA 1SVLA 1MR3F 3C5CA 1WBDA 3W3ZB 4DDVA 2ZVQX 4XH9B 4PQFA 4BEJA 2QSZA 4BECA 4A8JB 3GLHA 2CE7A 2WOJA 3MHVC 2HT6A 5EE3A 4TLEA 1CXZA 4A8JC 1Z63A 3I5YA 4H1VA 4Q4HA 1RRGA 2OFOA 2CEAA 1Z0DA 3RS0A 4HB2A 3TAUA 3MJHA 4LUCA 2WPDA 2F7SA 3AVOA 3CR7A 4HZUA 5EXTA 1PUJA 3EW9A 1G8PA 1XZQA 4G5QA 4ZO4A 5CITA 4JSTA 4AG6A 1TQDA 1ZM9A 1OXUA 3NIBA 3LAWA 2OV2A 3CLVA 2GZAA 3FTQA 4L16A 3GMTA 3OFND 3TQFA 4URWR 1DAKA 4HAWA 2OESA 1T6NA 1P75A 1UKVY 4LC1A 3RC3A 1TNDA 3KQHA 1RYFA 4D25A 5FTKA 4I1VA 1XRJA 2JAQA 5GJVC 4QGAA 3TUJC 3SJBA 1KK0A 4LBVA 2NGRA 1AQUA 1GSIA 1M7BA 1FMJA 1Z8FA 1XF9A 3KFVA 1VPLA 3RS3A 2JLYA 2OILA 1KMHB 2O8BB 1R0XA 1NSTA 5KSZA 3THYB 4B3XA 1D2NA 4E09A 2Q9CA 3CZQA 1IM2A 2F1RA 1C1YA 1W4RA 3IIMA 2P6NA 1G1MA 2GEVA 2WPDD 5AR1A 4P4UA 3ADKA 4C0SA 3SQWA 1ZNXA 3FVQA 2DR3A 1PV4A 2C99A 2WWFA 5HR5A 2PL3A 3IUYA 4GP6A 2YZ2A 4HI0E 2H5EA 2ODWA 3DZ8A 2VHTA 4IDHA 1T8UA 5JLJA 4GBMA 4PZLA 5L3QA 3CKLA 1NG1A 4WVFA 4LPKA 1U9IC 3QPVA 1S8FA 2D7CA 2OCAA 1NBMA 5CM8B 1M2OB 2BMJA 2IS4A 4DLSA 3GD7A 5EE9A 1N2CE 2WHXA 5DN6A 1W5TA 1EWQA 1W48A 4OKSA 3EC2A 4TLCA 3KUDA 4PC1A 1WB9A 1A82A 1NVVQ 3KUCA 2J41A 1AK2A 3KJGA 2I1QA 2P5TB 3TMKA 2VP6A 5KDDA 2XB2A 4PHGA 3QUSA 1OJLA 2ORIA 2PX0A 3U7EB 2ZU6A 3FB4A 3QVUA 1JNYA 4M1TA 4RVCA 2GZHA 3VX4A 4KVAA 1OFTA 4O3MA 1W49A 4LHZA 1E0SA 3Q85A 4IEIA 1FNNA 3CRVA 1BH2A 3E5HA 1F5NA 1NVVR 3QY0A 4P4SA 5FI0B 4XWOA 4UNQA 2QI9C 5FH9A 5FBRB 3A58B 1LNZA 1G18A 4TYNA 4FWIB 2WOOA 3GLHB 3UG7A 5EUMA 5FUYA 1FFHA 3FKQA 5EJEA 2ZAOA 1NN1A 1DELA 1DE0A 5EP1A 3DMDA 2WWHA 3LBNA 3QPWA 1L2TA 1P61B 4B3BA 1J8YF 4Q4HB 1NBMD 4RJLA 1E0JA 1UBCA 5EE0A 5DN6D 3GFTA 3T35A 4HDCA 3AP3A 4HZUB 4YDSA 2QBYA 1UBEA 4B6FA 4H9GA 4C0AC 1KO5A 1XB2A 3ZYCA 2J45A 3JZAA 2I4IA 1J2JA 2ZE8A 5LD2B 4BFSA 1KI8A 4Q9HA 4CDGA 5BN5A 1GTVA 5LD2C 3IHLA 2ANCA 4KU4A 3Q5DA 3GJ6A 1Z47A 5EUQB 4JVSB 1M74A 2ZRJA 2J59A 3OESA 3RVBA 3KQUA 4FMDF 1Q57A 3RRZA 1W2GA 4Q1EA 3RRNA 3KB1A 3K70D 2OEPA 2FGJA 5B2ZA 4DCSA 1G16A 3AF1A 2FPKA 1A2BA 4DC9A 4CEJB 2QL6A 2RGBA 3U7FB 4M9XA 2OAP1 2ZUCA 3X1DA 3U6KA 1XFAA 3M6AA 4PFSA 2H7VA 3U3KA 2EWWA 3K9GA 1E2LA 2GCPA 4M1YA 1QG4A 3BERA 3VR4A 1SKYE 1LS1A 1NN3A 3C8UA 3DKPA 4BWYA 3EC1A 5JJIA 4B44A 2IEZA 2F3RA 4NONA 1ZU5A 1N0WA 1FMLA 1UKYA 3VR3A 4MDEA 3UMSA 4W9MC 2CHGA 2ASEA 2GK6A 3PUYA 1OH7A 2BEJA 3TUZC 5IT5A 1OYWA 2VQSA 4ASUA 3EX7C 4PPGA 1TU4A 3CF6R 1G5TA 2IC5A 4NDZA 3R7WA 4AY2A 4DB2A 1FTSA 4YONB 4CT4B 1J70A 3D7MA 4KYIB 1G21E 2FSHA 1ZU4A 3AVXA 4JBYA 4ZKEA 5CDFA 1H8HA 3E70C 3RABA 1KO8A 3VKGA 4P4SB 5FPYA 4HB4A 3I4LA 3SFZA 1V43A 5DLQC 4TQUS 5CIWA 3WRXC 1NVXQ 2HV8A 3K70B 2WJVA 2VEDA 4KLZA 5LB4A 2ZRFA 1ZUHA 1E32A 4HLDA 3K70C 1OE0A 2GCOA 1P6XA 3VQTA 4DT1A 1S1CA 1DO2A 2OG2A 2V1XA 2WIAA 5FBVB 1G20E 2QPOA 3GLGA 3QKRA 4LZZA 2P0EA 1RRCA 4C0BA 3HWSA 2GVDC 1TQ2A 1DAFA 2ZI4A 