3H4QA

Crystal structure of putative acetyltransferase (np_371943.1) from staphylococcus aureus mu50 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
169
structure length
145
Chain Sequence
GMIRLGKMSDLDQILNLVEEAKELMKYPLLEHFEEDIAKDYLYVLEENDKIYGFIVVDQDQAEWYDDIDWPVNREGAFVIHRLTGSKEYKGAATELFNYVIDVVKARGAEVILTDTFALNKPAQGLFAKFGFHKVPFYAYYKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acetyltransferase
publication title Crystal structure of putative acetyltransferase (NP_371943.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.50 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Transferase
total genus 40
structure length 145
sequence length 169
ec nomenclature
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h4qA00
2FT0A 5FVJA 3S6FA 3TOAA 3PGPA 4KOSA 4YRHA 3VWDA 4KORA 5F46A 2B3VA 3G8WA 4QB9A 4ZBGA 2RC4A 1YR0A 2FE7A 2VBQA 4IUSA 3FXTA 3GKRA 2ATRA 3TO9A 2GIVA 2VXKA 4XPDB 3EO4A 3DR8A 2B4BA 4JJXA 2JDCA 2Q0YA 4DNCA 4PSWA 5F48A 3G3SA 2ZW5A 5C88A 1XMTA 2JLMA 4AG9A 1MJBA 5J8FA 3EXNA 5EC4A 2FSRA 2CNTA 2ZPAA 1Y7RA 3R96A 1IIDA 1XIXA 3IWGA 2BUEA 5HH1A 4RI1A 5DWMA 1YGHA 2AE6A 3DR6A 1BO4A 1M44A 2R8VA 5JQ4A 4OAEA 4M85A 2G0BA 1B87A 4JD6A 4X5KA 2FL4A 2CNSA 4BMHA 4KUBA 1S7LA 2BEIA 3FNCA 1QSTA 4H89A 1Y9WA 4E2AA 3FYNA 2D4PA 1OZPA 5F47A 5J8CA 5IV0A 5KTCA 4F6AA 2WPXA 4J3GA 4CS0B 4KLVA 4E8OA 4KOUA 3F0AA 4MI4A 4XNHB 4K30A 1S7FA 2OZHA 2R98A 1YLEA 1XF8A 3S6GA 2B3UA 4R9MA 2G3AA 2QIRA 2EVNA 4PSXA 1MJ9A 4HKFA 1VHSA 1YX0A 4UBRA 3TE4A 4FD6A 1S5KA 3R1KA 4KVME 4CAVA 2AJ6A 1K4JA 2Q4YA 2FXFA 4RS2A 3PZJA 5HMNA 2C27A 1GHEA 1YK3A 3OWCA 3C26A 3T9YA 4MHDA 4L89A 1NSLA 2B5GA 2B5GB 1U6MA 3QB8A 4PK3A 3ZJ0A 2HQYA 4YFJA 1S7KA 1Z4EA 4FD7A 2GE3A 5EBVA 4Y49C 2G3TA 1KUVA 3KKWA 3JUWA 4CRZB 2QMLA 2P6GA 1NMTA 3P2HA 3D8PA 2KCWA 4UWJA 4HNXB 3GY9A 2Q7BA 2ZW6A 3CXPA 3SHPA 2F5IA 2D4OA 3P2FA 2OB0A 5KTAA 3S6KA 1YVKA 4QBJA 3IGRA 3TO6A 3DSBA 4XPKA 3PP9A 4UWIA 1PUAA 3FIXA 1IYKA 4KVOE 1CJWA 2A4NA 5KTDA 1LRZA 4U9YA 3SXOA 1Z9UA 2R1IA 2I79A 4II9A 3TOBA 5GCNA 1SQHA 2K5TA 2I00A 2P0WA 2PQ8A 3LD2A 1Q2YA 2P6EA 3JVNA 4NXYA 2HV2A 4HNWB 3R9GA 1S7NA 2NMTA 5H84A 3TT2A 4KOYA 5IX3A 2R7HA 4AG7A 4KOTA 4JXQA 5DWNA 1J4JA 3LODA 4JWPA 3MGDA 3R9FA 4R3LA 1L0CA 1CM0A 4FD4A 3FB3A 1IB1E 1WWZA 4EVYA 2Q04A 1YVOA 2PC1A 1QSOA 2PDOA 1MJAA 2QECA 1P0HA 1NE9A 1M4GA 5IB0A 2H5MA 3K9UA 4KZTA 3TFYA 2J8MA 2PR8A 3R9EA 4NEXA 3T90A 2X7BA 2IL4A 4NCZA 2VQYA 4QUSA 2PR1A 2JEVA 1N71A 3F8KA 2WPWA 2B4DA 2OH1A 3BJ8A 2FS5A 3WR7A 2B4DB 1RXTA 3F5BA 3D3SA 3SXNA 3TO7A 4CAXA 3N7ZA 1QSMA 2ZW4A 3GYAA 5H86A 2Z0ZA 2EUIA 5I0CA 1KZFA 3I9SA 3ZZIA 1Q2DA 2BSWA 4KOVA 4NSQA 2Z10A 1Q2CA 2CNMA 3D2MA 1B6BA 4QC6A 1Y9KA 1M1DA 4MY3A 3BJ7A 4FD5A 3S6HA 2PRBA 1XEBA 4XPDC 1M4DA 4B5PA 2BL1A 3D2PA 3W6XA 2REEA 2HUZA 4B5PB 3EC4A 3NE7A 3CXQA 4Y49B 2J8NA 1R57A 1IYLA 2OZGA 3W91A 3EFAA 1RO5A 3H4QA 1BOBA 5F49A 4ONUA 2Z11A 1QSRA 4QVTA 2DXQA 4OLLA 4MJ8A 1FY7A 2VZZA 4KVXA 4OADA 4KOXA 4KUAA 2FIAA 1S3ZA 3V8IA 4I49A 1Z4RA 1UFHA 4MY0A 4YGOA 2OU2A 3FRMA 3TTHA 3QAHA 2FIWA 1M4IA 2ZXVA 4AVCA 4AVAA 1MK4A 3W6SA 4U9ZA 1YREA 2J8RA 3VWEA 3CXSA 2JDDA 4XPLA 2VEZA 4E0AA 2O28A 4CRYB 4NF1A 4R3KA 4MBUA 1QSNA 4XNHC 1I1DA 5E96A 3UY5A 4LX9A 3FBUA 3RYOA 2Q44A 2Y0MA 3DNSA 4PV6A 2CY2A 2ZW7A 4R87A 5JPHA 5CNPA 2ARHA 1XE4A 2VI7A 4H6UA 4M3SA 4KLWA 1KUYA 2PSWA 1KUXA 1S60A 4U5YA 1TIQA 2GANA 2OZUA 4UA3A 4AVBA 2P6FA 1V0CA 5C82A 5ISVA 4AB7A 4ORFA 1WK4A 1P4NA 3TCVA 3BLNA 1I21A 4L8AA 4IF5A 4CAWA 1PU9A 2VZYA 4B5OA 3E0KA 4R57A 4GS4A 4F0YA 1IICA 2B58A 2FCKA 4JXRA 4LUAA 3EY5A 4H6ZA 3B8GA 1VKCA 1ON0A 3DDDA 1I12A 4KOWA 2Q4VA 3R95A 2REFA 4JLYA 4HNYB 3I3GA 4PK2A
chains in the Genus database with same CATH superfamily
