3H4QA

Crystal structure of putative acetyltransferase (np_371943.1) from staphylococcus aureus mu50 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
169
structure length
145
Chain Sequence
GMIRLGKMSDLDQILNLVEEAKELMKYPLLEHFEEDIAKDYLYVLEENDKIYGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEVILTDTFALNKPAQGLFAKFGFHKVPFYAYYKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative acetyltransferase (NP_371943.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.50 A resolution
rcsb
molecule keywords putative acetyltransferase
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus mu50
total genus 40
structure length 145
sequence length 169
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h4qA00
5H84A 4QB9A 4U9ZA 4NXYA 3W91A 1PU9A 3CXSA 1L0CA 2FT0A 3PGPA 2Q04A 4MI4A 1YREA 5F46A 2B4DB 4YGOA 2J8RA 1M4GA 2Q4VA 2Q7BA 4R87A 3IGRA 4CAXA 1BOBA 2B3UA 1M44A 5ISVA 1N71A 4JD6A 3TCVA 3D8PA 1PUAA 2G0BA 2X7BA 5C88A 2OZUA 3JUWA 3I3GA 2FIAA 4KOWA 2FE7A 4MHDA 3P2HA 5IB0A 1VKCA 1YVOA 1FY7A 3K9UA 5F48A 2B4DA 1IB1E 3FB3A 3QB8A 3TT2A 2IL4A 1QSTA 4B5OA 2PSWA 4R57A 3R9FA 1CJWA 2JDCA 2JEVA 3DSBA 3F8KA 4OLLA 2Z0ZA 1YLEA 3SXNA 4F6AA 2VEZA 2PR1A 2EUIA 4QC6A 2OH1A 5J8CA 2G3AA 1Z4RA 1VHSA 1S5KA 1S7FA 4YRHA 4MY3A 4RI1A 4FD5A 2PRBA 3EO4A 2HQYA 4FD6A 2P0WA 3P2FA 3TO9A 2JDDA 1B87A 3S6FA 4R3LA 3EXNA 5JPHA 3TE4A 1IIDA 4NEXA 2R98A 4CRYB 1J4JA 2RC4A 2OB0A 1I21A 2VZZA 1XIXA 4UWJA 5DWMA 3F0AA 3B8GA 1YX0A 2J8MA 2B3VA 3EFAA 2ZW7A 2C27A 3H4QA 2A4NA 3S6KA 1BO4A 4JLYA 4I49A 2REEA 1P4NA 3R9GA 3TO7A 3RYOA 3ZZIA 3F5BA 2GIVA 3G8WA 3KKWA 4B5PA 2Y0MA 5F47A 3GYAA 3JVNA 2JLMA 2Q0YA 2Q44A 3TFYA 4XPDC 1NMTA 4F0YA 2GANA 5E96A 2FSRA 2OU2A 4OADA 4AVBA 2Q4YA 4XNHC 3FYNA 3I9SA 1Y9WA 4HNWB 2DXQA 1Y7RA 1P0HA 3LD2A 3VWDA 5HMNA 2O28A 4OAEA 4E0AA 2K5TA 4IF5A 2WPXA 1M1DA 4FD7A 4ZBGA 4CRZB 3TOBA 5EC4A 4CAVA 5IV0A 3S6HA 5DWNA 1S3ZA 4HNXB 4PSWA 4LUAA 2HV2A 5I0CA 2CNSA 3DDDA 1ON0A 3FNCA 3BJ8A 1I1DA 2Z10A 2VXKA 3FBUA 1V0CA 4MY0A 3ZJ0A 2Z11A 3FXTA 4PSXA 3SXOA 1CM0A 1OZPA 3FRMA 2OZHA 1M4IA 2P6FA 1MK4A 3N7ZA 1XEBA 3WR7A 2HUZA 4KORA 3PZJA 2FIWA 4KZTA 4JWPA 2FS5A 2NMTA 4X5KA 4H6ZA 3TTHA 5J8FA 3FIXA 3V8IA 2QECA 4KOYA 4MBUA 1M4DA 4MJ8A 4U5YA 3DR6A 2WPWA 1XE4A 3R96A 2VQYA 3W6XA 2P6GA 2QIRA 4AG9A 1LRZA 1Y9KA 2B5GA 3G3SA 4GS4A 4H89A 4HNYB 2PDOA 4AVAA 2R1IA 2P6EA 4LX9A 3DNSA 1KUVA 4B5PB 4L89A 1QSNA 4BMHA 2BUEA 4E8OA 1S60A 2QMLA 3R1KA 3QAHA 1MJBA 2ZW5A 4Y49B 1KUYA 3TO6A 2FL4A 1S7KA 2VZYA 4QVTA 3E0KA 2CNTA 3LODA 2OZGA 2ZW4A 3EY5A 4H6UA 5HH1A 3D3SA 5C82A 1IICA 1Q2DA 3C26A 4AB7A 4KOVA 4U9YA 2FCKA 3MGDA 4K30A 4II9A 4UWIA 1YVKA 3VWEA 1RXTA 4E2AA 3R9EA 3BJ7A 5KTCA 5GCNA 4Y49C 4KLVA 4KOSA 3PP9A 4UBRA 3R95A 4XPKA 1R57A 4HKFA 1K4JA 1IYKA 4PK2A 2ZPAA 2BSWA 1NE9A 2H5MA 4XPLA 2VBQA 4KUBA 3NE7A 1YK3A 4AG7A 4KOUA 1Q2CA 1Q2YA 4AVCA 1Z4EA 2GE3A 4PV6A 4QBJA 2PQ8A 4L8AA 2R8VA 2I79A 2B5GB 3CXPA 4KOXA 4R3KA 1Z9UA 4QUSA 5IX3A 3BLNA 3IWGA 3GY9A 1XF8A 1GHEA 4NCZA 2PR8A 1YGHA 2ATRA 2I00A 3DR8A 5FVJA 2FXFA 2ZW6A 1UFHA 2F5IA 3SHPA 4R9MA 4CS0B 1S7NA 2G3TA 1B6BA 4JJXA 5EBVA 4KUAA 1XMTA 2ZXVA 2R7HA 1QSOA 1KZFA 5CNPA 1SQHA 4CAWA 2CY2A 1WWZA 1TIQA 4ONUA 3T9YA 1NSLA 3T90A 5KTAA 4KVXA 2AJ6A 2CNMA 4YFJA 3EC4A 4XPDB 1RO5A 3S6GA 5H86A 4KVME 4DNCA 5KTDA 4XNHB 2D4PA 1KUXA 4RS2A 4NSQA 4KLWA 4ORFA 5F49A 4NF1A 1IYLA 3D2PA 4J3GA 2PC1A 1WK4A 2B58A 3CXQA 3GKRA 4IUSA 1U6MA 4FD4A 3UY5A 2J8NA 4PK3A 1MJ9A 3TOAA 2VI7A 2KCWA 4KVOE 3W6SA 4EVYA 2B4BA 2EVNA 1I12A 4KOTA 1S7LA 2BEIA 2ARHA 3D2MA 1QSMA 4JXQA 4M85A 1MJAA 2AE6A 3OWCA 4UA3A 5JQ4A 2REFA 1YR0A 2BL1A 2D4OA 4M3SA 4JXRA 1QSRA
chains in the Genus database with same CATH superfamily
