3H4MA

Aaa atpase domain of the proteasome- activating nucleotidase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-activating nucleotidase
publication title Structural Insights into the Regulatory Particle of the Proteasome from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3h4mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h4mA01
5BN3A 4PC3A 4AY2A 3AM1A 4AKHA 4HDCA 4B44A 2GXQA 5JMTA 3IPYA 4LCBA 3QBTA 3GJ8A 5DE3A 5FH9A 2QI9C 4PXAA 4V0NA 5J4KA 1QHHA 1K6MA 2IXEA 1G8FA 3H86A 2ORVA 2B7CA 2Z4RA 3JVVA 1FOEB 4LUCA 4MH0R 4TYNA 2Z0MA 2H7VA 3EZ9A 3TUJC 1WQ1R 3AQ4A 2OSBA 2J59A 3CRQA 3I32A 1NVMA 1Q22A 4IVQA 1SXJE 1MOZA 3K0SA 5HCNA 2RGGA 3TMKA 1XJ0A 4BFYA 1TQ4A 4DDUA 5BXQC 5EE9A 5J47A 3I92A 1SVWA 2P2LA 3N5CA 4FCVA 1QG4A 5JWHA 1OKKA 2G0TA 5HKKD 3Q5EA 5LB2A 4AK9A 3ONWA 1HUQA 4NBSA 3W3ZB 1I4TD 1E2EA 3Q8XB 2CLCX 1NVWQ 3GFOA 4K46A 4CEIB 1KIMA 1NMZA 4LHYA 1WDTA 2CE2X 3VX4A 2C03A 2QU8A 2ERXA 4JIMA 2QPAA 2P5SA 4Q1DA 5G53C 2AK3A 5EP1A 1KSHA 1T9HA 4P4TA 3W8NA 3SJAA 3ZIAD 1OB2A 3HU3A 5HE9A 5F3WB 1YRBA 2XSZD 4PC7A 1J8YF 4Q4HA 3LX5A 2J0QA 2K5UA 4KSBA 1E2DA 1W36C 3OHMA 1MR3F 4QNMA 3KXKA 1CIPA 4JBXA 2PT5A 5E7IA 4BFVA 4C7OA 5F2EA 3V4FA 4HAZA 1G20E 4AG6A 3CRMA 4TWZA 5FPKA 3ZZ0A 3BERA 1JR6A 1CR2A 1U0HC 4RZ3A 4XVQA 1ZRHA 4TQ9A 3SNHA 4BFUA 4MRNA 1ELOA 2Q3HA 3MLEA 3EA5A 3CNOA 4W7SA 4DLZA 4A36A 2BC9A 1KO4A 1E79D 5DI3A 2A5FA 1XPUA 4TMVA 1EG7A 3DKPA 5JHHB 4HLUA 1VIYA 1WXQA 1Z0FA 4UQOA 1VG0B 1T5IA 2I1QA 1KZ7B 3SYNA 4LSGA 5DO9A 5AUQA 4B43A 1G8HA 1ZNWA 3SQWA 4OHVA 4OHXA 1R0YA 2ZS7A 2GK6A 5KDLA 3K1JA 5IRCD 1W5SA 2NG1A 3EARA 4DCTA 3VNVA 4JMPA 4DSOA 3D3QA 1UM8A 2NO0A 2QP9X 3LVRE 2O8CA 2OLKA 3SS8A 3GPLA 3HR7A 1Z0KA 3GJ0A 4QGFA 3B13B 4HAWA 5EZ5A 3LXRA 3AGPA 4V02A 3W5JA 4Q4HB 2QMHA 2ZRNA 3FFAA 1DOAA 4A2PA 2B8WA 1TAGA 4MDEA 4QM6A 2NPIA 4A3VB 1R6BX 1XFAA 3THOA 4CVNA 3E70C 5KTYA 5D3MB 3GEHA 1E0KA 4HZUA 1KI2A 2ZS8A 2RKOA 3RC8A 5KSYA 5GVRA 4CT4B 4DIEA 2QBYB 3JZMA 4MGKR 2DFTA 2QEQA 2FG5A 1GL6A 821PA 4KHZA 4JLAA 3FMFA 2W2TA 3H4MA 2BIFA 1JQJC 3B85A 4UNSA 5JCZA 3SZRA 4US2R 3U3JA 3G0HA 2J9RA 5FPYA 3EAQA 2IUSA 4LPSA 1OFIA 3B1ZA 4K8OA 1VCOA 2RMKA 3U3MA 1W4CA 4WIAA 4JN6A 2VP0A 5EQTA 4PQRA 2QMOA 4ASUA 3PENA 1N6LA 3AP1A 1TEVA 1XZPA 1HV8A 5KNDA 3U6KA 4Q9LA 4XJXA 3RRMA 3ETLA 5G3YA 1ESNA 1FZQA 4P4UA 3T1VA 2O8CB 4E09A 2VLIA 3VTKA 3AGQA 2KB0A 4HAXA 4C0LA 2D7DA 2DHRA 4GZMA 3TQFA 1RPZA 3Q72A 3FB4A 4B3DA 2CHGA 5JSZA 2IXFA 4L16A 1S3SA 1AM4D 2V1XA 1P61B 4KFUA 4M21A 1E9DA 5EXTA 4CEHA 1P62B 1PJRA 3B7GA 3CONA 1XMJA 1AKYA 3SBEA 1YVDA 1CU1A 2QRZA 2VO1A 2ODBA 3GLGA 1DTSA 4NYIQ 2AKYA 2ZS9A 4HZUB 1U94A 1Q1EA 3TJZA 1OKKD 3E1SA 1NRJB 5CB8A 2JCSA 721PA 3CB4A 1XTKA 5K8TA 1D2MA 2BJWA 3OFNA 4RD6A 3T15A 1SVOA 3NG1A 4R98A 2WKRA 4FMBB 4KLZA 4KODA 5B57C 3M4YA 3ADDA 2X2FA 4PC6A 3IDQA 1OIVA 5GJVC 4PQYA 4W9MC 1MO6A 2CLSA 4G5QA 4XVRA 3G5UA 4B35A 2JLSA 1NJFA 2FFHA 1NVXQ 3VR1A 3WRXC 3KQHA 4EAQA 5GJBA 2XB4A 4KO8A 1XD8A 2HF9A 2QQ0A 2RGNC 3KUDA 5EP3A 4AD8A 4WZBE 4BLPA 2BJVA 1E32A 1UKYA 1YZLA 4TMXA 1US8B 2X2EA 2CEAA 5GJCA 4BGDA 4GMDA 2O8BB 3SI7A 2AWOA 5IK2A 3T12A 1KAGA 3FMIA 1QVRA 1SXJC 2A3RA 3EX7C 2FSFA 4TYWA 3BBPA 3BD9A 4NONA 2XNSA 2EWWA 4B6FA 3K70C 4D82A 5JSZB 3VR3A 2J3EA 4Q1AA 4I1OA 2F43A 4LBVA 5H68A 1H65A 4BQSA 1FUKA 3QXCA 4CEHB 5F98A 3N2IA 3SQXA 3IEUA 3VAAA 3BFXA 2JIZA 1CR0A 3C15C 1CJTC 2AXPA 4RKEA 3GLGB 4M1YA 1F2UA 1G8PA 3AJIB 1ZIOA 3FDIA 5EUMA 2BCGY 5HE8A 3JZAA 3AVVA 1OFHA 1XZQA 421PA 3M1IA 2LCFA 4OQLA 2H17A 4A8JA 3HPQA 2DWPA 1TL7C 4Q9HA 2CJWA 1FPMA 4LBWA 1UDWA 1EESA 4GL2A 3SN6A 5JI3E 4C0AC 5B2ZA 1WE2A 1NP6A 2AXNA 3ZZUA 4LHZA 4Q48A 5P21A 1QBKC 4KI0A 1L4YA 2HT6A 5EE1A 3BJIC 1NKTA 3UXMA 2R62A 1P72A 4DCSA 1UPTA 2CHQA 1OXVA 1OHHA 3RYTC 2AKAB 4W5HA 2BBTA 5BN4A 1KJZA 1Z0JA 4II7A 4Z8YA 4ERNA 3I61A 3U61B 2V6JA 3BWDD 3B8HA 2ZITA 3AKCA 4GRAA 4QJ3A 2YNMA 3A37A 3QY0A 4QKQA 1ZNZA 2WOOA 5K8IA 1LF0A 1HQYE 1E1RD 1WF3A 3C14C 4IOJA 2PJZA 1YR9A 2ZREA 1G4UR 3W6NA 2R6CA 1Z06A 2GKSA 2F43B 2ZE6A 1P5ZB 2ODNA 1KI7A 3B2EA 4U00A 3U7EB 4B3XA 1GFIA 1BOFA 4TMWA 1RJ9A 4LRSA 1U8YA 3MUFA 4URWR 1AGRA 1DAIA 1KGDA 1F2UB 1NY5A 4QJ5A 1JPNA 3UATA 4URUR 2QE7A 4LJAA 4FINA 3ZS9A 2KJQA 2O0HA 4IRUB 4A8JB 3AVOA 4BEJA 1LFDB 2H18A 4ASUD 2AFIE 3B1YA 2CJWB 3O8BA 4C0KA 2EFGA 2G1KA 2JA1A 3T1OA 3PUVA 4KLNA 3W9YA 4EPRA 5ELXA 4JLJA 4YMSA 3WYAA 2O5VA 4ARZA 2P65A 4A92A 4R9UC 2D3WA 2ZJYA 4DDVA 4A2QA 3OIWA 1GITA 2ZRBA 4A0GA 1GAJA 4F4JA 1Z08A 3MSXA 1RZ3A 1T3LA 3LQRA 5AJXA 2VYFA 3K0CC 3P4XA 1VPLA 4NCNA 2NPFA 5FL3A 1YZKA 1N2CE 4UJ5A 3FKSA 1F6BA 5B58C 2A30A 3TKLA 1XCMA 1UKZA 4LPKA 3KX2A 4D80A 4C0HA 4D4KA 1IN4A 3VKHA 1TADA 1SULA 1RRPA 1OIXA 3CO5A 4ZKDA 2PMDA 3GJ5A 4S2EA 1O87A 2WTUA 2ZJ5A 1PUJA 4GFDA 4QC2A 1XEXA 2QA5A 4P31A 3TIFA 3LO5A 2DZOB 1T4GA 3U6BA 1QHNA 1X3SA 3OFND 2A78A 4LZZA 3DO6A 4FMCB 4M53A 4DCUA 1RRFA 3CH4B 4DXAA 3RAPR 1KAOA 1HH4A 4I4LA 5L3VA 2G88A 4HLQB 2ZYTX 4PAOA 4JJKA 1KSGA 1SHKA 1F60A 1T3HA 3U3KA 4LYFA 2QROA 3IUYA 1OYYA 4BLOA 1C1KA 4YMWA 1CRQA 1R4AA 1JXMA 4B2LA 4L4UA 2PZEA 1Z22A 4Q21A 2REOA 5UKDA 4B3CA 3MD0A 4PX9A 3K9NA 