4O23A 2FT0A 3PB6X 3H5ZA 5FVJA 5G20A 4PPZA 4OIWA 2PJ3A 5EMIA 5CPAA 3B3CA 1VGYA 3S6FA 3TOAA 3PGPA 4KOSA 2VL1A 4F8ZA 4NGNA 4YRHA 3VWDA 1VHOA 4KORA 5F46A 2B3VA 2PJ5A 1LAPA 3G8WA 4QB9A 4ZBGA 2RC4A 1YR0A 2FE7A 2GLFA 2VBQA 4IUSA 3FXTA 4OMEA 3GKRA 2ATRA 3TO9A 2G9DA 2GIVA 2VXKA 2PJ8A 4XPDB 2PIYA 2CIJA 3EO4A 4UFVA 3DR8A 3KHXA 2B4BA 1TXRA 3RBUA 3VATA 5ELYA 4JJXA 2JDCA 4EWTA 1Z8WA 1IY7A 1BPMA 1Z8XA 2Q0YA 3IWEA 4DNCA 4UF4A 1ZLHA 4PSWA 3KQZA 3G3SA 5F48A 2ZW5A 4A37A 5HXDA 3B3VA 5C88A 1XMTA 2JLMA 4ZY1A 3KHZA 4AG9A 2Q51A 3S9MA 4W9YA 1MJBA 5J8FA 3EXNA 5EC4A 3V38A 3FH4A 1HEEA 2ODFA 2J9AA 3K9TA 1JQGA 1TF8A 1ZG8A 2OR4A 4A33A 2FSRA 1DE4C 2CNTA 4EFDA 3SJXA 2ZPAA 1Y7RA 3R96A 1LFWA 1IIDA 1XIXA 3IWGA 2BUEA 2XEFA 4RI1A 5HH1A 5DWMA 1YGHA 4H2KA 2AE6A 4CAWA 1M4LA 4KS9A 4MHYA 4CGNA 5K8NA 4P45A 3KI9A 4ZYQA 4MCSA 3DR6A 1BO4A 1M44A 1TKFA 2R8VA 4OAEA 5JQ4A 2CF4A 6CPAA 4M85A 2G0BA 1B87A 3DGVA 4M6GA 5JH9A 4Q36A 4JD6A 4P4FA 4X5KA 5BWAB 2FL4A 2Z3NA 2CNSA 2PJAA 4KUBA 4TNUA 4BMHA 1A2ZA 1PYTB 1S7LA 1Y7EA 2PRQA 3CPXA 2ZEDA 1LANA 2BEIA 3FNCA 4YU9A 4R7MA 4PXEA 2DF5A 1QSTA 1F2OA 1CP6A 1Y9WA 4H89A 3WABA 4E2AA 2AFWA 3GIUA 2PJ9A 2D4PA 1OZPA 2EK8A 2YNDA 3FYNA 3D7HA 5F47A 5IV0A 2O4HA 4P6YA 5KTCA 3NFZA 1AMPA 3D67A 4C2XA 3D7FA 4F6AA 1LOKA 2PIZA 2WPXA 4J3GA 1UWYA 3B35A 4CS0B 4KLVA 4P4JA 4F9VA 1ELMP 1Z8LA 4E8OA 4KOUA 4G1PA 3QAYA 3BXMA 3F0AA 4MI4A 2V8VA 1CG2A 2F8HA 3SI0A 4MHNA 2ZOGA 2PJ2A 4OC3A 3KGQA 1GYTA 3PB4X 4MFLA 4XNHB 4K30A 3CZXA 1S7FA 2OZHA 4UCPA 3FX6A 3SJFA 5F09A 2R98A 4CGLA 1YLEA 4A39A 1XF8A 4A94A 3S6GA 2WYRA 1FT7A 2B3UA 4R9MA 2G3AA 2C1CA 1IU8A 4OC1A 2QIRA 2EVNA 4M6HA 4OIDA 5HVGA 4PSXA 7CPAA 1MJ9A 4HKFA 1VHSA 1YX0A 4UBRA 3S9NA 4ZY0A 2POKA 1X12A 4FD6A 3FJUA 3FECA 2AFSA 3K2KA 3WC5A 1S5KA 3R1KA 4DJLA 4A38A 4MFKA 4MFZA 3CPAA 5LYIA 4KVME 4CAVA 2AJ6A 1K4JA 2CXAA 2Q4YA 4ZX9A 2FXFA 4NJQA 4RS2A 4A2ZA 5JGFA 3PZJA 5HMNA 5LYFA 4B6ZA 2C27A 1GHEA 1YK3A 3OWCA 3H8EA 3I1UA 3C26A 3T9YA 4MHDA 2EWBA 2ZEHA 5LYLA 4UCNA 4L89A 2PJ7A 2XEJA 3KR5A 3H8FA 1NSLA 3SI1A 2B5GA 3JTKA 1RTQA 4LQ6A 2B5GB 1U6MA 2BOAA 4P4EA 3QB8A 1CBXA 1VIXA 1R3NA 4B14A 2GU2A 4PK3A 3ZJ0A 2HQYA 4YFJA 1F57A 1S7KA 3IEHA 1Z4EA 4WWVA 4FD7A 1TF9A 2GE3A 3FMCA 3GLJA 5EBVA 2GFQA 3WT4A 2Q7SA 3B7IA 2YNEA 4Y49C 2ZENA 2JBJA 2G3TA 1KUVA 2PJ6A 3KKWA 3SJEA 3JUWA 2Z3MA 1NSAA 2RB7A 4CRZB 2AFUA 2QMLA 2P6GA 1NMTA 3P2HA 3D8PA 4NGQA 4Z65A 4CPAA 1ZG7A 2KCWA 3HUVA 1YMEA 3B2YA 3IC1A 4NGTA 2ZEMA 3NH5A 4HNXB 4UWJA 2YGWA 3BI0A 4BD9A 3GY9A 4IHMA 2ZW6A 3CXPA 2Q7BA 5AG7A 3SHPA 2F5IA 3IJ3A 4X3RA 2ZOFA 3KQXA 2PJ4A 2D4OA 3P2FA 5K8OA 3IO1A 4FBEA 2ZEGA 2OB0A 5KTAA 2DEAA 3D7DA 3S6KA 1JWQA 1YVKA 2GREA 2HB6A 3IGRA 2WZNA 3N5FA 3NA6A 4MRIA 2ZEOA 4TWEA 3DSBA 3TO6A 4XPKA 3PP9A 4UWIA 1PUAA 4F9UA 2XEIA 3FIXA 4WJBA 1IYKA 4DUKA 4KVOE 1CJWA 2C6PA 3RNZA 2A4NA 5KTDA 1LRZA 3B3SA 4U9YA 3GB0A 4PXBA 3SXOA 2DPTA 1Z9UA 5DS0A 2R1IA 2I79A 3LMSA 4II9A 4UCMA 3TOBA 5GCNA 3BHXA 2XEGA 4P4BA 1SQHA 4X8IA 1Q7LA 2K5TA 2I00A 2P0WA 2PQ8A 3LD2A 1Q2YA 2P6EA 3PB7X 3JVNA 3MN8A 4NJRA 4NXYA 2HV2A 4HNWB 2PJCA 2YNCC 3R9GA 4ZGYB 2PE3A 4MFJA 1S7NA 1VHEA 3D7GA 2NMTA 5H84A 3TT2A 4KOYA 5G1ZA 4C2YA 3ISZA 1F2PA 5IX3A 1YW4A 2R7HA 4AG7A 4KOTA 4ZY2A 2C6CA 4JXQA 5DWNA 1HDQA 2AFZA 1J4JA 1XBUA 3LODA 4OC4A 1YLOA 3PBBA 4JWPA 4HPSA 3MGDA 3R9FA 4BBHA 4R3LA 5AG6A 1L0CA 1CM0A 4FD4A 3FB3A 5I4MA 1IB1E 4MMOA 1OBRA 1WWZA 4EVYA 4RUHA 3KR4A 2Q04A 4NGSA 3KZWA 1YVOA 2PC1A 1QSOA 4ONWA 5THWA 2PDOA 2WSAA 1MJAA 2NSMA 4M6IA 3PB8X 1Z5RA 3D66A 2QECA 3D4UA 1P0HA 2BCOA 1ARMA 1NE9A 1M4GA 5IB0A 2H5MA 4ZX8A 3IU1A 4R6TA 2FVGA 1ZLIA 3K9UA 4KZTA 1ARLA 4BINA 5A27A 3TFYA 4X2TA 2J8MA 2PR8A 2WUUA 3R9EA 2HC9A 3PFEA 1HDUA 4NEXA 3T90A 2AFMA 4MFPA 4CYPA 4FAIA 3LWUA 2X7BA 2Z3OA 4UIAA 3WC6A 2IL4A 4NCZA 4Q7AA 2VQYA 4QUSA 2PR1A 2JEVA 1N71A 3F8KA 4UFXA 5D8NA 2WPWA 2B4DA 3SI2A 2BO9A 4UEFA 2OH1A 2PCUA 1CP7A 3BJ8A 2FS5A 3WR7A 2B4DB 1RXTA 2PJBA 3F5BA 4GXHA 4K3NA 3D3SA 3SXNA 2QYVA 4MHPA 3TO7A 4CAXA 3N7ZA 1QSMA 4NFRA 2ZW4A 3CT9A 3GYAA 4UFWA 5H86A 4YWYA 4PQAA 1ZO0A 3HLPA 5LRKA 2ANPA 4A32A 2Z0ZA 4F0XA 2EUIA 5I0CA 1KZFA 3SJGA 4CYNA 3NH4A 3I9SA 3ZZIA 4R8FA 1Q2DA 2BSWA 4A30A 1QMUA 2PVWA 2IMOA 4KOVA 4UEZA 5K8MA 4NSQA 2Z10A 1Q2CA 2CNMA 2Z3KA 1CX8A 3D2MA 1B6BA 3NE8A 2OOTA 4B13A 4QC6A 1Y9KA 3V7ZA 1M1DA 4EMEA 4MY3A 1IGBA 3BJ7A 4FD5A 4OC0A 3S6HA 3VARA 4CGOA 3PRTA 1BPNA 2IJZA 2PRBA 1XEBA 1IOIA 3BI1A 4MXUA 1CPXA 1M4DA 4XPDC 4B11A 4B5PA 2Q4ZA 2BL1A 3D2PA 3W6XA 2JBKA 2DPSA 2REEA 2HUZA 4B5PB 2V77A 3CDXA 2ZEEA 3EC4A 3NE7A 5AG4A 