3H4QA

Crystal structure of putative acetyltransferase (np_371943.1) from staphylococcus aureus mu50 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
169
structure length
145
Chain Sequence
b'GMIRLGKMSDLDQILNLVEEAKELMKYPLLEHFEEDIAKDYLYVLEENDKIYGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEVILTDTFALNKPAQGLFAKFGFHKVPFYAYYKNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (NP_371943.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.50 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Transferase
total genus 40
structure length 145
sequence length 169
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h4qA00
4UBRA 4Y49B 4QBJA 4UA3A 4GS4A 2Q04A 2B4DB 1QSTA 3VWEA 3TOBA 2REEA 3TOAA 5DWNA 4AG7A 1KUXA 3MGDA 3QAHA 2B5GA 4R3KA 4M85A 1S7LA 3EO4A 2KCWA 5C82A 5E96A 5IX3A 2FXFA 2Q7BA 2EUIA 2FS5A 1I12A 4B5PA 2Y0MA 4XPLA 1KZFA 5H84A 3CXSA 4J3GA 2PQ8A 4KVOE 2GE3A 1YR0A 4H6ZA 2ZW5A 3TO7A 4KLVA 5HMNA 3DR8A 2R1IA 2JDCA 4Y49C 1S5KA 2Q0YA 4PSXA 4R57A 1WK4A 4HNYB 3I9SA 4E2AA 3FNCA 4E0AA 2FT0A 5F46A 1Q2DA 4HNXB 3D3SA 1KUVA 4AVAA 1IIDA 3D8PA 4FD5A 1XF8A 2WPWA 2ZPAA 5KTDA 3B8GA 3NE7A 1QSMA 3TFYA 2Z0ZA 3DDDA 4R3LA 1YVOA 2FIWA 1BOBA 5KTAA 1S7FA 3TO9A 3LODA 3E0KA 2J8MA 1IYLA 2P6FA 3EFAA 3R96A 2R8VA 4KOWA 4KOYA 4UWIA 1Y7RA 4MY3A 4FD6A 4F0YA 4B5OA 4ONUA 3TE4A 3G3SA 4U9YA 2B3VA 4JWPA 4PV6A 2JDDA 4I49A 4NXYA 4JLYA 2Q44A 2R98A 4MHDA 1YGHA 3FXTA 4KOTA 3SHPA 3P2HA 1YX0A 3S6HA 4R87A 3CXPA 3R9EA 1YREA 4YGOA 4U5YA 3EXNA 4FD4A 3I3GA 3QB8A 4JJXA 4XPKA 4II9A 2FCKA 1QSRA 3PGPA 4NSQA 2AJ6A 4X5KA 5EC4A 1VKCA 2CY2A 3PP9A 3DSBA 4XPDB 3KKWA 4JXRA 2PR8A 4KOSA 1ON0A 2AE6A 5FVJA 2VI7A 4HNWB 1PUAA 1LRZA 1GHEA 3T9YA 3WR7A 5C88A 2D4OA 1B87A 4K30A 1MJAA 3F8KA 2H5MA 1MK4A 1S7KA 2B5GB 4KOUA 4CRZB 1MJ9A 2IL4A 1NE9A 3TT2A 2JLMA 3D2MA 1R57A 4KZTA 2ATRA 3T90A 3BLNA 3VWDA 4XPDC 3EY5A 5J8FA 2GANA 5ISVA 5H86A 3F0AA 4LUAA 2O28A 2VZZA 3OWCA 1TIQA 2VZYA 5IB0A 1MJBA 2GIVA 3S6KA 2PC1A 4IF5A 4BMHA 3S6FA 1Y9KA 2RC4A 2OZUA 1BO4A 2Q4YA 4LX9A 4YFJA 1NMTA 3IGRA 3GY9A 1M44A 3JVNA 4UWJA 1XEBA 3R9GA 2F5IA 4F6AA 4H6UA 3K9UA 1Q2YA 4L89A 4MBUA 3TTHA 2ZW6A 3SXOA 1P0HA 1Z4RA 2P6GA 2HUZA 4M3SA 2CNSA 5J8CA 2G3TA 3DR6A 4OAEA 2WPXA 3FB3A 2J8NA 2CNMA 4QB9A 3JUWA 3R1KA 2REFA 4NF1A 4PK2A 1J4JA 1IYKA 1I1DA 4QUSA 1UFHA 2B4BA 5CNPA 4AVCA 3UY5A 1M1DA 1S60A 4KOXA 3C26A 1L0CA 4AB7A 4ZBGA 3GYAA 3V8IA 2G3AA 3ZZIA 4DNCA 1M4IA 1XIXA 1B6BA 2PRBA 2NMTA 4NCZA 2ZW7A 5JQ4A 1CM0A 4YRHA 3PZJA 2OZGA 2OZHA 3TO6A 3N7ZA 2P6EA 1PU9A 2Z11A 3FIXA 4ORFA 4CAWA 1Q2CA 4QC6A 5I0CA 1SQHA 1S7NA 5F49A 4CAXA 2ZXVA 4NEXA 4RI1A 4RS2A 2OU2A 1P4NA 1XMTA 1XE4A 3G8WA 2FL4A 2Z10A 3P2FA 2R7HA 2FE7A 1M4GA 3LD2A 1Z4EA 4KORA 2PR1A 2PDOA 4MY0A 2B4DA 4KLWA 2QMLA 4H89A 1OZPA 3GKRA 4XNHB 2P0WA 5JPHA 2FIAA 4EVYA 1CJWA 4FD7A 3BJ7A 1YK3A 4KUAA 1N71A 3IWGA 1QSOA 2BUEA 1WWZA 2BL1A 4B5PB 2VQYA 1YVKA 2J8RA 2QECA 3R95A 4L8AA 2VBQA 3F5BA 4OLLA 2D4PA 5HH1A 2FSRA 1Z9UA 5KTCA 4U9ZA 1U6MA 4MI4A 4JXQA 3RYOA 5IV0A 2I00A 3TCVA 3DNSA 1RO5A 4MJ8A 5F47A 2PSWA 4XNHC 2I79A 1YLEA 3D2PA 1I21A 4KOVA 4KVME 2C27A 2QIRA 2VXKA 5GCNA 4CAVA 3FBUA 1IB1E 4CS0B 3EC4A 1QSNA 2VEZA 2CNTA 4OADA 4IUSA 4E8OA 2K5TA 2OB0A 2OH1A 4PSWA 1KUYA 4QVTA 3CXQA 4HKFA 3FRMA 1IICA 1V0CA 4R9MA 2HQYA 1S3ZA 5DWMA 4KVXA 2B58A 1RXTA 1VHSA 2HV2A 3R9FA 4AG9A 1K4JA 2Q4VA 2B3UA 3S6GA 2JEVA 3FYNA 4AVBA 2ARHA 2X7BA 3SXNA 3W91A 5EBVA 4CRYB 2ZW4A 4KUBA 1M4DA 2BSWA 3H4QA 3W6XA 1NSLA 5F48A 1FY7A 2G0BA 3W6SA 2A4NA 1Y9WA 4JD6A 4PK3A 2DXQA 2BEIA 2EVNA 3BJ8A 3ZJ0A
chains in the Genus database with same CATH superfamily