3TRFA 1SKYE 1D9ZA 3UK6A 1DBSA 2JASA 3MGCA 1LY1A 3UMSA 1OF1A 3KFXA 2R6FA 4ARZB 5IK2D 2FN4A 1QRAA 2EQBA 3AKEA 5CJ2A 3RRZA 3GP8A 2KBEA 1G3IA 2VH5R 3W90A 3QVUA 2BBOA 1GP2A 4B3GA 3LW8A 1NN5A 1XWIA 4ABYA 3GJXC 4ESVA 1FX0A 5EP4A 1MRNA 4LJ4A 1E9CA 4LHXA 2QUZA 3MRSA 2AL7A 1GIAA 4M9ZA 4NMMA 5KSZA 3KDSE 3QE0A 3QF4B 1OXUA 3HWSA 1VYVA 1UAAA 2JIZD 4LJ5A 4KFSA 4BFTA 1S8FA 1PUIA 2PX3A 5J5CA 3EA0A 1LS6A 4CEJA 4TLEA 2Q6TA 5TDHA 4DSUA 1XEXB 5KPDA 2EYUA 3NC1C 1SZPA 3BOSA 1G17A 3U7HB 2JGNA 3GLGE 5H70A 2BEJA 1CULC 2F1IA 2ODEA 1E4VA 4PSAA 4PR0A 5AUNB 1NSFA 1KI4A 1ESMA 2V54A 1IOZA 1QHYA 5HTKA 4J0QA 4L9WA 2FFBA 2YINC 1YR6A 2DWOA 1YU9A 1W1WA 3CX6A 4QJ4A 4XH9B 1IJFA 1ZM4A 3ASYA 4DSTA 1OHHD 4RSGA 4ZCLA 3ZGXA 3TVDA 1GVNB 1IY0A 2IYZA 3B6EA 5AJVB 1KJYA 2YWEA 3ADBA 4WXPA 1DE0A 1S96A 1G19A 1XMSA 3RABA 2IWRA 1I2MA 4H1VA 2AD5A 4LC1A 1HEIA 2P67A 3I5YA 2WVJA 2WWWA 2WHXA 2LKCA 1DG3A 1VECA 1E2QA 3MWLA 4B2IA 3OEEA 4X8OA 3PUYA 3WMGA 3GJ3A 1Z6AA 1FX0B 3BFKA 1KK1A 1GDDA 1W0KA 4QG7A 4OQFA 2Z4SA 4DLUA 2GXUA 3DPUA 4LWZA 1JXOA 2R2AA 4PAMA 3TLXA 3AF4A 2EW1A 4FWHA 3UMFA 4CEJB 3N70A 1XXHA 1GL9B 4FW9A 1RRCA 2A5YB 2NZJA 2WJIA 2F3TA 4UNQA 3UWKA 2H5EA 4OK5A 3U2QA 1IXZA 4BASA 4ZDIA 2BM1A 1N6IA 1E2FA 4AYWA 2QM7A 2PCJA 2R6DA 5LD2C 2HUPA 2Z5FA 2PH1A 1S3GA 2KSQA 3LRPA 3K0CA 4PPNA 5J4HA 1EGAA 2A2ZA 1D6JA 1L4UA 2C9YA 2GBLC 3CRVA 2IS6A 2FA9A 4UJ3A 1S0UA 1LVGA 1IHUA 2O8DA 1KDOA 2WMNB 2H1LA 2QORA 3ZVLA 4KSCA 4ITRC 4BFZA 2BWJA 3FKSD 4LY6A 4LOAA 3RSLA 2FFQA 4BLQA 5J4LA 1TEXA 1KYIA 3I62A 2G83A 3NDBB 1N3BA 1E3MA 1X86B 3CNNA 3FFBA 1SVMA 1UBGA 4NZYA 1MO5A 4DKXA 3EIEA 2MMGA 4CGZA 5FTJA 1KDPA 2QN6A 3UPUA 4HLUC 3DOFA 4EIWA 2ASEA 3RS4A 2VTKA 4DT1B 4URXR 1UEIA 1NLYA 1YHNA 3ICQB 4RZUA 1OT3A 2D4HA 2J0SA 4R2IA 1GM5A 2O52A 5L8VA 5GJWC 1XXHB 3PEVA 3FPAA 4RD2A 4N1AA 2IUUA 4FCTA 2Z6VA 3AF3A 4LK2A 3KKQA 5BYJA 4GDFA 1DAFA 2PT7A 2V6ZM 5K8LA 4PQFA 1Z8FA 4EPYA 3M6AA 1ZW6A 1IY1A 3EZ6A 3NXSA 1Z0IA 1I4LD 2YWHA 2HCJB 2J1LA 2W00A 3QXJA 3L8YA 4UXJA 2R65A 3HR8A 1NMYA 1S2MA 3PUWA 3DKVA 3NHBA 5IF9A 5CM8B 2Q0HA 3L0PA 3PQCA 4IVRA 5CDFE 2JJ8A 1E0AA 4WZ6A 2CXXA 1R0ZA 2OG2A 2KWIA 4BECA 4TL8A 5FPTA 4LJ8A 1Z07A 5GADl 2XTZA 5EJEA 1IXRC 4QGHA 1BIFA 4E22A 5JWOA 4HB2A 4BZQA 1NVVQ 2C95A 3CH5A 2QZ4A 2NO6A 3Q3JB 3PR1A 5LB4A 2HXYA 5K8UA 2YWGA 2IYXA 4KBGA 2VF7A 3GLFA 3U3RA 4YXWA 2BVNA 1HT1E 2HDNB 3C41J 4CEIA 1M8PA 4UXHA 2X77A 2FSGA 1TF7A 1NL3A 4B3FX 3FVQA 3EPKA 5FBQB 5CB6A 1I4DD 1Z6GA 1TX4B 1CKEA 1P6XA 2HLDD 4GSYA 4ZCMA 4DDWA 3AVQA 3L82B 1Z0AA 3TUIC 2ZTSA 3RHFA 2ZR0A 4P0TA 3FTQA 1P75A 1F2TA 4NCHA 2F9LA 1AZTA 2IT1A 2WAXA 4DC9A 3PXGA 2IS4A 5E95A 1M1YE 4A2WA 4OJKA 2W0MA 4L9SA 1CXZA 3GD7A 1DEKA 4B73A 4KV9A 3UIEA 2GCOA 1XP8A 2BDTA 1DARA 1XB2A 1LB1B 1EFTA 4B6EA 2WM9B 2GVZC 1T0HB 2DWQA 4H1UA 4Q1BA 3I73A 3VQTA 1GKUB 2OEPA 2QGNA 4YMUA 3P1JA 1G5RA 3F5FA 2WMOB 1CP2A 1JPJA 2ZSEA 3EPJA 3BK7A 3R9XA 1AJEA 3OAAA 1A1VA 2RAPA 3SOPA 3OEED 4D4JA 3SFVA 1EFHA 4CIDA 2JJ1A 4IDNA 4WW0A 1GNPA 4AIIA 4CT5A 3L43A 1XMVA 4IDOA 4KFRA 2W58A 1OJLA 2EYQA 1U99A 2OESA 3QPUA 1W0KD 3E2IA 2GAAA 4D81A 3GLFB 4QOSA 1SKQA 3LVQE 1AN0A 4S35A 4I1VA 2VHQA 4G0NA 4DBLC 3ND8A 5CJPA 1M7GA 2GJKA 2GJSA 3D7MA 1ZM7A 4HDQB 1W4BA 2AX4A 1JJ7A 4B3BA 3KXLA 1IN6A 5EXSA 2FE4A 3RNLA 3O8CA 3HJNA 4EFLA 1R5OA 4KXFB 2WOJA 3V00A 3KTAB 4B33A 3OE7A 4MUAA 1P9RA 1F2TB 2RHDA 2HT1A 4H9GA 4IDPA 1Z29A 4UNRA 2GBLA 3THYB 4Q00A 2O8EB 2IXGA 3PCRB 5KNBA 1ZD1A 4LV8B 1JALA 3DMNA 2V1UA 4TTPA 2QMEA 1P7CA 1NF3A 2GCOB 1BKDR 1M7HA 1FMLA 3DDCA 3OIUA 2DPXA 3QKSA 3WNBA 4G5OA 5D3MA 2BMFA 2YV5A 4RFVA 1R10A 1V5WA 3SEAA 1GWNA 1LS1A 3GJ6A 4TSFA 4IEEA 3LH5A 8OHMA 3PITA 4PC1A 5G41A 2GXSA 4EPVA 4OI4A 3KFVA 2R8RA 5JI2E 2DY1A 2QBYA 1JQLB 1G41A 2IHBA 2JATA 4C0SA 3CWZA 5FTMA 4Q4JA 2I4IA 4TMZA 3VHLB 1BYIA 2XXAA 1G18A 2HYDA 3BAFA 4CYMA 4EJSB 2NGRA 2Q9BA 3K0FB 1FTSA 4TQAA 5G40A 4EKDA 1G5PA 3HU1A 1VHLA 2ORWA 3B9QA 4RD0A 3KKPA 4AKGA 1PZNA 1IXSB 3BH6A 4A8JC 1G21E 1P73A 1G64A 3R9IA 2J0UA 2ANBA 1QHXA 2CL7X 5LD2B 1AA9A 1WMSA 1K8RA 5JS7A 2YOFA 1XXHE 1YZGA 3GFPA 1I2DA 5DYIA 5HR5A 4W5WA 2FGKA 1S1MA 5JBQA 2IYVA 2XX3A 4V03A 3VFDA 4DHEA 1DG1G 2KE5A 3KKMA 2F7SA 3PJRA 3OESA 3ZVRA 1ZYUA 1MKYA 2OLJA 3QKSB 4TL6A 3X1DA 4JYCA 4OBEA 4GOJA 4XTCS 1N5KA 1AZSC 1KO5A 1E1RA 1MV5A 1D5CA 1JI0A 3HP1A 4RCZA 4Q1CA 1DVRA 1Z5ZA 4PHFA 4EDHA 3WY9A 4MRVA 4QBIA 4ZI3A 4OI0A 5FTLA 1KI1A 4YXWD 2QGZA 4PSKA 1W48A 4FWIB 1KY2A 3CF0A 1G7CA 2P0EA 3WHKA 1TUIA 2FGJA 3AF2A 4L8GA 1XCPA 2WIAA 4Q4JB 1RKBA 4YONB 2OO7A 3K9GA 3SBDA 2GCNA 4DLVA 2ZE7A 3NBXX 4HUTA 2XXAB 5CK4A 1X6VA 1FNNA 121PA 4TYPA 3X1WA 2EFDB 1GNRA 1LF5A 1XNJA 1E9EA 1GUAA 2GWHA 3BE4A 3R20A 4NPHA 3QKTA 4HAYA 4Z51A 2OBLA 2QQEA 3LBIA 2ZQ5A 1US8A 4RJLA 4ACAA 5EXXA 1Z2CA 4D0NA 2YKGA 4C2TA 2O8BA 1U8AA 1IONA 3NWJA 3LWNA 2J0UB 3KJHA 1VKJA 2ZYVX 221PA 1U8ZA 3VHXA 2VSOA 3BXZA 4EQ6A 3IBYA 2XZOA 2CNWA 1RC8A 1XBTA 2OFWA 1XTIA 2WICA 1U98A 2GDJA 3QIAA 3U3OA 4Z54A 3G82C 3EPHA 3AF1A 3IGFA 2SHKA 4AURA 2BMDA 1QVAA 1V43A 2JLYA 4IHQA 3SHWA 2GAOA 1K5GA 3OAAD 4AC9A 1AS0A 4A9AA 2J45A 3NEYA 3EXAA 1UJ2A 2FEMA 2ERYA 2JJ1D 4TQUS 