5H84A 3QNVA 4QB9A 4U9ZA 4NXYA 3W91A 3NA6A 1PU9A 4C2YA 3CXSA 3KHZA 1VGYA 4C68A 4Q7AA 4C2XA 3H8EA 1L0CA 4ZI6A 3FECA 4MXUA 2BO9A 2JEWA 3B3VA 2FT0A 3PGPA 2Q04A 4MI4A 3WABA 3K9TA 3SI0A 1R43A 1YREA 2B4DB 3GLJA 5F46A 4YGOA 1TKJA 1VIXA 2J8RA 1M4GA 2Q4VA 3HLPA 5LRJA 4R6TA 3D68A 2Q7BA 4A94A 4R87A 1LFWA 3IGRA 1JQGA 4CAXA 1IU8A 1BOBA 3IFEA 4CGLA 2B3UA 4MFLA 4W9YA 2NYQA 1M44A 2CF4A 1CPXA 1N71A 4EMEA 4JD6A 5ISVA 1F57A 2GREA 3TCVA 3KGQA 3D8PA 3PBBA 1PUAA 2YNDA 2G0BA 2PJCA 2X7BA 5C88A 3NH8A 1TKFA 2OZUA 2ODFA 3FEDA 3I3GA 1ELLP 2FIAA 3JUWA 4KOWA 2AFSA 2ZEHA 3PRTA 1IGBA 3NE8A 4A37A 2FE7A 4MHDA 3P2HA 5IB0A 3RAMA 1CP7A 4WWVA 1VKCA 4PXDA 1YVOA 1FY7A 2DF5A 4R76A 3K9UA 5F48A 2B4DA 1IB1E 3FB3A 1X10A 3QB8A 4DYOA 3TT2A 3FH4A 4OC5A 3WC5A 5JGFA 1Q7LA 3FF3A 4MCRA 2PE3A 1ZO0A 5LYDA 3KASA 4CGMA 2IL4A 4MCPA 1QSTA 1X12A 4B5OA 2PSWA 2O4HA 4R57A 3R9FA 1CJWA 1HEEA 2PJ4A 4C2ZA 5HVHA 4NJRA 1ZG9A 2JDCA 2JEVA 3DSBA 3F8KA 4OLLA 2PVWA 4P10A 5AG6A 5CBMA 4A38A 2PJ9A 1YLEA 2Z0ZA 3SXNA 2VEZA 2WZNA 4F6AA 5J1QA 2PR1A 2EUIA 3KI9A 4QC6A 1GYTA 3D66A 2DPSA 2OH1A 4KSIA 5J8CA 3KL9A 2G3AA 3B2YA 2PJ5A 2C6PA 3SJXA 5LYIA 1Z4RA 3FX6A 1S5KA 1VHSA 2XEGA 4MHZA 4UCPA 1S7FA 3HUVA 4YRHA 3TC8A 4MY3A 2Z3PA 4RI1A 4B13A 5K8PA 4FD5A 2PRBA 3EO4A 3CT9A 3FMCA 3FEEA 2HQYA 2QYVA 4PXBA 4FD6A 3B7IA 2P0WA 3P2FA 3TO9A 2JDDA 2IMOA 2Z3LA 5K8MA 4OC1A 2PJ2A 1B87A 3S6FA 4UCMA 3H8FA 2JBKA 4R3LA 3EXNA 5JPHA 3TE4A 3LWUA 4F9VA 1YW4A 1IIDA 4G1PA 4NEXA 4F0XA 1CX8A 3CPAA 1YSJA 2R98A 4CRYB 1J4JA 1HDQA 2RC4A 2OB0A 4WJBA 1F2OA 1I21A 2IQ6A 1XIXA 2VZZA 4UCNA 4UWJA 1ELMP 5DWMA 3F0AA 3B8GA 1YX0A 5F09A 1ZG7A 1LAMA 2J8MA 2BOAA 5G22A 4JZ0A 2GU2A 3B3WA 2B3VA 2OR4A 3EFAA 3D7FA 2ZW7A 5LRGA 6CPAA 4YU9A 4Z65A 3A9LA 2C27A 3H4QA 2A4NA 3GUXA 3S6KA 2V8HA 3GB0A 1BO4A 2WSAA 4JLYA 2FVGA 3ISXA 4I49A 2REEA 4PXEA 1P4NA 3R9GA 3IWWA 3TO7A 4CYQA 3RYOA 2PCUA 4NGRA 3T8WA 3ZZIA 3F5BA 2GIVA 2PVVA 3G8WA 3KKWA 4B5PA 3S9LA 2Y0MA 5F47A 1IOIA 2ZEGA 3GYAA 2PJ6A 3PB8X 2YNCA 4KSAA 3JVNA 4B12A 5HVGA 2JLMA 2Q0YA 2Q44A 3TFYA 4XPDC 1ZLIA 1NMTA 4F0YA 2GANA 5E96A 2CIJA 2FSRA 2AFXA 2OU2A 4OADA 4ZY2A 4AVBA 2Q4YA 4XNHC 3FYNA 4MFZA 3I9SA 5I4MA 1Y9WA 3IU1A 4HNWB 5A27A 2DXQA 1Y7RA 4CGNA 1P0HA 4EWTA 3LD2A 3VATA 3VWDA 3WC7A 5HMNA 3MN8A 2ZEDA 1LAPA 2O28A 4OAEA 5G21A 4A31A 2K5TA 4E0AA 4IF5A 2WPXA 5AG7A 1M1DA 4FD7A 3ISZA 3LACA 4ZBGA 4CRZB 5BWAB 3QAYA 3TOBA 5G20A 4IK2A 3IWEA 5EC4A 4RN7A 4CAVA 2DEAA 4UIAA 3S6HA 5DWNA 4DJLA 1XBUA 5IV0A 1S3ZA 2ABZA 4TWEA 3KR4A 4HNXB 4PSWA 4LUAA 1Z8LA 2HV2A 2EO8A 5I0CA 2CNSA 4R8FA 4IAVA 4PPZA 4EFDA 3DDDA 4F8ZA 5LRKA 1ON0A 2V8DA 3FNCA 3IC1A 3DGVA 1XMBA 3BJ8A 8CPAA 1I1DA 2Z10A 2VXKA 3JRUA 1Z8TA 3FBUA 2PJ7A 2AFOA 1TF8A 4MFJA 4A33A 1V0CA 4MY0A 3KZWA 3D67A 3ZJ0A 4CYOA 2Z11A 3FXTA 4PSXA 4OC4A 1ARMA 3SXOA 1CM0A 1OZPA 3FRMA 3BHXA 2GLJA 5D8NA 2CXAA 3PB9X 4B11A 2OZHA 3IEHA 4OIDA 3D7GA 1M4IA 2EK9A 1PYTB 4P6YA 2P6FA 1MK4A 3N7ZA 2ZEPA 1XEBA 4JYWA 1IOFA 3B3SA 4HPSA 2C1CA 5LYLA 1YQEA 2POKA 3WR7A 1FNOA 2HUZA 4KORA 4B14A 3BI1A 3RO0A 3PZJA 2FIWA 4KZTA 4JWPA 2NMTA 2FS5A 1NSAA 4M6HA 1DE4C 4X5KA 2PJ0A 4H6ZA 3TTHA 4CAEA 4UF4A 5J8FA 4GM5A 3FIXA 3V8IA 2QECA 4KOYA 2ANPA 1M4DA 2Q4ZA 4MBUA 4MJ8A 4ZYQA 2XEFA 2ZENA 4LQGA 4BINA 4U5YA 2HB6A 3DR6A 3FVLA 2WPWA 1XE4A 4IHMA 1AYEA 3R96A 1YLOA 2VQYA 3W6XA 4CGOA 2P6GA 2QIRA 1TXRA 1CPSA 4Q38A 4FBEA 4AG9A 1EE3P 1BPNA 1LRZA 1Y9KA 2B5GA 2HC9A 3B3CA 3G3SA 4GS4A 4H89A 4HNYB 4UEFA 4YWYA 1CBXA 2XEIA 2PDOA 4AVAA 2R1IA 4B6ZA 4NGMA 2P6EA 1YMEA 4LX9A 3DNSA 1KUVA 3KHXA 4UIBA 4B5PB 4L89A 1YW6A 1QSNA 4BMHA 2BUEA 4E8OA 1S60A 2ZOGA 2QMLA 1ZG8A 1TF9A 3FJUA 4OC3A 4X2TA 3H5ZA 3R1KA 3QAHA 1MJBA 4FUUA 3SJEA 2C6GA 4OC2A 2ZW5A 4Y49B 1KUYA 3H8GA 1ZLHA 2F8HA 5DS0A 3B3TA 2EBJA 2EK8A 3TO6A 2FL4A 1S7KA 2VZYA 4QVTA 5K8OA 2Q51A 5K8NA 3WC6A 2RFHA 3D7HA 4C7HA 3E0KA 5D29A 4Q36A 2CNTA 2Q43A 3LODA 1DTDA 4OP4A 2OZGA 2ZW4A 3PB6X 2WUUA 3EY5A 4TNUA 4KSFA 4H6UA 2Z3OA 2QJ8A 2V8GA 4PQAA 5HH1A 5JM6A 3D3SA 5C82A 1IICA 1Q2DA 3C26A 4P4FA 1JWQA 4AB7A 2Q7SA 1LANA 3CZXA 4KOVA 3SJFA 4FAIA 4OMEA 4U9YA 2FCKA 4R7MA 3MGDA 4MCQA 2AFUA 4A32A 2C6CA 1F2PA 3CDXA 5THWA 4AXVA 4MCSA 4K30A 4CYPA 1PCAA 2Z3NA 1XOVA 2CTBA 4OIWA 4II9A 4UEZA 4UWIA 5AG5A 1YVKA 4MFQA 1FT7A 4MMOA 2YNCC 3VWEA 2GLFA 1Z5RA 4P4IA 1CG2A 1RXTA 3RBUA 5IB9A 4E2AA 4A30A 4UFVA 2ZEEA 3R9EA 3BJ7A 3KQZA 4P4DA 5GCNA 3WT4A 4ZY0A 5KTCA 3BI0A 4MFPA 4Y49C 4ZY1A 4UEEA 1BAVA 2ZOFA 5AG4A 4O23A 4P45A 3IU2A 4KLVA 4KOSA 3PP9A 4P4BA 4UBRA 4A95A 3R95A 4H2KA 4XPKA 3PFEA 2V77A 1RTQA 2AFZA 4P44A 3IO1A 1R57A 4HKFA 