4OC1A 1Q7LA 4UBRA 2AFWA 3RZAA 3IC1A 3V7ZA 4Y49B 2PJAA 4MCSA 4QBJA 4UA3A 2ZEDA 3D7GA 4GS4A 2Q04A 2B4DB 1BPMA 1QSTA 2PJ5A 3D7FA 4JYWA 3VH9A 3TOBA 3VWEA 4ZYQA 3DLJA 2CTBA 2REEA 3TOAA 5DWNA 4AG7A 1KUXA 3MGDA 3QAHA 1FT7A 2B5GA 4OC4A 4R3KA 2AFUA 3KR4A 4M85A 1S7LA 3EO4A 2ABZA 4CYPA 2KCWA 5C82A 2YNDA 5E96A 5IX3A 5JH9A 4GXHA 3GUXA 2CF4A 4AXVA 4KS9A 1TF8A 1VHOA 3CPAA 4P4DA 4FBEA 2FXFA 2Q7BA 3QAYA 3TC8A 2JEWA 2EUIA 4B11A 4WWVA 2FS5A 3FECA 5BWAB 4P6YA 4F9UA 3QNVA 3VARA 1I12A 4NJQA 4B5PA 2Y0MA 2PJ1A 4XPLA 1KZFA 5H84A 5LRKA 1X12A 3CXSA 2WYRA 2ANPA 2PQ8A 4J3GA 2GE3A 4KVOE 1YR0A 1CPSA 4H6ZA 5J1QA 2ZW5A 1IU8A 3TO7A 1CP6A 4MFQA 4OC5A 2ZEPA 4KLVA 2POKA 4R7MA 2IMOA 5HMNA 3DR8A 2R1IA 2JDCA 1LOKA 2Z3LA 1Y0YA 4Y49C 5JM6A 1BPNA 3JRUA 5CPAA 5CBMA 4P4JA 1S5KA 1ZLHA 2Q0YA 2O4HA 1CPXA 4PSXA 2C1CA 1WK4A 1YLOA 4R57A 2GLFA 2Q4ZA 4HNYB 4OIDA 1ELLP 3I9SA 4E2AA 3FNCA 4E0AA 2FT0A 3S9NA 5F46A 1LAMA 1Q2DA 4HNXB 3D3SA 4DYOA 1KUVA 4M6HA 2NYQA 4AVAA 2Z3PA 1IIDA 3D8PA 4Z65A 2XEIA 2HC9A 4FD5A 2JBKA 1XF8A 3PB7X 4A30A 2F8HA 2WPWA 1YQEA 4UF4A 2ZPAA 2PJ8A 5KTDA 4MHNA 5ELYA 3B8GA 3NE7A 1QSMA 3TFYA 5K8PA 2Z3KA 2Z0ZA 4H2KA 2C6PA 3DDDA 3A9LA 3PFOA 5JGFA 5LYIA 2V8HA 3LMSA 1YVOA 2AFXA 3PB8X 1ARLA 2ZEHA 2NSMA 4R3LA 4A33A 3B35A 1Z8TA 2FIWA 2CTCA 1BOBA 4ZY0A 5LYDA 5KTAA 4A95A 4YWYA 1S7FA 3TO9A 1LCPA 3LODA 3DGVA 3E0KA 2J8MA 4F9VA 1JQGA 1IYLA 2P6FA 3EFAA 3R96A 4OMEA 2R8VA 4KOWA 4KOYA 3FX6A 1LAPA 2XEJA 4OC2A 4Q36A 4UWIA 1Y7RA 4MY3A 4FD6A 1EE3P 1HEEA 4F0YA 3D68A 4B5OA 4ONUA 3TE4A 4MHYA 3G3SA 4U9YA 1IOFA 3GB0A 4DUKA 2B3VA 4JWPA 4NGMA 2JDDA 4PV6A 4I49A 3RNZA 4CGNA 2ZEOA 4NXYA 1YW4A 4JLYA 2Q44A 2R98A 4MHDA 2ZOGA 5THWA 2V77A 1YGHA 3FXTA 4KOTA 3TX8A 5LYLA 3SHPA 4B13A 1A2ZA 2RB7A 2WSAA 1YX0A 3FH4A 3P2HA 4NGRA 4C2ZA 4PQAA 3S6HA 3S9LA 4G1PA 4R87A 3CXPA 3R9EA 1YREA 4YGOA 1IY7A 4U5YA 2AFSA 3EXNA 3BHXA 3LWUA 2OR4A 4FD4A 2BCOA 3I3GA 2Q7SA 3KASA 3QB8A 4PXBA 4JJXA 4XPKA 5G1ZA 4F0XA 2FCKA 1QSRA 1NSAA 3PGPA 4II9A 2PJ0A 4NSQA 2AJ6A 2Z3NA 5A27A 4X5KA 4FAIA 5EC4A 3SI2A 1VKCA 2CY2A 3PP9A 3DSBA 4B12A 4XPDB 4MFJA 3KKWA 4JXRA 2PR8A 4KOSA 3D66A 1ON0A 2PJ3A 1YW6A 3SJGA 2AE6A 8CPAA 2O53A 4P4FA 4KSAA 3BI1A 4C68A 5FVJA 2VI7A 4HNWB 1PUAA 2V8DA 1LRZA 4UIAA 4CPAA 1GHEA 5AG6A 3T9YA 3SJFA 3WR7A 5C88A 2D4OA 1B87A 4K30A 5G20A 1Z5RA 1MJAA 1IOIA 1TF9A 3F8KA 1VGYA 2H5MA 1MK4A 4HPSA 1S7KA 4MCPA 3KGQA 1XRYA 2F7VA 2DEAA 1OBRA 3FMCA 2B5GB 4KOUA 4P45A 4CRZB 4NGPA 4MHPA 3VATA 5D29A 1MJ9A 2C6GA 2WUUA 1R3NA 2IL4A 1NE9A 2ZEFA 2ZEGA 2G9DA 3KQXA 2JLMA 5G21A 3TT2A 6CPAA 3D2MA 1R57A 4KZTA 2ATRA 3L2NA 3T90A 3BLNA 3VWDA 3IFEA 3I1UA 5LRJA 4XPDC 3EY5A 3K9TA 5J8FA 2GANA 5ISVA 5H86A 5A28A 4IHMA 3F0AA 3RAMA 4LUAA 3H8FA 2O28A 5G22A 4TWEA 3IJ3A 2VZZA 2PCUA 1LFWA 3OWCA 1ZG7A 2ZEMA 3GIUA 1TIQA 4O23A 2VZYA 4MRIA 3PBBA 5IB0A 3B2YA 3PB9X 2PRQA 4A2ZA 2QVPA 7CPAA 1MJBA 5IB9A 1R43A 2GIVA 4OP4A 1Z8WA 3S6KA 1RTQA 3SJEA 2PC1A 4IF5A 4ZX9A 4BMHA 1XFOA 3S6FA 3PRTA 1Y9KA 2RC4A 1M4LA 2OZUA 5LRGA 3HUVA 4YU9A 2PJ4A 1TKFA 1BO4A 2PIYA 2Q4YA 4OIWA 4LX9A 4YFJA 1NMTA 3RO0A 1XBUA 3IGRA 2EK9A 3GY9A 1M44A 3HLPA 3JVNA 4UWJA 4CAEA 1DTDA 1XEBA 3R9GA 4F8ZA 2C6CA 2PJ6A 1ZG8A 1HDUA 3ISZA 5AG5A 2F5IA 4X2TA 4F6AA 4H6UA 1Y0RA 3K9UA 3PFEA 1TXRA 1Q2YA 1AUGA 4L89A 4MBUA 3TTHA 4PXDA 2ZW6A 3IO1A 2DPTA 3SXOA 1P0HA 3JTKA 3BI0A 1ZG9A 1Z4RA 2P6GA 2YNCA 2Z3OA 2HUZA 4M3SA 2CNSA 4RN7A 5J8CA 2G3TA 3DR6A 4NJRA 1VHEA 2WPXA 3FB3A 4OAEA 2J8NA 4MFPA 4MFZA 2CNMA 3MRUA 2AFOA 4QB9A 1ZO0A 3JUWA 3R1KA 3H8GA 4ZI6A 2REFA 4EMEA 4NF1A 4C2XA 4PK2A 4NGSA 3CPXA 1J4JA 1GYTA 2JBJA 3PB6X 3KHZA 2DF5A 5HVGA 2RFHA 1PYTB 3KI9A 1IYKA 1I1DA 4MCQA 4QUSA 1UFHA 4ZX8A 2B4BA 2XEFA 2AFMA 5CNPA 4AVCA 5AG4A 2CXAA 3KR5A 4A39A 4K3NA 4CYQA 3UY5A 4ZGYB 1M1DA 1S60A 3NH5A 4TNUA 4KOXA 3RBUA 2VL1A 2AFZA 4BINA 5LYFA 4KSIA 3C26A 1L0CA 2PVVA 4AB7A 4ZBGA 3GYAA 3V8IA 2G3AA 1UWYA 3NH4A 3ZZIA 4DNCA 1M4IA 1XIXA 4IAVA 4P4IA 1B6BA 2PRBA 1F2PA 2YNEA 2NMTA 4C2YA 4NCZA 1XMBA 2ZW7A 4W9YA 5JQ4A 1CM0A 4UCNA 4YRHA 3PZJA 1BLLE 5HVHA 3WABA 4PPZA 1QMUA 4A37A 4P4EA 2OZGA 4A32A 2OZHA 1Z8XA 2WZNA 3N7ZA 3H5ZA 4NGQA 4Q38A 3LACA 4WJBA 3TO6A 2BOAA 2P6EA 1PU9A 2Z11A 3KZWA 3FIXA 4NGNA 4ORFA 4UFWA 5AG7A 1Q2CA 4B14A 4CAWA 2IQ6A 4UCMA 4QC6A 3KL9A 5I0CA 5I4MA 1SQHA 4C7IA 1S7NA 5DS0A 5F49A 4CYOA 5K8NA 1ARMA 2ZEEA 3B3VA 4CAXA 2ZXVA 4NEXA 4RI1A 4RS2A 2OU2A 4P44A 1P4NA 3FJUA 1XMTA 1XE4A 3G8WA 1YMEA 2FL4A 2Z10A 3FVLA 3P2FA 3FEEA 2R7HA 2FE7A 1M4GA 1IGBA 2FVGA 3LD2A 4UFXA 1YSJA 1Z4EA 4KORA 4RUHA 4R6TA 2GLJA 2PR1A 3D7DA 2EWBA 3CT9A 2QJ8A 2PDOA 4MY0A 1ZLIA 2B4DA 4KLWA 2PJBA 2QMLA 3K2KA 4H89A 1OZPA 