3H4VA

Selective screening and design to identify inhibitors of leishmania major pteridine reductase 1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
273
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent pteridine reductase inhibitors to guide antiparasite drug development
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 96
structure length 273
sequence length 284
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h4vA00
2GN8A 3D64A 2Y99A 4B3HA 4HV4A 1JVBA 3I9KA 4B8WA 4A7PA 3GOHA 4RORA 5AXAA 3E03A 2QRJA 1ISFA 3GY0A 4Y6RA 4CQMD 1I5RA 1PU2A 5F5NA 2Y1GA 4L74A 4D0SA 1JLLA 4Z3KA 1YXMA 3SC6A 2AHRA 1HDGO 1I3KA 5IXSA 3C7AA 1M6WA 1FDTA 5EQDA 4RL6A 4YYZA 1PJSA 2AG5A 3QE3A 1LLQA 3CZRA 4O6VA 3W8FA 3GRPA 3QVOA 4QT0A 3JQGA 5COAA 3WQRA 4O59O 1DC5A 4R16A 5IN5A 1KEUA 2YFQA 4UVEA 1CRWG 4RPKA 1XCBA 4XJSA 1MXHA 5G0TA 2BFMA 5L95A 1WNTA 1HE3A 1LDEA 1NVGA 1LDGA 4CV2A 5LDHA 1PEDA 3RU9A 4AJLA 3LQFA 4YJHB 4TROA 2VNSA 3I6IA 2W98A 2QIOA 1H2HA 2X1HA 5JFOA 1SNYA 3IOYA 5L51A 1F06A 3P2OA 3WYEA 4FR5A 2X0JA 4FB5A 2OO5A 3GMSA 2FR0A 1T2EA 4E21A 1CWUA 3CUKA 3Q2IA 4D3SA 1YB4A 1YL6A 5HS6A 4E30A 5CDTA 1R37A 2IODA 4A5OA 1TVEA 3A06A 1H2BA 4MVJD 5J23A 3WNVA 1H6AA 2YY7A 1ONNA 3LZ6A 1G0OA 1QV7A 2G5CA 5BSFA 4R5MA 3KRTA 4E5YA 3IJRA 5COBA 1C1XB 3JQ9C 3W4KA 5TQVA 4PVCA 4WLNA 3DDNA 3LSYA 3RVDA 5DULA 4WNIA 4CR8A 1ENYA 1QR6A 1SCUA 2NU7A 3OICA 3KSZO 1DC4A 1PL8A 1UXJA 2D5CA 4DLAA 2C7VA 2X9VA 1ISGA 5DT9A 4IXTA 5A06A 5TJ9A 4XRGA 2O23A 2ZTUA 3DBVO 2O7QA 1UXKA 2Q1SA 4WUVA 3FD8A 4YQZA 3PK0A 5FEUA 1M76A 1TT5A 1XA0A 2PD6A 2G76A 1EBFA 2ZYGA 1X7HA 4GVLA 2JD0A 4LRTB 4F46A 3HQ4O 4II3A 2P68A 1T2DA 3W8DA 5JCJD 2GZ2A 4GBJA 5CEEA 2J3HA 1YKFA 4RPGA 1ZK1A 1S6YA 4XB1A 