5HVFA 1YQEA 3S9LA 4P44A 3CXQA 4Y49B 2J8NA 1YW6A 2PVVA 3FEEA 1R57A 4AXVA 1AYEA 3PBEA 1IYLA 2OZGA 3L2NA 1Y0RA 1XJOA 3H8GA 4OP4A 5J8CA 3W91A 3EFAA 2EO8A 1RO5A 3H4QA 4MFQA 1BOBA 2QJ8A 5F49A 5K8PA 1Y0YA 3VH9A 4ONUA 2Z11A 5LRGA 4B12A 1IOFA 1Z8TA 1QSRA 4OKOA 4IAVA 4QVTA 2AFOA 2DXQA 4C7HA 3JRUA 4MJ8A 4OLLA 1FY7A 5AG5A 3RZAA 3DLJA 2VZZA 2CTBA 4KVXA 4JYWA 4CYOA 2V8GA 4OADA 3KASA 4KSFA 1ELLP 4KOXA 2I3CA 2O53A 4KUAA 3PEIA 2FIAA 1S3ZA 2ZEPA 4I49A 2RFHA 4OC2A 3V8IA 4C7IA 1Z4RA 1UFHA 4MY0A 1BAVA 1QQ9A 4YGOA 4R76A 2CTCA 2OU2A 3FRMA 3TTHA 3QNVA 4B10A 4KSAA 2EBJA 5G22A 3QAHA 3PB9X 3FF3A 5A28A 4P4DA 1XMBA 2ZEFA 1CPSA 1H8LA 2EK9A 1M4IA 2FIWA 3FVLA 5HVHA 3TE4A 2ZXVA 1KWMA 2Q43A 4MCRA 4AVCA 4CAEA 2YNCA 4A95A 2AFXA 3T8WA 5LYDA 4AVAA 5LRJA 1MK4A 4UIBA 3W6SA 4U9ZA 1YREA 4P4IA 4QBJA 2J8RA 3LACA 3VWEA 3CXSA 2JDDA 2PJ1A 4XPLA 2VEZA 1DTDA 5J1QA 5CBMA 3KL9A 1BLLE 4E0AA 2O28A 4CRYB 2ABZA 4NF1A 2F7VA 2NYQA 4C2ZA 1YSJA 2Z3LA 4R3KA 3TC8A 4MBUA 4FUUA 4CYQA 1QSNA 4XNHC 1I1DA 5E96A 3UY5A 3GUXA 3RAMA 4PXDA 3IWWA 4LX9A 3FBUA 4IK2A 3RYOA 1EE3P 1R43A 2Q44A 2Y0MA 1LAMA 5IB9A 3DNSA 3B3WA 2CY2A 2Z3PA 2ZW7A 3IIBA 4PV6A 4R87A 5G21A 4UEEA 4CGPA 5JPHA 3IFEA 2ARHA 5CNPA 1XE4A 3TX8A 2VI7A 4H6UA 4CAFA 4M3SA 4KLWA 1KUYA 5JM6A 2PSWA 2GLJA 2V8DA 1KUXA 2V8HA 4P10A 1S60A 4U5YA 1PCAA 2JEWA 1TIQA 1XOVA 2GANA 2OZUA 1X10A 4PXCA 4UA3A 4AVBA 2P6FA 1V0CA 5C82A 5ISVA 3PFOA 1AUGA 3ISXA 4AB7A 4NGRA 4ORFA 4FWUA 1FNOA 1WK4A 4ZI6A 1ZG9A 1P4NA 8CPAA 3TCVA 1TKJA 3BLNA 3FEDA 1I21A 2IQ6A 4L8AA 5D29A 3WC7A 1Z2LA 4IF5A 4DYOA 4MCPA 1PU9A 4KSIA 4OC5A 4C68A 2VZYA 5AGEA 1LCPA 3E0KA 2QVPA 4B5OA 3D68A 4R57A 3B3TA 3MRUA 2C6GA 4GS4A 4MCQA 4F0YA 1XFOA 4MHZA 1IICA 2B58A 2FCKA 4JXRA 4LUAA 3RO0A 3EY5A 4GM5A 4JZ0A 4H6ZA 3NH8A 4RN7A 3B8GA 1VKCA 4Q38A 1TKHA 4NGMA 1ON0A 3DDDA 1I12A 4KOWA 2PJ0A 2Q4VA 3A9LA 3R95A 2REFA 4JLYA 4HNYB 4A31A 4CGMA 3IU2A 4LQGA 4NGPA 2ZELA 3I3GA 1XRYA 4PK2A
chains in the Genus database with same CATH topology
2FT0A 3H5ZA 5FVJA 5G20A 3S6FA 3TOAA 3PGPA 4KOSA 4YRHA 3VWDA 4KORA 5F46A 2B3VA 3G8WA 4QB9A 4ZBGA 2RC4A 1YR0A 2FE7A 2VBQA 4IUSA 3FXTA 3GKRA 2ATRA 3TO9A 2GIVA 2VXKA 4XPDB 3EO4A 4UFVA 3DR8A 2B4BA 4JJXA 2JDCA 2Q0YA 3IWEA 4DNCA 4PSWA 5F48A 3G3SA 2ZW5A 5C88A 1XMTA 2JLMA 4AG9A 1MJBA 5J8FA 3EXNA 5EC4A 4A33A 2FSRA 2CNTA 2ZPAA 1Y7RA 3R96A 1IIDA 1XIXA 3IWGA 2BUEA 5HH1A 4RI1A 5DWMA 1YGHA 2AE6A 4CGNA 4KS9A 3DR6A 1BO4A 1M44A 2R8VA 5JQ4A 4OAEA 4M85A 2G0BA 1B87A 4Q36A 4JD6A 4X5KA 5BWAB 2FL4A 2Z3NA 2CNSA 4BMHA 4KUBA 1S7LA 2BEIA 3FNCA 1QSTA 4H89A 1Y9WA 4E2AA 3FYNA 2D4PA 1OZPA 2YNDA 5F47A 5J8CA 5IV0A 5KTCA 4C2XA 4F6AA 2WPXA 4J3GA 4CS0B 4KLVA 4E8OA 4KOUA 3F0AA 4MI4A 4MFLA 4XNHB 4K30A 1S7FA 2OZHA 4UCPA 2R98A 4CGLA 1YLEA 1XF8A 3S6GA 2B3UA 4R9MA 2G3AA 2QIRA 2EVNA 4PSXA 1MJ9A 4HKFA 1VHSA 1YX0A 4UBRA 3TE4A 4FD6A 1S5KA 3R1KA 4MFKA 4MFZA 4KVME 4CAVA 2AJ6A 1K4JA 2CXAA 2Q4YA 2FXFA 4RS2A 4A2ZA 3PZJA 5HMNA 2C27A 1GHEA 1YK3A 3OWCA 3C26A 3T9YA 4MHDA 4UCNA 4L89A 1NSLA 2B5GA 3JTKA 2B5GB 1U6MA 3QB8A 4B14A 4PK3A 3ZJ0A 2HQYA 4YFJA 1S7KA 1Z4EA 4FD7A 2GE3A 5EBVA 2YNEA 4Y49C 2G3TA 1KUVA 3KKWA 3JUWA 2Z3MA 4CRZB 2QMLA 2P6GA 1NMTA 3P2HA 3D8PA 2KCWA 4UWJA 4HNXB 2YGWA 3GY9A 2Q7BA 2ZW6A 3CXPA 3SHPA 5AG7A 2F5IA 2D4OA 3P2FA 2OB0A 5KTAA 3S6KA 1YVKA 4QBJA 3IGRA 3TO6A 3DSBA 4XPKA 3PP9A 4UWIA 1PUAA 3FIXA 1IYKA 4KVOE 1CJWA 2A4NA 5KTDA 1LRZA 4U9YA 3SXOA 2DPTA 1Z9UA 2R1IA 2I79A 4II9A 4UCMA 3TOBA 5GCNA 1SQHA 2K5TA 2I00A 2P0WA 2PQ8A 3LD2A 1Q2YA 2P6EA 3JVNA 4NXYA 2HV2A 4HNWB 2YNCC 3R9GA 4ZGYB 4MFJA 1S7NA 2NMTA 5H84A 3TT2A 4KOYA 5G1ZA 4C2YA 5IX3A 2R7HA 4AG7A 4KOTA 4JXQA 5DWNA 1J4JA 3LODA 4JWPA 4BBHA 3MGDA 3R9FA 4R3LA 5AG6A 1L0CA 1CM0A 4FD4A 3FB3A 1IB1E 1WWZA 4EVYA 2Q04A 1YVOA 2PC1A 1QSOA 2PDOA 2WSAA 1MJAA 2QECA 1P0HA 1NE9A 1M4GA 5IB0A 2H5MA 3IU1A 3K9UA 4KZTA 5A27A 3TFYA 2J8MA 2PR8A 2WUUA 3R9EA 4NEXA 3T90A 4MFPA 4CYPA 2X7BA 2Z3OA 2IL4A 4NCZA 2VQYA 4QUSA 2PR1A 2JEVA 1N71A 3F8KA 4UFXA 2WPWA 2B4DA 2OH1A 3BJ8A 2FS5A 3WR7A 2B4DB 1RXTA 3F5BA 3D3SA 3SXNA 3TO7A 4CAXA 3N7ZA 1QSMA 2ZW4A 3GYAA 4UFWA 5H86A 1ZO0A 4A32A 2Z0ZA 4F0XA 2EUIA 5I0CA 