3GKRA 3H8EA 5EMIA 4BBHA 1Z8LA 2I3CA 4XNHB 1CP7A 4CGPA 4LQGA 4P10A 2P0WA 5JPHA 1F57A 2FIAA 2PJ9A 4R8FA 5HVFA 4UEEA 4EVYA 1XJOA 2ZOFA 1CJWA 1LANA 2EBJA 3BJ7A 2HB6A 4FD7A 4MMOA 4Q7AA 1VIXA 1YK3A 4KUAA 2J9AA 1N71A 3IWGA 1QSOA 4B10A 2BUEA 1WWZA 3IEHA 2BL1A 4X8IA 2OOTA 4B5PB 1XOVA 2VQYA 3PBEA 1YVKA 2J8RA 2QECA 3R95A 4PXEA 4EFDA 5AGEA 4L8AA 4B6ZA 2VBQA 3F5BA 4OLLA 4OC0A 2D4PA 2PJCA 4UCPA 1KWMA 3PEIA 5HH1A 2FSRA 2PE3A 1ELMP 1Z9UA 2ZELA 5K8OA 4U9ZA 5KTCA 1U6MA 2XEGA 4MI4A 4JXQA 2GFQA 4UFVA 1AYEA 3RYOA 3B3TA 5IV0A 2I00A 3TCVA 2DPSA 3CZXA 3DNSA 4NGTA 1RO5A 4MJ8A 1BAVA 3KHXA 4MHZA 4BD9A 3SI0A 3S9MA 4A31A 5F47A 1QQ9A 2PSWA 4MFKA 4XNHC 2V8GA 3WC7A 4CGLA 2I79A 1YLEA 3D2PA 4MCRA 4M6IA 1I21A 2YGWA 4KOVA 4X3RA 4KVME 2C27A 2QIRA 4NFRA 2VXKA 5GCNA 3ISXA 2PIZA 4UEZA 3NE8A 4PXCA 4CAVA 3FBUA 1IB1E 1FNOA 3D67A 4M6GA 1JWQA 4CS0B 2ZENA 2IJZA 3EC4A 1H8LA 1QSNA 2VEZA 4JZ0A 4UIBA 2CNTA 3PB4X 4IUSA 4OADA 3V38A 2EO8A 3GLJA 4E8OA 4LQ6A 2K5TA 2GREA 2OB0A 4EWTA 2OH1A 4PSWA 1KUYA 4ZY1A 1CX8A 3NH8A 3B3WA 4OC3A 3N5FA 3FEDA 1TKJA 4QVTA 4CGMA 4CYNA 4C7HA 2ODFA 3CXQA 1F2OA 3NA6A 3FRMA 4HKFA 4KSFA 3CDXA 2V8VA 1IICA 3B7IA 4MFLA 1V0CA 3IIBA 4R9MA 4A94A 4UEFA 1Z2LA 1Y7EA 2HQYA 1S3ZA 3WT4A 3MN8A 5DWMA 3T8WA 4KVXA 4IK2A 2B58A 1RXTA 2PJ2A 1VHSA 2HV2A 4A38A 1CG2A 3FF3A 4CAFA 3R9FA 4AG9A 1X10A 1K4JA 5K8MA 2CIJA 3WC6A 3NFZA 2Q4VA 2B3UA 4P4BA 2Z3MA 4R76A 4CGOA 3S6GA 2JEVA 2BO9A 3FYNA 3IWWA 5D8NA 4AVBA 1PCAA 2ARHA 2X7BA 1DE4C 3KQZA 3SJXA 3IU2A 3SXNA 4OKOA 2EK8A 3W91A 5EBVA 4ZY2A 3D4UA 4CRYB 2YNCC 2ZW4A 5F09A 4MXUA 2GU2A 5HXDA 4KUBA 1M4DA 2BSWA 4GM5A 2PJ7A 3B3CA 2PVWA 4FWUA 3H4QA 1TKHA 3D7HA 3W6XA 2Q51A 1NSLA 5F48A 1FY7A 4FUUA 1AMPA 3BXMA 1HDQA 2G0BA 3IWEA 3W6SA 2A4NA 1Y9WA 4JD6A 4PK3A 1CBXA 3SI1A 2DXQA 4ONWA 2Q43A 2BEIA 2EVNA 4DJLA 3WC5A 3BJ8A 3IU1A 3B3SA 3ZJ0A 2QYVA
chains in the Genus database with same CATH topology
4UBRA 4Y49B 4QBJA 4UA3A 4GS4A 2Q04A 2B4DB 1QSTA 3VWEA 3TOBA 2REEA 3TOAA 5DWNA 4AG7A 1KUXA 3MGDA 3QAHA 2B5GA 4R3KA 4M85A 1S7LA 3EO4A 4CYPA 2KCWA 5C82A 2YNDA 5E96A 5IX3A 4KS9A 2FXFA 2Q7BA 2EUIA 4B11A 2FS5A 5BWAB 1I12A 4B5PA 2Y0MA 4XPLA 1KZFA 5H84A 3CXSA 4J3GA 2PQ8A 4KVOE 2GE3A 1YR0A 4H6ZA 2ZW5A 3TO7A 4MFQA 4KLVA 5HMNA 3DR8A 2R1IA 2JDCA 2Z3LA 4Y49C 1S5KA 2Q0YA 4PSXA 4R57A 1WK4A 4HNYB 3I9SA 4E2AA 3FNCA 4E0AA 2FT0A 5F46A 1Q2DA 4HNXB 3D3SA 1KUVA 4AVAA 2Z3PA 1IIDA 3D8PA 4FD5A 1XF8A 4A30A 2WPWA 2ZPAA 5KTDA 3B8GA 3NE7A 1QSMA 3TFYA 2Z3KA 2Z0ZA 3DDDA 3A9LA 4R3LA 1YVOA 4A33A 2FIWA 1BOBA 5KTAA 4A95A 1S7FA 3TO9A 3LODA 3E0KA 2J8MA 1IYLA 2P6FA 3EFAA 3R96A 2R8VA 4KOWA 4KOYA 4Q36A 4UWIA 1Y7RA 4MY3A 4FD6A 4F0YA 4B5OA 4ONUA 3TE4A 3G3SA 4U9YA 2B3VA 4JWPA 4PV6A 2JDDA 4CGNA 4I49A 4NXYA 4JLYA 2Q44A 2R98A 4MHDA 1YGHA 3FXTA 4KOTA 3SHPA 4B13A 2WSAA 3P2HA 1YX0A 4C2ZA 3S6HA 4R87A 3CXPA 3R9EA 1YREA 4YGOA 4U5YA 3EXNA 4FD4A 3I3GA 3QB8A 4JJXA 4XPKA 5G1ZA 4F0XA 2FCKA 1QSRA 3PGPA 4II9A 4NSQA 2AJ6A 2Z3NA 5A27A 4X5KA 5EC4A 1VKCA 2CY2A 3PP9A 3DSBA 4B12A 4XPDB 4MFJA 3KKWA 4JXRA 2PR8A 4KOSA 1ON0A 2AE6A 4KSAA 4C68A 5FVJA 2VI7A 4HNWB 1PUAA 1LRZA 1GHEA 5AG6A 3T9YA 3WR7A 5C88A 2D4OA 1B87A 4K30A 5G20A 1MJAA 3F8KA 2H5MA 1MK4A 1S7KA 2B5GB 4KOUA 4CRZB 1MJ9A 2WUUA 2IL4A 1NE9A 3TT2A 2JLMA 5G21A 3D2MA 1R57A 4KZTA 2ATRA 3T90A 3BLNA 3VWDA 4XPDC 3EY5A 5J8FA 2GANA 5ISVA 5H86A 5A28A 3F0AA 4LUAA 5G22A 2O28A 2VZZA 3OWCA 1TIQA 2VZYA 5IB0A 4A2ZA 1MJBA 2GIVA 3S6KA 2PC1A 4IF5A 4BMHA 3S6FA 1Y9KA 2RC4A 2OZUA 1BO4A 2Q4YA 4LX9A 4YFJA 1NMTA 3IGRA 3GY9A 1M44A 3JVNA 4UWJA 4CAEA 1XEBA 3R9GA 5AG5A 2F5IA 4F6AA 4H6UA 3K9UA 1Q2YA 4L89A 4MBUA 3TTHA 2ZW6A 2DPTA 3SXOA 1P0HA 3JTKA 1Z4RA 2P6GA 2YNCA 2Z3OA 2HUZA 4M3SA 2CNSA 5J8CA 2G3TA 3DR6A 4OAEA 2WPXA 3FB3A 2J8NA 4MFPA 4MFZA 2CNMA 4QB9A 1ZO0A 3JUWA 3R1KA 2REFA 4NF1A 4C2XA 4PK2A 1J4JA 1IYKA 1I1DA 4QUSA 1UFHA 2B4BA 5AG4A 5CNPA 4AVCA 2CXAA 4ZGYB 4CYQA 3UY5A 1M1DA 1S60A 4KOXA 3C26A 1L0CA 4AB7A 4ZBGA 3GYAA 3V8IA 2G3AA 3ZZIA 4DNCA 1M4IA 1XIXA 1B6BA 2PRBA 2YNEA 2NMTA 4C2YA 4NCZA 2ZW7A 5JQ4A 1CM0A 4UCNA 4YRHA 3PZJA 2OZGA 4A32A 2OZHA 3TO6A 3N7ZA 3H5ZA 4Q38A 2P6EA 