4E3ZA 4UREA 3UOGA 3JYOA 3K6JA 5THKA 3ZWVA 2B4RO 1KY4A 1P77A 4BB6A 4DIFA 1GPJA 1M6HA 1U9JA 4JGBA 4WASA 4KWIA 3V5NA 5G4KB 5K6AA 1DC6A 4DIOA 5JY6A 3K96A 2HMTA 2Y1DA 2C2XA 1ZZEA 1VL8A 4BNUA 4BO4A 2DPHA 3GT0A 3KXDA 4YRBA 4W9NA 3ZWPA 3ICPA 4KDFA 2DTXA 1K6JA 3PGXA 3ZWWA 4JXKA 5JYDA 1GADO 3IAHA 1HDRA 4FFOA 3HSKA 1IOLA 1GUYA 3ZWCA 4EJ0A 3PJDA 4D3FA 4M89A 4AJHA 5CDYA 1N5DA 4E5KA 4D42A 3Q1LA 5CDUA 1DSSG 4R9RA 4Z9FA 3U4IA 3ANNA 1LJ8A 1ONOA 1R0KA 3WB9A 1FF9A 4RQTA 3RUCA 2AXQA 4CLXA 3PYLA 3GHHA 4FFNA 3VZRA 3ZZNA 3PZRA 4GWGA 4HFNA 2YQ4A 3DWFA 1MGOA 3VTZA 4JP2A 1I24A 3JYPA 4R4JA 1GV0A 4UUOA 2OXIA 1BXGB 2EW2A 2HKIA 3O8QA 4PG7A 2DBZA 5T8KA 4EI2A 4MJLA 4HX5A 4FGSA 3GG9A 1PTJA 5IAAA 2HAEA 2PKQP 3DTYA 3SC4A 3KUXA 3V2HA 2AQIA 2IXAA 4TZKA 3VKUA 1NX6A 3PHJA 2EHDA 4E31A 4AJ2A 1VE9A 1NYTA 1R66A 4PG6A 2AEFA 1NPDA 4BNIA 3CMCO 5BR7A 1XELA 2I65A 1KOLA 1PGPA 1DB3A 2Q50A 4FGWA 3AU8A 1JAXA 3Q9UA 3JYQA 1LSJA 2DBVO 3KSDO 1NQTA 2I66A 2PR2A 4L8VA 4CUZA 4EDFA 4KTTE 4M86A 4WOKA 4B4OA 1HF3A 2PA3A 4R5HA 2Z1MA 2PV7A 4J9VA 2PZKA 2GN4A 5BT9A 1H9BA 3GVCA 1XDWA 4AJ1A 2VUTA 3HZZA 3WIDA 5A4DA 4GSLA 1E6WA 4WEOA 1IYZA 1ZEJA 3PFWO 5A3VA 4GX0A 1GQQA 3F6YA 1E3IA 3PLRA 1ZMOA 4JQCA 1XU7A 3P7MA 2B0JA 3D4OA 5ILOA 5KNLA 4FC7A 4PLTA 3AU9A 1JW9B 1M67A 1CETA 2QHXA 3WMWA 4B79A 1UP7A 1QKIA 4XCVA 1DO8A 3GN1A 1WWKA 1S7CA 2HJSA 3WJ7A 4NJMB 4RGBA 1C0KA 3WXBA 2DUUA 2DVMA 2J3JA 3JYNA 1FK8A 1H94A 1PS0A 1DLJA 3CPSA 5F21A 4KP7A 4BNGA 3TOZA 4E6PA 4LK3A 4RF5A 3BHJA 1NM5A 3WMXA 3I9LA 5JO0A 4CMEA 2B4TO 3AY6A 4IIVA 4IDGA 3VOSA 1EUZA 1VJ0A 1IZ0A 4FW8A 1BGVA 1ZIDA 2PGDA 1JAYA 4XKJA 2HO5A 3R1IA 4OAQA 1IHYA 1YBAA 1DIRA 1P1KA 3WNQA 4B7CA 4MVJE 4D46A 2BFOA 1A7KA 1YOVB 3ABIA 3KHUA 1I2ZA 4DXHA 