1KZFA 4CYNA 3I9SA 3ZZIA 1Q2DA 2BSWA 4A30A 4KOVA 4NSQA 2Z10A 1Q2CA 2CNMA 2Z3KA 3D2MA 4B13A 1B6BA 4QC6A 1Y9KA 1M1DA 4MY3A 3BJ7A 4FD5A 3S6HA 4CGOA 2PRBA 1XEBA 4XPDC 1M4DA 4B11A 4B5PA 2BL1A 3D2PA 3W6XA 2DPSA 2REEA 2HUZA 4B5PB 3EC4A 3NE7A 5AG4A 3CXQA 4Y49B 2J8NA 1R57A 1IYLA 2OZGA 3W91A 3EFAA 1RO5A 3H4QA 4MFQA 1BOBA 5F49A 4ONUA 2Z11A 4B12A 1QSRA 4QVTA 2DXQA 4C7HA 4OLLA 4MJ8A 5AG5A 1FY7A 2VZZA 4KVXA 4CYOA 4OADA 4KSFA 4KOXA 4KUAA 2FIAA 1S3ZA 3V8IA 4I49A 4C7IA 1Z4RA 1UFHA 4MY0A 4YGOA 2OU2A 3FRMA 3TTHA 4B10A 4KSAA 5G22A 3QAHA 5A28A 2FIWA 1M4IA 2ZXVA 4CAEA 4AVCA 2YNCA 4A95A 4AVAA 1MK4A 3W6SA 4U9ZA 1YREA 2J8RA 3VWEA 3CXSA 2JDDA 4XPLA 2VEZA 4E0AA 2O28A 4CRYB 4NF1A 4C2ZA 2Z3LA 4R3KA 4MBUA 4CYQA 1QSNA 4XNHC 1I1DA 5E96A 3UY5A 4LX9A 3FBUA 3RYOA 2Q44A 2Y0MA 3DNSA 4PV6A 2CY2A 2Z3PA 2ZW7A 4R87A 5G21A 4CGPA 5JPHA 5CNPA 2ARHA 1XE4A 2VI7A 4H6UA 4CAFA 4M3SA 4KLWA 1KUYA 2PSWA 1KUXA 1S60A 4U5YA 1TIQA 2GANA 2OZUA 4UA3A 4AVBA 2P6FA 1V0CA 5C82A 5ISVA 4AB7A 4ORFA 1WK4A 1P4NA 3TCVA 3BLNA 1I21A 4L8AA 4IF5A 4CAWA 1PU9A 4C68A 2VZYA 5AGEA 4B5OA 3E0KA 4R57A 4GS4A 4F0YA 1IICA 2B58A 2FCKA 4JXRA 4LUAA 3EY5A 4H6ZA 3B8GA 1VKCA 4Q38A 1ON0A 3DDDA 1I12A 4KOWA 2Q4VA 3A9LA 3R95A 2REFA 4JLYA 4HNYB 4A31A 4CGMA 3IU2A 3I3GA 4PK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT0 A;  5FVJ A;  3S6F A;  3TOA A;  3PGP A;  4KOS A;  4YRH A;  3VWD A;  4KOR A;  5F46 A;  2B3V A;  3G8W A;  4QB9 A;  4ZBG A;  2RC4 A;  1YR0 A;  2FE7 A;  2VBQ A;  4IUS A;  3FXT A;  3GKR A;  2ATR A;  3TO9 A;  2GIV A;  2VXK A;  4XPD B;  3EO4 A;  3DR8 A;  2B4B A;  4JJX A;  2JDC A;  2Q0Y A;  4DNC A;  4PSW A;  5F48 A;  3G3S A;  2ZW5 A;  5C88 A;  1XMT A;  2JLM A;  4AG9 A;  1MJB A;  5J8F A;  3EXN A;  5EC4 A;  2FSR A;  2CNT A;  2ZPA A;  1Y7R A;  3R96 A;  1IID A;  1XIX A;  3IWG A;  2BUE A;  5HH1 A;  4RI1 A;  5DWM A;  1YGH A;  2AE6 A;  3DR6 A;  1BO4 A;  1M44 A;  2R8V A;  5JQ4 A;  4OAE A;  4M85 A;  2G0B A;  1B87 A;  4JD6 A;  4X5K A;  2FL4 A;  2CNS A;  4BMH A;  4KUB A;  1S7L A;  2BEI A;  3FNC A;  1QST A;  4H89 A;  1Y9W A;  4E2A A;  3FYN A;  2D4P A;  1OZP A;  5F47 A;  5J8C A;  5IV0 A;  5KTC A;  4F6A A;  2WPX A;  4J3G A;  4CS0 B;  4KLV A;  4E8O A;  4KOU A;  3F0A A;  4MI4 A;  4XNH B;  4K30 A;  1S7F A;  2OZH A;  2R98 A;  1YLE A;  1XF8 A;  3S6G A;  2B3U A;  4R9M A;  2G3A A;  2QIR A;  2EVN A;  4PSX A;  1MJ9 A;  4HKF A;  1VHS A;  1YX0 A;  4UBR A;  3TE4 A;  4FD6 A;  1S5K A;  3R1K A;  4KVM E;  4CAV A;  2AJ6 A;  1K4J A;  2Q4Y A;  2FXF A;  4RS2 A;  3PZJ A;  5HMN A;  2C27 A;  1GHE A;  1YK3 A;  3OWC A;  3C26 A;  3T9Y A;  4MHD A;  4L89 A;  1NSL A;  2B5G A;  2B5G B;  1U6M A;  3QB8 A;  4PK3 A;  3ZJ0 A;  2HQY A;  4YFJ A;  1S7K A;  1Z4E A;  4FD7 A;  2GE3 A;  5EBV A;  4Y49 C;  2G3T A;  1KUV A;  3KKW A;  3JUW A;  4CRZ B;  2QML A;  2P6G A;  1NMT A;  3P2H A;  3D8P A;  2KCW A;  4UWJ A;  4HNX B;  3GY9 A;  2Q7B A;  2ZW6 A;  3CXP A;  3SHP A;  2F5I A;  2D4O A;  3P2F A;  2OB0 A;  5KTA A;  3S6K A;  1YVK A;  4QBJ A;  3IGR A;  3TO6 A;  3DSB A;  4XPK A;  3PP9 A;  4UWI A;  1PUA A;  3FIX A;  1IYK A;  4KVO E;  1CJW A;  2A4N A;  5KTD A;  1LRZ A;  4U9Y A;  3SXO A;  1Z9U A;  2R1I A;  2I79 A;  4II9 A;  3TOB A;  5GCN A;  1SQH A;  2K5T A;  2I00 A;  2P0W A;  2PQ8 A;  3LD2 A;  1Q2Y A;  2P6E A;  3JVN A;  4NXY A;  2HV2 A;  4HNW B;  3R9G A;  1S7N A;  2NMT A;  5H84 A;  3TT2 A;  4KOY A;  5IX3 A;  2R7H A;  4AG7 A;  4KOT A;  4JXQ A;  5DWN A;  1J4J A;  3LOD A;  4JWP A;  3MGD A;  3R9F A;  4R3L A;  1L0C A;  1CM0 A;  4FD4 A;  3FB3 A;  1IB1 E;  1WWZ A;  4EVY A;  2Q04 A;  1YVO A;  2PC1 A;  1QSO A;  2PDO A;  1MJA A;  2QEC A;  1P0H A;  1NE9 A;  1M4G A;  5IB0 A;  2H5M A;  3K9U A;  4KZT A;  3TFY A;  2J8M A;  2PR8 A;  3R9E A;  4NEX A;  3T90 A;  2X7B A;  2IL4 A;  4NCZ A;  2VQY A;  4QUS A;  2PR1 A;  2JEV A;  1N71 A;  3F8K A;  2WPW A;  2B4D A;  2OH1 A;  3BJ8 A;  2FS5 A;  3WR7 A;  2B4D B;  1RXT A;  3F5B A;  3D3S A;  3SXN A;  3TO7 A;  4CAX A;  3N7Z A;  1QSM A;  2ZW4 A;  3GYA A;  5H86 A;  2Z0Z A;  2EUI A;  5I0C A;  1KZF A;  3I9S A;  3ZZI A;  1Q2D A;  2BSW A;  