4JLDA 5C46F 4TMKA 3SFZA 3B78A 3GLHA 2CVHA 3T1TA 4D26A 2BMEA 2CCJA 3EASA 4MYUA 1PVOA 3DL0A 4AKEA 1ZBDA 4CF7A 2ORIA 2ZUDA 4ZDWA 2E9SA 4QGGA 1ZVQA 3MMPA 1RW4A 2PL3A 3A4LA 1FNMA 4BLTA 5E7MA 4Q7MB 1AQUA 4M1TA 4LYHA 2PZGA 4RD1A 4DLXA 4OJQA 5KUTA 3GLFE 4O3MA 2BCJQ 4JL8A 4FI3C 3KJEA 3NBFA 3TK1A 2A5GA 4Q03A 3OE7D 2FOLA 1GL7A 1S9HA 3CWQA 5FUYA 4KCGA 1W7AA 1CF4A 2ZRKA 1VDZA 2OHFA 2ZRGA 4A0HA 4LBZA 3RWOA 1CLUA 1KO8A 3NHAA 1KMHA 4OKSA 4V0MA 3THXA 3MG9A 1T8TA 5DI9A 4EQ6B 2OXRA 5KO2A 1T8UA 4IJMA 3CIOA 1E2LA 3L0IB 4HDOB 5J4VA 3RLFA 5AK0A 1GG2A 2HXSA 2WWFA 4TSFD 5KU1A 4DJTA 4LJ7A 2IF2A 4KITB 2C98A 4GT1A 2C96A 3LLUA 5KSPA 2HEIA 1CJKC 2RHMA 4FMCF 4D4MA 2ZI6A 3IBGA 3BB1A 3CZQA 4HAVA 3DM9B 3GLHB 1EK0A 3H1TA 1PLJA 1WCV1 1G6HA 1T6NA 1KI3A 2OAP1 2J7PA 4RFSA 4NHOA 3SJBA 2JLWA 1EFCA 3FHOA 5DN6A 4NU0A 4M1MA 3CM0A 3OEHA 1E96A 2QENA 3TGPA 4C4PA 1VYTA 3DEFA 1G8YA 3QXXA 3T35A 3BB4A 4KYUA 5CIQA 4YMVA 4QBFA 4TT3A 2MMCA 3GMTA 2ZUCA 3S1AB 2NMVA 3T5DA 2IC5A 2Z83A 4NYMQ 3B60A 2CDNA 1HURA 1Z2AA 4OHWA 2OCBA 1XX6A 4URZR 1AGPA 2ZI4A 3PFIA 1OPXA 2B8TA 1ZJ6A 2BOVA 5DHAA 2NO1A 4OHYA 1E2KA 3UG6A 1IBRA 4GI7A 2B92A 2JEOA 1XD9A 3ZD7A 3A4MA 3AP2A 4WA7A 1KMHB 1XEWY 3THXB 3C4JA 5AUOB 1XD2B 1XPOA 2C99A 4MKGA 4DLTA 3DM5A 1DAEA 4M1OA 1OH7A 2FF7A 4A15A 1ZAKA 2ZJAA 3AKYA 2QTVB 1SVKA 2HF8A 3R9WA 1P60A 4KAXA 3RRYA 1RYFA 1BMFA 3WXMA 4A1FA 1U81A 1Q57A 4F91B 4FXPA 4PHHA 4ZDKA 3GLIA 4NTZA 5L3SA 5FR1A 1SGWA 4L5BA 1ZUNB 2FSIA 4BWYA 4OL0A 4Q4LA 2IYSA 2QMUA 1P2SA 1ZC4A 3SDZA 1E9SA 3LV8A 1YQTA 3NTUA 2D7CA 2FZLA 1WA5A 1JNYA 1JEDA 1OLOA 2CL6X 2QT0A 4RFSB 2GZDA 3HPRA 3P20A 5CDFA 3A6PC 4Q02A 3F0TA 2EVWX 5FOXA 2RGAA 5JRJA 2GA8A 2DFNA 2PX0A 4IW3B 5E4FA 4C0QC 1FW6A 2JAQA 2Q3FA 2QPOA 4TLAA 4YLGA 4ILEA 3NIBA 1YRAA 2CNWD 1KKMA 2G77B 1E2MA 3REFA 2BKUA 1QHSA 2E87A 1KJWA 1UEJA 3PUZA 2ZE8A 1KTVA 2IYUA 1AS2A 1UDXA 5FFMA 2B6HA 4NYJQ 2GEUA 2GK7A 2D2EA 1ZCBA 4M8NE 3QF4A 5L3QB 1NIPA 5C18A 3AVWA 2CE7A 1CJVC 2OCPA 4JT2A 4C30A 1ZIPA 3TSZA 1MRSA 2FNAA 1NBMA 2JLQA 4LI0A 2IYTA 4JJZA 1NY6A 4C3ZA 1WP9A 3EWAA 1LV7A 2OCAA 1II8A 1JECA 1A2BA 3AB3A 5AJYA 4DRZA 3PIRA 4POAA 4F92B 1PV4A 4JLBA 5FL7A 1Q44A 4XD7A 3GLIB 1COWA 3UKDA 4JSTA 4DLWA 5L3SB 1G7SA 1DO0A 4HEJA 1OH6A 1C9KA 3PG5A 4FCWA 1KDTA 3DZ8A 1VMAA 2YZ2A 3ADKA 1Y3AA 5CITA 2AFHE 4URVR 3LXXA 4M1KA 2OBMA 1OV4A 3NC0C 3FHCB 1QHIA 2ZR7A 3KUCA 2I3BA 2CL0X 2ZRMA 5CLLA 2ANCA 3I72A 2CBZA 3QI2A 4GOXA 1PLKA 2QAJA 2OBNA 2GESA 3IO5A 4ON9A 3SJCA 1DAKA 4GMXA 4ZCIA 2VBCA 3LBNA 4JL6A 2TMKA 1Y63A 4CW7A 5E3HA 1YR7A 4ZDJA 2IYWA 4JZKA 4D2IA 3ND9A 1MO4A 3WMFA 4JBYA 2C8VA 3RS7A 1R8QA 2VEDA 4YC7A 3CUEF 4NCKA 4R2HA 4ESHA 2QY9A 5E7JA 1QZMA 3IIJA 4MITA 3I8SA 2VHUA 1HYQA 4TLDA 3H84A 4E03A 2FPKA 4Q7KA 3CR7A 4MYTA 4AWXA 4TYYA 5DLQC 2HLDA 4M0LA 4PO8A 2ZI3A 3AVTA 3ICEA 5C4MA 4YMTA 2VHCA 4P3YA 2WZQA 4MRRA 1II8B 3GLHE 2XNDA 2J7PD 2ZROA 3FYHA 5C4GB 2FSHA 5DN6D 5HPYB 4OQXA 3R8CA 1N5LA 1UBCA 3OEHD 4BLSA 2JJ2A 4WBSA 2J7KA 1KO7A 1KHTA 3A36A 4ZPXA 2GXAA 1HY3A 3WP0A 2PCLA 3THWA 4TT3D 1ZU4A 3TR5A 1F3OA 2V9PA 2QAGC 4O25A 3R8FA 1BS1A 4KFTA 2C5LA 2GJ9A 2IEYA 4NE2A 2ZJBA 4RKFA 3KXIA 1Z6TA 2XJ9A 5TXGA 3TR0A 3U7FB 2F1HA 3OIYA 3SE0A 2WPDA 1JAIA 2MSEB 4LGMA 2FH5B 2PEZA 5EE3A 4A6XA 1XEFA 2ZXUA 2HYIC 4I81A 2VP2A 1E94E 5FTKA 1F5NA 1VIAA 2DR3A 2EU8A 2HV8A 4LHWA 1U0JA 4TZ0A 1T0JB 2YOGA 2OXCA 2WJVA 3AF0A 3LFUA 4V0ME 5SZKB 5JJLA 4PFSA 3WP1B 2REXB 1BMFD 1N0VC 2WSMA 1IAQA 3AVYA 1A5TA 1DELA 2A9KA 4NL4H 2VP6A 1Z47A 3IQWA 4DT1A 1E2JA 1KK2A 3TNFA 3A1WA 4EJSC 1NMXA 4IDHA 5JRZA 3LX8A 2PBRA 3RRNA 5KYKA 2Q3MA 2JLVA 1XF9A 1JEEA 1ZUHA 4LJYA 5SZIA 3X1XA 3BGWA 2D06A 2IHYA 2XTNA 2V4ZA 2CMKA 4QXAA 3BB3A 2C9CA 1NN3A 5FBVB 4EPWA 3NKVA 5BQ5A 3HYRA 3DMDA 1W0JA 4TTQA 4OI2A 2F1JA 4RCYA 3EPLA 4DLSA 3LDAA 3THWB 1G3MA 1T3SA 4ZV4A 5H8WA 3EZFA 1N6PA 5J4YA 2VSXA 1R2QA 3J81k 2PLRA 2C2HA 1DS6A 4EFNA 5KDOA 2Q9CA 2ZI7A 4QM7A 1ZCAA 3NEJA 1KSFX 4M22A 3CW2A 4G5GA 1E0SA 1N6NA 5CYPA 1EFRA 2GZAA 2KRKA 4JLOA 1OH8A 4MGIR 2BKEA 3U4QA 2ZETA 5B30A 3A8TA 3LNCA 4Q1FA 3SJZA 3K9HA 2A7QA 3EIQA 4Q01A 3RDPA 3QVVA 1HTWA 2BBSA 2IYRA 2O0KA 2WJGA 3VMFA 3VKGA 1NBMD 1Z6YA 3ZYCA 4IOKA 1JAHA 3R7WA 3ADCA 4A0FA 5B64A 3WBKA 4BEBA 3CR8A 3QXHA 5JECA 1KZGB 4TTRA 4IXMA 1ZM2A 4QL3A 1YR8A 3IILA 5FL7D 4XD7D 1COWD 1Z28A 4Q47A 1CJMA 2H8KA 3WMEA 5AWFC 2I1VB 3WNDA 1Q1QA 4IFEA 4LRTA 1W49A 1ZP6A 5FUWA 2EFHB 3GLIE 1SVLA 1P9NA 2IYYA 1TTTA 4MKIA 2EFEB 3EZ2A 3HYTA 4EPTA 4QFMA 2ZRIA 3K9LA 3Q7QA 4D0LB 4BPBA 3O8DA 4IVPA 2ZRCA 3U5ZB 4B75A 4C0BA 1IN5A 3WBJA 2GJ8A 1GOTA 1CTQA 4JLKA 2YOHA 1PLLA 5TB5A 2H16A 1GILA 2YYZA 2FDCA 2F9MA 1G3UA 1N25A 1VYUA 1C4OA 2IYQA 2ZYWX 3ZVMA 2WWXA 4Q9JA 3ZZTA 4FWDA 2IUTA 5CYOA 1E9FA 1OH5A 1ZUIA 4R7ZA 2O8FB 1J90A 3U4QB 1WB9A 1JBKA 5G3ZA 3RS2A 2NO7A 4DZZA 1EWQA 2IK8A 2HCBA 3UWOA 1BO6A 1KKLA 2VP4A 3LLMA 4DUGA 3UMRA 4M9SA 1OFTA 1R0XA 1HE8B 1U90A 2V7QA 4FIDA 2UZ3A 1UBFA 4JLMA 3QUSA 2ZAMA 3R7WB 3U60B 5KOYA 3PUXA 1G9XA 4XWOA 1YJ5A 1HE1C 2X8AA 2REBA 4XOIA 1Q0UA 3FKQA 3KTAA 3MJHA 2OUKA 1NBME 2XNDD 1G3QA 3VU9A 1G8GA 2QAGA 3THYA 2O8EA 1D2EA 4CRWB 4CZ2A 3P26A 2JJ2D 