2EERA 1HT0A 3PGJA 2UUOA 1I3NA 3AWDA 1H5QA 1B3BA 1O94A 4KZPA 4NPCA 3DAFA 4U6QA 5C7OO 1HLPA 3VDRA 3FR7A 3CKYA 2EGGA 4CM9D 3RASA 4HY3A 1P3DA 2EKPA 5ICMA 1EZ4A 2B37A 3K2EA 2ZCUA 3KLMX 3Q9NA 5TX7A 1NXQA 1Z74A 2J8ZA 1IY8A 1UJMA 1B8PA 1LDYA 5CPFA 1SPXA 3BHMA 4BKQA 1KEWA 3K5PA 4LSMA 4NBTA 3BTSA 1RM5A 2UYYA 3DBLA 4IQ0A 5A9SA 5GZ6A 3KZVA 9LDBA 2E37A 3MTJA 1JVSA 1QXSA 1DFIA 4N5LA 3LLSA 3RC1A 2W8ZA 1ZKMA 3MJCA 1DIHA 4GL4A 1JDJA 4IJWA 3WQSB 1K6XA 2IYPA 4RJTA 1M66A 3E1KA 3H6KA 4J90A 1PZFA 5C3MA 4D44A 3RROA 1JWBB 2A35A 2FOIA 1I36A 4OXNA 2PY6A 2PNFA 1EMDA 1PJ3A 5I9NA 4NQZA 5CG1A 5G0UA 4TRNA 1G1AA 1E7WA 3DXFA 1SEVA 2IZ1A 3O26A 1SOVA 2GO1A 3P19A 3L6OO 4MIEA 3GFGA 4BNLA 1FDUA 5KJ6A 1R4MA 5C5IA 2NSDA 4BO9A 4ILKA 5IG2A 4J1QA 3WYBA 5AVOA 3BMNB 4FFMA 1UP6A 3CSDA 1DOHA 3DMTC 3JV7A 4M55A 4BO1A 4MVJH 3ZGYA 1HTBA 1ZK2A 3A14A 3VHRA 2CVOA 3VH1A 1BVUA 4FFRA 4JBHA 4PZCA 2WWRA 2X9GA 4CM3A 4DRYA 1Q0HA 3MTGA 4URFA 3DZKA 2CDCA 2VWGA 3IMFA 4R54A 1NQOA 2ZK7A 1KY5A 1E0DA 1NTOA 2Q1TA 2IEDA 3JD1A 3R6DA 2NADA 1B8VA 2G1UA 4UVIA 1HYGA 4CQLA 1AGNA 1I30A 3N58A 2PGJA 1DIAA 1Z7EA 1DDOA 3I6QA 2VYNA 4DBVO 3GK3A 2BGLA 4E5MA 1NNUA 5U9CA 2NU8A 1VKNA 4J4HA 2JAHA 4JIGA 3EMKA 3HB4X 1YO6A 5BSEA 2GZ1A 2I76A 4U0KA 3BAZA 2HLPA 1ULUA 4UUMA 1YBMA 3F47A 3PI7A 3ZWNA 2PK3A 2Q2VA 5JAMA 3DHYA 1N7HA 4QECA 1U8XX 1GCOA 2Y67A 3Q2KA 3F3SA 3PJFA 5DZSA 1DJQA 3ETDA 1RYDA 2QRLA 4QEDA 5FF9A 3O4RA 3TNLA 1DAPA 3TL2A 4PVDA 3I5MA 4H16A 4L76A 1PL7A 4ZQEA 3GEMA 1X7DA 2B83A 3JTMA 5JW6A 4Y6SA 2WSBA 3AUSA 1I32A 1U8FO 3JQAA 5AXCA 4E0BA 1Q1NA 1Y7TA 3A4VA 3QW2A 3K8ZA 5THQA 4LCJA 3C3XA 3JQCA 4OM8A 3OP4A 1IPEA 1U2DA 2HU2A 8LDHA 1XKQA 3HDYA 3KO8A 4IDAA 3WSWA 4BNWA 4AJOA 3ST7A 2RBEA 2NUAA 3QLJA 2GSDA 5IDXA 