2VYFA 2WTUA 3P26A 1VCOA 2O0KA 3IQXA 4TYYA 4OQFA 5J4KA 4TZ6A 1JAIA 1SVWA 3CZPA 5ELXA 1D2MA 1XJCA 3NBFA 3BIFA 2Q9BA 4M4SA 2A2ZA 1S3SA 5LBIA 1H8HD 2TMKA 2YJTD 4CW7A 1QF9A 3RDPA 5D3QA 4DSTA 4JKIA 4HUQA 4MRNA 4BFTA 2WAYA 2IS6A 1N6RA 5JFGA 2Q3MA 3CO5A 1EESA 3GLFB 3BH7A 1S9DA 1R6BX 4EFMA 2C95A 4EUNA 5DE3A 1CIPA 4KFRA 3TNFA 1XTKA 4Q7LA 4B71A 4RY2A 2ZSFA 2IXEA 1OPXA 4NE2A 4KFUA 4AK9A 1XD9A 2BDTA 4OK6A 4TMXA 5JRJA 5J5CA 4B76A 1FP7A 2H1LA 1PLKA 1U99A 1HH4A 2V55B 2XB4A 1UAAA 4MGIR 2EVWX 1TUEA 4NMMA 4V0LA 2IXGA 2GHIA 3I62A 4BFZA 1JJ7A 2XX3A 1MRSA 3SHWA 2OM2A 3TK1A 4BRUA 2KSQA 2AR7A 2VHQA 2GAAA 2CXXA 4A6XA 1XMVA 4HSEA 3R7WB 1ZP6A 1TQ4A 1KDTA 3ASYA 5JHGB 3GP8A 3MUFA 3K0CA 5DSZA 4DUGA 4KYUA 3WNDA 4JLAA 4QNRA 1XEXA 4V02A 3NH9A 2B92A 2WJGA 2Q21A 2J1LA 5C2JB 3GEHA 2QPAA 5AUPB 4E03A 2OCBA 2AK3A 4XWAA 1EGAA 2LKCA 2SHKA 1XCMA 2OBMA 5J47A 3W90A 4YMVA 1AS0A 4DCUA 1O3YA 3K0AA 4BASA 1DG3A 3TKLA 2GCOB 2VL7A 3A1SA 4AIIA 4DT1B 2MSDB 2H8KA 2X77A 1GWNA 2QP9X 4G5RA 3GLGB 4Q03A 2HYIC 1UKEA 4LJ7A 5KUTA 4JMPA 1W1WA 5KO2A 3U7HB 2V9PA 121PA 4DUGD 1S3GA 2JLZA 1KNXA 3RWOA 1E4YA 1CJMA 4Q21A 3TVDA 2PLRA 2DB3A 4XIGS 4DWJA 4JKYA 2PX3A 3BBPA 4YXWA 3SI7A 1SHZA 4IXNA 2Z4RA 2X8AA 2ZRCA 1YZNA 1XD8A 4A2QA 3PVSA 4LJ9A 2B7CA 1P9NA 3OIYA 4IXMA 3VHXA 2ZIAA 1YZLA 3PEVA 4V03A 3WBKA 3RS2A 2YV5A 1SXJE 2C2HA 5KNDA 4CEHA 4OHZA 2D62A 3B60A 1FQJA 1XEFA 4FWTA 3TSZA 1G41A 2REBA 5GJCA 3CF0A 3B82A 3DVLA 3RHFA 3PFIA 3DM5A 4RD1A 4YMWA 1KSGA 2IUTA 5B64A 2G88A 1JR3A 4OBEA 3GCGA 4JLVA 2ZS9A 2GJKA 5JI2E 1TTTA 2MMCA 3CX6A 2W2TA 3VX3A 1RZ3A 2IHYA 2R6DA 4RD3A 4EPWA 4J0QA 1P5ZB 4HDOB 4OHYA 1IN5A 3K0FA 3FMOB 4YXWD 1KDPA 5HCNA 4DBLC 2A5GA 2REXB 1W5SA 4IVPA 4ZDJA 2J7KA 2DWZB 1Q44A 1T3LA 1Y63A 3K0CC 4EAQA 4JT4A 4Y0AA 3T1TA 3X1XA 2Q0HA 2BMEA 1IN6A 1H8EA 2DBYA 1XEXB 3NDPA 2Z4SA 4LI0A 3B1YA 1TU3A 4A0GA
chains in the Genus database with same CATH superfamily
3ZWWA 1YMUA 3WSWA 4HB0A 2QUHA 1HT2E 2VJYA 3DOIA 4FVTA 4OFZA 1DKNA 2I1LA 4GBJA 1W5AA 2GKGA 3T7EA 4PAQA 1MVOA 2XCTB 2AJBA 4CDRA 1JPJA 3ZWXA 1S89A 3UJBA 3X1YA 3DSRA 1ZNQO 1KDOA 3GG2A 4JR2A 1ZCBA 3B1JA 1N2JA 2EAUA 1A1SA 3B7QA 1N7JA 1KRXA 2X0DA 2AG1A 2VQDA 3MINA 1A4RA 4UFPA 4CR7A 2ODEA 5CA1B 5E7IA 1X1BA 3AHDA 1F4LA 2NO1A 3EDMA 3F3YA 4GX5A 2W9XA 2G67A 4TWJA 3H9GA 3W4KA 5A0FA 3RG2A 2DWNA 1O8BA 2XNSA 3OMXA 4F4FA 2IYZA 1GUZA 4KPYA 2EG9A 2QD5A 3NFRA 5ECWA 3SFTA 2CDBA 3RYCA 1Y4SA 1XEWY 3W2IA 5J3JA 4LRSA 3OM1A 2V45A 2Z30A 3EJWA 2VF2A 5F9FA 2CMGA 1HE3A 4FEAA 4QPZA 1B1AA 1BKDR 1W36D 1P1CA 1BVRA 2JLWA 2OHIA 4HUJA 3ZE1B 4A23A 1T1JA 1I36A 4GH5A 2BGMA 3SQMA 3MSCA 1BCSA 3D6FA 4DKXA 3PPYA 5AVYA 1MJNA 3AP1A 4AWAA 3O4RA 4KGVA 4YJGA 3FPHA 5EMHA 1FSFA 2YN0A 2Q29A 1NHWC 1PKEA 3U44B 2G09A 2ZUEA 5KVVA 5KNBD 4XI9A 4EA7A 1BVUA 2WWVD 3I0NA 2FF7A 