3SU8A 3RWMB 1HT2E 1SVSA 4BRUA 1RIFA 3CRW1 3IHLA 4O2LA 1VCMA 5FOVA 1OE0A 1XRJA 5FI1B 1HQCA 2NQ2C 2DZNB 1KOFA 1MABB 4GOKA 1Q3HA 1UKVY 2ZU6A 1QG2A 3IHWA 3W6OA 3AVXA 2FJUA 2GTPA 2WPDD 3L0SA 2YJTD 4TL9A 2PZFA 4G1UC 5LBIA 4EPXA 5HZKA 1E9RA 4MGYR 5JEDA 5FI0B 3QG5A 3M0EA 4PTLA 4ZKEA 1DAMA 2ZAOA 1GSIA 1UBEA 1GRNA 2BHRA 2XEXA 5H1YA 5JEEA 3KQKA 2F6RA 4PAQA 4DB2A 4U5XA 2OAQ1 1X1SA 1SHZA 3DOEA 4URYR 4EJSA 1T91A 3K0FA 5CK5A 1UKEA 2F3RA 2JLRA 3QEOA 5IT5A 2FX3A 2WV9A 4OQNA 2RB4A 3ZJYA 2GEDA 4NYIR 1P2TA 4Q66C 4GBMA 3IQXA 1ZD9A 3QKRB 5DGXA 4HB4A 5TMPA 3AUXA 1S1CA 1TF2A 3FE2A 3REGA 3T61A 4AI6A 3X1ZA 2ZRDA 2ONKA 4JT4A 3RS5A 2BV3A 2VQSA 4Q7JB 4QGAA 4JYBA 2WIBA 3NBYC 3Q9LA 5DSZA 2QAGB 3VU9B 3LW7A 5FUVA 1M74A 2Z43A 1W0JD 3AEZA 5JJIA 1GRQA 4NH0A 1XTSA 1Z63A 2RGEA 4KYIB 3H2YA 4HB3A 3K0AA 3ZQJA 5DIFA 6Q21A 4I1UA 4DLRA 3VR6A 1DPFA 2FU5C 5TARA 3TH5A 4Q19A 5TV2A 2EFCB 1ZU5A 4JBWA 4MKFA 4MDFA 1KK3A 1EFRD 1Q12A 1LW7A 1OW3B 1VTKA 2NIPA 1X8LA 1ZINA 2BBWA 2IS2A 4FD2A 2QP4A 1Q21A 1G7RA 1YE8A 2OE2A 3GJ4A 4HAUA 1W44A 3FWYA 2XOKA 5JZVA 5DNYB 5LPNA 2FWRA 2B7BA 2AR7A 4KVGA 4WXRA 1QHHB 2ZI5A 1R0WA 2IEZA 4QBHA 1YKSA 4XIGS 2GCPA 5HCIA 3CF2A 1GTVA 1CJUC 4PZYA 4BRWA 2HJVA 1E9AA 2WJHA 3DVLA 2VHJA 1E2HA 2GEVA 1EFUA 1SVIA 2IX3A 4JVLA 3W5IA 2ZJOA 1IJEA 1AS3A 5SZHB 3ZS8A 3QPWA 4Z1MA 4TL7A 2QPTA 4M1WA 4HATA 1E2NA 3C16C 4MUBA 5EXPA 3A1UA 3QBVA 3GFTA 1J2JA 4RZ2A 1U0LA 3B5JA 2ZUBA 1G6OA 2W0SA 2WSSA 3GQBA 3K53A 3KB1A 1OIWA 1JJVA 4FMDB 4NKRA 1NG9A 3TAHA 4RY2A 2XITA 1N5JA 2ZVPX 2ZU0C 5EUQB 2NZ8A 1W5TA 2RGCA 1EWRA 1XJCA 5JWRA 4B32A 2W6JA 2WWIA 1X8JA 4NYMR 3K0AB 3KZ1E 1P4SA 4QNRA 1XU4A 2AK2A 2HJGA 4D4LA 4TLCA 5FOTA 4M2LA 3KQUA 1H8EA 3B9PA 1NKSA 4JLNA 4DEXA 4HSEA 3L8ZA 1DAHA 4YDHB 3L0OA 3TBKA 3IPXA 2AN9A 4A4DA 5KDDA 4HLDA 4B34A 1Q3TA 2DWZB 2AD1A 2D74A 4DUGD 1CRPA 4LHVA 2QRNA 2R6GA 5F9HA 3GJ7A 2V7QD 3KKNA 5A5GA 3MAAC 2FMXA 4C7OB 2FPLA 1QF9A 2W6ID 3EW9A 1E0JA 2N46A 2VHTA 4N0DA 2JLZA 3LBHA 3SHFA 3MWJA 1TU4A 2QP3A 3AV0B 1P9WA 5IDVA 4AKIA 2GJAA 4XSGA 5DH9A 1CEEA 2YWFA 2CCKA 3K09C 2IF0A 1A4RA 4MKHA 1U9IC 1AKEA 3B1WA 1R5NA 1KI8A 5DI3B 1RFLA 1L2TA 2VF8A 3IIKA 3P32A 4UXIA 5BW8A 2PMKA 4G5SA 2WWGA 3RSOA 2QTHA 1RYHA 1YZQA 1N6KA 1Q1ZA 4Y0AA 1VHTA 4I99A 1JR3A 1Z6XA 3W6PA 4WAUA 1N0UA 2WWHA 5EP2A 3I5XA 2WBLC 3FMOB 1S4QA 5L3RA 3MWYW 4DB4A 1UADA 4HB0A 4PO1A 4RVCA 4OI1A 2R6AA 2W2XA 4F7WA 4Q9KA 3Q7PA 4BZXA 4TLBA 3VLFB 3SC3A 4OHZA 1FP6A 1B23P 1N5IA 1U2RA 1II0A 4NYJR 1Q20A 1FUUA 4BFSA 4FWTA 2QL6A 1AK2A 2YHSA 3JVUA 2W2VA 4LC0A 2G1JA 4XTRA 4OK6A 3CRRA 4JKYA 1QZXA 3W3AA 4JKIA 1EX7A 1GRRA 2CLDX 2ECKA 2ZSAA 2ZPTX 1OSNA 4X8MA 4DVGA 2P6RA 3HDTA 4E5UA 3QF7A 2FEOA 3QOFA 3S1AA 2QM8A 3A1TA 1KNXA 3GCGA 5EE5B 1FQJA 2LKDA 4ZI2A 3PEUA 1IM2A 4F93B 4V0OA 4IOLA 1LTQA 3B1VA 5FPHA 4LV5B 3ZD6A 3I8XA 3KJGA 5KSOA 3CKLA 1KO1A 3WNCA 3A1VA 4QRHA 5A4JA 5KHOC 2QT1A 2OZEA 1CBUA 1LNZA 4KBFA 3KQLA 1ZMXA 3MHVC 2VRWA 1XD2A 4LV6A 5FBWB 3T5GA 1WRBA 1GZSA 2DYKA 5AJZA 4HI0E 1A2KC 1G7TA 2A5DA 2OM2A 3QG1A 3VR5A 5JLJA 1SKYB 2FZ4A 1R7RA 4LDJA 4A82A 3A1SA 1T5LA 2NOAA 2A5JA 2KBFA 3UANA 3RS0A 2DB3A 4EFMA 3QEJA 4M9QA 3AVPA 2GNOA 1XCGB 5FPSA 2XOKD 1FFHA 1MT0A 4Q9IA 3BIFA 3W8RA 1NLZA 2FV8A 2BM0A 4MYHA 4OK3A 4BFXA 2J5XA 3CLVA 1W4RA 2ZSDA 5CLQA 1KI6A 5KPJA 1NI3A 3X1YA 3BC1A 1IN8A 1E1QA 3CNLA 3K8YA 4ACBA 5JFGA 1XEWX 1DADA 2JLXA 4M4SA 2D62A 4B76A 2ZJZA 1OXSC 3U7GA 3AUYA 1H8HA 4Z1MD 3N2EA 2ZIAA 4G5RA 1L7VC 4O0MA 1NSTA 2G3YA 3C8UA 3IKJA 4LX0A 1XTQA 3NH6A 3QQ5A 4B2PA 4AYXA 4Z8XA 1OB5A 2ZJ8A 2WSSD 5GVSA 4LYAA 3DHWC 3F3YA 1XDBA 5BYKA 4IEIA 4C2UA 4D25A 4IOMA 1W46A 4TYQA 1S9DA 4BLRA 5L3QA 1E6CA 2BEKA 5CIWA 2W6JD 4DEYA 3CX7A 2NO9A 2VP9A 4LRWA 3LA6A 1M7BA 1NNEA 1J7KA 4GITA 3TE6A 1NN0A 3AP3A 1TQ6A 3NH9A 3QNUA 3CBQA 4LYJA 5J40A 1H8ED 3ZVNA 2N42A 5SZJA 1CR4A 1OFUX 4NDZA 1W36B 2J46A 3CX8A 4PC2A 4D6PA 2OFOA 2ZANA 1XJQA 2QSZA 3TW8B 4C0JA 2PLFA 2VSFA 2Q21A 2Q9AA 4Q4AA 2IL1A 4JL5A 2V8OA 3Q85A 3HU2A 3MFYA 3PVSA 2UZIR 2F1RA 1A82A 2J0VA 2GHIA 2V6IA 3T1QA 2QG6A 4C9BA 2GETA 1E2PA 3IIMA 3KB2A 5DISB 4XVUA 3K09A 3PV0A 1U9IA 5M04A 4TMTA 3B1XA 1KI6B 1ZM3A 4U02A 2ZRLA 3I4LA 4IXNA 1KDRA 3NDPA 4P4SA 2G0NA 4XSHA 5FOWA 4PHGA 1IN7A 3NVAA 4CDGA 1GKYA 2XAUA 3W34A 2XZLA 3B82A 4US1R 3C5HA 2GZHA 1RE0A 3MWKA 4GZLA 2ONJA 2OILA 1J99A 2AHOA 2ZRPA 4JLPA 2AWNA 1UFQA 1IQPA 1XPRA 1NJGA 3BH0A 2G6BA 1B0UA 4ZO4A 4ZIRA 2JDIA 3OZXA 4P33A 3QKUA 4E07A 1W4AA 4GP6A 4YDSA 2ZM5A 2VIIA 1RVDA 1FMJA 1P2VA 4V0LA 5BWMA 3CZPA 1VCNA 4OYHA 1N6RA 2ZEJA 2C78A 1JR3D 1N0WA 4LJ6A 1QDEA 5FOUA 2DCUA 2GF9A 2OCYC 4MYCA 2PEYA 4M9XA 2JLUA 3T06B 3VX3A 2CCGA 3ECCA 4GPTA 3VNUA 2EWVA 3A58B 2B21A 4A6PA 1GKIA 4MGZR 3ZLJA 4I1SA 521PA 4LBYA 3EZ7A 1E99A 2IYLD 3Q5DA 1J8MF 1R8SA 4KU4A 2P6UA 1P2UA 4TN1A 5EE0A 5EZ6B 4Q4AB 1YZNA 3WHLA 1WBDA 2LWIA 1R5BA 2OFXA 2QTFA 3EG5A 3A4NA 1II9A 3CF6R 4PHTA 4RD4A 3TVTA 4QHTA 2DFLA 3TW4A 2NTYC 1JB1A 2CK3A 5LDDC 2E1RA 1Z3IX 1ZNYA 1M34E 2J87A 3AH8A 4TZ6A 2RCNA 2WJJA 4DCVA 1N6OA 1DAGA 2VA8A 5JS8A 4XWKA 4AYTA 4P4SB 2O0JA 4JS0A 1E69A 4PANA 5BN5A 4Q18A 1P3JA 5JJKA 1ODFA 2Y8EA 2XGJA 1FL9A 