4S1VA 1V8BA 2O3SA 3GAFA 4EYEA 4DC0A 3CMMA 4YWJA 1K89A 2FRDA 5B12A 2HK7A 1ADBA 2IYOA 4UVHA 1B3RA 3DHNA 4L4RA 1UZMA 3BMCB 4GMGA 3SJ7A 1HSZA 3S1LA 2C59A 4AFNA 3GDGA 2Y0DA 1T2CA 2ZB8A 3I9MA 2P9GA 2P5YA 3UAGA 2ZTLA 2DBRA 1T26A 3F5QA 2ZIZA 1XWFA 3PHIA 3ULKA 5CFZA 5U4QA 3EUWA 3AOGA 3Q0EA 4QO7A 5HS4A 2AQ8A 3WX0A 4O0LA 1Y1PA 4C7KA 1FDSA 4RLHA 4L73A 4YR9A 4IUYA 4DQUA 1DHRA 3TSCA 2ZTMA 2DUWA 2IE0A 5A5FA 3K92A 3BMOA 3WBFA 2WD7B 3FSRA 4XRRA 1E92A 3TZCA 1NHWA 3AM3A 3I9NA 4NJMA 1HLDA 2F1KA 3ITDA 1YB5A 4PZEA 5KKCA 1BDBA 1GAEO 4U8GA 1I2BA 2Y1EA 2FZWA 2PTGA 1MP0A 4WKGA 1NWCA 1P44A 4LCEA 2EKQA 4LISA 2VRCA 1P1RA 4HXYA 5IF3A 2Q2WA 2I3GA 2GN9A 1YE3A 1ISHA 3OJ0A 4U7WA 5K6AC 1CEQA 2V6MA 3EYWA 3LYLA 1NQ5A 4J43A 4RF4A 3DL2A 5I8WA 2DLDA 2O2SA 4ZN6A 2A92A 1ENPA 2P4QA 2V6BA 4N7RA 2XOXA 3AFNA 3DZIA 1MFPA 3I1JA 5DN9A 2W4QA 1F17A 3ZWAA 3JQFA 3MOGA 3OFSA 4LGVA 1X1TA 3G1TA 3H9EO 1Z6ZA 3ZCXA 1HE2A 1JKIA 4WPGA 2B4QA 4I5EA 5TT0A 3PLNA 2BHLA 3I3OA 4GKVA 4IY1A 3KTDA 1UR5A 3PVZA 3RJ9A 4YXFA 3NDIA 3U9LA 4J2OA 1NAIA 5KOIA 1DIGA 1JKFA 1RM3A 1LA2A 3BMQA 4PG5A 1ZJZA 2JHFA 3EGOA 3AY7A 4PRLA 2VZ0A 2VRBA 3WBBA 4CMEC 1D3AA 2EP7A 4FSHA 5AOVA 4A10A 3ZDFA 4L4SA 3OJOA 1CIVA 3DZFA 1LQTA 2AE1A 4CUJA 2I6TA 1ZXLA 1EVJA 3HDJA 3JQ6A 3HFSA 3WGHA 5FFFA 3L07A 1C0PA 3WSVA 1Y5RA 1EQ2A 3OSUA 4I9HA 4ND3A 4ZJUA 2QYSA 1KS9A 2A9FA 4CR7A 2NV6A 1GTMA 4QX6A 1N9GB 3VPSA 3H9UA 4MKRA 3DEYX 1R4NA 2BH9A 4IJKA 4AJPA 4YA6A 2VQ3A 3AUAA 3H3JA 5JAIA 4PG4A 1WXDA 3D4NA 5KVQA 3CINA 3FNHA 4GGOA 3E5RA 3ETGA 2CF6A 5JY1A 2FMUA 1WDKA 4IJUA 3ZWBA 3GGPA 3GMDA 1SC6A 3T7EA 2QQ5A 1BMDA 2CDBA 1YQGA 4BHTA 5G0SA 1C0LA 1M75A 1U1IA 1O89A 4XYMA 1ISJA 4I9UA 2W2KB 2E48A 2ZJ1A 4KUHA 4LMRA 4H3VA 3C7CB 4M1QA 4TVOA 3KVOA 