1K4JA 1AMPA 1IYKA 3V38A 4BBHA 4PK2A 2ZPAA 1Y7EA 2VL1A 1UWYA 4CAFA 1AUGA 3PFOA 2XEJA 2Z3KA 2BSWA 2AFMA 1NE9A 1Y0RA 5G1ZA 2H5MA 4XPLA 4MHYA 2VBQA 3LMSA 4KUBA 3NE7A 3TX8A 3K2KA 1YK3A 2ZELA 4AG7A 4KOUA 2WYRA 1Q2CA 3MRUA 1Q2YA 4AVCA 2PRQA 1VHEA 4UFXA 2NSMA 1Z4EA 3PB4X 4DUKA 2GE3A 3SI1A 1R3NA 4PV6A 4QBJA 4P4EA 4ONWA 2PIYA 2PQ8A 1LOKA 4L8AA 3VH9A 4PXCA 3NH5A 2O53A 2R8VA 2I79A 2B5GB 5LYFA 5EMIA 3CXPA 1IY7A 1H8LA 2V8VA 4KOXA 4OKOA 4OC0A 1TKHA 4R3KA 5JH9A 1BLLE 1Z9UA 2AFWA 3D7DA 4MRIA 4QUSA 3VARA 5IX3A 3BLNA 3IWGA 3GY9A 1XF8A 2ZEMA 1GHEA 4K3NA 4NCZA 2PR8A 1YGHA 2PJ1A 4ZX8A 4CPAA 2ATRA 2I00A 3DR8A 5FVJA 2FXFA 2ZW6A 1UFHA 1XFOA 2J9AA 3DLJA 2F5IA 4BD9A 3SHPA 5CPAA 2JBJA 2YNEA 4NFRA 5ELYA 2YGWA 4RUHA 1M4LA 4R9MA 4CS0B 2QVPA 3KR5A 1S7NA 2G3TA 4B10A 1B6BA 1Z8WA 4JJXA 3NFZA 5EBVA 3B35A 1ARLA 5A28A 4KUAA 1XMTA 2ZXVA 2R7HA 2G9DA 2OOTA 1QSOA 1KZFA 2PIZA 5CNPA 1SQHA 4CAWA 2CY2A 1WWZA 1TIQA 4ONUA 3SI2A 3PBEA 4NGTA 3SJGA 3T9YA 2EWBA 4MHPA 1NSLA 3T90A 5KTAA 4KVXA 2AJ6A 2CNMA 4YFJA 3L2NA 3EC4A 4NGNA 1XJOA 4XPDB 1RO5A 3S9MA 4X3RA 4FWUA 3S6GA 4UFWA 2PJAA 4LQ6A 1Z2LA 5H86A 1QMUA 4KVME 4DNCA 3KQXA 1CP6A 5KTDA 4XNHB 3D4UA 4GXHA 4KS9A 5HXDA 2D4PA 1KUXA 5HVFA 4MFKA 4M6IA 4RS2A 4NSQA 4CYNA 4KLWA 3I1UA 4ORFA 5F49A 1VHOA 4NF1A 2Z3MA 4NJQA 3JTKA 2BCOA 1IYLA 4NGQA 3D2PA 2I3CA 4NGSA 2PJ3A 4J3GA 3NH4A 3N5FA 3PB7X 3S9NA 2PC1A 1WK4A 2B58A 3CXQA 3GKRA 4IUSA 7CPAA 1U6MA 4FD4A 3UY5A 2ZEOA 2DPTA 3RZAA 2J8NA 4MHNA 4PK3A 4C7IA 1MJ9A 3V7ZA 3TOAA 2VI7A 2KCWA 3RNZA 1XRYA 2GFQA 4KVOE 3W6SA 2ZEFA 3IIBA 3GIUA 4EVYA 2B4BA 4ZGYB 2EVNA 1OBRA 2F7VA 1I12A 1S7LA 4KOTA 1BPMA 1LCPA 2BEIA 2IJZA 2ARHA 4NGPA 1HDUA 4CGPA 1A2ZA 4P4JA 4ZX9A 3D2MA 1QSMA 4JXQA 2PJBA 3PEIA 1MJAA 2AE6A 3OWCA 1KWMA 4M85A 2PJ8A 3IJ3A 1QQ9A 4UA3A 4M6GA 4F9UA 5JQ4A 2REFA 1YR0A 4X8IA 2BL1A 4A2ZA 1Y0YA 1Z8XA 4A39A 2D4OA 3BXMA 3CPXA 2RB7A 2CTCA 5AGEA 4M3SA 4JXRA 1QSRA
chains in the Genus database with same CATH topology
5H84A 4QB9A 4U9ZA 4NXYA 3W91A 1PU9A 4C2YA 3CXSA 4C68A 4C2XA 1L0CA 2FT0A 3PGPA 2Q04A 4MI4A 1YREA 5F46A 2B4DB 4YGOA 2J8RA 1M4GA 2Q4VA 2Q7BA 4R87A 3IGRA 4CAXA 1BOBA 4CGLA 2B3UA 4MFLA 1M44A 5ISVA 1N71A 4JD6A 3TCVA 3D8PA 1PUAA 2YNDA 2G0BA 2X7BA 5C88A 2OZUA 3JUWA 3I3GA 2FIAA 4KOWA 2FE7A 4MHDA 3P2HA 5IB0A 1VKCA 1YVOA 1FY7A 3K9UA 5F48A 2B4DA 1IB1E 3FB3A 3QB8A 3TT2A 1ZO0A 4CGMA 2IL4A 1QSTA 4B5OA 2PSWA 4R57A 3R9FA 1CJWA 4C2ZA 2JDCA 2JEVA 3DSBA 3F8KA 4OLLA 5AG6A 2Z0ZA 1YLEA 3SXNA 4F6AA 2VEZA 2PR1A 2EUIA 4QC6A 2DPSA 2OH1A 5J8CA 2G3AA 1Z4RA 1VHSA 1S5KA 4UCPA 1S7FA 4YRHA 4MY3A 2Z3PA 4RI1A 4B13A 4FD5A 2PRBA 3EO4A 2HQYA 4FD6A 2P0WA 3P2FA 3TO9A 2JDDA 2Z3LA 1B87A 3S6FA 4UCMA 4R3LA 3EXNA 5JPHA 3TE4A 1IIDA 4NEXA 4F0XA 2R98A 4CRYB 1J4JA 2RC4A 2OB0A 1I21A 2VZZA 1XIXA 4UCNA 4UWJA 5DWMA 3F0AA 3B8GA 1YX0A 2J8MA 5G22A 2B3VA 3EFAA 2ZW7A 3A9LA 2C27A 3H4QA 2A4NA 3S6KA 1BO4A 2WSAA 4JLYA 4I49A 2REEA 1P4NA 3R9GA 3TO7A 4CYQA 3RYOA 3ZZIA 3F5BA 2GIVA 3G8WA 3KKWA 4B5PA 2Y0MA 5F47A 3GYAA 4B12A 2YNCA 4KSAA 3JVNA 2JLMA 2Q0YA 2Q44A 3TFYA 4XPDC 1NMTA 4F0YA 2GANA 5E96A 2FSRA 2OU2A 4OADA 4AVBA 2Q4YA 4XNHC 3FYNA 4MFZA 3I9SA 1Y9WA 3IU1A 4HNWB 5A27A 2DXQA 1Y7RA 4CGNA 1P0HA 3LD2A 3VWDA 5HMNA 2O28A 4OAEA 5G21A 4E0AA 4A31A 2K5TA 4IF5A 2WPXA 5AG7A 1M1DA 4FD7A 4ZBGA 4CRZB 5BWAB 3TOBA 5G20A 3IWEA 5EC4A 4CAVA 5IV0A 3S6HA 5DWNA 1S3ZA 4HNXB 4PSWA 4LUAA 2HV2A 5I0CA 2CNSA 3DDDA 1ON0A 3FNCA 3BJ8A 1I1DA 2Z10A 2VXKA 3FBUA 4MFJA 4A33A 1V0CA 4MY0A 3ZJ0A 4CYOA 2Z11A 3FXTA 4PSXA 3SXOA 1CM0A 1OZPA 3FRMA 2CXAA 4B11A 2OZHA 1M4IA 2P6FA 1MK4A 3N7ZA 1XEBA 3WR7A 2HUZA 4KORA 4B14A 3PZJA 2FIWA 4KZTA 4JWPA 2FS5A 2NMTA 4X5KA 4H6ZA 3TTHA 4CAEA 5J8FA 3FIXA 3V8IA 2QECA 4KOYA 4MBUA 1M4DA 4MJ8A 4U5YA 3DR6A 2WPWA 1XE4A 3R96A 4CGOA 2VQYA 3W6XA 2P6GA 2QIRA 4Q38A 4AG9A 1LRZA 1Y9KA 2B5GA 3G3SA 4GS4A 4H89A 4HNYB 2PDOA 4AVAA 2R1IA 2P6EA 4LX9A 3DNSA 1KUVA 4B5PB 4L89A 1QSNA 4BMHA 2BUEA 4E8OA 1S60A 2QMLA 3H5ZA 3R1KA 3QAHA 1MJBA 2ZW5A 4Y49B 1KUYA 3TO6A 2FL4A 1S7KA 2VZYA 4QVTA 4C7HA 3E0KA 4Q36A 2CNTA 3LODA 2OZGA 2ZW4A 2WUUA 3EY5A 4KSFA 4H6UA 2Z3OA 5HH1A 3D3SA 5C82A 1IICA 