4KOV A;  4NSQ A;  2Z10 A;  1Q2C A;  2CNM A;  3D2M A;  1B6B A;  4QC6 A;  1Y9K A;  1M1D A;  4MY3 A;  3BJ7 A;  4FD5 A;  3S6H A;  2PRB A;  1XEB A;  4XPD C;  1M4D A;  4B5P A;  2BL1 A;  3D2P A;  3W6X A;  2REE A;  2HUZ A;  4B5P B;  3EC4 A;  3NE7 A;  3CXQ A;  4Y49 B;  2J8N A;  1R57 A;  1IYL A;  2OZG A;  3W91 A;  3EFA A;  1RO5 A;  3H4Q A;  1BOB A;  5F49 A;  4ONU A;  2Z11 A;  1QSR A;  4QVT A;  2DXQ A;  4OLL A;  4MJ8 A;  1FY7 A;  2VZZ A;  4KVX A;  4OAD A;  4KOX A;  4KUA A;  2FIA A;  1S3Z A;  3V8I A;  4I49 A;  1Z4R A;  1UFH A;  4MY0 A;  4YGO A;  2OU2 A;  3FRM A;  3TTH A;  3QAH A;  2FIW A;  1M4I A;  2ZXV A;  4AVC A;  4AVA A;  1MK4 A;  3W6S A;  4U9Z A;  1YRE A;  2J8R A;  3VWE A;  3CXS A;  2JDD A;  4XPL A;  2VEZ A;  4E0A A;  2O28 A;  4CRY B;  4NF1 A;  4R3K A;  4MBU A;  1QSN A;  4XNH C;  1I1D A;  5E96 A;  3UY5 A;  4LX9 A;  3FBU A;  3RYO A;  2Q44 A;  2Y0M A;  3DNS A;  4PV6 A;  2CY2 A;  2ZW7 A;  4R87 A;  5JPH A;  5CNP A;  2ARH A;  1XE4 A;  2VI7 A;  4H6U A;  4M3S A;  4KLW A;  1KUY A;  2PSW A;  1KUX A;  1S60 A;  4U5Y A;  1TIQ A;  2GAN A;  2OZU A;  4UA3 A;  4AVB A;  2P6F A;  1V0C A;  5C82 A;  5ISV A;  4AB7 A;  4ORF A;  1WK4 A;  1P4N A;  3TCV A;  3BLN A;  1I21 A;  4L8A A;  4IF5 A;  4CAW A;  1PU9 A;  2VZY A;  4B5O A;  3E0K A;  4R57 A;  4GS4 A;  4F0Y A;  1IIC A;  2B58 A;  2FCK A;  4JXR A;  4LUA A;  3EY5 A;  4H6Z A;  3B8G A;  1VKC A;  1ON0 A;  3DDD A;  1I12 A;  4KOW A;  2Q4V A;  3R95 A;  2REF A;  4JLY A;  4HNY B;  3I3G A;  4PK2 A; 
#chains in the Genus database with same CATH topology
 4O23 A;  2FT0 A;  3PB6 X;  3H5Z A;  5FVJ A;  5G20 A;  4PPZ A;  4OIW A;  2PJ3 A;  5EMI A;  5CPA A;  3B3C A;  1VGY A;  3S6F A;  3TOA A;  3PGP A;  4KOS A;  2VL1 A;  4F8Z A;  4NGN A;  4YRH A;  3VWD A;  1VHO A;  4KOR A;  5F46 A;  2B3V A;  2PJ5 A;  1LAP A;  3G8W A;  4QB9 A;  4ZBG A;  2RC4 A;  1YR0 A;  2FE7 A;  2GLF A;  2VBQ A;  4IUS A;  3FXT A;  4OME A;  3GKR A;  2ATR A;  3TO9 A;  2G9D A;  2GIV A;  2VXK A;  2PJ8 A;  4XPD B;  2PIY A;  2CIJ A;  3EO4 A;  4UFV A;  3DR8 A;  3KHX A;  2B4B A;  1TXR A;  3RBU A;  3VAT A;  5ELY A;  4JJX A;  2JDC A;  4EWT A;  1Z8W A;  1IY7 A;  1BPM A;  1Z8X A;  2Q0Y A;  3IWE A;  4DNC A;  4UF4 A;  1ZLH A;  4PSW A;  3KQZ A;  3G3S A;  5F48 A;  2ZW5 A;  4A37 A;  5HXD A;  3B3V A;  5C88 A;  1XMT A;  2JLM A;  4ZY1 A;  3KHZ A;  4AG9 A;  2Q51 A;  3S9M A;  4W9Y A;  1MJB A;  5J8F A;  3EXN A;  5EC4 A;  3V38 A;  3FH4 A;  1HEE A;  2ODF A;  2J9A A;  3K9T A;  1JQG A;  1TF8 A;  1ZG8 A;  2OR4 A;  4A33 A;  2FSR A;  1DE4 C;  2CNT A;  4EFD A;  3SJX A;  2ZPA A;  1Y7R A;  3R96 A;  1LFW A;  1IID A;  1XIX A;  3IWG A;  2BUE A;  2XEF A;  4RI1 A;  5HH1 A;  5DWM A;  1YGH A;  4H2K A;  2AE6 A;  4CAW A;  1M4L A;  4KS9 A;  4MHY A;  4CGN A;  5K8N A;  4P45 A;  3KI9 A;  4ZYQ A;  4MCS A;  3DR6 A;  1BO4 A;  1M44 A;  1TKF A;  2R8V A;  4OAE A;  5JQ4 A;  2CF4 A;  6CPA A;  4M85 A;  2G0B A;  1B87 A;  3DGV A;  4M6G A;  5JH9 A;  4Q36 A;  4JD6 A;  4P4F A;  4X5K A;  5BWA B;  2FL4 A;  2Z3N A;  2CNS A;  2PJA A;  4KUB A;  4TNU A;  4BMH A;  1A2Z A;  1PYT B;  1S7L A;  1Y7E A;  2PRQ A;  3CPX A;  2ZED A;  1LAN A;  2BEI A;  3FNC A;  4YU9 A;  4R7M A;  4PXE A;  2DF5 A;  1QST A;  1F2O A;  1CP6 A;  1Y9W A;  4H89 A;  3WAB A;  4E2A A;  2AFW A;  3GIU A;  2PJ9 A;  2D4P A;  1OZP A;  2EK8 A;  2YND A;  3FYN A;  3D7H A;  5F47 A;  5IV0 A;  2O4H A;  4P6Y A;  5KTC A;  3NFZ A;  1AMP A;  3D67 A;  4C2X A;  3D7F A;  4F6A A;  1LOK A;  2PIZ A;  2WPX A;  4J3G A;  1UWY A;  3B35 A;  4CS0 B;  4KLV A;  4P4J A;  4F9V A;  1ELM P;  1Z8L A;  4E8O A;  4KOU A;  4G1P A;  3QAY A;  3BXM A;  3F0A A;  4MI4 A;  2V8V A;  1CG2 A;  2F8H A;  3SI0 A;  4MHN A;  2ZOG A;  2PJ2 A;  4OC3 A;  3KGQ A;  1GYT A;  3PB4 X;  4MFL A;  4XNH B;  4K30 A;  3CZX A;  1S7F A;  2OZH A;  4UCP A;  3FX6 A;  3SJF A;  5F09 A;  2R98 A;  4CGL A;  1YLE A;  4A39 A;  1XF8 A;  4A94 A;  3S6G A;  2WYR A;  1FT7 A;  2B3U A;  4R9M A;  2G3A A;  2C1C A;  1IU8 A;  4OC1 A;  2QIR A;  2EVN A;  4M6H A;  4OID A;  5HVG A;  4PSX A;  7CPA A;  1MJ9 A;  4HKF A;  1VHS A;  1YX0 A;  