1IUKA 2IXBA 3NTQA 2WE7A 3UHAA 1U28A 4Z9XA 2VRCD 4OOEA 2C2YA 3IC5A 1PGNA 4PLYA 2X9NA 6ADHA 4ZQFA 4W9NC 3AUTA 3V8BA 3WWYA 3KV3O 4PGFA 1TT5B 5I8ZA 1EBUA 1Z75A 5C7IO 3I4FA 2UUPA 1DFHA 3LC7O 4P4LA 1EE9A 5DDIP 5EL0A 4YAIA 3V1YA 1XGKA 3ITKA 4CM8A 2O4CA 4PLPA 3GC6A 3NDRA 5A9TA 2P5UA 3E9NA 7ADHA 1UXHA 3UGKA 4BQRA 4OKNA 1N9GA 4FPXA 3ZU4A 4NZ9A 3JD3A 4UAGA 5JXWA 1SOWA 1E1NA 3JQGB 1DJNA 4JBGA 2WYWA 3WG9A 3VZQA 4DTIA 3PYMA 4Q9NA 4AL4A 2H63A 3DC2A 4B7UA 4CMCA 4HFJA 1SZJG 3NUGA 2VNAA 5I7SA 2Y0CA 3RC9A 3RUFA 4IM7A 2C07A 4Q3NA 3ZH2A 3SJUA 1NR1A 4YRDA 1A4IA 3W4IA 4BKUA 4RVDA 2ET6A 2V6FA 1NFFA 4YBZA 1O0SA 5L4NA 2X58A 1V9LA 1YL5A 3L6EA 1KETA 2GPTA 3MJVA 3E18A 4WNCA 3TZQA 1DC3A 2VOEA 2B69A 4JLWA 3AOEA 3GVPA 3QV1A 1PQUA 3ADPA 2A4KA 2X5JO 1YDWA 1P74A 3D3WB 3AJRA 3PZBA 5G2OA 1NASA 1E3WB 3HUDA 4NK5A 4Q39A 5I7VA 2YV2A 2W2LD 3R3JA 2J6IA 3JQAD 2YYYA 2I67A 5GY7A 4BNMA 1QLJA 1KC1A 1E77A 1P0FA 1QYWA 1XQ6A 3GPDG 1W0CA 4AJ4A 2GASA 5EQFA 3ZHZA 1NPYA 3BA1A 1KERA 3ENNA 3PHLA 1GYQA 1DXYA 3TQHA 1Y8QB 3FNGA 2RH8A 4BNZA 1V6AA 3C1OA 1R0SA 4XJTA 3DHEA 1B26A 2AE2A 4AJJA 4PLGA 5L4LA 5HRUA 3E48A 1V3TA 4RDIA 1N1GA 4BVAA 3RD5A 1Q2XA 1PS9A 1UXGA 4GKBA 3DOOA 2J5KA 3C85A 3IJPA 2HQ1A 4DMMA 1ZJYA 1DEHA 3F1KA 4G2NA 3M2TA 1EFKA 3WOHA 5CP8A 2CF5A 2EG9A 3PRJA 2BRUA 4ROSA 3EZYA 2DTDA 4R68A 1ZCJA 4LSWA 4CMIB 3ZU2A 3ZI0A 2ZATA 4B3JA 3TDKA 1V3UA 1QMGA 3FBTA 5L7TA 2QW8A 5A02A 1PZGA 3C1TA 1Z45A 1LU9A 5JMWA 4L0QA 1LBEA 4BO8A 3AUUA 1JTVA 1C3VA 3WWZA 3OQ1A 3EK2A 1GQ2A 3AOEC 4PG8A 3NJ4A 5JPIA 3IS3A 4DPMA 4YT4A 4CMAA 5EESA 2Q1UA 1OMOA 4D7AA 1LRJA 1V0JA 2P2SA 2J3KA 3RFTA 1ID1A 3OM9A 1E1KA 1P33A 3ZHXA 4E12A 3ZWOA 2GZ3A 1YB1A 1Y9EA 2EJWA 1UZNA 5IN4A 3LF1A 1QRRA 1K3TA 4DBZA 4D43A 1UDBA 