1N6HA 3E5HA 1RJ9B 2F55A 1TMKA 2ATXA 4RD3A 4ZIRB 5FBLB 5IHPA 2RGNA 4DWJA 5FBRB 3VR4A 4V0KA 3LQQA 1OXXK 1W36D 1XTJA 1HA3A 4Q7LA 3K0EA 2D2FA 3EC1A 1TPZA 1E4YA 1NVUQ 2YC2C 1SXJA 3TSOA 4US0R 2C9OA 4WVFA 1E98A 1TU3A 1JR3E 4Y0VA 4MA4A 1VG8A 5JHGB 2P6NA 1L8QA 4X8HA 3FOZA 3CPEA 4WZAE 4IDQA 5HZHA 1NVVR 1AQYA 4N3NA 3SR0A 2UKDA 4IFBA 5DHFA 3RANA 2RGDA 3RS3A 3U44A 1VG1A 4MQBA 1X37A 2ZSBA 4DCNA 1G4AE 1EX6A 3OF5A 2OT3B 1E1QD 1ZC3A 4HZIA 3RC3A 3FHTA 1A7JA 1CS4C 4DIDA 1H8HD 2ZRFA 1ONBA 2GRJA 1KNQA 1G3RA 1M6NA 3QENA 1C1YA 2GF0A 3P27A 4JVSB 4M1SA 4PO9A 4FWGA 2IW3A 2DFKB 4A0RA 4KVAA 1KI9A 1KY3A 4UNPA 1Z0DA 1D9XA 2P5TB 2UVQA 4HLCA 1TUEA 4JSYA 2XB2A 4RZXA 1E2GA 3UG7A 1IY2A 2ZRHA 4WOPA 3WYFA 3VR2A 4IKEA 5TVKA 2GILA 1TQ2A 3D8BA 3KL4A 4U7DA 1NN1A 4JLVA 1ZM9A 3ZDQA 1UF9A 2GVDC 4DSNA 3P4YA 1G5TA 2IA5A 3CPJB 1SXJB 3GEIA 2WKQA 2YVUA 621PA 3FGNA 3K70B 2KI5A 1W2HA 3LAWA 4MRSA 1WBBA 3TAUA 4N0EA 4AG5A 4XWAA 2XJ4A 3VKWA 2X19A 3U44B 4G01B 3F8TA 3I1FA 3MCAA 2WKPA 4B74A 3ZH9B 1EXMA 2ZE5A 4BE7B 2ZI9A 5HKKA 2IBMA 5AR1A 4B48A 1Z83A 4QHYA 4O2RA 5AUPB 2DVWB 4G3XA 2X1VA 1ETUA 2C04A 4QBGB 3V9PA 3DZDA 3RVBA 4JVNA 4GNKA 3H0KA 2JDID 3V4RA 2WWYA 3D6TB 1X8KA 2R44A 2RGXA 4Q5IA 3NBZC 2QE7D 2C77A 3TQCA 2J41A 3ZQ6A 1TNDA 3KW6A 1BH2A 3ZIAA 3QJYA 5DYGA 5D3QA 5CM9C 1NIJA 1YZTA 4YQFA 1E9BA 2ATVA 2O8FA 2XSZA 1FTNA 4L15A 2YC4C 5A0FA 3LY5A 5F9FA 1X1RA 2V55B 1FP7A 5FR2A 2H57A 2FFAA 2L0XA 4B71A 3WRYC 2WJYA 4K81B 4R71A 1MH1A 3EIHA 1OXTA 4PPQA 1CR1A 1KSJA 3PEYA 1Q1BA 4F4CA 4KJZA 1KMQA 4UKDA 3IEVA 4QHSA 3KQNA 2BMJA 5FTNA 1D2NA 1OYWA 4DDTA 3ASZA 3O8RA 4MRPA 3OIVA 3SYKA 4X8LA 3I3SR 1TF5A 3MJRA 2G9NA 2ZRAA 4BUJA 2CK3D 1K5DA 1E79A 3C5CA 2DBYA 3IO3A 4HUQA 1KK0A 1SQ5A 2ZJ2A 3PEWA 1MABA 2ZSFA 4UNNA 2IWHA 1ZD8A 4BZPA 1ZNXA 2RGBA 1W47A 2CHVA 4PSVA 4LJ9A 2P3SA 4F38A 3O47A 4NCJA 2FPMA 3C7KA 2ZRJA 4EUNA 2QSYA 2RH5A 3BFVA 1ANKA 2N1BA 1GNQA 3D31A 4GP7A 3CPHA 3QPVA 3T34A 4PZLA 4PPGA 4NCIA 2VL7A 3BORA 3BH7A 5KNCA 1NG1A 2V3CC 1O3YA 3EC2A 1XTRA 3LD9A 4DLYA 1BYUA 1D8TA 3AKDA 1SXJD 2VP5A 5AJWA 2OV2A 1G291 1F48A 3WYGA 2PJRA 3EWSA 3QSYA 3K70D 2QNRA 3KKOA 4D0GA 4FN5A 1G1MA 3QKRA 3GEEA 4HYYA 1VCIA 2XZPA 3X2SA 2W6IA 4PPFA 1XMIA 1VG9B 2R9VA 4NP6A 4B47A 5C2JB 3AVUA 2CVFA 1YZUA 2IS1A 1NLFA 2W83A 3L2OB 2O8DB 3QXSA 2VPPA 2H92A 3BS4A 3FMPB 2ODWA 5FOSA 5TY0A 4P32A 3SYLA 3KJIA 1RRGA 2MSDB 5JCPA 4FMDF 2ZR9A 4JVMA 5ANRB 2ZVQX 1W2GA 5C1BA 1AIPA 3BRWD 2MSCB 3TSWA 4HUQB 1FQKA 2XTMA 1DO2A 1QHGA 4OQMA 3TUZC 1G16A 1M2OB 1J70A 2WAYA 4W5JA 4BFWA 1E2IA 5FUXA 4PZZA 2ZYUX 4Q1EA 4F4IA 1TQDA 1MO3A
chains in the Genus database with same CATH superfamily
3L49A 1AMNA 1U6JA 5CFZA 2ORVA 1DX4A 1J49A 4R8KA 2K0BX 4RS3A 1GFSA 3RVNA 2DKNA 4QPZA 4XE5A 4BFYA 3FH0A 1F6DA 2C7QA 3T5TA 1W8IA 2G0TA 4RJ2A 5INTA 4YY3M 2VQDA 4XDHA 1TAHA 2H2DA 2DAKA 3R75A 4H4EA 2XCRB 2K5UA 4KSBA 3F2VA 3O4RA 4TTAA 4E5NA 5JNLA 2G5PA 1VIMA 3DXZA 5HJEA 3GT4A 5TPZA 1LSOA 1YZVA 4NFSA 1W1IA 2BC9A 4TMVA 3HKCA 3I6MA 1ISGA 3BXHA 4EA9A 2ZR8A 3EVFA 4Z3DA 3NYIA 4A5SA 1DP4A 2OR3A 3ACDA 3R74A 2GHQA 3E35A 4QQNA 5DB4A 4HDNB 4V02A 1CIVA 3BCSA 2CL5A 3H1AA 3F47A 1KI2A 3CNBA 1EFLA 4XVHA 3WGKA 2RSLA 4BNGA 4DIEA 3LKBA 5K09A 5EMHA 2W2TA 4TOIA 4NBKA 3K16A 4JP1A 3RFXA 2ZYHA 3IP9A 2N9UA 1H22A 2IIQA 4XJXA 4DMKA 3SBJA 2DPGA 3IEKA 4QDXA 1M2WA 1N2CB 1FLDA 3ZU2A 4L16A 4JODA 1SD1A 1P61B 4KFUA 4CKEA 4IXWA 1J0EA 1UAGA 4B79A 3GLGA 3D2BA 5DCLA 4HZUB 3EDRA 5IVPA 4X95A 4F85A 1A69A 1JR4A 4DARA 4BNUA 1I32A 4KODA 3EG9B 4LXIA 3IDQA 1OIVA 5BT9A 4ZAGA 4B35A 5JIBA 4ZHSA 2WTAA 1YZLA 2JBAB 4BGDA 4JNCA 4OH7A 4G4SP 1O8CA 2FSFA 1DEXA 1LU9A 1QKJA 1B74A 4I4NA 2JIBA 3K70C 4D82A 4GF5A 4X94A 5HUQA 1FUKA 1XA4A 2C54A 3SMPA 1T4BA 5FADA 3BFXA 1U2TA 3U7JA 5HE8A 4HQLA 3M1IA 3ONDA 2DWPA 2UYHA 3I3OA 1DKMA 3GJRA 5DNEA 2ECOA 1T2CA 5TMDA 1BDJA 5GOZA 3W5UA 1NQVA 2O3RA 1ZNZA 5K8IA 3F6RA 3OZIA 2RHHA 1QV7A 5CB4F 4B3XA 1CE8A 1JLLA 4NDAA 4OLBA 4BIMA 3LHKA 2GQFA 1ZK3A 2KJQA 3DKIA 4YNBA 4C0KA 5H0IA 1B8PA 3G79A 1GAJA 1K75A 4TKZA 1BXZA 5IYZB 4ETIA 3KX2A 1MUUA 1IN4A 4S2EA 1QO7A 5GZ1A 3EIOA 1JG6A 1XZAA 1N7IA 4BRSA 1BS9A 1BFDA 4M0CA 3IUYA 5KJ1A 3M1AA 1FDWA 3KP1E 1P0QA 3D6AA 3OTWA 4F7DA 3B70A 2EQBA 3RRZA 3ENZA 3IE1A 1RYMA 3QVUA 5D1HA 2ASVA 4B3GA 4ESVA 4C87A 3KQPA 4ZGWA 1M2EA 1VYVA 5KTOA 4KE9A 1EFAA 1RQ7A 4Z0NA 2OXEA 2Z2XA 4IBBA 1R4NA 2F1IA 4OFBA 1KI4A 3FNEA 1L8OA 4F71A 3HFRA 1BMTA 2MINB 4QJ4A 2LBPA 4J9VA 5FPQA 3HUDA 2JK1A 4C3OB 2XT0A 3QTLA 4LC1A 5IAEA 3E9RA 2YNMD 4X8OA 3P2YA 5FAKA 4BMVA 1FX0B 3C3MA 1GGNA 3A05A 1PHPA 1YZHA 1VB5A 2PSFA 3A2NA 4DLUA 2G70A 4NWIA 4J7CA 2W2KA 1XXHA 1GL9B 4YIKA 5K7SA 1U2GA 2FJ0A 2PX6A 2X0FA 2DPLA 2PCJA 1Z4IA 2WA1A 1LPPA 2Z5FA 4BYMA 3LVFO 4LSZA 2YWBA 1VE1A 3SR4A 2IS6A 2H7YA 2O8DA 4Z9BA 3NHFA 1J33A 1OVGA 1Y33E 2FFQA 1MX0A 2X9VA 1I9GA 1MC5A 1IXYA 4QPNA 3QE3A 5BR8M 4W9NA 2ADFA 1A9ZA 2BP7A 3GP1A 1KDPA 5AVQA 3I4CA 4FVTA 3LRTA 2XCIA 2QVLA 5IEJA 3ZX5A 2IUUA 4O29A 2XEPA 4WKBA 4L6V6 3RAGA 2O5RA 3KWJA 2HMWA 3ZJVA 2P8SA 1K5HA 1WZNA 3DAFA 2JBHA 5GADl 4TS3A 2VF7A 4YXWA 3MJDA 3EVEA 1QWOA 2O3JA 1NL3A 2L42A 2UYGA 1CKEA 