1PU9A 2Z11A 4UFWA 3FIXA 5AG7A 4ORFA 4B14A 4CAWA 1Q2CA 4UCMA 4QC6A 5I0CA 1SQHA 4C7IA 1S7NA 5F49A 4CYOA 4CAXA 2ZXVA 4NEXA 4RI1A 4RS2A 2OU2A 1P4NA 1XMTA 1XE4A 3G8WA 2FL4A 2Z10A 3P2FA 2R7HA 2FE7A 1M4GA 3LD2A 4UFXA 1Z4EA 4KORA 2PR1A 2PDOA 4MY0A 2B4DA 4KLWA 2QMLA 4H89A 1OZPA 3GKRA 4BBHA 4XNHB 4CGPA 2P0WA 5JPHA 2FIAA 4EVYA 1CJWA 4FD7A 3BJ7A 1YK3A 4KUAA 1N71A 3IWGA 1QSOA 4B10A 2BUEA 1WWZA 2BL1A 4B5PB 2VQYA 1YVKA 2J8RA 2QECA 3R95A 5AGEA 4L8AA 2VBQA 3F5BA 4OLLA 4UCPA 2D4PA 5HH1A 2FSRA 1Z9UA 5KTCA 4U9ZA 1U6MA 4MI4A 4JXQA 4UFVA 3RYOA 5IV0A 2I00A 3TCVA 2DPSA 3DNSA 1RO5A 4MJ8A 4A31A 5F47A 2PSWA 4MFKA 4XNHC 4CGLA 2I79A 1YLEA 3D2PA 1I21A 2YGWA 4KOVA 4KVME 2C27A 2QIRA 2VXKA 5GCNA 4CAVA 3FBUA 1IB1E 4CS0B 3EC4A 1QSNA 2VEZA 2CNTA 4OADA 4IUSA 4E8OA 2K5TA 2OB0A 2OH1A 4PSWA 1KUYA 4QVTA 4CYNA 4CGMA 4C7HA 3CXQA 4HKFA 3FRMA 4KSFA 4MFLA 1IICA 1V0CA 4R9MA 2HQYA 1S3ZA 5DWMA 4KVXA 2B58A 1RXTA 1VHSA 2HV2A 4CAFA 3R9FA 4AG9A 1K4JA 2Q4VA 2B3UA 2Z3MA 4CGOA 3S6GA 2JEVA 3FYNA 4AVBA 2ARHA 2X7BA 3IU2A 3SXNA 3W91A 5EBVA 4CRYB 2YNCC 2ZW4A 4KUBA 1M4DA 2BSWA 3H4QA 3W6XA 1NSLA 5F48A 1FY7A 2G0BA 3IWEA 3W6SA 2A4NA 1Y9WA 4JD6A 4PK3A 2DXQA 2BEIA 2EVNA 3BJ8A 3IU1A 3ZJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UBR A;  4Y49 B;  4QBJ A;  4UA3 A;  4GS4 A;  2Q04 A;  2B4D B;  1QST A;  3VWE A;  3TOB A;  2REE A;  3TOA A;  5DWN A;  4AG7 A;  1KUX A;  3MGD A;  3QAH A;  2B5G A;  4R3K A;  4M85 A;  1S7L A;  3EO4 A;  2KCW A;  5C82 A;  5E96 A;  5IX3 A;  2FXF A;  2Q7B A;  2EUI A;  2FS5 A;  1I12 A;  4B5P A;  2Y0M A;  4XPL A;  1KZF A;  5H84 A;  3CXS A;  4J3G A;  2PQ8 A;  4KVO E;  2GE3 A;  1YR0 A;  4H6Z A;  2ZW5 A;  3TO7 A;  4KLV A;  5HMN A;  3DR8 A;  2R1I A;  2JDC A;  4Y49 C;  1S5K A;  2Q0Y A;  4PSX A;  4R57 A;  1WK4 A;  4HNY B;  3I9S A;  4E2A A;  3FNC A;  4E0A A;  2FT0 A;  5F46 A;  1Q2D A;  4HNX B;  3D3S A;  1KUV A;  4AVA A;  1IID A;  3D8P A;  4FD5 A;  1XF8 A;  2WPW A;  2ZPA A;  5KTD A;  3B8G A;  3NE7 A;  1QSM A;  3TFY A;  2Z0Z A;  3DDD A;  4R3L A;  1YVO A;  2FIW A;  1BOB A;  5KTA A;  1S7F A;  3TO9 A;  3LOD A;  3E0K A;  2J8M A;  1IYL A;  2P6F A;  3EFA A;  3R96 A;  2R8V A;  4KOW A;  4KOY A;  4UWI A;  1Y7R A;  4MY3 A;  4FD6 A;  4F0Y A;  4B5O A;  4ONU A;  3TE4 A;  3G3S A;  4U9Y A;  2B3V A;  4JWP A;  4PV6 A;  2JDD A;  4I49 A;  4NXY A;  4JLY A;  2Q44 A;  2R98 A;  4MHD A;  1YGH A;  3FXT A;  4KOT A;  3SHP A;  3P2H A;  1YX0 A;  3S6H A;  4R87 A;  3CXP A;  3R9E A;  1YRE A;  4YGO A;  4U5Y A;  3EXN A;  4FD4 A;  3I3G A;  3QB8 A;  4JJX A;  4XPK A;  4II9 A;  2FCK A;  1QSR A;  3PGP A;  4NSQ A;  2AJ6 A;  4X5K A;  5EC4 A;  1VKC A;  2CY2 A;  3PP9 A;  3DSB A;  4XPD B;  3KKW A;  4JXR A;  2PR8 A;  4KOS A;  1ON0 A;  2AE6 A;  5FVJ A;  2VI7 A;  4HNW B;  1PUA A;  1LRZ A;  1GHE A;  3T9Y A;  3WR7 A;  5C88 A;  2D4O A;  1B87 A;  4K30 A;  1MJA A;  3F8K A;  2H5M A;  1MK4 A;  1S7K A;  2B5G B;  4KOU A;  4CRZ B;  1MJ9 A;  2IL4 A;  1NE9 A;  3TT2 A;  2JLM A;  3D2M A;  1R57 A;  4KZT A;  2ATR A;  3T90 A;  3BLN A;  3VWD A;  4XPD C;  3EY5 A;  5J8F A;  2GAN A;  5ISV A;  5H86 A;  3F0A A;  4LUA A;  2O28 A;  2VZZ A;  3OWC A;  1TIQ A;  2VZY A;  5IB0 A;  1MJB A;  2GIV A;  3S6K A;  2PC1 A;  4IF5 A;  4BMH A;  3S6F A;  1Y9K A;  2RC4 A;  2OZU A;  1BO4 A;  2Q4Y A;  4LX9 A;  4YFJ A;  1NMT A;  3IGR A;  3GY9 A;  1M44 A;  3JVN A;  4UWJ A;  1XEB A;  3R9G A;  2F5I A;  4F6A A;  4H6U A;  3K9U A;  1Q2Y A;  4L89 A;  4MBU A;  3TTH A;  2ZW6 A;  3SXO A;  1P0H A;  1Z4R A;  2P6G A;  2HUZ A;  4M3S A;  2CNS A;  5J8C A;  2G3T A;  3DR6 A;  4OAE A;  2WPX A;  3FB3 A;  2J8N A;  2CNM A;  4QB9 A;  3JUW A;  3R1K A;  2REF A;  4NF1 A;  4PK2 A;  1J4J A;  1IYK A;  1I1D A;  4QUS A;  1UFH A;  2B4B A;  5CNP A;  4AVC A;  3UY5 A;  1M1D A;  1S60 A;  4KOX A;  3C26 A;  1L0C A;  4AB7 A;  4ZBG A;  3GYA A;  3V8I A;  2G3A A;  3ZZI A;  4DNC A;  1M4I A;  1XIX A;  1B6B A;  2PRB A;  2NMT A;  4NCZ A;  2ZW7 A;  5JQ4 A;  1CM0 A;  4YRH A;  3PZJ A;  2OZG A;  2OZH A;  3TO6 A;  3N7Z A;  2P6E A;  1PU9 A;  2Z11 A;  3FIX A;  4ORF A;  4CAW A;  1Q2C A;  4QC6 