4UBR A;  3S9N A;  4ZY0 A;  2POK A;  1X12 A;  4FD6 A;  3FJU A;  3FEC A;  2AFS A;  3K2K A;  3WC5 A;  1S5K A;  3R1K A;  4DJL A;  4A38 A;  4MFK A;  4MFZ A;  3CPA A;  5LYI A;  4KVM E;  4CAV A;  2AJ6 A;  1K4J A;  2CXA A;  2Q4Y A;  4ZX9 A;  2FXF A;  4NJQ A;  4RS2 A;  4A2Z A;  5JGF A;  3PZJ A;  5HMN A;  5LYF A;  4B6Z A;  2C27 A;  1GHE A;  1YK3 A;  3OWC A;  3H8E A;  3I1U A;  3C26 A;  3T9Y A;  4MHD A;  2EWB A;  2ZEH A;  5LYL A;  4UCN A;  4L89 A;  2PJ7 A;  2XEJ A;  3KR5 A;  3H8F A;  1NSL A;  3SI1 A;  2B5G A;  3JTK A;  1RTQ A;  4LQ6 A;  2B5G B;  1U6M A;  2BOA A;  4P4E A;  3QB8 A;  1CBX A;  1VIX A;  1R3N A;  4B14 A;  2GU2 A;  4PK3 A;  3ZJ0 A;  2HQY A;  4YFJ A;  1F57 A;  1S7K A;  3IEH A;  1Z4E A;  4WWV A;  4FD7 A;  1TF9 A;  2GE3 A;  3FMC A;  3GLJ A;  5EBV A;  2GFQ A;  3WT4 A;  2Q7S A;  3B7I A;  2YNE A;  4Y49 C;  2ZEN A;  2JBJ A;  2G3T A;  1KUV A;  2PJ6 A;  3KKW A;  3SJE A;  3JUW A;  2Z3M A;  1NSA A;  2RB7 A;  4CRZ B;  2AFU A;  2QML A;  2P6G A;  1NMT A;  3P2H A;  3D8P A;  4NGQ A;  4Z65 A;  4CPA A;  1ZG7 A;  2KCW A;  3HUV A;  1YME A;  3B2Y A;  3IC1 A;  4NGT A;  2ZEM A;  3NH5 A;  4HNX B;  4UWJ A;  2YGW A;  3BI0 A;  4BD9 A;  3GY9 A;  4IHM A;  2ZW6 A;  3CXP A;  2Q7B A;  5AG7 A;  3SHP A;  2F5I A;  3IJ3 A;  4X3R A;  2ZOF A;  3KQX A;  2PJ4 A;  2D4O A;  3P2F A;  5K8O A;  3IO1 A;  4FBE A;  2ZEG A;  2OB0 A;  5KTA A;  2DEA A;  3D7D A;  3S6K A;  1JWQ A;  1YVK A;  2GRE A;  2HB6 A;  3IGR A;  2WZN A;  3N5F A;  3NA6 A;  4MRI A;  2ZEO A;  4TWE A;  3DSB A;  3TO6 A;  4XPK A;  3PP9 A;  4UWI A;  1PUA A;  4F9U A;  2XEI A;  3FIX A;  4WJB A;  1IYK A;  4DUK A;  4KVO E;  1CJW A;  2C6P A;  3RNZ A;  2A4N A;  5KTD A;  1LRZ A;  3B3S A;  4U9Y A;  3GB0 A;  4PXB A;  3SXO A;  2DPT A;  1Z9U A;  5DS0 A;  2R1I A;  2I79 A;  3LMS A;  4II9 A;  4UCM A;  3TOB A;  5GCN A;  3BHX A;  2XEG A;  4P4B A;  1SQH A;  4X8I A;  1Q7L A;  2K5T A;  2I00 A;  2P0W A;  2PQ8 A;  3LD2 A;  1Q2Y A;  2P6E A;  3PB7 X;  3JVN A;  3MN8 A;  4NJR A;  4NXY A;  2HV2 A;  4HNW B;  2PJC A;  2YNC C;  3R9G A;  4ZGY B;  2PE3 A;  4MFJ A;  1S7N A;  1VHE A;  3D7G A;  2NMT A;  5H84 A;  3TT2 A;  4KOY A;  5G1Z A;  4C2Y A;  3ISZ A;  1F2P A;  5IX3 A;  1YW4 A;  2R7H A;  4AG7 A;  4KOT A;  4ZY2 A;  2C6C A;  4JXQ A;  5DWN A;  1HDQ A;  2AFZ A;  1J4J A;  1XBU A;  3LOD A;  4OC4 A;  1YLO A;  3PBB A;  4JWP A;  4HPS A;  3MGD A;  3R9F A;  4BBH A;  4R3L A;  5AG6 A;  1L0C A;  1CM0 A;  4FD4 A;  3FB3 A;  5I4M A;  1IB1 E;  4MMO A;  1OBR A;  1WWZ A;  4EVY A;  4RUH A;  3KR4 A;  2Q04 A;  4NGS A;  3KZW A;  1YVO A;  2PC1 A;  1QSO A;  4ONW A;  5THW A;  2PDO A;  2WSA A;  1MJA A;  2NSM A;  4M6I A;  3PB8 X;  1Z5R A;  3D66 A;  2QEC A;  3D4U A;  1P0H A;  2BCO A;  1ARM A;  1NE9 A;  1M4G A;  5IB0 A;  2H5M A;  4ZX8 A;  3IU1 A;  4R6T A;  2FVG A;  1ZLI A;  3K9U A;  4KZT A;  1ARL A;  4BIN A;  5A27 A;  3TFY A;  4X2T A;  2J8M A;  2PR8 A;  2WUU A;  3R9E A;  2HC9 A;  3PFE A;  1HDU A;  4NEX A;  3T90 A;  2AFM A;  4MFP A;  4CYP A;  4FAI A;  3LWU A;  2X7B A;  2Z3O A;  4UIA A;  3WC6 A;  2IL4 A;  4NCZ A;  4Q7A A;  2VQY A;  4QUS A;  2PR1 A;  2JEV A;  1N71 A;  3F8K A;  4UFX A;  5D8N A;  2WPW A;  2B4D A;  3SI2 A;  2BO9 A;  4UEF A;  2OH1 A;  2PCU A;  1CP7 A;  3BJ8 A;  2FS5 A;  3WR7 A;  2B4D B;  1RXT A;  2PJB A;  3F5B A;  4GXH A;  4K3N A;  3D3S A;  3SXN A;  2QYV A;  4MHP A;  3TO7 A;  4CAX A;  3N7Z A;  1QSM A;  4NFR A;  2ZW4 A;  3CT9 A;  3GYA A;  4UFW A;  5H86 A;  4YWY A;  4PQA A;  1ZO0 A;  3HLP A;  5LRK A;  2ANP A;  4A32 A;  2Z0Z A;  4F0X A;  2EUI A;  5I0C A;  1KZF A;  3SJG A;  4CYN A;  3NH4 A;  3I9S A;  3ZZI A;  4R8F A;  1Q2D A;  2BSW A;  4A30 A;  1QMU A;  2PVW A;  2IMO A;  4KOV A;  4UEZ A;  5K8M A;  4NSQ A;  2Z10 A;  1Q2C A;  2CNM A;  2Z3K A;  1CX8 A;  3D2M A;  1B6B A;  3NE8 A;  2OOT A;  4B13 A;  4QC6 A;  1Y9K A;  3V7Z A;  1M1D A;  4EME A;  4MY3 A;  1IGB A;  3BJ7 A;  4FD5 A;  4OC0 A;  3S6H A;  3VAR A;  4CGO A;  3PRT A;  1BPN A;  2IJZ A;  2PRB A;  1XEB A;  1IOI A;  3BI1 A;  4MXU A;  1CPX A;  1M4D A;  4XPD C;  4B11 A;  4B5P A;  2Q4Z A;  2BL1 A;  3D2P A;  