1Q2DA 3C26A 4AB7A 4KOVA 4U9YA 2FCKA 3MGDA 4A32A 4K30A 4CYPA 2Z3NA 4II9A 4UWIA 5AG5A 1YVKA 4MFQA 2YNCC 3VWEA 1RXTA 4E2AA 4A30A 4UFVA 3R9EA 3BJ7A 5KTCA 5GCNA 4MFPA 4Y49C 5AG4A 4KLVA 4KOSA 3PP9A 4A95A 4UBRA 3R95A 4XPKA 1R57A 4HKFA 1K4JA 1IYKA 4BBHA 4PK2A 2ZPAA 4CAFA 2Z3KA 2BSWA 5G1ZA 1NE9A 2H5MA 4XPLA 2VBQA 4KUBA 3NE7A 1YK3A 4AG7A 4KOUA 1Q2CA 1Q2YA 4AVCA 4UFXA 1Z4EA 2GE3A 4PV6A 4QBJA 2PQ8A 4L8AA 2R8VA 2I79A 2B5GB 3CXPA 4KOXA 4R3KA 1Z9UA 4QUSA 5IX3A 3BLNA 3IWGA 3GY9A 1XF8A 1GHEA 4NCZA 2PR8A 1YGHA 2ATRA 2I00A 3DR8A 5FVJA 2FXFA 2ZW6A 1UFHA 2F5IA 3SHPA 2YNEA 2YGWA 4R9MA 4CS0B 1S7NA 2G3TA 4B10A 1B6BA 4JJXA 5EBVA 5A28A 4KUAA 1XMTA 2ZXVA 2R7HA 1QSOA 1KZFA 5CNPA 1SQHA 4CAWA 2CY2A 1WWZA 1TIQA 4ONUA 3T9YA 1NSLA 3T90A 5KTAA 4KVXA 2AJ6A 2CNMA 4YFJA 3EC4A 4XPDB 1RO5A 3S6GA 4UFWA 5H86A 4KVME 4DNCA 5KTDA 4XNHB 4KS9A 2D4PA 1KUXA 4MFKA 4RS2A 4NSQA 4CYNA 4KLWA 4ORFA 5F49A 4NF1A 2Z3MA 3JTKA 1IYLA 3D2PA 4J3GA 2PC1A 1WK4A 2B58A 3CXQA 3GKRA 4IUSA 1U6MA 4FD4A 3UY5A 2DPTA 2J8NA 4PK3A 4C7IA 1MJ9A 3TOAA 2VI7A 2KCWA 4KVOE 3W6SA 4EVYA 2B4BA 4ZGYB 2EVNA 1I12A 1S7LA 4KOTA 2BEIA 2ARHA 4CGPA 3D2MA 1QSMA 4JXQA 4M85A 1MJAA 2AE6A 3OWCA 4UA3A 5JQ4A 2REFA 1YR0A 2BL1A 4A2ZA 2D4OA 3IU2A 5AGEA 4M3SA 4JXRA 1QSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H84 A;  4QB9 A;  4U9Z A;  4NXY A;  3W91 A;  1PU9 A;  3CXS A;  1L0C A;  2FT0 A;  3PGP A;  2Q04 A;  4MI4 A;  1YRE A;  5F46 A;  2B4D B;  4YGO A;  2J8R A;  1M4G A;  2Q4V A;  2Q7B A;  4R87 A;  3IGR A;  4CAX A;  1BOB A;  2B3U A;  1M44 A;  5ISV A;  1N71 A;  4JD6 A;  3TCV A;  3D8P A;  1PUA A;  2G0B A;  2X7B A;  5C88 A;  2OZU A;  3JUW A;  3I3G A;  2FIA A;  4KOW A;  2FE7 A;  4MHD A;  3P2H A;  5IB0 A;  1VKC A;  1YVO A;  1FY7 A;  3K9U A;  5F48 A;  2B4D A;  1IB1 E;  3FB3 A;  3QB8 A;  3TT2 A;  2IL4 A;  1QST A;  4B5O A;  2PSW A;  4R57 A;  3R9F A;  1CJW A;  2JDC A;  2JEV A;  3DSB A;  3F8K A;  4OLL A;  2Z0Z A;  1YLE A;  3SXN A;  4F6A A;  2VEZ A;  2PR1 A;  2EUI A;  4QC6 A;  2OH1 A;  5J8C A;  2G3A A;  1Z4R A;  1VHS A;  1S5K A;  1S7F A;  4YRH A;  4MY3 A;  4RI1 A;  4FD5 A;  2PRB A;  3EO4 A;  2HQY A;  4FD6 A;  2P0W A;  3P2F A;  3TO9 A;  2JDD A;  1B87 A;  3S6F A;  4R3L A;  3EXN A;  5JPH A;  3TE4 A;  1IID A;  4NEX A;  2R98 A;  4CRY B;  1J4J A;  2RC4 A;  2OB0 A;  1I21 A;  2VZZ A;  1XIX A;  4UWJ A;  5DWM A;  3F0A A;  3B8G A;  1YX0 A;  2J8M A;  2B3V A;  3EFA A;  2ZW7 A;  2C27 A;  3H4Q A;  2A4N A;  3S6K A;  1BO4 A;  4JLY A;  4I49 A;  2REE A;  1P4N A;  3R9G A;  3TO7 A;  3RYO A;  3ZZI A;  3F5B A;  2GIV A;  3G8W A;  3KKW A;  4B5P A;  2Y0M A;  5F47 A;  3GYA A;  3JVN A;  2JLM A;  2Q0Y A;  2Q44 A;  3TFY A;  4XPD C;  1NMT A;  4F0Y A;  2GAN A;  5E96 A;  2FSR A;  2OU2 A;  4OAD A;  4AVB A;  2Q4Y A;  4XNH C;  3FYN A;  3I9S A;  1Y9W A;  4HNW B;  2DXQ A;  1Y7R A;  1P0H A;  3LD2 A;  3VWD A;  5HMN A;  2O28 A;  4OAE A;  4E0A A;  2K5T A;  4IF5 A;  2WPX A;  1M1D A;  4FD7 A;  4ZBG A;  4CRZ B;  3TOB A;  5EC4 A;  4CAV A;  5IV0 A;  3S6H A;  5DWN A;  1S3Z A;  4HNX B;  4PSW A;  4LUA A;  2HV2 A;  5I0C A;  2CNS A;  3DDD A;  1ON0 A;  3FNC A;  3BJ8 A;  1I1D A;  2Z10 A;  2VXK A;  3FBU A;  1V0C A;  4MY0 A;  3ZJ0 A;  2Z11 A;  3FXT A;  4PSX A;  3SXO A;  1CM0 A;  1OZP A;  3FRM A;  2OZH A;  1M4I A;  2P6F A;  1MK4 A;  3N7Z A;  1XEB A;  3WR7 A;  2HUZ A;  4KOR A;  3PZJ A;  2FIW A;  4KZT A;  4JWP A;  2FS5 A;  2NMT A;  4X5K A;  4H6Z A;  3TTH A;  5J8F A;  3FIX A;  3V8I A;  2QEC A;  4KOY A;  4MBU A;  1M4D A;  4MJ8 A;  4U5Y A;  3DR6 A;  2WPW A;  1XE4 A;  3R96 A;  2VQY A;  3W6X A;  2P6G A;  2QIR A;  4AG9 A;  1LRZ A;  1Y9K A;  2B5G A;  3G3S A;  4GS4 A;  4H89 A;  4HNY B;  2PDO A;  4AVA A;  2R1I A;  2P6E A;  4LX9 A;  3DNS A;  1KUV A;  4B5P B;  4L89 A;  1QSN A;  4BMH A;  2BUE A;  4E8O A;  1S60 A;  2QML A;  3R1K A;  3QAH A;  1MJB A;  2ZW5 A;  4Y49 B;  1KUY A;  3TO6 A;  2FL4 A;  1S7K A;  2VZY A;  4QVT A;  3E0K A;  2CNT A;  3LOD A;  2OZG A;  2ZW4 A;  3EY5 A;  4H6U A;  5HH1 A;  3D3S A;  5C82 A;  1IIC A;  1Q2D A;  3C26 A;  4AB7 A;  4KOV A;  4U9Y A;  2FCK A;  3MGD A;  