A;  5I0C A;  1SQH A;  1S7N A;  5F49 A;  4CAX A;  2ZXV A;  4NEX A;  4RI1 A;  4RS2 A;  2OU2 A;  1P4N A;  1XMT A;  1XE4 A;  3G8W A;  2FL4 A;  2Z10 A;  3P2F A;  2R7H A;  2FE7 A;  1M4G A;  3LD2 A;  1Z4E A;  4KOR A;  2PR1 A;  2PDO A;  4MY0 A;  2B4D A;  4KLW A;  2QML A;  4H89 A;  1OZP A;  3GKR A;  4XNH B;  2P0W A;  5JPH A;  2FIA A;  4EVY A;  1CJW A;  4FD7 A;  3BJ7 A;  1YK3 A;  4KUA A;  1N71 A;  3IWG A;  1QSO A;  2BUE A;  1WWZ A;  2BL1 A;  4B5P B;  2VQY A;  1YVK A;  2J8R A;  2QEC A;  3R95 A;  4L8A A;  2VBQ A;  3F5B A;  4OLL A;  2D4P A;  5HH1 A;  2FSR A;  1Z9U A;  5KTC A;  4U9Z A;  1U6M A;  4MI4 A;  4JXQ A;  3RYO A;  5IV0 A;  2I00 A;  3TCV A;  3DNS A;  1RO5 A;  4MJ8 A;  5F47 A;  2PSW A;  4XNH C;  2I79 A;  1YLE A;  3D2P A;  1I21 A;  4KOV A;  4KVM E;  2C27 A;  2QIR A;  2VXK A;  5GCN A;  4CAV A;  3FBU A;  1IB1 E;  4CS0 B;  3EC4 A;  1QSN A;  2VEZ A;  2CNT A;  4OAD A;  4IUS A;  4E8O A;  2K5T A;  2OB0 A;  2OH1 A;  4PSW A;  1KUY A;  4QVT A;  3CXQ A;  4HKF A;  3FRM A;  1IIC A;  1V0C A;  4R9M A;  2HQY A;  1S3Z A;  5DWM A;  4KVX A;  2B58 A;  1RXT A;  1VHS A;  2HV2 A;  3R9F A;  4AG9 A;  1K4J A;  2Q4V A;  2B3U A;  3S6G A;  2JEV A;  3FYN A;  4AVB A;  2ARH A;  2X7B A;  3SXN A;  3W91 A;  5EBV A;  4CRY B;  2ZW4 A;  4KUB A;  1M4D A;  2BSW A;  3H4Q A;  3W6X A;  1NSL A;  5F48 A;  1FY7 A;  2G0B A;  3W6S A;  2A4N A;  1Y9W A;  4JD6 A;  4PK3 A;  2DXQ A;  2BEI A;  2EVN A;  3BJ8 A;  3ZJ0 A; 
#chains in the Genus database with same CATH topology
 4OC1 A;  1Q7L A;  4UBR A;  2AFW A;  3RZA A;  3IC1 A;  3V7Z A;  4Y49 B;  2PJA A;  4MCS A;  4QBJ A;  4UA3 A;  2ZED A;  3D7G A;  4GS4 A;  2Q04 A;  2B4D B;  1BPM A;  1QST A;  2PJ5 A;  3D7F A;  4JYW A;  3VH9 A;  3TOB A;  3VWE A;  4ZYQ A;  3DLJ A;  2CTB A;  2REE A;  3TOA A;  5DWN A;  4AG7 A;  1KUX A;  3MGD A;  3QAH A;  1FT7 A;  2B5G A;  4OC4 A;  4R3K A;  2AFU A;  3KR4 A;  4M85 A;  1S7L A;  3EO4 A;  2ABZ A;  4CYP A;  2KCW A;  5C82 A;  2YND A;  5E96 A;  5IX3 A;  5JH9 A;  4GXH A;  3GUX A;  2CF4 A;  4AXV A;  4KS9 A;  1TF8 A;  1VHO A;  3CPA A;  4P4D A;  4FBE A;  2FXF A;  2Q7B A;  3QAY A;  3TC8 A;  2JEW A;  2EUI A;  4B11 A;  4WWV A;  2FS5 A;  3FEC A;  5BWA B;  4P6Y A;  4F9U A;  3QNV A;  3VAR A;  1I12 A;  4NJQ A;  4B5P A;  2Y0M A;  2PJ1 A;  4XPL A;  1KZF A;  5H84 A;  5LRK A;  1X12 A;  3CXS A;  2WYR A;  2ANP A;  2PQ8 A;  4J3G A;  2GE3 A;  4KVO E;  1YR0 A;  1CPS A;  4H6Z A;  5J1Q A;  2ZW5 A;  1IU8 A;  3TO7 A;  1CP6 A;  4MFQ A;  4OC5 A;  2ZEP A;  4KLV A;  2POK A;  4R7M A;  2IMO A;  5HMN A;  3DR8 A;  2R1I A;  2JDC A;  1LOK A;  2Z3L A;  1Y0Y A;  4Y49 C;  5JM6 A;  1BPN A;  3JRU A;  5CPA A;  5CBM A;  4P4J A;  1S5K A;  1ZLH A;  2Q0Y A;  2O4H A;  1CPX A;  4PSX A;  2C1C A;  1WK4 A;  1YLO A;  4R57 A;  2GLF A;  2Q4Z A;  4HNY B;  4OID A;  1ELL P;  3I9S A;  4E2A A;  3FNC A;  4E0A A;  2FT0 A;  3S9N A;  5F46 A;  1LAM A;  1Q2D A;  4HNX B;  3D3S A;  4DYO A;  1KUV A;  4M6H A;  2NYQ A;  4AVA A;  2Z3P A;  1IID A;  3D8P A;  4Z65 A;  2XEI A;  2HC9 A;  4FD5 A;  2JBK A;  1XF8 A;  3PB7 X;  4A30 A;  2F8H A;  2WPW A;  1YQE A;  4UF4 A;  2ZPA A;  2PJ8 A;  5KTD A;  4MHN A;  5ELY A;  3B8G A;  3NE7 A;  1QSM A;  3TFY A;  5K8P A;  2Z3K A;  2Z0Z A;  4H2K A;  2C6P A;  3DDD A;  3A9L A;  3PFO A;  5JGF A;  5LYI A;  2V8H A;  3LMS A;  1YVO A;  2AFX A;  3PB8 X;  1ARL A;  2ZEH A;  2NSM A;  4R3L A;  4A33 A;  3B35 A;  1Z8T A;  2FIW A;  2CTC A;  1BOB A;  4ZY0 A;  5LYD A;  5KTA A;  4A95 A;  4YWY A;  1S7F A;  3TO9 A;  1LCP A;  3LOD A;  3DGV A;  3E0K A;  2J8M A;  4F9V A;  1JQG A;  1IYL A;  2P6F A;  3EFA A;  3R96 A;  4OME A;  2R8V A;  4KOW A;  4KOY A;  3FX6 A;  1LAP A;  2XEJ A;  4OC2 A;  4Q36 A;  4UWI A;  1Y7R A;  4MY3 A;  4FD6 A;  1EE3 P;  1HEE A;  4F0Y A;  3D68 A;  4B5O A;  4ONU A;  3TE4 A;  4MHY A;  3G3S A;  4U9Y A;  1IOF A;  3GB0 A;  4DUK A;  2B3V A;  4JWP A;  4NGM A;  2JDD A;  4PV6 A;  4I49 A;  3RNZ A;  4CGN A;  2ZEO A;  4NXY A;  1YW4 A;  4JLY A;  2Q44 A;  2R98 A;  4MHD A;  2ZOG A;  5THW A;  2V77 A;  1YGH A;  3FXT A;  4KOT A;  3TX8 A;  5LYL A;  