2NO9A 2NTVA 4IIJB 4Q3DA 3INGA 3HV2A 1D1PA 3LY5A 2O8FA 3RVLA 2HTEA 4UE6A 1EAMA 4P08A 1O96A 3SDZA 3OE7D 4P32A 3N2NA 4QJ3A 5KJEA 1S01A 3WGHA 1ONPA 4N3GA 1WKBA 2PX8A 5IT4A 4O5AA 3RSHA 4X62B 4NXNB 3ZHCA 1WEKA 4RHXA 3GWZA 3L2OB 4L3WA 1J8QA 3QITA 1GNQA 3LZDA 3D64A 2HA5A 2QRNA 4CEJA 1UEIA 5L3ZA 4Z0NA 3LKBA 2B9EA 4OBXA 2A0XA 4RPLA 2GD2A 3HCCA 1T5TA 2C5GA 1EEXB 4YECA 4MITA 3U6MA 3EIQA 4LXHA 3CKKA 4D4LA 1JT9A 1RFLA 5HFNA 2QTCA 4MWTA 5F7ZA 1DBIA 1Z2AA 1P77A 3NBQA 4G23A 2HK6A 3EQ7A 4XFDA 2A0YA 3ABSB 3M4NA 3TTYA 4BGVA 3IIJA 3RKRA 2KHZA 3RSGA 2WA2A 3VTAA 1BJKA 2Z2KA 1QH0A 4RSHA 2EDCA 2RHDA 2OORA 3C24A 3OTHA 1N5DA 4RLHA 1Z6TA 1SQ5A 5AOBA 5SZJA 5KMGB 2P6RA 1T0PA 1PHPA 2VT7A 3JSXA 5KYUB 2EQ5A 2YWHA 4GIPA 1Z4LA 4XOIA 2OXRA 1Q0TA 4MRAA 3LLMA 2ZCVA 1XAGA 3OE4A 1C7ZA 3W9BA 1JFFA 1NXWA 2AKYA 2FDXA 1M8FA 4RK7A 2HIAA 3WWYA 1CZLA 3PIRA 4ASUD 1HURA 2Y1DA 1X1DA 4H27A 2ILVA 2O3UA 4QTZA 1JSCA 1WQ1R 2HREA 5ITXA 3V1LA 4MIYA 1AU9A 4KOEC 1IBRA 1ZUNB 4BLTA 3TG2A 2HUNA 5IJ9A 1JAZA 5CB4A 4FCVA 5KPTA 2HCBA 4F86A 4QOJA 4EHDA 1ZDMA 4BJ3A 2O8CA 1UOEA 4EHAA 5KX5A 4KAFA 2VTBA 3WWCA 1PZMA 1RSZA 4UHEA 5JYBA 1GHTA 1KI2A 2G1UA 2QLTA 4MWBA 4ZMRA 3MMPA 4YT2A 1IPFA 1VKJA 1KNQA 3STXA 4Y30A 3QX9A 1BMFD 2VAWA 1XAJA 4EG3A 2QAIA 3RK1A 4DR4M 2QEQA 2FETA 3M0EA 2WW8A 1BGWA 4EF6A 4FX2A 3TQOA 2IYLD 3EK2A 5CNKA 3JQ8B 4WX2B 3OSUA 1Q1BA 5AUNB 1Z8HA 2R8PA 2XITA 2R85A 2F3SA 1HF3A 3SGLA 5BMVB 2LCFA 4BVLA 1TF7A 1C9MA 2B98A 1ZIPA 3HR8A 3I2JA 1SNYA 4QASA 1QDTA 2UUPA 1OYVA 2A94A 1UUFA 2PBZA 4KBYA 1KI1A 3M6IA 3RS7A 1NW8A 4UU7A 4DNQA 4E5UA 3O93A 2ZTVA 4LN1A 4PEVA 5CW1A 2RIPA 4E2FA 4DWVA 4FQ8A 1B16A 3KZCA 4Z2YA 1M8PA 5MGNA 4Z9XA 2OENG 3VU3A 3L6OO 4HTAA 3BRWD 1GXSB 1KY2A 1DV0A 3HM2A 3CIFA 4R9NA 4ZAYA 3HGQA 3ZVRA 3MRVA 3L9XA 1AM4D 3T7KA 1DQSA 4EO4A 2PZLA 3ROKA 2AW3A 2AKAB 5HFJA 2G3QA 2PGAA 3UAVA 3NS7A 1WRBA 2J5XA 1C7FA 1TUGA 4Q24A 4DANA 3EXG2 5IF3A 1RQ2A 3GQ4A 4KIFA 2XB6A 5HYVA 3VHLB 3FGOA 3UMGA 5ITVA 1YUBA 1TIKA 1XV5A 1N1MA 4UCXA 1UK6A 3EGCA 4JVMA 3TDMA 4J4BA 3WMGA 1C0IA 3QFFA 1YE5A 4DUYM 2PGIA 3SMPA 1V8FA 3DVAA 4K6CA 1QNLA 4KXQA 1TLLA 5CUQA 3DBHB 3QFSA 2Y27A 4C43A 3OJLA 1ZQ1A 3U81A 4IDOA 3DOEA 2AUNA 2WAXA 3W9YA 3OFJA 3RVSA 4PV7A 2W42A 3NM6B 3ZGYA 2I62A 4JLOA 2LHCA 5AHOA 4A92A 2YX1A 2MCFA 3Q0EA 4FB5A 4EY3A 1W7AA 2IX3A 2UXCB 3SAJA 1DHRA 5T41A 2JCGA 3LHFA 1XF1A 2JCVA 3T5PA 5DM4A 1F48A 5I5GA 1E8MA 5JAMA 5KOJA 3BJZA 3ZQJA 3U17A 3JR7A 2NZ8A 1HNZM 3PQ2A 3PKJA 1VQ1A 3QX7A 2PUJA 2F90A 2PPVA 3NHMA 3U6BA 4C03A 1Z2OX 4L75A 1QGOA 2WKPA 2Z09A 2EJTA 1MT0A 2HGZA 2Q5CA 4OXYA 3BE5A 2XQGA 1XU9A 4H1TA 1T29A 5BR8M 5DO9A 4YHHB 4O8CA 5D7BA 2G82A 1E6CA 3OMLA 4PSUA 3UK7A 2IYRA 1KI6B 4MQ4A 3V4SA 4DUPA 1X7XA 3QLTA 2I3ZA 3PUWA 4IFBA 1MT3A 1YA4A 1TUBA 3OLCX 2IIVA 5EJ8A 4W9NA 4IIGA 2FPLA 5AKHA 