4K30 A;  4II9 A;  4UWI A;  1YVK A;  3VWE A;  1RXT A;  4E2A A;  3R9E A;  3BJ7 A;  5KTC A;  5GCN A;  4Y49 C;  4KLV A;  4KOS A;  3PP9 A;  4UBR A;  3R95 A;  4XPK A;  1R57 A;  4HKF A;  1K4J A;  1IYK A;  4PK2 A;  2ZPA A;  2BSW A;  1NE9 A;  2H5M A;  4XPL A;  2VBQ A;  4KUB A;  3NE7 A;  1YK3 A;  4AG7 A;  4KOU A;  1Q2C A;  1Q2Y A;  4AVC A;  1Z4E A;  2GE3 A;  4PV6 A;  4QBJ A;  2PQ8 A;  4L8A A;  2R8V A;  2I79 A;  2B5G B;  3CXP A;  4KOX A;  4R3K A;  1Z9U A;  4QUS A;  5IX3 A;  3BLN A;  3IWG A;  3GY9 A;  1XF8 A;  1GHE A;  4NCZ A;  2PR8 A;  1YGH A;  2ATR A;  2I00 A;  3DR8 A;  5FVJ A;  2FXF A;  2ZW6 A;  1UFH A;  2F5I A;  3SHP A;  4R9M A;  4CS0 B;  1S7N A;  2G3T A;  1B6B A;  4JJX A;  5EBV A;  4KUA A;  1XMT A;  2ZXV A;  2R7H A;  1QSO A;  1KZF A;  5CNP A;  1SQH A;  4CAW A;  2CY2 A;  1WWZ A;  1TIQ A;  4ONU A;  3T9Y A;  1NSL A;  3T90 A;  5KTA A;  4KVX A;  2AJ6 A;  2CNM A;  4YFJ A;  3EC4 A;  4XPD B;  1RO5 A;  3S6G A;  5H86 A;  4KVM E;  4DNC A;  5KTD A;  4XNH B;  2D4P A;  1KUX A;  4RS2 A;  4NSQ A;  4KLW A;  4ORF A;  5F49 A;  4NF1 A;  1IYL A;  3D2P A;  4J3G A;  2PC1 A;  1WK4 A;  2B58 A;  3CXQ A;  3GKR A;  4IUS A;  1U6M A;  4FD4 A;  3UY5 A;  2J8N A;  4PK3 A;  1MJ9 A;  3TOA A;  2VI7 A;  2KCW A;  4KVO E;  3W6S A;  4EVY A;  2B4B A;  2EVN A;  1I12 A;  4KOT A;  1S7L A;  2BEI A;  2ARH A;  3D2M A;  1QSM A;  4JXQ A;  4M85 A;  1MJA A;  2AE6 A;  3OWC A;  4UA3 A;  5JQ4 A;  2REF A;  1YR0 A;  2BL1 A;  2D4O A;  4M3S A;  4JXR A;  1QSR A; 
#chains in the Genus database with same CATH topology
 5H84 A;  3QNV A;  4QB9 A;  4U9Z A;  4NXY A;  3W91 A;  3NA6 A;  1PU9 A;  4C2Y A;  3CXS A;  3KHZ A;  1VGY A;  4C68 A;  4Q7A A;  4C2X A;  3H8E A;  1L0C A;  4ZI6 A;  3FEC A;  4MXU A;  2BO9 A;  2JEW A;  3B3V A;  2FT0 A;  3PGP A;  2Q04 A;  4MI4 A;  3WAB A;  3K9T A;  3SI0 A;  1R43 A;  1YRE A;  2B4D B;  3GLJ A;  5F46 A;  4YGO A;  1TKJ A;  1VIX A;  2J8R A;  1M4G A;  2Q4V A;  3HLP A;  5LRJ A;  4R6T A;  3D68 A;  2Q7B A;  4A94 A;  4R87 A;  1LFW A;  3IGR A;  1JQG A;  4CAX A;  1IU8 A;  1BOB A;  3IFE A;  4CGL A;  2B3U A;  4MFL A;  4W9Y A;  2NYQ A;  1M44 A;  2CF4 A;  1CPX A;  1N71 A;  4EME A;  4JD6 A;  5ISV A;  1F57 A;  2GRE A;  3TCV A;  3KGQ A;  3D8P A;  3PBB A;  1PUA A;  2YND A;  2G0B A;  2PJC A;  2X7B A;  5C88 A;  3NH8 A;  1TKF A;  2OZU A;  2ODF A;  3FED A;  3I3G A;  1ELL P;  2FIA A;  3JUW A;  4KOW A;  2AFS A;  2ZEH A;  3PRT A;  1IGB A;  3NE8 A;  4A37 A;  2FE7 A;  4MHD A;  3P2H A;  5IB0 A;  3RAM A;  1CP7 A;  4WWV A;  1VKC A;  4PXD A;  1YVO A;  1FY7 A;  2DF5 A;  4R76 A;  3K9U A;  5F48 A;  2B4D A;  1IB1 E;  3FB3 A;  1X10 A;  3QB8 A;  4DYO A;  3TT2 A;  3FH4 A;  4OC5 A;  3WC5 A;  5JGF A;  1Q7L A;  3FF3 A;  4MCR A;  2PE3 A;  1ZO0 A;  5LYD A;  3KAS A;  4CGM A;  2IL4 A;  4MCP A;  1QST A;  1X12 A;  4B5O A;  2PSW A;  2O4H A;  4R57 A;  3R9F A;  1CJW A;  1HEE A;  2PJ4 A;  4C2Z A;  5HVH A;  4NJR A;  1ZG9 A;  2JDC A;  2JEV A;  3DSB A;  3F8K A;  4OLL A;  2PVW A;  4P10 A;  5AG6 A;  5CBM A;  4A38 A;  2PJ9 A;  1YLE A;  2Z0Z A;  3SXN A;  2VEZ A;  2WZN A;  4F6A A;  5J1Q A;  2PR1 A;  2EUI A;  3KI9 A;  4QC6 A;  1GYT A;  3D66 A;  2DPS A;  2OH1 A;  4KSI A;  5J8C A;  3KL9 A;  2G3A A;  3B2Y A;  2PJ5 A;  2C6P A;  3SJX A;  5LYI A;  1Z4R A;  3FX6 A;  1S5K A;  1VHS A;  2XEG A;  4MHZ A;  4UCP A;  1S7F A;  3HUV A;  4YRH A;  3TC8 A;  4MY3 A;  2Z3P A;  4RI1 A;  4B13 A;  5K8P A;  4FD5 A;  2PRB A;  3EO4 A;  3CT9 A;  3FMC A;  3FEE A;  2HQY A;  2QYV A;  4PXB A;  4FD6 A;  3B7I A;  2P0W A;  3P2F A;  3TO9 A;  2JDD A;  2IMO A;  2Z3L A;  5K8M A;  4OC1 A;  2PJ2 A;  1B87 A;  3S6F A;  4UCM A;  3H8F A;  2JBK A;  4R3L A;  3EXN A;  5JPH A;  3TE4 A;  3LWU A;  4F9V A;  1YW4 A;  1IID A;  4G1P A;  4NEX A;  4F0X A;  1CX8 A;  3CPA A;  1YSJ A;  2R98 A;  4CRY B;  1J4J A;  1HDQ A;  2RC4 A;  2OB0 A;  4WJB A;  1F2O A;  1I21 A;  2IQ6 A;  1XIX A;  2VZZ A;  4UCN A;  4UWJ A;  1ELM P;  5DWM A;  3F0A A;  3B8G A;  1YX0 A;  5F09 A;  1ZG7 A;  1LAM A;  2J8M A;  2BOA A;  5G22 A;  4JZ0 A;  2GU2 A;  3B3W A;  2B3V A;  2OR4 A;  3EFA A;  3D7F