2RKBA 3LDFA 2QTRA 5F3WA 4EECA 5CHYA 1MPXA 3LU1A 4B73A 2BDTA 1JNXX 5D6NA 2WM9B 3PF9A 2GVZC 2ENWA 4EB3A 4ND3A 4ENRA 3EEBA 2WR8A 5B1IA 4EHFA 1ICEA 4GLLA 2CMHA 1AJEA 2D5LA 3BKXA 5GONA 1YAJA 4CKYA 3WB1A 1OI2A 4EHNA 1VL0A 2GAAA 5CLJA 4G0NA 3ND8A 4HX9A 2VZ8A 2GJSA 4EHHA 4XX0B 1KU0A 3BE5A 3HJUA 1X0VA 2C3PA 4CG1A 2QTLA 3PXCX 1UWCA 3R7SA 4BCCA 4TTPA 5ITXE 3L40A 4YRSA 5DX8A 3S2FA 3PDWA 2ZB8A 3ETHA 3HRKA 5TS2A 3WTBA 4YDQA 1BYIA 1WIWA 1POXA 1T8WA 5ALVA 3MGGA 3KSMA 4DV1M 1G5PA 4RD0A 5CXUA 3KKPA 3DBRA 2O4CA 3JATB 1AA9A 1J22A 1EP1B 3LI2A 1WVGA 4MI9A 3FMVA 2FXVA 5T67A 1RABA 4V03A 1XMXA 5KWJA 3D4PA 2HJWA 4KRGA 4JYCA 3HDQA 4E0BA 1CUEA 2AMLA 4MRVA 3FRHA 4RKQA 1W48A 4WT7A 4YT4A 3LX4A 3K2IA 1RKBA 2OO7A 4FKBA 1XNJA 3SARA 1OU0A 2P62A 3E9NA 1XCJA 1ENYA 1LRKA 1TDJA 3VHXA 3NTRA 1D07A 3G2QA 1QRSA 2GDJA 1JTVA 3G82C 3IGFA 3K6KA 3AM3A 3HCPA 1KWKA 1CJSA 8ADHA 1GA1A 5HGJA 3RVMA 4ZZ3A 1U1DA 2FEMA 1DHTA 4JLDA 3S5JA 3MS2A 5KYXB 3DL0A 1XTUA 2E9SA 1M0WA 2BGLA 2FYTA 1OI3A 4OJQA 4O3MA 1RQ2A 1YS1X 2CUTA 5DXAA 1U8XX 3W4KA 1RS0A 2WFLA 1HXHA 4B1FA 5DPMA 1C0LA 1VDZA 1V11A 4J3FA 4DV7M 1KO8A 4V0MA 1NYQA 5CXSA 4EQ6B 4X66B 4OHKA 1KF0A 1GG2A 4L2IA 2NTNA 4FYPA 2VH1A 4R69A 3WQRA 2KLBA 4ZAYA 1WEHA 2YR0A 3IBGA 3CZQA 4BRZA 4C1BA 1X94A 2HIHA 1T6NA 1TIBA 3BSWA 2EZ9A 3TQOA 3FYSA 2BTEA 3AJ8A 2MMCA 1IBKB 4IBJA 2G0AA 1CWUA 4NAVA 4UUBA 1XX6A 4M46A 1L7XA 3GOHA 3WWDA 1BKSB 2JEOA 4QASA 3SAWA 2VNAA 4DZTA 4LZLA 5AJHA 1DQZA 2WEKA 3A98B 2QTVB 3AT1A 2VWGA 1SZDA 5J23A 1Q57A 2Q4BA 4FXPA 2FPPA 4DDMA 4A7PA 4OL0A 3ZXXA 1E9SA 1ODIA 4ZK2A 1N3LA 1QIKA 1ZJ4A 5CDFA 3NDRA 3OU7A 5G1NA 2J0EA 4IW3B 1X9IA 1FP2A 5JQGB 4Z0HO 2ZE8A 3TCNA 4O02B 4LMPA 3UK2A 3SM9A 2FR8A 1NIPA 5DNDA 1ZIPA 4X5OA 3WL4A 2X6RA 4KN6A 2C7BA 4EGJA 3E27A 1IZ9A 3U7QB 3ADKA 2OKCA 3P8ZA 1M6WA 4ZAVA 1C2TA 4URVR 4C43A 5HRCA 1N36M 1RJGA 3RW9A 3UJDA 4D2IA 4QUIA 1MFZA 4BY9E 1HYEA 2P91A 4R2HA 4BQIA 2QY9A 4W99A 2VHUA 1TIPA 4CF4A 1MHTA 4G4RA 1CUCA 1YE9A 1Z5UA 2KNAA 3GVHA 2FSHA 2QLNA 1AUQA 3VKUA 3N9IA 4ECAA 2QD2A 1ZU4A 4R2LA 3R8FA 2HFJA 1SBHA 1NVEA 2B82A 4RKFA 5HIMA 3GGPA 2PEZA 4RIEA 1PDWA 4I46A 1P45A 3HA7A 2P77A 2HA4A 3ZXUB 5T5QA 3CUUA 4EZIA 4S2UA 3QOWA 3G7NA 9LDBA 3RFUA 4CMEC 1KK2A 3NS7A 5IT9A 4MB7A 2KHZA 2ZB4A 1ZK4A 1CS0B 2XTNA 1KKUA 4OGKA 2WV7A 1BE6A 1DEOA 3EBPA 4NXMM 3THWB 3CSSA 3R0XA 3ST7A 5AIBA 3NWLA 3P9SA 3GPXA 3UUWA 3BEOA 3VNQA 2P4EA 5TNXA 4NI5A 1VSVA 2Q5EA 3ESBA 2A7QA 2ZUTA 3IYLW 1RLJA 1WPGA 3LZ6A 3ADCA 1SXHA 1TW2A 2Q2EB 4J9UE 1HDEA 4Q3NA 3KT0A 1LDBA 1RI5A 1GSHA 4H1TA 3A9RA 3AW9A 1IN5A 3HJFA 3BWBA 4JLKA 3ZY5A 3FZGA 1G3UA 3CTWB 4FWDA 3PQFA 4D9KA 5I51A 3PQ2A 1EWQA 1DKOA 1UBFA 4PM4A 1LBHA 3ZK7A 5E1DA 1V7PC 4WLOA 4WRRA 4CRWB 1HT2E 3EVCA 5CBPA 1VL1A 4N5LA 4G1UC 2OHXA 5LBIA 1E9RA 3GXBA 1SK8A 3VGJA 3KQKA 1TJNA 1C1DA 2B61A 2RB4A 5HQTA 2WABA 3OX3A 4DV5M 2INGX 3M2TA 3OJLA 1OTHA 1MVLA 3LW7A 2Z43A 3FNBA 4C7XA 3AR7A 1HDRA 3EIUA 2B30A 2PV0A 2C9MA 1Q12A 2OQ4A 1B14A 2IS2A 4FBGA 1X7WB 3OICA 3KUKA 4H3HB 4A8HA 1ZBQA 1L6RA 2DM6A 4GKJB 4HC4A 2VHJA 1JRLA 1CZNA 1HLFA 2X2OA 4DPKA 1EFUA 3VU8A 3W5IA 1DIHA 3HUUA 4ZCSA 1J2JA 2XE4A 4UE2A 2KNZA 1GNLA 4KG7A 1X8JA 4R6XA 2OZLA 1TH3A 3G2MA 4YJGB 1Z25A 3RS9A 1DAHA 1ZITA 5JARA 1U1GA 5DEOA 4JP3A 1I3LA 4N0DA 2A86A 2PSJA 2V7PA 1JBEA 1CEEA 2XOEA 1KEWA 4RTSA 2X9LA 3FPLA 4RQUA 1YMUA 1XAHA 2WWGA 3T7AA 5CT5A 2GSWA 1IM8A 3AF6A 1T9BA 4LYGA 1X7HA 1L7MA 1RQGA 3M7GA 3SC3A 1YULA 3ZQUA 1Q20A 1FXUA 1YVRA 5LQSA 4OK6A 4EQZA 5A5DA 4KN8A 1V35A 4Q4CA 3HDTA 5GIOE 4E5UA 1L7EA 2HQBA 1Q84A 2AEFA 3SICE 2I3AA 1OBHA 1KE1A 2XUAA 1QS0B 4RXUA 1T6BY 4AQYM 3A1VA 4NULA 3PA6A 1QR6A 1XD2A 5FBWB 3GP3A 3TXYA 5ADWA 2QKYA 3ZI4A 4ZCRA 3ETEA 4U2GA 2YS7A 1XCGB 4ENQA 3HKPA 1OOEA 1BN6A 4LDNA 2PGAA 5BWOA 5ALUA 1SU6A 5TQ2A 3Q3GE 4ACBA 1P2DA 4BNKA 2JS7A 2Y4OA 3FTFA 3CBGA 3J81A 3A7EA 2G3YA 4EVRA 2I6GA 1K7YA 4AP9A 2O2SA 4RTKA 5HP4A 3GJZA 4Z7NB 2HPHA 3DV9A 1M7BA 1XYYA 2R7LA 5JCXA 4YLYA 1QG0A 1ZN7A 2OFOA 4ZMRA 2QQGA 5HIKA 2Q21A 4JL5A 3RRFA 2CFCA 2B94A 2VDMB 1T2FA 4KACA 3RAFC 2BE9A 1KI6B 4PZDA 1KDRA 5FOWA 2Z57A 4XSHA 1ZI8A 1GKYA 4GSLA 4DUPA 1RE0A 5DTJA 5M7EA 1F9EA 1TH2A 4KPYA 1AC5A 2RI1A 4NV0A 5F7ZA 3R8XA 3AXSA 1ZO8A 1W75A 4L7QA 3SKYA 3IE2A 2H2FA 1YH3A 4G5HA 5DNVA 2GEJA 5EMMA 1OZFA 1YZNA 3C8ZA 1HL3A 3MB8A 3A4NA 4P4LA 1OXBB 2D6FA 1Z3IX 2RCNA 4XK8F 4DWVA 2GBCA 1MDBA 2O0JA 2I6UA 3V2HA 5GGXA 4EA7A 3N2GB 2DWUA 2WZJA 3CCFA 1KAEA 1MNAA 3UMJA 3S27A 3UT0A 1E4YA 1EDEA 4C06A 4Y0VA 1PZHA 1I0LA 3DFZA 1VG1A 3O6VA 1N0IA 2GN4A 3TLBA 3RC3A 1QP8A 1H8HD 1MG5A 3MQ4A 3QENA 3F1LA 4JVSB 4EX7A 2D1QA 5EWLA 1XF1A 4Z4CA 3KAPA 3OJFA 2ZRHA 1E8MA 4IKEA 3S2GA 1MEEA 4FEGA 4UCXA 3CPJB 621PA 5ALLA 4RIGA 3D5QA 4MRSA 2WKPA 5AM1A 5AW4A 1S02A 4P3OA 4QT4A 1ETUA 5AVJA 1TGUA 4TPKA 3N2LA 2R44A 4W6ZA 5A4FS 2IZ7A 3TQCA 3TLEA 2RGUA 3TBFA 5DYGA 2P2DA 3JAMA 3R3WA 1A1SA 5A0FA 5IN5A 1E77A 2H57A 4KUHA 3WRYC 3HJSA 3NHRA 3NM5A 1P4GA 1UP4A 1ETHA 3FNGA 2QZJA 3GRKA 3I1YA 1HM5A 4XM2A 4KIUA 3PEWA 1U0RA 5JS1A 4WGFA 1ATZA 1PVVA 4KMOA 2R8XA 2OYSA 4FE4A 3EC2A 1XHBA 2GKOA 3OJXA 3D3NA 2BDEA 2CKMA 1RFGE 2RI6A 2XZPA 1MGOA 