2P69A 2R18A 1NVBA 2C94A 4ARSA 2VBFA 5JR3A 4E4YA 3I28A 3OPYI 1KP9A 4RJKA 3UVEA 5F73A 1RWPA 3LT0A 2HT1A 4UC0A 3UHFA 3VR1A 1Y7PA 3B78A 1CD5A 2WAAA 5DYNA 5JANA 1EZ4A 3IEIA 4WFQA 2QGNA 1MEEA 2G80A 4XQGA 6YASA 3EG9A 3NHKA 3E23A 3UGQA 4I36A 2WILA 5BSMA 4N7RA 4O6VA 5E1BA 1LLCA 1O6ZA 3BFJA 5ALSA 1SG0A 1ULUA 2OCIA 3AUFA 3W78A 1KERA 4JGIA 4D42A 4HLCA 5IVDA 1UBKS 1JHQA 3NDIA 2OCKA 3SNKA 4WFIA 1PEDA 4DVJA 5H9WA 5FWYA 1U7HA 5TARA 1QZ3A 1E2DA 3OJOA 3CUYA 1GFZA 3W8RA 5BW8A 3ACDA 3DQZA 2Y66A 4IDFA 4L6V6 4FWDA 5ITZB 2PKQO 3WNZA 4NJMA 3UJDA 2B99A 4WKBA 3EGIA 4K9SA 1XNGA 2J5RA 4JYBA 2P6UA 2MSWA 4HLQA 4EQ6B 5BV7A 2IUFA 2IVFA 2IYVA 3ZYZA 2WF8A 1Q17A 4AL4A 3RJZA 3U26A 3MB5A 1Y6GA 2PQMA 1B8UA 3KT3A 3AETA 4JQOA 1XBTA 2IHTA 1XWFA 4TTSA 4L78A 3PHIA 5JSFA 5EJ4A 3CF2A 2O07A 2Q1WA 4IIWA 4RFLA 1VLHA 4D4KA 3DO6A 4B7AA 1N8SA 1UM8A 1Q0UA 1WSBA 4IG9A 4CMEA 3GJTA 1HEIA 3JD3A 1G63A 2VRNA 1FTWA 3ESCA 2O8DB 4NTZA 1ACJA 4UJ3A 3M6UA 4P4GA 2I7CA 5CFQA 3GRZA 1DAHA 1PT9A 3UK6A 5A5EA 1OAIA 4LFBB 2Q5QA 3WYAA 4PIMA 2QX6A 3QVGB 3GO4A 5TJHA 1THZA 3DHWC 2FEAA 1R10A 3TD6A 4MI3A 3TRHA 3K9PA 1X0VA 3DTTA 1IUNA 2UZ3A 2F1HA 4BVEA 1A5BB 3TRFA 5JZBA 2PPLA 1EAYA 4M0WA 2XNDD 1L5FA 3NMUF 4FD3A 2G0NA 4JKOA 2UZIR 3CZ9A 4Z7NB 1JFTA 2IEYA 5T7BA 2IU0A 3REQB 3IAXA 3K2LA 2YJ4A 1KTVA 1UIMA 4IUYA 5IWCA 4V24A 3LC2O 4OKNA 5B36A 3VPAA 2X5NA 3WZLA 2A9RA 1KK3A 1PR3A 2PKXA 1GZUA 1KYYA 2CKMA 1Y5IA 2TS1A 3PNSA 3WFZA 5J58A 3Q98A 4UDXX 2H16A 4IQ4A 1JI0A 3EXIA 4MI1A 4D9KA 5JCPA 1Y4ZA 3O4JA 1X8JA 2V5VA 1JPVA 2Z56A 1JN0A 5IBQA 1U2ZA 1MV5A 2X4DA 2KZSA 4B74A 3H9EO 1QYXA 1E2BA 3WWDA 1XP5A 4ISBA 2CZGA 3G17A 3SKVA 2GJ4A 1I4DD 2A59A 4GMQA 4Y98A 3EH1A 4MMYB 1UDWA 3HWRA 4KDFA 5CLFA 3SOZA 2W2KA 2MYPA 4J3FA 3FVVA 5ALWA 5E8JA 2Q27A 4MEBA 1YJBA 2J9ZB 5IAKA 3HEMA 5F98A 1ABFA 5C7YA 5JDCC 1YBFA 3ENQA 4GYKA 4ZHQB 1YS2X 4AWXA 3F46A 1GTMA 5E1DA 1GSAA 3BM5A 4L8WB 1VG5A 1HLFA 4P92A 3JZDA 4GL2A 1GGFA 3IP5A 3LW8A 5HKKA 4GKKM 1D0IA 3CB2A 1SZCA 3U16A 3T3EA 1ISGA 2HEIA 5JS8A 5JPCA 1CHDA 2UU9M 1MHTA 2VF7A 2ZSBA 3BWMA 2SKEA 3RGSA 4UM9B 5JO0A 4LE0A 1C4XA 1NMYA 1FUKA 1HYHA 3OVMA 5AQ1A 4FYXA 4IJWA 4PM4A 1HFJA 3W1WA 1E18A 4PSVA 1ADJA 3OHSX 2REOA 2WJHA 3PNMA 2ALJA 1G7TA 1KF0A 4ALMA 1YDFA 4CMJA 1NVMA 4IJQA 2VDWA 1H9BA 2PLNA 4PHCA 1STOA 2C57A 3W5VA 4G01B 3MRSA 4X8OA 3TM4A 1U5BA 3V7UA 3LUDA 1L5ZA 1UMBA 1FU4A 2WYWA 2BKVA 2BR4A 2ZBVA 2ONJA 2HADA 3N74A 1D8AA 3GXBA 1GP2A 3RTBA 1KAHA 3ZY4A 1BC5A 3GPUA 2RBKA 3L1UA 2AXQA 3UN1A 4B7CA 3ZOZA 3AVVA 4K3UA 5L8RF 2WABA 3A4TA 2OHGA 3N2LA 2JS7A 1GTSA 4K5QA 1JHDA 3LPAA 2KLBA 2PLAA 5E6UA 1OGYA 1TJ4A 4J2OA 3RBAA 2CEAA 4BUCA 1DUSA 1PR5A 2WPDA 2G17A 2DSNA 1Z73A 1OXUA 4LYEA 4OW0A 5DWDA 4RS4A 3ANYB 4CUZA 5FTKA 3ENVA 4PYOA 1VHQA 4QGAA 5JAHA 2PYIA 1U9ZA 1L5MA 2QR3A 3EY9A 3I2GA 1IM2A 