A;  2ZW7 A;  5LRG A;  6CPA A;  4YU9 A;  4Z65 A;  3A9L A;  2C27 A;  3H4Q A;  2A4N A;  3GUX A;  3S6K A;  2V8H A;  3GB0 A;  1BO4 A;  2WSA A;  4JLY A;  2FVG A;  3ISX A;  4I49 A;  2REE A;  4PXE A;  1P4N A;  3R9G A;  3IWW A;  3TO7 A;  4CYQ A;  3RYO A;  2PCU A;  4NGR A;  3T8W A;  3ZZI A;  3F5B A;  2GIV A;  2PVV A;  3G8W A;  3KKW A;  4B5P A;  3S9L A;  2Y0M A;  5F47 A;  1IOI A;  2ZEG A;  3GYA A;  2PJ6 A;  3PB8 X;  2YNC A;  4KSA A;  3JVN A;  4B12 A;  5HVG A;  2JLM A;  2Q0Y A;  2Q44 A;  3TFY A;  4XPD C;  1ZLI A;  1NMT A;  4F0Y A;  2GAN A;  5E96 A;  2CIJ A;  2FSR A;  2AFX A;  2OU2 A;  4OAD A;  4ZY2 A;  4AVB A;  2Q4Y A;  4XNH C;  3FYN A;  4MFZ A;  3I9S A;  5I4M A;  1Y9W A;  3IU1 A;  4HNW B;  5A27 A;  2DXQ A;  1Y7R A;  4CGN A;  1P0H A;  4EWT A;  3LD2 A;  3VAT A;  3VWD A;  3WC7 A;  5HMN A;  3MN8 A;  2ZED A;  1LAP A;  2O28 A;  4OAE A;  5G21 A;  4A31 A;  2K5T A;  4E0A A;  4IF5 A;  2WPX A;  5AG7 A;  1M1D A;  4FD7 A;  3ISZ A;  3LAC A;  4ZBG A;  4CRZ B;  5BWA B;  3QAY A;  3TOB A;  5G20 A;  4IK2 A;  3IWE A;  5EC4 A;  4RN7 A;  4CAV A;  2DEA A;  4UIA A;  3S6H A;  5DWN A;  4DJL A;  1XBU A;  5IV0 A;  1S3Z A;  2ABZ A;  4TWE A;  3KR4 A;  4HNX B;  4PSW A;  4LUA A;  1Z8L A;  2HV2 A;  2EO8 A;  5I0C A;  2CNS A;  4R8F A;  4IAV A;  4PPZ A;  4EFD A;  3DDD A;  4F8Z A;  5LRK A;  1ON0 A;  2V8D A;  3FNC A;  3IC1 A;  3DGV A;  1XMB A;  3BJ8 A;  8CPA A;  1I1D A;  2Z10 A;  2VXK A;  3JRU A;  1Z8T A;  3FBU A;  2PJ7 A;  2AFO A;  1TF8 A;  4MFJ A;  4A33 A;  1V0C A;  4MY0 A;  3KZW A;  3D67 A;  3ZJ0 A;  4CYO A;  2Z11 A;  3FXT A;  4PSX A;  4OC4 A;  1ARM A;  3SXO A;  1CM0 A;  1OZP A;  3FRM A;  3BHX A;  2GLJ A;  5D8N A;  2CXA A;  3PB9 X;  4B11 A;  2OZH A;  3IEH A;  4OID A;  3D7G A;  1M4I A;  2EK9 A;  1PYT B;  4P6Y A;  2P6F A;  1MK4 A;  3N7Z A;  2ZEP A;  1XEB A;  4JYW A;  1IOF A;  3B3S A;  4HPS A;  2C1C A;  5LYL A;  1YQE A;  2POK A;  3WR7 A;  1FNO A;  2HUZ A;  4KOR A;  4B14 A;  3BI1 A;  3RO0 A;  3PZJ A;  2FIW A;  4KZT A;  4JWP A;  2NMT A;  2FS5 A;  1NSA A;  4M6H A;  1DE4 C;  4X5K A;  2PJ0 A;  4H6Z A;  3TTH A;  4CAE A;  4UF4 A;  5J8F A;  4GM5 A;  3FIX A;  3V8I A;  2QEC A;  4KOY A;  2ANP A;  1M4D A;  2Q4Z A;  4MBU A;  4MJ8 A;  4ZYQ A;  2XEF A;  2ZEN A;  4LQG A;  4BIN A;  4U5Y A;  2HB6 A;  3DR6 A;  3FVL A;  2WPW A;  1XE4 A;  4IHM A;  1AYE A;  3R96 A;  1YLO A;  2VQY A;  3W6X A;  4CGO A;  2P6G A;  2QIR A;  1TXR A;  1CPS A;  4Q38 A;  4FBE A;  4AG9 A;  1EE3 P;  1BPN A;  1LRZ A;  1Y9K A;  2B5G A;  2HC9 A;  3B3C A;  3G3S A;  4GS4 A;  4H89 A;  4HNY B;  4UEF A;  4YWY A;  1CBX A;  2XEI A;  2PDO A;  4AVA A;  2R1I A;  4B6Z A;  4NGM A;  2P6E A;  1YME A;  4LX9 A;  3DNS A;  1KUV A;  3KHX A;  4UIB A;  4B5P B;  4L89 A;  1YW6 A;  1QSN A;  4BMH A;  2BUE A;  4E8O A;  1S60 A;  2ZOG A;  2QML A;  1ZG8 A;  1TF9 A;  3FJU A;  4OC3 A;  4X2T A;  3H5Z A;  3R1K A;  3QAH A;  1MJB A;  4FUU A;  3SJE A;  2C6G A;  4OC2 A;  2ZW5 A;  4Y49 B;  1KUY A;  3H8G A;  1ZLH A;  2F8H A;  5DS0 A;  3B3T A;  2EBJ A;  2EK8 A;  3TO6 A;  2FL4 A;  1S7K A;  2VZY A;  4QVT A;  5K8O A;  2Q51 A;  5K8N A;  3WC6 A;  2RFH A;  3D7H A;  4C7H A;  3E0K A;  5D29 A;  4Q36 A;  2CNT A;  2Q43 A;  3LOD A;  1DTD A;  4OP4 A;  2OZG A;  2ZW4 A;  3PB6 X;  2WUU A;  3EY5 A;  4TNU A;  4KSF A;  4H6U A;  2Z3O A;  2QJ8 A;  2V8G A;  4PQA A;  5HH1 A;  5JM6 A;  3D3S A;  5C82 A;  1IIC A;  1Q2D A;  3C26 A;  4P4F A;  1JWQ A;  4AB7 A;  2Q7S A;  1LAN A;  3CZX A;  4KOV A;  3SJF A;  4FAI A;  4OME A;  4U9Y A;  2FCK A;  4R7M A;  3MGD A;  4MCQ A;  2AFU A;  4A32 A;  2C6C A;  1F2P A;  3CDX A;  5THW A;  4AXV A;  4MCS A;  4K30 A;  4CYP A;  1PCA A;  2Z3N A;  1XOV A;  2CTB A;  4OIW A;  4II9 A;  4UEZ A;  4UWI A;  5AG5 A;  1YVK A;  4MFQ A;  1FT7 A;  4MMO A;  2YNC C;  3VWE A;  2GLF A;  1Z5R A;  4P4I A;  1CG2 A;  1RXT A;  3RBU A;  5IB9 A;  4E2A A;  4A30 A;  4UFV A;  2ZEE A;  3R9E A;  3BJ7 A;  3KQZ A;  4P4D A;  5GCN A;  3WT4 A;  4ZY0 A;  5KTC A;  3BI0 A;  4MFP A;  4Y49 C;  4ZY1 A;  4UEE A;  1BAV A;  2ZOF A;  5AG4 A;  4O23 A;  4P45 A;  3IU2 A;  4KLV A;  4KOS A;  3PP9 