1XMIA 2POQX 3I34X 2P40A 3INYA 5FOSA 3M6MD 1J70A 2G8LA 1E3JA 2HH9A 1N33B 3IPYA 4E5VA 4H2DA 2JRLA 4Q93A 3LPCA 2YICA 2Z4RA 4CIBA 3IXMA 4NBRA 2X0IA 3CRQA 3NX4A 1Q22A 3HHWA 4IVQA 4BWVA 3BQNB 4QD3A 3TZEA 3W5SA 3IIEA 4BX0A 3COPA 4LTMA 1NVWQ 4K46A 5E0KB 5ALNA 4YWJA 4B81A 2R45A 4ER3A 4G4QA 4R5HA 4Q1DA 4M8SA 5I8PA 2KA6B 5JROA 3OT4A 3TQRA 5ITSA 2W2OA 2PT5A 4BFVA 2UXBB 1N7HA 1W73A 3D64A 1YFJA 4RHFA 3MLEA 5ENDA 4GLOA 3DKPA 3QE9Y 4GKKM 4IMPA 4N76A 2I33A 2Q1XA 4QQKA 2GFIA 4BLVA 2GK6A 3K1JA 2NU7A 4QVKA 1OILA 3PR3A 1G5QA 5EPUA 2ID8A 1TUBA 1MOQA 3DKKA 2XMGA 3B13B 1WX1A 2UYCA 1F51E 4YRMA 2CVZA 1ID1A 5KTYA 2Y0TA 2PZMA 5DLPA 3OTOB 3DUWA 4N5IX 1BW9B 1E20A 4D9NA 1U7UA 2R8PA 3KOWA 3ILHA 1O95C 3QLEA 4DLLA 4JN6A 5EQTA 3CTPA 5TQJA 5KNDA 1PW5A 4Q9LA 5A0VA 3RU2A 3CLRC 3K72B 3OUTA 3TQFA 4G0PA 1SCJA 1B2RA 3GA5A 3QMVA 2WM8A 1SZCA 2VO1A 4HS9A 3E1SA 1FZTA 1NRJB 5K8TA 3CB4A 3CLSD 1OLUA 4UM8B 3C6KA 5JANA 2WKRA 2PXXA 1UJMA 1MO6A 1LSUA 2AFHB 3KEOA 1RMTA 4KAJA 5L9AA 4NSOB 2OHJA 4NC9A 5GJBA 1LD3A 1MJHA 4FN4A 3DL2A 1CQWA 1QLWA 3EX7C 2VCYA 4A16A 5B3LA 2OENG 2AC2A 2J3DA 4CHTA 1V34A 4CEHB 5KYYA 3ZWWA 4JV5M 3LOUA 3KB6A 4D45A 2ZTCA 3R5HA 3FDIA 2ZFUA 3KYCA 1IIRA 2ZBDA 2W4MA 5F33A 3NHMA 1RDFA 1NP6A 1KU6A 2HT6A 2V7TA 3WAGA 1OQAA 5F51A 4BVLA 1M6HA 3RQIA 2M6KA 4UPDA 2JK0A 2WOOA 3R0VA 1N3IA 1LF0A 4BGUA 4E3ZA 2ZREA 1GPJA 3ZWDA 2Z1MA 3KDAA 5EHXA 2DULA 3MUFA 5G4KA 3DB1A 5AW8A 4H7DA 2C7OA 4IRUB 4KIFA 4CODB 3B1YA 1U5BB 1NGSA 4DPLA 2GLUA 4FHEA 1GPWB 4XYGA 1P0IA 3IMEA 2AW5A 5ALFA 4DQXA 1WDLA 4YUAA 1XCMA 3L7JA 1JAXA 3DT9A 1NW7A 2E49A 3LNTA 1PUJA 1E5XA 3M6FA 3N3BC 1FE8A 3IRVA 3R4VA 4YJ2F 4W1RA 3KSJA 4M53A 3DO6A 4FMCB 2W6QA 1QOPB 1H9AA 1JSXA 2R6R1 4JB0A 4HLQB 1F60A 2QROA 2X4AA 4L4RA 2XFSA 1C1KA 5JS6A 3VKVA 2F5OA 1SKYE 4NXNB 1A7AA 1M2HA 4WCFB 2XGOA 4V24A 1NN5A 1MRNA 2V5VA 4EHKA 3ANNA 4LJ5A 2Q5IA 3MQFA 4CEJA 1BHSA 2X4IA 2FZVA 5TDHA 4DSUA 2NUAB 3O9VA 5D5QA 1FNSA 3U7HB 1M1YB 4RK7A 5I45A 2PQ6A 3E6AA 2E4ZA 1DKRA 3R7DA 3GL9A 1Z2EA 2Y4NA 3TQHA 2QJWA 4QYTA 1ZM4A 2B69A 1Z7YA 5FAXA 1Z38A 3ADBA 3UAYA 4WXPA 1RU3A 2AD5A 3KBBA 1BHO1 1QIHA 3OEEA 3QE2A 3PFNA 3OY7A 1T1IA 1NPDA 1W0KA 2BTQB 2GXUA 1WZ2A 1CZOA 2JC3A 4FGJA 1UBKS 4IIHA 3HGMA 3W2TA 5A3JA 3UWDA 2EX0A 5J5VA 2F3TA 4UNQA 4GRIA 3E48A 2YFYA 3GCXA 2OA0A 5B37A 3AEKB 3LG2A 3ONVA 1ORTA 2QORA 2XKKA 3K2BA 3DNFA 3TQIA 2PANA 4BLQA 3C8HA 1MB0A 3FJ1A 1H6BA 3B6MA 1LBSA 3FB1A 2D0OB 5KMGA 1G8AA 1SUCA 1TMGE 1BDMA 3VVMA 2PUGA 4W5TA 3S7TA 4HNAB 4LX8A 2FPIB 3EIEA 1YBMA 2QN6A 4FFVA 2EDCA 4ZTUB 4N18A 4RD2A 1TYCA 2FF5A 1DT3A 3EZ6A 2W00A 3L8YA 1U0TA 3RC1A 1M1NA 4B9AA 2WUWE 2XTZA 5EJEA 3RD5A 4UU7A 4OKNA 5MFPA 1FTQA 4QRDA 1D4ZA 2J48A 4H16A 1Z6GA 3ITNA 1T2DA 2VPTA 2RAUA 2IP2A 4LF4B 1NQWA 2BGJA 1N75A 1SQ0A 3PDJA 3GXOA 4A2WA 2W0MA 1QZUA 4OEHA 3K71B 2Y6VA 3QHAA 3BQMB 4Y7CA 1KEVA 1GKUB 1HT0A 3TGWA 3DOAA 3Q3HA 4KZPA 2DHCA 1K5PA 4OQ4A 3SATA 1UZMA 4CIDA 2C42A 1K8XB 2YHBA 2W82A 1YU6A 4DRYA 2HSEA 3QPUA 4HYEA 4D81A 2Y2VA 4N47A 1AN0A 2VHQA 1LTKA 3ORRA 4W4TA 4MUJA 3WLNA 5AXAA 3TPZA 3GPDG 2VJMB 2IDZA 4WZZA 3PCRB 3IP6A 2FR1A 1HJPA 4EPVA 1PZMA 1Z82A 4LQ4A 1ZMTA 3F7TA 1F17A 4YAUA 2IHBA 2IP4A 3NMUF 5FTMA 3JARB 3D7SA 1W5AA 4Z0PA 4KLAA 4TUYB 4EJSB 4L0MA 4AKGA 4IS3A 2DUMA 3NR2A 4MUNA 5DYIA 3TTXA 2VDQB 2FGKA 1RD4A 3JQEA 1GN9A 3X1DA 4OBEA 1KC3A 2D00A 4ZYTA 4F3KA 1THMA 4HOYA 1O9GA 3WHKA 4J0JA 2WIAA 5TRTA 1Z0UA 3DZFA 4QYIB 1Q6ZA 3JD4A 1GUAA 2ZBFA 3QKTA 1XDDA 2BZ1A 3EA4A 5HM8A 1QZEA 3E9QA 221PA 3SHVA 2CNWA 4KWIA 2OFWA 2JVKA 5IKXA 3U37A 1YS9A 2HHJA 4I3FA 1QVAA 1V43A 2YASA 5B1EA 2VDBB 1YI1A 4AC9A 4MW7A 3NEYA 1Y6QA 4TSKA 1TDHA 4J6FA 3GK3A 2FPOA 2F5NA 1FA9A 3I28A 3RBVA 1ZBDA 1GYQA 2ZUDA 3VH3A 4JI4B 1PI3A 3IAHA 1MIHA 3LA8A 4RD1A 2Y1GA 4BEWA 2O2GA 2PLAA 5CH8A 3TIXB 2BCJQ 2YHUA 3O8NA 3IX7A 4F1KA 2YZNA 1N78A 2FOLA 1N3YA 2Z4TA 1CF4A 2UU9B 1Y9JA 2O06A 4O5AA 3E8SA 2O50A 1ZJZA 2EKFA 1E2LA 1CZHA 1V37A 4AZ0B 4EF4A 1BROA 4XASA 1CJKC 2FJPA 1ZUNA 2H51A 1J23A 2B36A 1PDOA 2P6MA 1WU7A 3JASB 2IQ5A 3T3PB 3EUAA 3AFHA 4MVJM 4LNAA 3C3DA 3TTWA 4I4TA 4KYUA 3NRJA 2IC5A 2Z83A 3PD1A 3B60A 3AHFA 1DRKA 1AQNA 2NO1A 2EKBA 3L41A 1ULTA 3V4SA 4FGWA 3OOEA 4WNAA 2LIVA 4RPCA 3O9MA 5DLDA 3WSTA 2W2MA 4P35A 3QV2A 5AXCA 3ZW9A 4DIUA 2F62A 1WPQA 4AO8A 4C29A 2C9ZA 2VS1A 2NXWA 4MHOA 1JWBB 1FW6A 1E1KA 5IJZA 1C80A 4ILEA 2G77B 1E2MA 1QHSA 5JDCA 2CFSA 3QF4A 1E6EA 2DMRA 2CP8A 4Y1RA 5JPCA 3J7AS 1KEEA 2G09A 4LI0A 5DGHA 1RMQA 1FBTA 5K0LA 1ZEJA 3DE3X 2GPBA 3CKKA 4HEJA 1C9KA 2JJQA 4IJ6A 3DZ8A 3QEMA 2ZP1A 4JT9A 2XGMA 3HDYA 4ZANA 2E1PA 1PLKA 2XWSA 2N35A 1CY8A 1DAKA 1FYEA 1E6WA 3Q12A 1RVV1 3CZRA 5IJXA 4CLXA 5EIBD 3PHIA 5CHEA 2PMCA 5DLQC 1FDIA 3N05A 4YMTA 2VHCA 2J7PD 1E92A 4TT3D 4N9QA 1UKAA 1P1FA 2GH1A 3TQTA 3X1MA 1JAIA 4GYJA 4PS1A 2W2LA 4PG7A 4Z2AA 1OC4A 2I8AA 3MERA 1NVGA 2WJVA 2OYCA 4PFSA 1DELA 2ACWA 3A1WA 4IDHA 4C2BA 2PBRA 5ESRA 1ZGBA 3ZXSA 4N5MA 5K3OA 3DHVA 3NTQA 3SXJA 4PLZA 4EW2A 2XWQA 4FEAA 3T5BA 5LBTA 3RSZA 3C3PA 3WYDA 2YUIA 2QZ9A 2Q5OA 3KFLA 5H8WA 5KHAA 3VV2A 4MEAA 3ZCXA 3H6HA 2ZI7A 2QTNA 4G9BA 4D99A 1Y4UA 1I2CA 4JLOA 2IYEA 