1M1XB 1QOQB 2P6NA 2ROQA 4QVKA 3ADKA 2CUZA 2C99A 3PX2A 3IUYA 4LMBA 2GASA 2XQFA 3ABRB 3ORHA 4E0BA 4X6LA 5JTUA 3D7SA 3R0XA 5CM8B 2QYSA 3I76A 4I9UA 1ATZA 2ICAA 1WB9A 3KUCA 5EMLA 2PX0A 4W1PA 3L8HA 1W49A 1RQGA 2WVHA 5FI0B 4P4SA 4LF8M 4I2NA 3C7AA 2E48A 3FJ1A 1QX4A 4DMGA 4TYNA 3GLHB 5F4ZA 3HCPA 5AJUA 3WDKA 3U31A 3LQKA 3MEQA 2QXUA 1A7UA 2AOVA 3T35A 1KYQA 1JG1A 1ZKDA 4B6FA 4Q7QA 3QEAZ 4O4HA 4MUYA 3RRNA 5B2ZA 2Q2EB 2QQGA 3KT8A 2A57A 3U7FB 4M9XA 1VJRA 2IIBA 5F3DA 3K9GA 3L7AA 5CT4A 2Z6UA 2F3RA 2JI9A 2O20A 3TXYA 1H23A 3KOYA 3PUYA 3QPBA 3TUZC 1YUMA 1AKMA 3TLGB 2OKGA 4MJ3A 2QVZX 3PQEA 4O1MA 4MDHA 2YW2A 2BFEB 3UJ6A 1ZU4A 3AVXA 2EKLA 1RQXA 4L0DA 1XLTC 4XK8F 5FPYA 3MTIA 4FT2A 3I2YX 4FQ7A 4IFTA 2ZRFA 5CXSA 4ZO8A 3JQ7B 4NXMM 5TLSA 4TKLA 1XDZA 4CW7A 1I3NA 4BFTA 3EDCA 2ORED 4BXOB 2C4HA 5AOVA 2VSQA 2O05A 2WU8A 4OQZA 1EGQA 4X7MA 2LCIA 2FLWA 3FNQA 3UAOA 1Y0BA 3PDCA 2VHQA 4XQ0A 4DA0A 3MUFA 1W5EA 3H16A 4MVJM 3CISA 3E82A 4W1QA 4QNRA 1XEXA 5K0NA 5LN1A 3CUKA 1LPOA 4RHTA 3G2HA 4LF9B 1EGAA 1A04A 3VNRA 4M0MA 4H0CA 3J2PB 4IF4A 2X77A 3JQPA 4OAPA 1RPTA 3EDOA 4I55B 1HEUA 2J5QA 2BFCB 2D59A 4JMPA 2V9PA 3EFHA 2RI1A 3VC1A 4BX0A 5IJZA 2YFHA 1L4NA 3H1EA 5L4NA 2X76A 2GB4A 1Z39A 3HCNA 1TO1E 3U13A 2ZRCA 1NFFA 2KQUA 4V03A 1T6YA 3QMWA 2D62A 4FP9A 5HF5A 2HA0A 3PFIA 3M6MD 4M8IA 2YVLA 3A2MA 2ZS9A 2HBZA 4IDEA 4WVLA 3AU8A 1VI2A 1J25A 1U02A 3D6AA 2GN6A 2VNSA 2Q0HA 2W11A 5IHXA 4Q3EA 4A0GA 3PD1A 1CQJA 1HC7A 5EINA 1ADYA 1QQ7A 1YK0A 3CCFA 5LA6A 3TINA 2C8VA 3TD2A 1YIDA 3X1KA 1AF7A 1YB4A 1G3QA 1Z5GA 4IFIA 3IEUA 5IVIA 4QYIA 5FBQB 4I81A 2C2KA 4LW8A 6PFKA 1NJ6A 2ZI5A 1T2FA 2VRBA 4YLGA 3OIUA 3K16A 1KOGA 2XOKD 3H8VA 4NYJQ 1WHSB 1JE0A 1PJCA 4BYGA 3KHTA 5HIJA 3OEYA 2OG1A 4WKPA 2DF8A 2Y21A 2VJDA 2AFHA 4WZ6A 4CMGA 2Q8NA 3R24A 4HWPA 4ZVRA 4K0KM 1E3WB 1A71A 3SQNA 4FSXA 4QU0A 2Y2VA 3L0BA 3QU2A 4CG0A 4W5TA 1X8KA 4NOLA 5DN9A 3ZD8A 1FFWA 1V4VA 3DL4A 4GDFA 3PQ6A 4GMHA 4FWHA 5EHXA 3GDGA 1JHUA 5GQSA 4B2LA 1L1EA 2O23A 3U62A 3JQ9A 4LK3A 4LYDA 4I1OA 1HDZA 3OO0A 4AURA 3K71B 1FXWF 3ADDA 1TQ6A 3UT6A 2ZR7A 3RS4A 1I3CA 5KNBA 2JCXA 4I3GA 1Y3CE 2C5AA 2HPHA 1N34B 2X4IA 3E0XA 4COKA 1JBKA 5EN4A 2FF5A 1NZJA 4DJTA 2JLAA 5KNDH 2AJLI 5J63A 3DAOA 3LX6A 1ZXBA 2UYHA 2HJVA 3GT3A 2L6OA 4FHCA 4YP1A 3INRA 4V1CB 3BFXA 3OIFA 3OOWA 3HJCA 1M2NA 3OE7A 4MGEA 3IMFA 4ZOBA 5ERYA 1OFIA 4H7IA 3KG2A 3RWBA 3H99A 5CPFA 2NSDA 5J2TF 1ZRNA 4KK4A 4QIHA 4EI8A 1ENPA 1MO6A 4BKMA 3A7DA 4GQAA 1X77A 5ALMA 3R23A 3LT4A 5HW0A 2Z6VA 5YASA 1T9ZA 2Z5GA 1LDBA 5CT6A 5AI4A 4ZRNA 3DTNA 4IMIB 2I7XA 3ZV3A 2ZQYA 5BPHA 4OYLA 3CLHA 2QR2A 4CMHA 3E9SA 4L5YA 5FOXA 1WY5A 1ILEA 4QOZC 2ETXA 3A6KA 2HQSA 4NAHA 4LJLA 4FLFA 3WS7A 4CF3A 3GJ7A 2JY8A 2QD3A 5AM0A 4X9XA 3SYNA 4L8YA 3T9FA 4XB6B 2ZTDA 2YDYA 1DEKA 1N32B 1I51A 1Z2PX 4DAEA 3UJ7A 1Y4DE 