2AG8A 2Y1OA 3RBZA 4PLHA 4FBGA 1CF2O 1WZEA 3JQ8B 4CM4A 1ZH8A 4KUEA 4DLLA 2FPIA 1ZSVA 5KTKA 4PLCA 3GQVA 5EN4A 1LSOA 3AI1A 3TZHA 1QORA 2P9CA 3BXXA 1YS4A 2P91A 1P1FA 5ER6A 1SEPA 3H5AA 1GEEA 1M2WA 1I10A 5IFLA 3SVTA 3UW3A 1F14A 1WAMA 3L77A 4D0RA 2I9PA 4UVDA 1MC5A 1N7GA 5T6BA 1U2GA 1L7EA 5BSGA 3WGIA 2HK8A 2NTVA 5HBRA 4JP3A 2O3QA 2RHRA 4CM6A 4QFDA 4J7CA 1BXZA 1I2CA 1PWZA 5ITWA 3WIEA 3F4BA 2X5KO 1EVZA 1Z73A 4MKZA 4NG5A 3SEFA 3WTBA 2O48X 4R01A 1SAYA 1T4BA 3RIHA 4PLZA 4NBWA 4TQGA 1X7GA 1LNQA 4A27A 2D2IA 2BLLA 3RKRA 5C7LO 1FMCA 1YQDA 3INRA 3OH8A 4OXKA 3NGLA 1HETA 5L53A 1NP3A 4BKPA 4Z6KA 1ADCA 1P1HA 1C0IA 3QWBA 4FDAA 3NDJA 4NHEA 4IDBA 3WGTA 4E33A 2JFHA 1VI2A 1LI4A 2ZJ0A 1L1FA 2EGHA 1HE4A 1RPNA 3ZNNA 1DAOA 5L45A 3QIVA 3RJ5A 4YJFA 3U4CA 4RLSA 4E2XA 5JYEA 5MGBA 1X0XA 4B4WA 1OI7A 3CXRA 3B1JA 2VWQA 3D4PA 4XX0A 1WZIA 4NI5A 4DUPA 1HWYA 4OXYA 5CPBA 2VCYA 4IGEA 1XU9A 2DPGA 5DP2A 1HDOA 3GFBA 3L0DA 3OF2A 1CQIA 4M49A 3LT4A 4R41A 3DBRA 5DNAA 4UEJA 3BMNA 3I52A 4ALIA 1ENZA 2NTJA 2DQ4A 4TRJA 1ZMTA 2DKNA 1FJHA 1PJQA 3BTUA 4EEXA 5TSDA 1NVTA 1QSGA 4DMLA 3QQPA 2EKLA 4XGIA 4HUJA 3WGYA 2D59A 4P4GA 4XIYA 1XR3A 1OAAA 1U7TA 2JD1A 1GZ6A 4M8SA 2NU9A 2W2KA 4WEQA 4ZU3A 4PCVA 3GZNB 5G4LA 4E4YA 4DGSA 3JQDA 3OJFA 1MG0A 2AQHA 2LDBA 3U3XA 1D4FA 4ZICA 4FJ0A 5JMPA 1WMAA 1ZEMA 1U3TA 4IDDA 3KSUA 4J1NA 4WJZA 4MVJM 1KC3A 1ADFA 2W90A 4UULA 2OHXA 2VYND 1G6KA 3EVNA 1TEHA 4ND1A 3DZGA 4RVFA 4A2CA 3GNSA 4JJIA 2X5OA 4GH5A 3WJAA 5CDSA 3JQ7B 1EUDA 1OBFO 1BRMA 2JKVA 2D5AA 2UAGA 3QWIA 2GLXA 3H4VA 2PKRA 4II2A 3L4BC 4F6CA 4WGGA 2I3AA 3LDHA 2E4AA 4BV8A 2C82A 3WFIA 1BVRA 3RQSA 2NWQA 4RQUA 5DCWA 2BMAA 2UVDA 2WTBA 4CMIA 3G79A 2EF1A 2Q45A 2WD7A 4J91A 3FWNA 4YJGA 3UN1A 4Y6PA 2EP5A 4IS2A 