3W6X A;  2JBK A;  2DPS A;  2REE A;  2HUZ A;  4B5P B;  2V77 A;  3CDX A;  2ZEE A;  3EC4 A;  3NE7 A;  5AG4 A;  5HVF A;  1YQE A;  3S9L A;  4P44 A;  3CXQ A;  4Y49 B;  2J8N A;  1YW6 A;  2PVV A;  3FEE A;  1R57 A;  4AXV A;  1AYE A;  3PBE A;  1IYL A;  2OZG A;  3L2N A;  1Y0R A;  1XJO A;  3H8G A;  4OP4 A;  5J8C A;  3W91 A;  3EFA A;  2EO8 A;  1RO5 A;  3H4Q A;  4MFQ A;  1BOB A;  2QJ8 A;  5F49 A;  5K8P A;  1Y0Y A;  3VH9 A;  4ONU A;  2Z11 A;  5LRG A;  4B12 A;  1IOF A;  1Z8T A;  1QSR A;  4OKO A;  4IAV A;  4QVT A;  2AFO A;  2DXQ A;  4C7H A;  3JRU A;  4MJ8 A;  4OLL A;  1FY7 A;  5AG5 A;  3RZA A;  3DLJ A;  2VZZ A;  2CTB A;  4KVX A;  4JYW A;  4CYO A;  2V8G A;  4OAD A;  3KAS A;  4KSF A;  1ELL P;  4KOX A;  2I3C A;  2O53 A;  4KUA A;  3PEI A;  2FIA A;  1S3Z A;  2ZEP A;  4I49 A;  2RFH A;  4OC2 A;  3V8I A;  4C7I A;  1Z4R A;  1UFH A;  4MY0 A;  1BAV A;  1QQ9 A;  4YGO A;  4R76 A;  2CTC A;  2OU2 A;  3FRM A;  3TTH A;  3QNV A;  4B10 A;  4KSA A;  2EBJ A;  5G22 A;  3QAH A;  3PB9 X;  3FF3 A;  5A28 A;  4P4D A;  1XMB A;  2ZEF A;  1CPS A;  1H8L A;  2EK9 A;  1M4I A;  2FIW A;  3FVL A;  5HVH A;  3TE4 A;  2ZXV A;  1KWM A;  2Q43 A;  4MCR A;  4AVC A;  4CAE A;  2YNC A;  4A95 A;  2AFX A;  3T8W A;  5LYD A;  4AVA A;  5LRJ A;  1MK4 A;  4UIB A;  3W6S A;  4U9Z A;  1YRE A;  4P4I A;  4QBJ A;  2J8R A;  3LAC A;  3VWE A;  3CXS A;  2JDD A;  2PJ1 A;  4XPL A;  2VEZ A;  1DTD A;  5J1Q A;  5CBM A;  3KL9 A;  1BLL E;  4E0A A;  2O28 A;  4CRY B;  2ABZ A;  4NF1 A;  2F7V A;  2NYQ A;  4C2Z A;  1YSJ A;  2Z3L A;  4R3K A;  3TC8 A;  4MBU A;  4FUU A;  4CYQ A;  1QSN A;  4XNH C;  1I1D A;  5E96 A;  3UY5 A;  3GUX A;  3RAM A;  4PXD A;  3IWW A;  4LX9 A;  3FBU A;  4IK2 A;  3RYO A;  1EE3 P;  1R43 A;  2Q44 A;  2Y0M A;  1LAM A;  5IB9 A;  3DNS A;  3B3W A;  2CY2 A;  2Z3P A;  2ZW7 A;  3IIB A;  4PV6 A;  4R87 A;  5G21 A;  4UEE A;  4CGP A;  5JPH A;  3IFE A;  2ARH A;  5CNP A;  1XE4 A;  3TX8 A;  2VI7 A;  4H6U A;  4CAF A;  4M3S A;  4KLW A;  1KUY A;  5JM6 A;  2PSW A;  2GLJ A;  2V8D A;  1KUX A;  2V8H A;  4P10 A;  1S60 A;  4U5Y A;  1PCA A;  2JEW A;  1TIQ A;  1XOV A;  2GAN A;  2OZU A;  1X10 A;  4PXC A;  4UA3 A;  4AVB A;  2P6F A;  1V0C A;  5C82 A;  5ISV A;  3PFO A;  1AUG A;  3ISX A;  4AB7 A;  4NGR A;  4ORF A;  4FWU A;  1FNO A;  1WK4 A;  4ZI6 A;  1ZG9 A;  1P4N A;  8CPA A;  3TCV A;  1TKJ A;  3BLN A;  3FED A;  1I21 A;  2IQ6 A;  4L8A A;  5D29 A;  3WC7 A;  1Z2L A;  4IF5 A;  4DYO A;  4MCP A;  1PU9 A;  4KSI A;  4OC5 A;  4C68 A;  2VZY A;  5AGE A;  1LCP A;  3E0K A;  2QVP A;  4B5O A;  3D68 A;  4R57 A;  3B3T A;  3MRU A;  2C6G A;  4GS4 A;  4MCQ A;  4F0Y A;  1XFO A;  4MHZ A;  1IIC A;  2B58 A;  2FCK A;  4JXR A;  4LUA A;  3RO0 A;  3EY5 A;  4GM5 A;  4JZ0 A;  4H6Z A;  3NH8 A;  4RN7 A;  3B8G A;  1VKC A;  4Q38 A;  1TKH A;  4NGM A;  1ON0 A;  3DDD A;  1I12 A;  4KOW A;  2PJ0 A;  2Q4V A;  3A9L A;  3R95 A;  2REF A;  4JLY A;  4HNY B;  4A31 A;  4CGM A;  3IU2 A;  4LQG A;  4NGP A;  2ZEL A;  3I3G A;  1XRY A;  4PK2 A; 
#chains in the Genus database with same CATH homology
 2FT0 A;  3H5Z A;  5FVJ A;  5G20 A;  3S6F A;  3TOA A;  3PGP A;  4KOS A;  4YRH A;  3VWD A;  4KOR A;  5F46 A;  2B3V A;  3G8W A;  4QB9 A;  4ZBG A;  2RC4 A;  1YR0 A;  2FE7 A;  2VBQ A;  4IUS A;  3FXT A;  3GKR A;  2ATR A;  3TO9 A;  2GIV A;  2VXK A;  4XPD B;  3EO4 A;  4UFV A;  3DR8 A;  2B4B A;  4JJX A;  2JDC A;  2Q0Y A;  3IWE A;  4DNC A;  4PSW A;  5F48 A;  3G3S A;  2ZW5 A;  5C88 A;  1XMT A;  2JLM A;  4AG9 A;  1MJB A;  5J8F A;  3EXN A;  5EC4 A;  4A33 A;  2FSR A;  2CNT A;  2ZPA A;  1Y7R A;  3R96 A;  1IID A;  1XIX A;  3IWG A;  2BUE A;  5HH1 A;  4RI1 A;  5DWM A;  1YGH A;  2AE6 A;  4CGN A;  4KS9 A;  3DR6 A;  1BO4 A;  1M44 A;  2R8V A;  5JQ4 A;  4OAE A;  4M85 A;  2G0B A;  1B87 A;  4Q36 A;  4JD6 A;  4X5K A;  5BWA B;  2FL4 A;  2Z3N A;  2CNS A;  4BMH A;  4KUB A;  1S7L A;  2BEI A;  3FNC A;  1QST A;  4H89 A;  1Y9W A;  4E2A A;  3FYN A;  2D4P A;  1OZP A;  2YND A;  5F47 A;  5J8C A;  5IV0 A;  5KTC A;  4C2X A;  4F6A A;  2WPX A;  4J3G A;  4CS0 B;  4KLV A;  4E8O A;  4KOU A;  3F0A A;  4MI4 