3SHP A;  4B13 A;  1A2Z A;  2RB7 A;  2WSA A;  1YX0 A;  3FH4 A;  3P2H A;  4NGR A;  4C2Z A;  4PQA A;  3S6H A;  3S9L A;  4G1P A;  4R87 A;  3CXP A;  3R9E A;  1YRE A;  4YGO A;  1IY7 A;  4U5Y A;  2AFS A;  3EXN A;  3BHX A;  3LWU A;  2OR4 A;  4FD4 A;  2BCO A;  3I3G A;  2Q7S A;  3KAS A;  3QB8 A;  4PXB A;  4JJX A;  4XPK A;  5G1Z A;  4F0X A;  2FCK A;  1QSR A;  1NSA A;  3PGP A;  4II9 A;  2PJ0 A;  4NSQ A;  2AJ6 A;  2Z3N A;  5A27 A;  4X5K A;  4FAI A;  5EC4 A;  3SI2 A;  1VKC A;  2CY2 A;  3PP9 A;  3DSB A;  4B12 A;  4XPD B;  4MFJ A;  3KKW A;  4JXR A;  2PR8 A;  4KOS A;  3D66 A;  1ON0 A;  2PJ3 A;  1YW6 A;  3SJG A;  2AE6 A;  8CPA A;  2O53 A;  4P4F A;  4KSA A;  3BI1 A;  4C68 A;  5FVJ A;  2VI7 A;  4HNW B;  1PUA A;  2V8D A;  1LRZ A;  4UIA A;  4CPA A;  1GHE A;  5AG6 A;  3T9Y A;  3SJF A;  3WR7 A;  5C88 A;  2D4O A;  1B87 A;  4K30 A;  5G20 A;  1Z5R A;  1MJA A;  1IOI A;  1TF9 A;  3F8K A;  1VGY A;  2H5M A;  1MK4 A;  4HPS A;  1S7K A;  4MCP A;  3KGQ A;  1XRY A;  2F7V A;  2DEA A;  1OBR A;  3FMC A;  2B5G B;  4KOU A;  4P45 A;  4CRZ B;  4NGP A;  4MHP A;  3VAT A;  5D29 A;  1MJ9 A;  2C6G A;  2WUU A;  1R3N A;  2IL4 A;  1NE9 A;  2ZEF A;  2ZEG A;  2G9D A;  3KQX A;  2JLM A;  5G21 A;  3TT2 A;  6CPA A;  3D2M A;  1R57 A;  4KZT A;  2ATR A;  3L2N A;  3T90 A;  3BLN A;  3VWD A;  3IFE A;  3I1U A;  5LRJ A;  4XPD C;  3EY5 A;  3K9T A;  5J8F A;  2GAN A;  5ISV A;  5H86 A;  5A28 A;  4IHM A;  3F0A A;  3RAM A;  4LUA A;  3H8F A;  2O28 A;  5G22 A;  4TWE A;  3IJ3 A;  2VZZ A;  2PCU A;  1LFW A;  3OWC A;  1ZG7 A;  2ZEM A;  3GIU A;  1TIQ A;  4O23 A;  2VZY A;  4MRI A;  3PBB A;  5IB0 A;  3B2Y A;  3PB9 X;  2PRQ A;  4A2Z A;  2QVP A;  7CPA A;  1MJB A;  5IB9 A;  1R43 A;  2GIV A;  4OP4 A;  1Z8W A;  3S6K A;  1RTQ A;  3SJE A;  2PC1 A;  4IF5 A;  4ZX9 A;  4BMH A;  1XFO A;  3S6F A;  3PRT A;  1Y9K A;  2RC4 A;  1M4L A;  2OZU A;  5LRG A;  3HUV A;  4YU9 A;  2PJ4 A;  1TKF A;  1BO4 A;  2PIY A;  2Q4Y A;  4OIW A;  4LX9 A;  4YFJ A;  1NMT A;  3RO0 A;  1XBU A;  3IGR A;  2EK9 A;  3GY9 A;  1M44 A;  3HLP A;  3JVN A;  4UWJ A;  4CAE A;  1DTD A;  1XEB A;  3R9G A;  4F8Z A;  2C6C A;  2PJ6 A;  1ZG8 A;  1HDU A;  3ISZ A;  5AG5 A;  2F5I A;  4X2T A;  4F6A A;  4H6U A;  1Y0R A;  3K9U A;  3PFE A;  1TXR A;  1Q2Y A;  1AUG A;  4L89 A;  4MBU A;  3TTH A;  4PXD A;  2ZW6 A;  3IO1 A;  2DPT A;  3SXO A;  1P0H A;  3JTK A;  3BI0 A;  1ZG9 A;  1Z4R A;  2P6G A;  2YNC A;  2Z3O A;  2HUZ A;  4M3S A;  2CNS A;  4RN7 A;  5J8C A;  2G3T A;  3DR6 A;  4NJR A;  1VHE A;  2WPX A;  3FB3 A;  4OAE A;  2J8N A;  4MFP A;  4MFZ A;  2CNM A;  3MRU A;  2AFO A;  4QB9 A;  1ZO0 A;  3JUW A;  3R1K A;  3H8G A;  4ZI6 A;  2REF A;  4EME A;  4NF1 A;  4C2X A;  4PK2 A;  4NGS A;  3CPX A;  1J4J A;  1GYT A;  2JBJ A;  3PB6 X;  3KHZ A;  2DF5 A;  5HVG A;  2RFH A;  1PYT B;  3KI9 A;  1IYK A;  1I1D A;  4MCQ A;  4QUS A;  1UFH A;  4ZX8 A;  2B4B A;  2XEF A;  2AFM A;  5CNP A;  4AVC A;  5AG4 A;  2CXA A;  3KR5 A;  4A39 A;  4K3N A;  4CYQ A;  3UY5 A;  4ZGY B;  1M1D A;  1S60 A;  3NH5 A;  4TNU A;  4KOX A;  3RBU A;  2VL1 A;  2AFZ A;  4BIN A;  5LYF A;  4KSI A;  3C26 A;  1L0C A;  2PVV A;  4AB7 A;  4ZBG A;  3GYA A;  3V8I A;  2G3A A;  1UWY A;  3NH4 A;  3ZZI A;  4DNC A;  1M4I A;  1XIX A;  4IAV A;  4P4I A;  1B6B A;  2PRB A;  1F2P A;  2YNE A;  2NMT A;  4C2Y A;  4NCZ A;  1XMB A;  2ZW7 A;  4W9Y A;  5JQ4 A;  1CM0 A;  4UCN A;  4YRH A;  3PZJ A;  1BLL E;  5HVH A;  3WAB A;  4PPZ A;  1QMU A;  4A37 A;  4P4E A;  2OZG A;  4A32 A;  2OZH A;  1Z8X A;  2WZN A;  3N7Z A;  3H5Z A;  4NGQ A;  4Q38 A;  3LAC A;  4WJB A;  3TO6 A;  2BOA A;  2P6E A;  1PU9 A;  2Z11 A;  3KZW A;  3FIX A;  4NGN A;  4ORF A;  4UFW A;  5AG7 A;  1Q2C A;  4B14 A;  4CAW A;  2IQ6 A;  4UCM A;  4QC6 A;  3KL9 A;  5I0C A;  5I4M A;  1SQH A;  4C7I A;  1S7N A;  5DS0 A;  5F49 A;  4CYO A;  5K8N A;  1ARM A;  2ZEE A;  3B3V A;  4CAX A;  2ZXV A;  4NEX A;  4RI1 A;  4RS2 A;  2OU2 A;  4P44 A;  1P4N A;  3FJU A;  1XMT A;  1XE4 A;  3G8W A;  1YME A;  2FL4 A;  2Z10 A;  3FVL A;  3P2F A;  3FEE A;  2R7H A;  2FE7 A;  1M4G A;  1IGB A;  2FVG A;  3LD2 