3A37A 3NTXA 5E2BA 2ZW9A 1N2CB 4RSGA 3HJQA 1A50B 1K7XB 5HJ7A 1LI5A 2ZCJA 5T6MA 1OT3A 2MHCA 3IR7A 1QP4A 1AN9A 2DJIA 4M53A 4GI5A 6CHYA 5LNK6 5TXGA 1P1JA 1EYZA 2SKCA 3MJFA 4GU5A 4HK4A 3IBSA 3JCZA 4BO5A 5JCOA 3MQ4A 1BXZA 1QS0B 1N6LA 5BW6B 3A4LA 2QVLA 1I1OA 1XMXA 3CW8X 4BQPA 4JU9A 4PQRA 3DMGA 1Y1LA 1E6KA 1K66A 1ULTA 3D2BA 4W5HA 1N6NA 1VA4A 1AGRA 4O0MA 3ZHXA 3K92A 2PRKA 4I4NA 2HR1A 2ZJ5A 3B3QA 2GKOA 2Q8PA 3Q8GA 1RCUA 1WW3A 5EZ5A 2XCQA 1JZSA 3THXB 2OBYA 4II7A 5AI0A 2YMQA 1TPYA 2XDAA 4JXXA 4IIDA 2C0QA 3A7EA 2MSEB 4FS3A 1QB7A 2IUEA 3WWPA 2BBWA 1PI3A 4QBIA 1E9VA 1EI9A 2WFAA 1JDSA 3TNDA 2CJWA 3CV3A 4NPAA 1CIVA 2P3SA 4EW1A 4CMIA 1OF1A 5CVUA 1BMFA 3DTVD 1D9XA 4ZV4A 1QH9A 2PX2A 2V6FA 2XMCA 3EVGA 4MICA 2X9LA 1V3TA 5DXJA 5DMHA 3HJTA 5AIBA 3LV8A 3EEQA 4R1NA 4MV6A 1VMKA 4GOLD 3IP6A 3V1NA 3WK4A 2EG5A 3NG1A 5A04A 4FFLA 3O0TA 2GPJA 1OJ7A 1BFKA 3RSOA 1OZGA 1EVEA 2HTFA 2ONKA 3FAKA 4IXTA 3EBLA 5KOHA 3QX8A 3GZJA 2X42A 4UVGA 1JG4A 5JAQA 8OHMA 4EA6A 5K8CA 1XZMA 4ZU3A 1JI3A 1DC8A 1VIVA 2B36A 2GAJA 5FA6A 3CRMA 3H86A 2BKUA 3AB7A 1SXJC 3SMSA 2VK1A 1BW9B 3BRWA 4QA9A 1L2DA 5CVVA 3L0PA 5AI9A 5AK0A 4EPRA 3EA5A 4L1KA 2PGLA 2HB6A 3KT0A 4IQGA 2XOXA 1ZD9A 5SZHB 3C3BA 1R12A 4TSRA 1QGUB 4C0KA 1KJZA 3PFBA 3ZGNA 1WXIA 2CVZA 2GYVA 3GGPA 3W5BA 5FTNA 3ZCRA 4CI9A 4UOZA 1KHTA 1FRQA 1Q1AA 1G6HA 3C16C 3P9NA 3QLVA 3MBOA 5FUBA 4CQMB 2XUQA 1XZAA 4G84A 4OQLA 2YICA 1DJNA 1JU3A 1WA5A 2A1IA 3B6KA 3MUNA 1HY3A 4V2UA 2XCSB 1ORHA 2H65A 2XGNA 2G40A 4DSAA 4U6NA 5F12A 1UK7A 2JGKA 4G4OA 2IH2A 3HCDA 1W25A 2NO0A 5EWJB 5IVKA 4IJ6A 2DBZA 4Q5IA 1GR0A 2HF9A 1QBGA 2R4TA 5MFPA 4X6XA 4MW6A 1NU6A 1ZRHA 4NCKA 3I5XA 4QTXA 3T61A 3A11A 1B6GA 5C1IA 4BGEA 1EWVA 5KYXA 5DLEA 1WZCA 4O4IF 2OGUA 3OHMA 5HZGA 4PBTA 3NTLA 2FRDC 1L9KA 2EJUA 2GTPA 4MVJG 5E2AA 2HKJA 3TLBA 3KXDA 521PA 4O4LB 3UAZA 2EYUA 2P7HA 3MWKA 4DQLA 3AVWA 4ND6A 3PC4A 1E2IA 3EG5A 4LGCA 2J0QA 5BSWA 1OLUB 1B14A 3WHKA 1PJLA 1NVUQ 4PZCA 2WG2A 5BOSB 4XSHA 3ETNA 1VLLA 5LIPA 1NI4A 4WRRA 1VL8A 1R4MA 1SEPA 2CWWA 3EXHC 3M4JA 1IWOA 1Z3IX 2QN3A 1J97A 3UFBA 1A5AB 3DPSA 1JDVA 1KEUA 1AE1A 3PNBA 4JI0M 3IILA 1B74A 4PLYA 2OVBA 2FGKA 2VZLA 1ZAEA 4FZJA 2F5OA 2HHLA 4NRWA 3OT1A 1RYBA 1RXYA 4Q34A 3U6EA 1RKBA 1UDXA 2PK3A 4QGHA 1VE1A 3LTNC 4RJ2A 4RDIA 3ER9A 4PPFA 4Q9DA 4KIUA 4MRMA 2ZROA 3GRUA 1E2GA 1GQFA 3LFUA 9MHTA 2CC2A 3ZTWA 4JP3A 3FX2A 5LOVA 1LW7A 1H65A 5JSQA 4E5KA 4Z9YA 1E3IA 1H2YA 1WDTA 4KW7A 5IKEA 2P4UA 3T7IA 4BAUA 4G37A 2WD7A 3D8NA 2YMLA 1GRQA 1E99A 2F1JA 4P2GA 2JVJA 1UWVA 3R8FA 1XRQA 2NP7A 1OLOA 3CBQA 4P3KA 5BVGA 2RGAA 3M6FA 4F2DA 1Q5PA 1JW9B 3KKPA 5AVJA 1E5XA 3PGKA 4RC9A 3U4MA 3Q9NA 1N3BA 1YZGA 3VJLA 1X42A 5FUVA 1IG3A 3ZVNA 1UFZA 4MQFA 2O3TA 1B8VA 4MQLA 1JSRA 3GLHE 4MJXA 1W6UA 3SXUA 4MB0A 3TQSA 4RKEA 4C7XA 4HJRA 4NMXB 3MOSA 2R47A 