1YQXA 1BQ4A 2QIPA 3VMFA 1Z15A 4YFYA 5DNCA 3CR8A 1A2QA 1HEUA 4U6QA 1Q5PA 2FUG1 3ZI7A 2CDBA 1TRKA 2QV0A 3HV0A 3OQIB 4TXLA 4DMFA 4J16C 4L74A 2V0NA 4ZZIA 3K9LA 2XZFA 2QYTA 2IH5A 4XIFA 4YPVA 1L7PA 1VPDA 1M8KA 4B82A 4J1TC 3FDZB 2VG8A 3W1WA 3BD6A 5L4LA 2FP3A 5FO0A 4LZAA 1JBKA 4HJXA 4DUGA 2HSWA 5A04A 2PZBA 4H1WA 3PC7A 3MJHA 4XARA 4H7EA 5BMVA 3L7OA 3P26A 4IMRA 2WHQA 2H4WA 1BXKA 4LRTB 1QQTA 1GTRA 5FI1B 2BHTA 5ALPA 4IGKA 4RE5A 4A03A 1TA9A 4MR7A 2OTCA 2JL1A 1R4MB 2KZSA 3EJ6A 4CMEA 5CDTA 3JQ7A 1G55A 3ISTA 4OQYA 5F77A 1EQAA 4R3UC 3WADA 1T91A 4HEOA 5JVDB 3DFIA 3WFIA 2PA3A 4HB4A 1DX6A 2P9HA 5LC1A 3RS5A 3V32A 4Q7JB 3LQYA 1V1RB 1T34A 3M4NA 2Q50A 3N3AC 4JUDX 3FPHA 5DIFA 3CEHA 3F90A 4Q19A 3ZHTA 1XZCA 3CVOA 3VC2A 4NK4A 4BZZA 3AG6A 4RK0A 5DNYB 5CFRA 2QRPA 4PCUA 1L4FA 4Y18A 3BDVA 1VGQA 2M98A 1J20A 2I22A 5JJBA 1H93A 1SVIA 1IJEA 3ORSA 4HATA 2JHCA 2R1VB 1QGDA 4A23A 1U0LA 4X9XA 2G4CA 2W0SA 5ITYA 1RTTA 1NFFA 3FD9A 2ZVPX 4AP5A 2WWIA 4TS9A 4CXMA 1C41A 3Q3CA 5FOTA 4HVCA 2HMYB 3IJPA 1SUAA 3DF9A 2DWZB 2A0YA 2VUHB 4GEWA 1Y4AE 2Q29A 2P68A 1WHTA 4NOMA 1QF9A 4PYNA 3GF4A 5CNJA 3WNQA 2ZYSA 2GJAA 4XSGA 2FWJA 4TV8B 3T3OA 1SQSA 1U9IC 1YS6A 2R8OA 4E15A 3RSOA 2LVNC 3GN1A 5K0EA 1VHTA 2WWHA 3SHOA 4MAFA 4RPIA 3VBEA 4RCVA 1GRRA 1M34B 1NXSA 3VO2A 3ZQKA 2C9BA 1NR1A 5IW8A 3B1VA 4R2XA 5KSOA 4O6VA 1OWLA 3OZTA 1BG6A 1KYXA 5AJZA 2AG6A 2OM2A 5IAOA 4KNVA 2XDWA 5D5HA 1OI4A 1RXSA 5LL6P 2BM0A 4O4JB 3FFXA 1SOAA 4IS2A 3I4YA 3MT7A 1E4OA 3RUHA 1XEWX 4BAGA 2NV6A 1JJFA 4FVMA 4BBZA 4Z8XA 3GPCA 1JIXA 1OV6A 4BNWA 5A1JA 1JGTA 4XM0A 3DBHA 3EFEA 3V5NA 5H59A 3LA6A 1GXSA 4E1BA 3WAJA 1ZOOA 3USCS 1W36B 3B1KA 4UBKA 2QSZA 3TW8B 3PVSA 4CWAA 2UZIR 1YTLA 2Y67A 1J1ZA 4C9BA 2ENUA 3J80A 5FOQA 2ODQA 3DE0X 3K0HA 2XAUA 3EULA 3V76A 3C5HA 3Q9NA 2DERA 5JH7B 4WGGA 1XPRA 2ATCA 2JIDA 2E3JA 4UTZA 4BLWA 4GP6A 5B6PA 1XMPA 4YX9A 3IE0A 3GT3A 5JD3A 5BWMA 1N6RA 3EMDA 2C78A 3X44A 5EG5A 4YN3A 3VNUA 3A58B 2Y1CA 4A6PA 1GKIA 2QL5A 2PL9A 1CRWG 1J8MF 2C2OA 4MS1A 1QRRA 2OFXA 2CLKB 4PHTA 3T7DA 2V74B 3ZJTA 4WY2A 2P9GA 2OZPA 1ZNYA 4TZ6A 5KVCA 2Y9PB 4BGEA 4EOGA 2J33A 3DOCA 2PGLA 5FO1A 2DH5A 1ODSA 1XTJA 4JI7B 4MWTA 3DV0B 1TPZA 4MQUA 1H4SA 4PZPA 1R00A 1TU3A 4IFBA 2SICE 3AJEA 2UVPB 2FDRA 3ON5A 5IVIA 3H5RA 4RF3A 2PD3A 2UVQA 2RH4A 3W7VA 4BAUA 5HM6A 4P7JA 1MHPA 1C29B 3P9RA 4O2AA 3TLZA 3H2JA 1J1UA 1SXJB 4L50A 3ZTYA 4ZEVA 3A26A 3AXTA 2I4OA 4GI2A 2WU4A 3GT0A 5JZBA 1KGSA 2X19A 3U44B 1XAGA 4OXQA 3NANA 1U1CA 2ZI9A 3GO4A 1T36A 3DEZA 3LUBA 3K9FC 3K6SB 2QE7D 2QZZA 2YS6A 3KW6A 2HPZA 5FLXA 3I2HA 5F9FA 3WWPA 4CQMB 1KFJB 4B71A 4A2CA 3U60A 1IULA 3RNOA 3OIVA 4QIHA 5HWSA 3LC2O 3KT6A 1Z4OA 1EFPA 5A7HA 3F74A 2CK3D 4GP9A 5LA6B 1F0KA 3TLGA 4E6EA 1ZD8A 3C7KA 3MC1A 3P2MA 2C0PA 4MIKA 4B3RM 4B7CA 2JFPA 1VEKA 4NCIA 2OCXA 4BMPB 1Y6FA 1N5DA 4UW9A 2EG9A 1ECGA 1BVRA 4U9HS 4ZYZA 2W6IA 2R9VA 1VG9B 3QKWA 1YZUA 5E6RA 3KJIA 3I9LA 3R3YA 4BCBA 4BTVA 3OFVA 3S1SA 1QHGA 5DBHX 1PVDA 4W5JA 4DM7A 2IW1A 5BN3A 1AKVA 2GXQA 4LCBA 3DTNA 3V80A 1DJNA 5IH3A 2AJTA 3JVVA 2PSSA 4CUZA 1KIAA 2XQVA 3K9PA 3FWZA 2YJ5A 2Q2QA 2EKLA 3TZCA 3IDZA 4BB5A 1Y6JA 1D7OA 5DOZA 1Z26A 2C61A 3VX4A 3BXWA 3HWRA 4JIMA 4PHCA 1PAUA 2NU8A 3IAM1 1ENPA 3C58A 1SXGA 1XL1A 2AMJA 1CC1S 1T9HA 2WSYB 1OB2A 3HU3A 1I4EB 3WRYA 2GBFA 3EYWA 1D2GA 4P58A 4N3AA 3A9SA 4EEKA 3OZEA 3AR5A 5KVVA 1DGHA 2C5GA 3PX7A 2D0IA 2Z8ZA 3BE8A 4RZ3A 3BMQB 2P4QA 4DQUA 9GPBA 2VPIA 3ZE1B 4HLUA 3SVZA 5E6UA 2QIOA 2CZQA 1MNQA 3FW1A 5AVTA 3KSUA 4QAJA 3T4PA 2PKWA 1FVOA 1Q16A 3TI9A 3HP7A 4FDUA 1P44A 2ZRNA 4S0XA 1V16B 2FETA 3THOA 3PDIA 4DR1M 4ZZ2A 2KMLA 2MDTA 4JBHA 2MSLA 1EVYA 6AT1A 4EGFA 3IBCA 3G3EA 4LPSA 2TECE 1IPEA 4MV6A 1CQJB 2GRAA 1EAMA 2G5TA 1V9SA 5IT9S 1SU8A 4NG4A 4JT8A 1L8XA 2FN8A 4PWZA 4BFLA 1YT5A 3AGQA 5LOVA 5BO5A 3KLNA 1PBNA 1SKBA 3LHFA 3NRCA 4D96A 2A9RA 4IQ0A 3QTTA 1E9DA 3W0FA 3B7GA 4YCAA 2GD0A 1E1YA 3DVQX 4HGQA 4EA8A 3FUVA 3WYCA 4G23A 4E5KA 1W9MA 2CC2A 3GFGA 1P6QA 2OQVA 4FMBB 1Q92A 1C3OA 1M2VA 5G0WA 2NUTA 4EZEA 2QMYA 5CT4A 4YUZA 3WKEA 2X6QA 2PKYX 5EP3A 3P0HA 2H2WA 2QLBA 3NO4A 3OMXA 2O8BB 3SI7A 5IK2A 1YONA 2ACEA 3JQFA 3FMIA 2XNSA 1N2BA 2FMFA 3SS7X 3JQ8B 3TJMA 5H68A 4LBVA 2ACVA 4BNJA 2CD9A 2O14A 4KX5A 5DOVA 3H16A 5DSTA 1O5TA 1QQ7A 2DECA 1ZL2A 1EESA 4RFLA 4C4RA 2AOWA 3RFWA 1L4YA 4OP2A 3UPTA 1TJYA 3HUTA 1UXGA 1M0TA 5BN4A 3GYGA 3U61B 4K05A 1FRQA 1DC3A 1LLQA 4JI0M 3IP1A 1RHQA 1F0NA 4LAFA 3TZBA 1WF3A 1O95A 1I6WA 3HKBB 2GKSA 4L5CA 5CFPA 1F2UB 2PO7A 1JPNA 4QJ5A 3UATA 3RSCA 4LDZA 2XADA 2DHQA 5DTIA 5HKBA 5C52B 3TECE 4KE7A 2WUVA 4IL5A 1HFWA 3U4CA 2D3WA 1QQWA 4BJHB 3U80A 4I0WB 3MSXA 1A9RA 1CUGA 4YCNA 4C0HA 1RRPA 3AL3A 3CO5A 4QVGA 1J5PA 4I9NA 3EQ7A 4Q9DA 1RMYA 1X3SA 3G17A 4HSGA 4UFOA 3TX2A 3NPMA 3AFIA 4HZGA 3VJRA 1PJBA 2Q62A 2REOA 3M6IA 2BGRA 2JASA 3DT6A 1RIIA 4WBXC 2QX7A 4BATA 4X71A 1MGPA 1ZGCA 4F04A 4XCXA 2W90A 3NATA 1DJLA 2EA0A 3MRSA 4GBJA 1A9PA 1PTKA 2Q07A 3H5VA 1A9TA 2Z04A 3HZRA 1WETA 1XEXB 4BB6A 2BEJA 1ZH0A 2ODEA 1O97C 3AEUB 4FZVA 1KJNA 1QH8B 4N5NA 1X2EA 1O6GA 1KJYA 2Q3BA 1G19A 3PL5A 1RCUA 1RYZA 3FPKA 2P8JA 3PQ4A 1ODKA 4RE6A 2XODA</