A;  4P4B A;  4UBR A;  4A95 A;  3R95 A;  4H2K A;  4XPK A;  3PFE A;  2V77 A;  1RTQ A;  2AFZ A;  4P44 A;  3IO1 A;  1R57 A;  4HKF A;  1K4J A;  1AMP A;  1IYK A;  3V38 A;  4BBH A;  4PK2 A;  2ZPA A;  1Y7E A;  2VL1 A;  1UWY A;  4CAF A;  1AUG A;  3PFO A;  2XEJ A;  2Z3K A;  2BSW A;  2AFM A;  1NE9 A;  1Y0R A;  5G1Z A;  2H5M A;  4XPL A;  4MHY A;  2VBQ A;  3LMS A;  4KUB A;  3NE7 A;  3TX8 A;  3K2K A;  1YK3 A;  2ZEL A;  4AG7 A;  4KOU A;  2WYR A;  1Q2C A;  3MRU A;  1Q2Y A;  4AVC A;  2PRQ A;  1VHE A;  4UFX A;  2NSM A;  1Z4E A;  3PB4 X;  4DUK A;  2GE3 A;  3SI1 A;  1R3N A;  4PV6 A;  4QBJ A;  4P4E A;  4ONW A;  2PIY A;  2PQ8 A;  1LOK A;  4L8A A;  3VH9 A;  4PXC A;  3NH5 A;  2O53 A;  2R8V A;  2I79 A;  2B5G B;  5LYF A;  5EMI A;  3CXP A;  1IY7 A;  1H8L A;  2V8V A;  4KOX A;  4OKO A;  4OC0 A;  1TKH A;  4R3K A;  5JH9 A;  1BLL E;  1Z9U A;  2AFW A;  3D7D A;  4MRI A;  4QUS A;  3VAR A;  5IX3 A;  3BLN A;  3IWG A;  3GY9 A;  1XF8 A;  2ZEM A;  1GHE A;  4K3N A;  4NCZ A;  2PR8 A;  1YGH A;  2PJ1 A;  4ZX8 A;  4CPA A;  2ATR A;  2I00 A;  3DR8 A;  5FVJ A;  2FXF A;  2ZW6 A;  1UFH A;  1XFO A;  2J9A A;  3DLJ A;  2F5I A;  4BD9 A;  3SHP A;  5CPA A;  2JBJ A;  2YNE A;  4NFR A;  5ELY A;  2YGW A;  4RUH A;  1M4L A;  4R9M A;  4CS0 B;  2QVP A;  3KR5 A;  1S7N A;  2G3T A;  4B10 A;  1B6B A;  1Z8W A;  4JJX A;  3NFZ A;  5EBV A;  3B35 A;  1ARL A;  5A28 A;  4KUA A;  1XMT A;  2ZXV A;  2R7H A;  2G9D A;  2OOT A;  1QSO A;  1KZF A;  2PIZ A;  5CNP A;  1SQH A;  4CAW A;  2CY2 A;  1WWZ A;  1TIQ A;  4ONU A;  3SI2 A;  3PBE A;  4NGT A;  3SJG A;  3T9Y A;  2EWB A;  4MHP A;  1NSL A;  3T90 A;  5KTA A;  4KVX A;  2AJ6 A;  2CNM A;  4YFJ A;  3L2N A;  3EC4 A;  4NGN A;  1XJO A;  4XPD B;  1RO5 A;  3S9M A;  4X3R A;  4FWU A;  3S6G A;  4UFW A;  2PJA A;  4LQ6 A;  1Z2L A;  5H86 A;  1QMU A;  4KVM E;  4DNC A;  3KQX A;  1CP6 A;  5KTD A;  4XNH B;  3D4U A;  4GXH A;  4KS9 A;  5HXD A;  2D4P A;  1KUX A;  5HVF A;  4MFK A;  4M6I A;  4RS2 A;  4NSQ A;  4CYN A;  4KLW A;  3I1U A;  4ORF A;  5F49 A;  1VHO A;  4NF1 A;  2Z3M A;  4NJQ A;  3JTK A;  2BCO A;  1IYL A;  4NGQ A;  3D2P A;  2I3C A;  4NGS A;  2PJ3 A;  4J3G A;  3NH4 A;  3N5F A;  3PB7 X;  3S9N A;  2PC1 A;  1WK4 A;  2B58 A;  3CXQ A;  3GKR A;  4IUS A;  7CPA A;  1U6M A;  4FD4 A;  3UY5 A;  2ZEO A;  2DPT A;  3RZA A;  2J8N A;  4MHN A;  4PK3 A;  4C7I A;  1MJ9 A;  3V7Z A;  3TOA A;  2VI7 A;  2KCW A;  3RNZ A;  1XRY A;  2GFQ A;  4KVO E;  3W6S A;  2ZEF A;  3IIB A;  3GIU A;  4EVY A;  2B4B A;  4ZGY B;  2EVN A;  1OBR A;  2F7V A;  1I12 A;  1S7L A;  4KOT A;  1BPM A;  1LCP A;  2BEI A;  2IJZ A;  2ARH A;  4NGP A;  1HDU A;  4CGP A;  1A2Z A;  4P4J A;  4ZX9 A;  3D2M A;  1QSM A;  4JXQ A;  2PJB A;  3PEI A;  1MJA A;  2AE6 A;  3OWC A;  1KWM A;  4M85 A;  2PJ8 A;  3IJ3 A;  1QQ9 A;  4UA3 A;  4M6G A;  4F9U A;  5JQ4 A;  2REF A;  1YR0 A;  4X8I A;  2BL1 A;  4A2Z A;  1Y0Y A;  1Z8X A;  4A39 A;  2D4O A;  3BXM A;  3CPX A;  2RB7 A;  2CTC A;  5AGE A;  4M3S A;  4JXR A;  1QSR A; 
#chains in the Genus database with same CATH homology
 5H84 A;  4QB9 A;  4U9Z A;  4NXY A;  3W91 A;  1PU9 A;  4C2Y A;  3CXS A;  4C68 A;  4C2X A;  1L0C A;  2FT0 A;  3PGP A;  2Q04 A;  4MI4 A;  1YRE A;  5F46 A;  2B4D B;  4YGO A;  2J8R A;  1M4G A;  2Q4V A;  2Q7B A;  4R87 A;  3IGR A;  4CAX A;  1BOB A;  4CGL A;  2B3U A;  4MFL A;  1M44 A;  5ISV A;  1N71 A;  4JD6 A;  3TCV A;  3D8P A;  1PUA A;  2YND A;  2G0B A;  2X7B A;  5C88 A;  2OZU A;  3JUW A;  3I3G A;  2FIA A;  4KOW A;  2FE7 A;  4MHD A;  3P2H A;  5IB0 A;  1VKC A;  1YVO A;  1FY7 A;  3K9U A;  5F48 A;  2B4D A;  1IB1 E;  3FB3 A;  3QB8 A;  3TT2 A;  1ZO0 A;  4CGM A;  2IL4 A;  1QST A;  4B5O A;  2PSW A;  4R57 A;  3R9F A;  1CJW A;  4C2Z A;  2JDC A;  2JEV A;  3DSB A;  3F8K A;  4OLL A;  5AG6 A;  2Z0Z A;  1YLE A;  3SXN A;  4F6A A;  2VEZ A;  2PR1 A;  2EUI A;  4QC6 A;  2DPS A;  2OH1 A;  5J8C A;  2G3A A;  1Z4R A;  1VHS A;  1S5K A;  4UCP A;  1S7F A;  4YRH A;  4MY3 A;  2Z3P A;  4RI1 A;  4B13 A;  4FD5 A;  2PRB A;  3EO4 A;  2HQY A;  4FD6 A;  2P0W A;  3P2F A;  3TO9 A;  2JDD A;  2Z3L A;  1B87 A;  