1UBFA 5CFLA 3P9PA 3EH2A 3ZJTA 4N39A 1IHOA 1RAEA 3ORYA 2XDYA 4YRQA 5JMOA 4GGPA 4MR9B 5KYTA 1QFSA 1FJGM 5K3FA 1XCLA 1FLVA 3ZY2A 4L7VA 2WJYA 4P4TA 3KKNA 3F6CA 4CN8A 1KJIA 2IY9A 2RHRA 3AR6A 4X45A 2C5BA 3EDRA 2J33A 1G21B 5TV2A 4B4OA 2QJTA 5C80A 1RM5A 4IOMA 3Q6IA 3UKDA 5HBRA 4REQA 4U7FA 4AROA 2ZR8A 1KY5A 4GP7A 4NP6A 3B8HA 4V0NA 2G8LA 1RRFA 5A0TA 3ILKA 3D59A 5DZSA 4ZVMA 1KJJA 1A9TA 4B40A 4IXWA 2WWGA 3DHYA 1JX6A 5AJYA 2JAPA 1P45A 4X7RA 4Z53A 3D3EA 2BELA 2H2DA 2NO7A 4ZO7A 1LC3A 2JBAB 2ZJAA 1M2VB 1GFIA 3W79A 4EMSA 2ISQA 3NZEA 2JFWA 3PNPA 3QYEA 1Y82A 1VDMA 4Q1VA 2V96A 2ZSJA 2E7ZA 1CNMA 1H6BA 1E1KA 2CUKA 1ICEA 3EPPA 1LBHA 2XNDA 2ZXFA 2FJPA 4YHBA 3VI4B 5KYWA 3ZCSA 3TW0A 3AW8A 3C1TA 1M7HA 3H11A 4EYSA 3KSUA 1K6JA 3O1JC 3VDRA 4DR7M 1PX2A 2PCLA 1HNWM 1O6CA 4GI7A 3CVUA 4G3XA 1XQVA 3QKRB 2C4WA 4NJOA 3WQBA 3IVMA 5G3YA 1M0EA 2D5BA 4N3AA 2GPWA 1JP7A 3G2JA 4KK3A 3GRRA 4DG5A 2ZIXA 3E8XA 4ABYA 5HE9A 5HM8A 1W88A 5BWLA 4I8OA 2VP5A 1MB4A 2FFQA 2FX5A 4ZCMA 3PT5A 2NXEA 4G2NA 1PJ4A 3D7RA 1TZCA 5F5XA 3NVMB 1IATA 4E3ZA 2VQEB 3THWA 3AEZA 1Z5BA 1Z8DA 1RWWA 1XELA 1GM5A 3WOHA 4QVIA 2NXWA 3CZRA 3U4AA 5FXMA 1B0AA 4TQGA 1AGPA 4WECA 1KAQA 2B34A 3ELYA 2ZRIA 4JS0A 5ARDA 1KXZA 3NAQA 3LOQA 1HNXB 3HRHA 3WDLA 5CIYA 1WPQA 2XZTA 4X24A 3K53A 3ZHRA 1JZQA 4E15A 1CJCA 1U0RA 3CSUA 1H6UA 4UREA 3KOXA 2P41A 5AW2A 2A35A 3A6FA 4CIYA 4J7UA 3GFBA 4YUAA 1P4GA 1XALA 3KYIB 5LLSA 4Q1CA 4E4TA 1OREA 3FMFA 4JL6A 3H1FA 1DCKA 3AEKA 5DK6A 1X80A 1V8ZA 3BXGA 1XX6A 1M1NB 3P8ZA 5CB8A 3I72A 1KZ4A 1Z4PX 4NYMQ 1IXYA 5C1OA 1IEQA 4BIMA 2PYZA 4AW9A 3RADC 4EWLA 3QE4A 3B12A 4CRWB 1P1HA 3QF7A 1GGEA 1RZUA 1CLUA 1F38A 2BBSA 3LQ2A 4DGQA 5IMBA 5BXQC 2ID7A 2ZS8A 4L2IA 3TW6A 4FYIA 4LF4B 3OWHA 4LVUA 1EFPA 2HU5A 1V5FA 1ZVQA 5DBHX 2H1WA 1FYDA 4MLDA 4EI7A 3LQYA 4EB3A 4B3SB 4RESA 2AG8A 5FO1A 2XMBA 2WQ6A 3U60B 3E2IA 1PNOA 3ZWNA 1LPBB 2OFPA 1X7WA 3OQ6A 4WQMA 3BPSA 2GAOA 5LXTB 3EY4A 1UMDA 5K0FA 2DHCA 4ZARA 1N2HA 4PYNA 3ZVKA 1KIFA 5HUQA 2PGJA 4LZWA 2GBCA 2Q2NA 5HX7A 1GO2A 3Q8LA 5DDIP 2QRUA 3TRJA 1JIKA 4F45A 4KV7A 3N2EA 1T9HA 5LZ9A 4DV0M 3ILVA 3UGJA 2X0NA 1BD4A 5L51A 5LNK1 4XYMA 4LSWA 2MDTA 1WBDA 1NNJA 2W98A 4X7PA 3ROMA 3MHVC 1G0OA 1RHMA 5TRTA 1YJ8A 1Z0DA 3UICA 1U0TA 5BYAA 4JSTA 1NF9A 2IOHA 4WLVA 4DM7A 1IK4A 2NUPA 1JEYB 3L7OA 1T6NA 1P75A 5BORA 4RVUA 1VZ2A 5JS2A 2QD4A 5T8KA 1VPLA 3RS3A 3V7NA 1EUCB 2PS3A 3RD5A 4YT4A 4YCJA 3HVRA 1JHYA 4ZYZA 5L3QA 1OC4A 1N2CE 2Y9MB 1O6BA 4ZVVA 3EC2A 2R86A 3TMKA 4DR5M 3AY7A 3O83A 4PHGA 2FKNA 1R18A 1MZVA 5J59A 3WV4A 1MUUA 4YP6A 1N3YA 4LXYA 3VVCA 1HT0A 4B3BA 2XWSA 4I08A 4DNXA 1PSZA 4MVWA 4FFBB 4MW0A 3NTOA 3ZYCA 3JALA 5LD2B 2X7XA 1QORA 3Q5DA 3VGJA 3KQUA 2OOSA 3CVWA 4I1IA 4FR0A 1V1RB 4H16A 1G16A 3G2PA 4JB2A 2C0PA 1XFAA 3ETEA 4ZI7F 2H1SA 4UARA 1N0WA 2IU4A 4W9MC 2E4UA 