A;  4MFL A;  4XNH B;  4K30 A;  1S7F A;  2OZH A;  4UCP A;  2R98 A;  4CGL A;  1YLE A;  1XF8 A;  3S6G A;  2B3U A;  4R9M A;  2G3A A;  2QIR A;  2EVN A;  4PSX A;  1MJ9 A;  4HKF A;  1VHS A;  1YX0 A;  4UBR A;  3TE4 A;  4FD6 A;  1S5K A;  3R1K A;  4MFK A;  4MFZ A;  4KVM E;  4CAV A;  2AJ6 A;  1K4J A;  2CXA A;  2Q4Y A;  2FXF A;  4RS2 A;  4A2Z A;  3PZJ A;  5HMN A;  2C27 A;  1GHE A;  1YK3 A;  3OWC A;  3C26 A;  3T9Y A;  4MHD A;  4UCN A;  4L89 A;  1NSL A;  2B5G A;  3JTK A;  2B5G B;  1U6M A;  3QB8 A;  4B14 A;  4PK3 A;  3ZJ0 A;  2HQY A;  4YFJ A;  1S7K A;  1Z4E A;  4FD7 A;  2GE3 A;  5EBV A;  2YNE A;  4Y49 C;  2G3T A;  1KUV A;  3KKW A;  3JUW A;  2Z3M A;  4CRZ B;  2QML A;  2P6G A;  1NMT A;  3P2H A;  3D8P A;  2KCW A;  4UWJ A;  4HNX B;  2YGW A;  3GY9 A;  2Q7B A;  2ZW6 A;  3CXP A;  3SHP A;  5AG7 A;  2F5I A;  2D4O A;  3P2F A;  2OB0 A;  5KTA A;  3S6K A;  1YVK A;  4QBJ A;  3IGR A;  3TO6 A;  3DSB A;  4XPK A;  3PP9 A;  4UWI A;  1PUA A;  3FIX A;  1IYK A;  4KVO E;  1CJW A;  2A4N A;  5KTD A;  1LRZ A;  4U9Y A;  3SXO A;  2DPT A;  1Z9U A;  2R1I A;  2I79 A;  4II9 A;  4UCM A;  3TOB A;  5GCN A;  1SQH A;  2K5T A;  2I00 A;  2P0W A;  2PQ8 A;  3LD2 A;  1Q2Y A;  2P6E A;  3JVN A;  4NXY A;  2HV2 A;  4HNW B;  2YNC C;  3R9G A;  4ZGY B;  4MFJ A;  1S7N A;  2NMT A;  5H84 A;  3TT2 A;  4KOY A;  5G1Z A;  4C2Y A;  5IX3 A;  2R7H A;  4AG7 A;  4KOT A;  4JXQ A;  5DWN A;  1J4J A;  3LOD A;  4JWP A;  4BBH A;  3MGD A;  3R9F A;  4R3L A;  5AG6 A;  1L0C A;  1CM0 A;  4FD4 A;  3FB3 A;  1IB1 E;  1WWZ A;  4EVY A;  2Q04 A;  1YVO A;  2PC1 A;  1QSO A;  2PDO A;  2WSA A;  1MJA A;  2QEC A;  1P0H A;  1NE9 A;  1M4G A;  5IB0 A;  2H5M A;  3IU1 A;  3K9U A;  4KZT A;  5A27 A;  3TFY A;  2J8M A;  2PR8 A;  2WUU A;  3R9E A;  4NEX A;  3T90 A;  4MFP A;  4CYP A;  2X7B A;  2Z3O A;  2IL4 A;  4NCZ A;  2VQY A;  4QUS A;  2PR1 A;  2JEV A;  1N71 A;  3F8K A;  4UFX A;  2WPW A;  2B4D A;  2OH1 A;  3BJ8 A;  2FS5 A;  3WR7 A;  2B4D B;  1RXT A;  3F5B A;  3D3S A;  3SXN A;  3TO7 A;  4CAX A;  3N7Z A;  1QSM A;  2ZW4 A;  3GYA A;  4UFW A;  5H86 A;  1ZO0 A;  4A32 A;  2Z0Z A;  4F0X A;  2EUI A;  5I0C A;  1KZF A;  4CYN A;  3I9S A;  3ZZI A;  1Q2D A;  2BSW A;  4A30 A;  4KOV A;  4NSQ A;  2Z10 A;  1Q2C A;  2CNM A;  2Z3K A;  3D2M A;  4B13 A;  1B6B A;  4QC6 A;  1Y9K A;  1M1D A;  4MY3 A;  3BJ7 A;  4FD5 A;  3S6H A;  4CGO A;  2PRB A;  1XEB A;  4XPD C;  1M4D A;  4B11 A;  4B5P A;  2BL1 A;  3D2P A;  3W6X A;  2DPS A;  2REE A;  2HUZ A;  4B5P B;  3EC4 A;  3NE7 A;  5AG4 A;  3CXQ A;  4Y49 B;  2J8N A;  1R57 A;  1IYL A;  2OZG A;  3W91 A;  3EFA A;  1RO5 A;  3H4Q A;  4MFQ A;  1BOB A;  5F49 A;  4ONU A;  2Z11 A;  4B12 A;  1QSR A;  4QVT A;  2DXQ A;  4C7H A;  4OLL A;  4MJ8 A;  5AG5 A;  1FY7 A;  2VZZ A;  4KVX A;  4CYO A;  4OAD A;  4KSF A;  4KOX A;  4KUA A;  2FIA A;  1S3Z A;  3V8I A;  4I49 A;  4C7I A;  1Z4R A;  1UFH A;  4MY0 A;  4YGO A;  2OU2 A;  3FRM A;  3TTH A;  4B10 A;  4KSA A;  5G22 A;  3QAH A;  5A28 A;  2FIW A;  1M4I A;  2ZXV A;  4CAE A;  4AVC A;  2YNC A;  4A95 A;  4AVA A;  1MK4 A;  3W6S A;  4U9Z A;  1YRE A;  2J8R A;  3VWE A;  3CXS A;  2JDD A;  4XPL A;  2VEZ A;  4E0A A;  2O28 A;  4CRY B;  4NF1 A;  4C2Z A;  2Z3L A;  4R3K A;  4MBU A;  4CYQ A;  1QSN A;  4XNH C;  1I1D A;  5E96 A;  3UY5 A;  4LX9 A;  3FBU A;  3RYO A;  2Q44 A;  2Y0M A;  3DNS A;  4PV6 A;  2CY2 A;  2Z3P A;  2ZW7 A;  4R87 A;  5G21 A;  4CGP A;  5JPH A;  5CNP A;  2ARH A;  1XE4 A;  2VI7 A;  4H6U A;  4CAF A;  4M3S A;  4KLW A;  1KUY A;  2PSW A;  1KUX A;  1S60 A;  4U5Y A;  1TIQ A;  2GAN A;  2OZU A;  4UA3 A;  4AVB A;  2P6F A;  1V0C A;  5C82 A;  5ISV A;  4AB7 A;  4ORF A;  1WK4 A;  1P4N A;  3TCV A;  3BLN A;  1I21 A;  4L8A A;  4IF5 A;  4CAW A;  1PU9 A;  4C68 A;  2VZY A;  5AGE A;  4B5O A;  3E0K A;  4R57 A;  4GS4 A;  4F0Y A;  1IIC A;  2B58 A;  2FCK A;  4JXR A;  4LUA A;  3EY5 A;  4H6Z A;  3B8G A;  1VKC A;  4Q38 A;  1ON0 A;  3DDD A;  1I12 A;  4KOW A;  2Q4V A;  3A9L A;  3R95 A;  2REF A;  4JLY A;  4HNY B;  4A31 A;  4CGM A;  3IU2 A;  3I3G A;  4PK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...