3S6F A;  4UCM A;  4R3L A;  3EXN A;  5JPH A;  3TE4 A;  1IID A;  4NEX A;  4F0X A;  2R98 A;  4CRY B;  1J4J A;  2RC4 A;  2OB0 A;  1I21 A;  2VZZ A;  1XIX A;  4UCN A;  4UWJ A;  5DWM A;  3F0A A;  3B8G A;  1YX0 A;  2J8M A;  5G22 A;  2B3V A;  3EFA A;  2ZW7 A;  3A9L A;  2C27 A;  3H4Q A;  2A4N A;  3S6K A;  1BO4 A;  2WSA A;  4JLY A;  4I49 A;  2REE A;  1P4N A;  3R9G A;  3TO7 A;  4CYQ A;  3RYO A;  3ZZI A;  3F5B A;  2GIV A;  3G8W A;  3KKW A;  4B5P A;  2Y0M A;  5F47 A;  3GYA A;  4B12 A;  2YNC A;  4KSA A;  3JVN A;  2JLM A;  2Q0Y A;  2Q44 A;  3TFY A;  4XPD C;  1NMT A;  4F0Y A;  2GAN A;  5E96 A;  2FSR A;  2OU2 A;  4OAD A;  4AVB A;  2Q4Y A;  4XNH C;  3FYN A;  4MFZ A;  3I9S A;  1Y9W A;  3IU1 A;  4HNW B;  5A27 A;  2DXQ A;  1Y7R A;  4CGN A;  1P0H A;  3LD2 A;  3VWD A;  5HMN A;  2O28 A;  4OAE A;  5G21 A;  4E0A A;  4A31 A;  2K5T A;  4IF5 A;  2WPX A;  5AG7 A;  1M1D A;  4FD7 A;  4ZBG A;  4CRZ B;  5BWA B;  3TOB A;  5G20 A;  3IWE A;  5EC4 A;  4CAV A;  5IV0 A;  3S6H A;  5DWN A;  1S3Z A;  4HNX B;  4PSW A;  4LUA A;  2HV2 A;  5I0C A;  2CNS A;  3DDD A;  1ON0 A;  3FNC A;  3BJ8 A;  1I1D A;  2Z10 A;  2VXK A;  3FBU A;  4MFJ A;  4A33 A;  1V0C A;  4MY0 A;  3ZJ0 A;  4CYO A;  2Z11 A;  3FXT A;  4PSX A;  3SXO A;  1CM0 A;  1OZP A;  3FRM A;  2CXA A;  4B11 A;  2OZH A;  1M4I A;  2P6F A;  1MK4 A;  3N7Z A;  1XEB A;  3WR7 A;  2HUZ A;  4KOR A;  4B14 A;  3PZJ A;  2FIW A;  4KZT A;  4JWP A;  2FS5 A;  2NMT A;  4X5K A;  4H6Z A;  3TTH A;  4CAE A;  5J8F A;  3FIX A;  3V8I A;  2QEC A;  4KOY A;  4MBU A;  1M4D A;  4MJ8 A;  4U5Y A;  3DR6 A;  2WPW A;  1XE4 A;  3R96 A;  4CGO A;  2VQY A;  3W6X A;  2P6G A;  2QIR A;  4Q38 A;  4AG9 A;  1LRZ A;  1Y9K A;  2B5G A;  3G3S A;  4GS4 A;  4H89 A;  4HNY B;  2PDO A;  4AVA A;  2R1I A;  2P6E A;  4LX9 A;  3DNS A;  1KUV A;  4B5P B;  4L89 A;  1QSN A;  4BMH A;  2BUE A;  4E8O A;  1S60 A;  2QML A;  3H5Z A;  3R1K A;  3QAH A;  1MJB A;  2ZW5 A;  4Y49 B;  1KUY A;  3TO6 A;  2FL4 A;  1S7K A;  2VZY A;  4QVT A;  4C7H A;  3E0K A;  4Q36 A;  2CNT A;  3LOD A;  2OZG A;  2ZW4 A;  2WUU A;  3EY5 A;  4KSF A;  4H6U A;  2Z3O A;  5HH1 A;  3D3S A;  5C82 A;  1IIC A;  1Q2D A;  3C26 A;  4AB7 A;  4KOV A;  4U9Y A;  2FCK A;  3MGD A;  4A32 A;  4K30 A;  4CYP A;  2Z3N A;  4II9 A;  4UWI A;  5AG5 A;  1YVK A;  4MFQ A;  2YNC C;  3VWE A;  1RXT A;  4E2A A;  4A30 A;  4UFV A;  3R9E A;  3BJ7 A;  5KTC A;  5GCN A;  4MFP A;  4Y49 C;  5AG4 A;  4KLV A;  4KOS A;  3PP9 A;  4A95 A;  4UBR A;  3R95 A;  4XPK A;  1R57 A;  4HKF A;  1K4J A;  1IYK A;  4BBH A;  4PK2 A;  2ZPA A;  4CAF A;  2Z3K A;  2BSW A;  5G1Z A;  1NE9 A;  2H5M A;  4XPL A;  2VBQ A;  4KUB A;  3NE7 A;  1YK3 A;  4AG7 A;  4KOU A;  1Q2C A;  1Q2Y A;  4AVC A;  4UFX A;  1Z4E A;  2GE3 A;  4PV6 A;  4QBJ A;  2PQ8 A;  4L8A A;  2R8V A;  2I79 A;  2B5G B;  3CXP A;  4KOX A;  4R3K A;  1Z9U A;  4QUS A;  5IX3 A;  3BLN A;  3IWG A;  3GY9 A;  1XF8 A;  1GHE A;  4NCZ A;  2PR8 A;  1YGH A;  2ATR A;  2I00 A;  3DR8 A;  5FVJ A;  2FXF A;  2ZW6 A;  1UFH A;  2F5I A;  3SHP A;  2YNE A;  2YGW A;  4R9M A;  4CS0 B;  1S7N A;  2G3T A;  4B10 A;  1B6B A;  4JJX A;  5EBV A;  5A28 A;  4KUA A;  1XMT A;  2ZXV A;  2R7H A;  1QSO A;  1KZF A;  5CNP A;  1SQH A;  4CAW A;  2CY2 A;  1WWZ A;  1TIQ A;  4ONU A;  3T9Y A;  1NSL A;  3T90 A;  5KTA A;  4KVX A;  2AJ6 A;  2CNM A;  4YFJ A;  3EC4 A;  4XPD B;  1RO5 A;  3S6G A;  4UFW A;  5H86 A;  4KVM E;  4DNC A;  5KTD A;  4XNH B;  4KS9 A;  2D4P A;  1KUX A;  4MFK A;  4RS2 A;  4NSQ A;  4CYN A;  4KLW A;  4ORF A;  5F49 A;  4NF1 A;  2Z3M A;  3JTK A;  1IYL A;  3D2P A;  4J3G A;  2PC1 A;  1WK4 A;  2B58 A;  3CXQ A;  3GKR A;  4IUS A;  1U6M A;  4FD4 A;  3UY5 A;  2DPT A;  2J8N A;  4PK3 A;  4C7I A;  1MJ9 A;  3TOA A;  2VI7 A;  2KCW A;  4KVO E;  3W6S A;  4EVY A;  2B4B A;  4ZGY B;  2EVN A;  1I12 A;  1S7L A;  4KOT A;  2BEI A;  2ARH A;  4CGP A;  3D2M A;  1QSM A;  4JXQ A;  4M85 A;  1MJA A;  2AE6 A;  3OWC A;  4UA3 A;  5JQ4 A;  2REF A;  1YR0 A;  2BL1 A;  4A2Z A;  2D4O A;  3IU2 A;  5AGE A;  4M3S A;  4JXR A;  1QSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...