2GLXA 3I3OA 4EECA 2ESRA 2PRYA 4RMJA 4M1ZA 3KPYA 3RSFA 1TKAA 2V1CA 1KO8A 3K2BA 3I4LA 2HDHA 3ZWDA 4CLXA 5LB4A 3L8MA 1N33B 2UYOA 3H65A 1MX1A 2EKPA 1ZXXA 4C0BA 2VYFA 1JTVA 4PD2A 3KYCA 4R2MA 4IL5A 4LC9A 4IH9A 5BN5B 4D46A 1RVV1 3MZ0A 2WAYA 1CDEA 4NDNE 1CQIB 3ZCXA 3L41A 3NBAA 4KXWA 3GMSA 3LUCA 3M5PA 3L0YA 3VJKA 4BNVA 4OK6A 3E3NA 2WJPA 4U6SA 3BMNB 2WG1A 1ZK1A 2EIXA 3AOEA 3EVFA 3D5TA 4JLAA 5MDHA 1KZ6A 4URFA 3HI6A 2Q21A 3RTDA 2PA0A 3Q8KA 4F9GA 3LYAA 4DT1B 3ANLA 5JC8A 3HM9A 3OPMA 3OQVA 5JAPA 4G65A 1TJPB 1NW3A 2R2GA 1N2ZA 1KAEA 4JKYA 4DMUB 3HFGA 5KNCD 3ECAA 1YDHA 4IXNA 3KVNA 4URHA 1NQ5A 3VHXA 5GOZA 2ZIGA 1T36A 4I5IA 2P8SA 3B60A 4YRFA 4FWTA 1Z5UA 1VP3A 4OMFG 2OM6A 4C20A 1S02A 4B9EA 3EGOA 1WUKS 4FJ1A 1FDTA 2A9VA 4EPWA 1NU8A 5AK4A 2A5GA 4KZPA 3S6JA 4I1RA 1ZLYA 3HKPA 4N6NA 4EAQA 2XRZA 3T1TA 1IN6A 3AXTA 3EZLA 5EXXA 1AN0A 3H6HA 3DNPA 2R44A 4URVR 2LCQA 4EFDA 4C7KA 3IXMA 5BNWA 2AI2A 5EC8A 1VCMA 4LJSA 4EYOA 2FG5A 3H42B 5D8DA 5FPSA 5CYOA 4NESA 3QLUC 2DTEA 3BE8A 3TTUA 5JAOA 4TXMA 5KPRA 2LPMA 1LVHA 1MD9A 1U0GA 5BNTA 5CBKA 4PSCA 3GLSA 4TV9F 3C48A 3IVGA 2FDCA 3CEMA 3HXPA 4A27A 3EQ2A 3GJRA 3K0FB 4NYJR 4XVCA 4D8XA 3W77A 3THGA 3JRWA 3VPFA 2D5AA 3IP9A 3MCWA 3C98A 1C9JA 4QDJA 1V8PA 2IBTA 2GWRA 5THKA 4YUWA 2LGJA 3KZKA 3FTCA 3BRQA 4KO2S 2YWDA 4UNIA 4QPJC 1BGVA 2G3YA 3MTBA 1DG1G 3QNWA 4JNKA 3FPEA 1JWLA 2OZLA 4EGSA 1GL6A 1V5IA 3MWEA 1G8KA 4HL6A 2HMUA 3GA7A 3FOZA 3ETJA 4MKHA 4EJ6A 3W5IA 3H1TA 5DNAA 1ZH4A 1NTOA 3EYAA 5I8WA 4I1PA 4B73A 1K88A 4MQEA 2ZDHA 1UPXA 5BPVA 1TF5A 4CEIA 4GSYA 1E9BA 4XRRA 5AVKA 4O2BB 3D7NA 2DENA 1HETA 3JARA 3W4IA 1QC5A 3LKZA 3GAMA 3W68A 1OWPA 4O1HA 3LM8A 1JEAA 1WHTA 4NV3A 2D5CA 3HJBA 4XYBA 4W5WA 2RMKA 4W4TA 2GA9A 5ESWA 3NBZC 4Z4HA 4XYGA 4R9SA 2Z0MA 3ENWA 1SA0A 1WV1A 1B43A 3QWHA 1IUKA 2DQZA 3IIIA 2V7GA 1YFJA 2R1VB 4BTEA 4K8OA 3E58A 4LWOA 2O5RA 1MTZA 1QCZA 3KAPA 3G85A 1ISHA 4QEKA 1PGJA 1C81A 3Q10A 4BLVA 3UCXA 1WF3A 5ARBA 1KETA 5GGXA 4IDCA 1W4AA 2PL9A 2RONA 5FFMA 3VPHA 3QEMB 3FZQA 5ALVA 1M2FA 3U3OA 2R65A 2WG0A 1ZGAA 5IVHA 1XPOA 1GZSA 3WQSB 1IHDA 2FCAA 1W0JD 1B23P 2ZWIA 5H4GA 5FWNA 3HU3A 2XYVA 4LG2A 3WLPA 4ZCQA 4C7BA 2DFNA 2ZB2A 4IV0A 1BQ3A 3B3AA 1G5RA 3QLJA 4MV4A 1TAQA 3A3NA 3PDWA 3T5CA 2XZUA 3SLGA 1P7PA 1T4GA 3P4XA 2QK4A 1PZEA 3USES 2FNAA 2D2VA 5ANRB 2JIPA 2B4RO 3IB6A 5GONA 1DIGA 4Y6LA 1R5JA 2FPIB 1P5HA 2Q5IA 4GZ5A 3AFMA 1P5RA 2HO4A 3HBLA 4B31A 3HZJA 5KNBH 4TT8A 3LXXA 4PTZA 2ATEA 1KS2A 4K28A 4Y2UA 1FP4A 2YXDA 4AZSA 2LTAA 2YHAA 1U4NA 1I7QB 2L82A 4NMWA 1BSVA 2G0AA 2XA2A 2PMDA 5CK4A 4D8UA 3G0GA 5IDVA 1TDZA 3RCBA 3IA7A 1LS6A 1N2EA 1U63A 2BJVA 4ITUA 5J2UB 2XMPA 3STVA 4C4XA 2O52A 4N8EA 1UPTA 3QE0A 4PPNA 4I3FA 3DMNA 2F1IA 3KQTA 3LX4A 3FHCB 5K3SA 3DTVA 2M60A 1EWRA 1W35A 5CTJA 3GJQA 1LI4A 1GZ5A 2R3SA 1X1AA 1E7WA 4HGRA </