3A1NA 5T67A 4RO0A 5JAQA 3OHSX 4MP6A 1A7AA 1YGYA 4CR6A 3JQFC 1VJ1A 4ALLA 3E5MA 4NNJA 2GR9A 3L4BA 3WFJA 4BO6A 3AK4A 1XLTA 4WOJA 4PLVA 3OMLA 1EK6A 1MC4A 4WLVA 3SLGA 3B20A 3VTFA 5CDGA 4RVSA 4BNYA 1PWXA 1A72A 4TSKA 3FF4A 4CLEA 3FPLA 1U5AA 3JQEA 1UP4A 3W6UA 3ROQA 1N2SA 2VWPA 4LVCA 5DCYA 1UAYA 3N74A 3ADOA 1U4SA 4BNXA 5K0ZA 1KEPA 2OBYA 2YV1A 3NYWA 1R12A 5B4TA 4FJ2A 1TI7A 3EC7A 2O2YA 2UV8A 4R3WA 1B0AA 1PL6A 5F5LA 4BO7A 1D1SA 1T25A 2RH4A 5CG2A 2OZPA 3P2YA 4XQCA 4YEDA 1WVGA 2VZ9A 1A71A 4XEHA 2D8AA 4CV0A 2GNAA 4FC6A 5C37A 5A3JA 3DBHB 1CERA 4W99A 1T2AA 2IEBA 2Q4EA 2Q46A 4ONEA 3PXXA 3NT5A 4P22A 4QXMA 3WS7A 3ZNPA 3H9QA 2YHIB 4U6SA 5DBGA 2NVBA 1E3SA 3IDSA 4K6CA 4FJ1A 4QO8A 3OBBA 1IHXA 2VOJA 4TKLA 1CYDA 1MXFA 1Y8RB 1HDXA 4NJOA 1I8TA 3HDHA 5FI3A 3ICCA 3NT2A 4J49A 3GF4A 3DFUA 2OOSA 1UDAA 5JCXA 1K5HA 3QRWA 2ZB3A 1GFSA 1OOEA 1LC0A 2Y1CA 4J0EA 3DR3A 3H7AA 4BO5A 2BELA 4DYVA 4HFMA 4RVGA 2UDPA 2R00C 4ITUA 3AFMA 4OO3A 3MWEB 4JJGA 4UUPA 3DBRB 1PJ4A 1Q7CA 4YQYA 1Z82A 2YFHA 4CODB 1PGOA 1JWAB 3RUEA 2ZB7A 1B15A 4FS3A 3EZLA 3GGGA 1I01A 4FQ8A 2PFGA 5EJ2A 1D8AA 1GCUA 1BDMA 1GY8A 3T4EA 3M1LA 1LRKA 8ADHA 1XHLA 2NTNA 4HNGA 4CLHA 3FBGA 4GX2A 1YJQA 3GZNA 1F12A 4LRSB 3LC2O 4XZ3A 5ICSA 4TKMA 4B4VA 1WDMA 4MDHA 2O3RA 3H9JA 3KB6A 3U62A 2CMDA 1PIWA 2YHIA 2Q3EA 4FFPA 3TL3A 5IDQA 3U49A 1KVTA 4CM4B 4ALMA 1HRDA 1PJLA 5A05A 3R3SA 4AICA 2YDXA 3NRCA 1GYPA 4KMSA 4XYGA 3GG2A 4E13A 5KIAA 4HBGA 3DMYA 3UCXA 5U1PA 1U4OA 4RPJA 4WECA 2WJPA 4ALJA 1EEHA 3VKVA 3ZV6A 2OL4A 2P9EA 4OJNA 4P4NA 4ALKA 2Q49A 1HZJA 2YZ7A 5JDIA 1HDYA 1B14A 5DBFA 5EIOA 4FIZA 4DA9A 1TXGA 3GDOA 1T4DA 5EERA 4I9NA 5TIIA 4CM1A 1DFGA 3KYDA 1RKXA 4WE3A 1V35A 4MO2A 5TGDA 1HL3A 1UDCA 4BO0A 1RJWA 2LDXA 1GPDG 1JU9A 