A;  4UFX A;  1YSJ A;  1Z4E A;  4KOR A;  4RUH A;  4R6T A;  2GLJ A;  2PR1 A;  3D7D A;  2EWB A;  3CT9 A;  2QJ8 A;  2PDO A;  4MY0 A;  1ZLI A;  2B4D A;  4KLW A;  2PJB A;  2QML A;  3K2K A;  4H89 A;  1OZP A;  3GKR A;  3H8E A;  5EMI A;  4BBH A;  1Z8L A;  2I3C A;  4XNH B;  1CP7 A;  4CGP A;  4LQG A;  4P10 A;  2P0W A;  5JPH A;  1F57 A;  2FIA A;  2PJ9 A;  4R8F A;  5HVF A;  4UEE A;  4EVY A;  1XJO A;  2ZOF A;  1CJW A;  1LAN A;  2EBJ A;  3BJ7 A;  2HB6 A;  4FD7 A;  4MMO A;  4Q7A A;  1VIX A;  1YK3 A;  4KUA A;  2J9A A;  1N71 A;  3IWG A;  1QSO A;  4B10 A;  2BUE A;  1WWZ A;  3IEH A;  2BL1 A;  4X8I A;  2OOT A;  4B5P B;  1XOV A;  2VQY A;  3PBE A;  1YVK A;  2J8R A;  2QEC A;  3R95 A;  4PXE A;  4EFD A;  5AGE A;  4L8A A;  4B6Z A;  2VBQ A;  3F5B A;  4OLL A;  4OC0 A;  2D4P A;  2PJC A;  4UCP A;  1KWM A;  3PEI A;  5HH1 A;  2FSR A;  2PE3 A;  1ELM P;  1Z9U A;  2ZEL A;  5K8O A;  4U9Z A;  5KTC A;  1U6M A;  2XEG A;  4MI4 A;  4JXQ A;  2GFQ A;  4UFV A;  1AYE A;  3RYO A;  3B3T A;  5IV0 A;  2I00 A;  3TCV A;  2DPS A;  3CZX A;  3DNS A;  4NGT A;  1RO5 A;  4MJ8 A;  1BAV A;  3KHX A;  4MHZ A;  4BD9 A;  3SI0 A;  3S9M A;  4A31 A;  5F47 A;  1QQ9 A;  2PSW A;  4MFK A;  4XNH C;  2V8G A;  3WC7 A;  4CGL A;  2I79 A;  1YLE A;  3D2P A;  4MCR A;  4M6I A;  1I21 A;  2YGW A;  4KOV A;  4X3R A;  4KVM E;  2C27 A;  2QIR A;  4NFR A;  2VXK A;  5GCN A;  3ISX A;  2PIZ A;  4UEZ A;  3NE8 A;  4PXC A;  4CAV A;  3FBU A;  1IB1 E;  1FNO A;  3D67 A;  4M6G A;  1JWQ A;  4CS0 B;  2ZEN A;  2IJZ A;  3EC4 A;  1H8L A;  1QSN A;  2VEZ A;  4JZ0 A;  4UIB A;  2CNT A;  3PB4 X;  4IUS A;  4OAD A;  3V38 A;  2EO8 A;  3GLJ A;  4E8O A;  4LQ6 A;  2K5T A;  2GRE A;  2OB0 A;  4EWT A;  2OH1 A;  4PSW A;  1KUY A;  4ZY1 A;  1CX8 A;  3NH8 A;  3B3W A;  4OC3 A;  3N5F A;  3FED A;  1TKJ A;  4QVT A;  4CGM A;  4CYN A;  4C7H A;  2ODF A;  3CXQ A;  1F2O A;  3NA6 A;  3FRM A;  4HKF A;  4KSF A;  3CDX A;  2V8V A;  1IIC A;  3B7I A;  4MFL A;  1V0C A;  3IIB A;  4R9M A;  4A94 A;  4UEF A;  1Z2L A;  1Y7E A;  2HQY A;  1S3Z A;  3WT4 A;  3MN8 A;  5DWM A;  3T8W A;  4KVX A;  4IK2 A;  2B58 A;  1RXT A;  2PJ2 A;  1VHS A;  2HV2 A;  4A38 A;  1CG2 A;  3FF3 A;  4CAF A;  3R9F A;  4AG9 A;  1X10 A;  1K4J A;  5K8M A;  2CIJ A;  3WC6 A;  3NFZ A;  2Q4V A;  2B3U A;  4P4B A;  2Z3M A;  4R76 A;  4CGO A;  3S6G A;  2JEV A;  2BO9 A;  3FYN A;  3IWW A;  5D8N A;  4AVB A;  1PCA A;  2ARH A;  2X7B A;  1DE4 C;  3KQZ A;  3SJX A;  3IU2 A;  3SXN A;  4OKO A;  2EK8 A;  3W91 A;  5EBV A;  4ZY2 A;  3D4U A;  4CRY B;  2YNC C;  2ZW4 A;  5F09 A;  4MXU A;  2GU2 A;  5HXD A;  4KUB A;  1M4D A;  2BSW A;  4GM5 A;  2PJ7 A;  3B3C A;  2PVW A;  4FWU A;  3H4Q A;  1TKH A;  3D7H A;  3W6X A;  2Q51 A;  1NSL A;  5F48 A;  1FY7 A;  4FUU A;  1AMP A;  3BXM A;  1HDQ A;  2G0B A;  3IWE A;  3W6S A;  2A4N A;  1Y9W A;  4JD6 A;  4PK3 A;  1CBX A;  3SI1 A;  2DXQ A;  4ONW A;  2Q43 A;  2BEI A;  2EVN A;  4DJL A;  3WC5 A;  3BJ8 A;  3IU1 A;  3B3S A;  3ZJ0 A;  2QYV A; 
#chains in the Genus database with same CATH homology
 4UBR A;  4Y49 B;  4QBJ A;  4UA3 A;  4GS4 A;  2Q04 A;  2B4D B;  1QST A;  3VWE A;  3TOB A;  2REE A;  3TOA A;  5DWN A;  4AG7 A;  1KUX A;  3MGD A;  3QAH A;  2B5G A;  4R3K A;  4M85 A;  1S7L A;  3EO4 A;  4CYP A;  2KCW A;  5C82 A;  2YND A;  5E96 A;  5IX3 A;  4KS9 A;  2FXF A;  2Q7B A;  2EUI A;  4B11 A;  2FS5 A;  5BWA B;  1I12 A;  4B5P A;  2Y0M A;  4XPL A;  1KZF A;  5H84 A;  3CXS A;  4J3G A;  2PQ8 A;  4KVO E;  2GE3 A;  1YR0 A;  4H6Z A;  2ZW5 A;  3TO7 A;  4MFQ A;  4KLV A;  5HMN A;  3DR8 A;  2R1I A;  2JDC A;  2Z3L A;  4Y49 C;  1S5K A;  2Q0Y A;  4PSX A;  4R57 A;  1WK4 A;  4HNY B;  3I9S A;  4E2A A;  3FNC A;  4E0A A;  2FT0 A;  5F46 A;  1Q2D A;  4HNX B;  3D3S A;  1KUV A;  4AVA A;  2Z3P A;  1IID A;  3D8P A;  4FD5 A;  1XF8 A;  4A30 A;  2WPW A;  2ZPA A;  5KTD A;  3B8G A;  3NE7 A;  1QSM A;  3TFY A;  2Z3K A;  2Z0Z A;  3DDD A;  3A9L A;  4R3L A;  1YVO A;  4A33 A;  2FIW A;  1BOB A;  5KTA A;  4A95 A;  1S7F A;  3TO9 A;  3LOD A;  3E0K A;  2J8M A;  1IYL A;  2P6F A;  3EFA A;  3R96 A;  2R8V A;  4KOW A;  4KOY A;  4Q36 A;  4UWI A;  1Y7R A;  4MY3 A;  4FD6 A;  4F0Y A;  4B5O A;  4ONU A;  3TE4 A;  3G3S A;  4U9Y A;  2B3V A;  4JWP A;  4PV6 A;  2JDD A;  4CGN A;  4I49 A;  4NXY A;  4JLY A;  2Q44 A;  2R98 A;  4MHD A;  1YGH A;  3FXT A;  4KOT A;  3SHP A;  4B13 A;  2WSA A;  3P2H A;  1YX0 A;  4C2Z A;  3S6H A;  4R87 A;  3CXP A;  3R9E A;  1YRE A;  4YGO A;  4U5Y A;  3EXN A;  4FD4 A;  3I3G A;  3QB8 A;  4JJX A;  4XPK A;  5G1Z A;  4F0X A;  2FCK A;  1QSR A;  3PGP A;  4II9 A;  4NSQ A;  2AJ6 A;  2Z3N A;  5A27 A;  4X5K A;  5EC4 A;  1VKC A;  2CY2 A;  3PP9 A;  3DSB A;  4B12 A;  4XPD B;  4MFJ A;  3KKW A;  4JXR A;  2PR8 A;  4KOS A;  1ON0 A;  2AE6 A;  4KSA A;  4C68 A;  5FVJ A;  2VI7 A;  4HNW B;  1PUA A;  1LRZ A;  1GHE A;  5AG6 A;  3T9Y A;  3WR7 A;  5C88 A;  2D4O A;  1B87 A;  4K30 A;  5G20 A;  1MJA A;  3F8K A;  2H5M A;  1MK4 A;  1S7K A;  2B5G B;  4KOU A;  4CRZ B;  1MJ9 A;  2WUU A;  2IL4 A;  1NE9 A;  3TT2 A;  2JLM A;  5G21 A;  3D2M A;  1R57 A;  4KZT A;  2ATR A;  3T90 A;  3BLN A;  3VWD A;  4XPD C;  3EY5 A;  5J8F A;  2GAN A;  5ISV A;  5H86 A;  5A28 A;  3F0A A;  4LUA A;  5G22 A;  2O28 A;  2VZZ A;  3OWC A;  1TIQ A;  2VZY A;  5IB0 A;  4A2Z A;  1MJB A;  2GIV A;  3S6K A;  2PC1 A;  4IF5 A;  4BMH A;  3S6F A;  1Y9K A;  2RC4 A;  2OZU A;  1BO4 A;  2Q4Y A;  4LX9 A;  4YFJ A;  1NMT A;  3IGR A;  3GY9 A;  1M44 A;  3JVN A;  4UWJ A;  4CAE A;  1XEB A;  3R9G A;  5AG5 A;  2F5I A;  4F6A A;  4H6U A;  3K9U A;  1Q2Y A;  4L89 A;  4MBU A;  3TTH A;  2ZW6 A;  2DPT A;  3SXO A;  1P0H A;  3JTK A;  1Z4R A;  2P6G A;  2YNC A;  2Z3O A;  2HUZ A;  4M3S A;  2CNS A;  5J8C A;  2G3T A;  3DR6 A;  4OAE A;  2WPX A;  3FB3 A;  2J8N A;  4MFP A;  4MFZ A;  2CNM A;  4QB9 A;  1ZO0 A;  3JUW A;  3R1K A;  2REF A;  4NF1 A;  4C2X A;  4PK2 A;  1J4J A;  1IYK A;  1I1D A;  4QUS A;  1UFH A;  2B4B A;  5AG4 A;  5CNP A;  4AVC A;  2CXA A;  4ZGY B;  4CYQ A;  3UY5 A;  1M1D A;  1S60 A;  4KOX A;  3C26 A;  1L0C A;  4AB7 A;  4ZBG A;  3GYA A;  3V8I A;  2G3A A;  3ZZI A;  4DNC A;  1M4I A;  1XIX A;  1B6B A;  2PRB A;  2YNE A;  2NMT A;  4C2Y A;  4NCZ A;  2ZW7 A;  5JQ4 A;  1CM0 A;  4UCN A;  4YRH A;  3PZJ A;  2OZG A;  4A32 A;  2OZH A;  3TO6 A;  3N7Z A;  3H5Z A;  4Q38 A;  2P6E A;  1PU9 A;  2Z11 A;  4UFW A;  3FIX A;  5AG7 A;  4ORF A;  4B14 A;  4CAW A;  1Q2C A;  4UCM A;  4QC6 A;  5I0C A;  1SQH A;  4C7I A;  1S7N A;  5F49 A;  4CYO A;  4CAX A;  2ZXV A;  4NEX A;  4RI1 A;  4RS2 A;  2OU2 A;  1P4N A;  1XMT A;  1XE4 A;  3G8W A;  2FL4 A;  2Z10 A;  3P2F A;  2R7H A;  2FE7 A;  1M4G A;  3LD2 A;  4UFX A;  1Z4E A;  4KOR A;  2PR1 A;  2PDO A;  4MY0 A;  2B4D A;  4KLW A;  2QML A;  4H89 A;  1OZP A;  3GKR A;  4BBH A;  4XNH B;  4CGP A;  2P0W A;  5JPH A;  2FIA A;  4EVY A;  1CJW A;  4FD7 A;  3BJ7 A;  1YK3 A;  4KUA A;  1N71 A;  3IWG A;  1QSO A;  4B10 A;  2BUE A;  1WWZ A;  2BL1 A;  4B5P B;  2VQY A;  1YVK A;  2J8R A;  2QEC A;  3R95 A;  5AGE A;  4L8A A;  2VBQ A;  3F5B A;  4OLL A;  4UCP A;  2D4P A;  5HH1 A;  2FSR A;  1Z9U A;  5KTC A;  4U9Z A;  1U6M A;  4MI4 A;  4JXQ A;  4UFV A;  3RYO A;  5IV0 A;  2I00 A;  3TCV A;  2DPS A;  3DNS A;  1RO5 A;  4MJ8 A;  4A31 A;  5F47 A;  2PSW A;  4MFK A;  4XNH C;  4CGL A;  2I79 A;  1YLE A;  3D2P A;  1I21 A;  2YGW A;  4KOV A;  4KVM E;  2C27 A;  2QIR A;  2VXK A;  5GCN A;  4CAV A;  3FBU A;  1IB1 E;  4CS0 B;  3EC4 A;  1QSN A;  2VEZ A;  2CNT A;  4OAD A;  4IUS A;  4E8O A;  2K5T A;  2OB0 A;  2OH1 A;  4PSW A;  1KUY A;  4QVT A;  4CYN A;  4CGM A;  4C7H A;  3CXQ A;  4HKF A;  3FRM A;  4KSF A;  4MFL A;  1IIC A;  1V0C A;  4R9M A;  2HQY A;  1S3Z A;  5DWM A;  4KVX A;  2B58 A;  1RXT A;  1VHS A;  2HV2 A;  4CAF A;  3R9F A;  4AG9 A;  1K4J A;  2Q4V A;  2B3U A;  2Z3M A;  4CGO A;  3S6G A;  2JEV A;  3FYN A;  4AVB A;  2ARH A;  2X7B A;  3IU2 A;  3SXN A;  3W91 A;  5EBV A;  4CRY B;  2YNC C;  2ZW4 A;  4KUB A;  1M4D A;  2BSW A;  3H4Q A;  3W6X A;  1NSL A;  5F48 A;  1FY7 A;  2G0B A;  3IWE A;  3W6S A;  2A4N A;  1Y9W A;  4JD6 A;  4PK3 A;  2DXQ A;  2BEI A;  2EVN A;  3BJ8 A;  3IU1 A;  3ZJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...