2Y66A 4FOSA 3LT1A 3JQBA 3U5TA 3E82A 1AXGA 2E6UX 1DRWA 4YACA 1BHSA 3OIDA 4Z9YA 4WK6A 4A73A 3FNFA 1TLTA 3HB5X 3M1AA 3SX2A 4CM5A 5JDCA 1VL0A 1E5LA 3UKOA 2H9IA 3GNTA 2CY0A 4R1TA 1I0ZA 2NQTA 3BIOA 3OA2A 1CJCA 1WMBA 4DIBA 3NV9A 3OIFA 4KUGA 5KJEA 1KVSA 4J4TA 5EPOA 3OQBA 3KYBA 4CQMB 1AHHA 4NFHA 1X13A 5IZCA 3WDSA 4LMPA 3ZU3A 3S2EA 5MDHA 4Q3EA 1PGQA 4X54A 3NT4A 1ZO8A 2C5AA 2OGUA 3RBVA 3GH3A 4F6LA 5KJFA 1LSSA 2GUGA 2PH5A 4INAA 1EVIA 1BWSA 4BO2A 1XYGA 4BL5A 2GDZA 3BHIA 2GN6A 4XWYA 3ONFA 2WEKA 4U0JA 2FR1A 2F00A 1VLLA 4BGIA 4NFSA 4DPKA 4MINA 1ISIA 3DAPA 4CMJA 1R4MB 2C0CA 1HKUA 4CM7A 2JAPA 3QP9A 5B4VA 4FFLA 5A5EA 3D7LA 3PJEA 2EEZA 3RKUA 5HWSA 4E2YA 4R69A 4MPDA 3UVEA 2WM3A 3V1UA 2AEMA 4KTVE 1P1JA 4PLWA 1VM6A 1OC4A 4PFJA 2OFPA 1BW9B 1FDVA 3OQ6A 4LVUA 3LLVA 2ZKLA 3KYCA 1E1MA 2C54A 1AHIA 5JSFA 4OL9A 3QVXA 4IS3A 1NPTO 2B5WA 3DFZA 3TOXA 4W7HA 1X15A 2B36A 1LUAA 4EW6A 2V65A 1AN9A 2HUNA 4IDFA 3X2FA 2XF8A 3V2UA 4HADA 3OEYA 1G0NA 1IL0A 3PPIA 1ORRA 3QVWA 1VSVA 4DVJA 4EEZA 2O4UX 3G0OA 3QVTA 4CMHA 2H6EA 1PS8A 2VHYA 1U7HA 3NKLA 2Y05A 4LW8A 4TMFA 4XGNA 4BGVA 4S3MA 4E5NA 1ZXBA 4YAGA 5G0WA 4YVFA 3JD4A 3D3EA 1MB4A 2GYYA 2HSDA 2CNBA 1O6ZA 2FWMX 3PWZA 4I08A 1E3LA 4IINA 3RBXA 3RC7A 3ROPA 4CMKA 4R3NA 2O50A 5ENVA 2J3IA 3GVHA 4RPHA 1YOVA 3CZMA 1EVYA 1E7QA 1EK5A 4IQ8A 3IQDB 3KOUA 3CIFA 4DL9A 1JN0A 3JYLA 3W4JA 1E5QA 4L75A 1IE3A 5JE8A 3L4SO 1E6EA 2FSVA 2WE8A 3O03A 4Z3DA 2OMEA 4P8RA 4ID9A 2G0TA 4Y67A 4IPTA 3UICA 1NQAO 2FY8A 3DB2A 4OIMA 3DZHA 5F1OA 1K2WA 2CZCA 3WGOA 4XYEA 4MVJF 4CJXA 1HZZA 4J7UA 4NK4A 4OQZA 4GMFA 1PJTA 3GGOA 3HN2A 3AI3A 1VL6A 1YBVA 3ZV3A 2IZ0A 1N92A 2HDHA 1J49A 1KYQA 4PZDA 1H6DA 4ND2A 3TPCA 2YV3A 4BOYA 1AE1A 1H6CA 1EDOA 1HDCA 3G1UA 1QLHA 4NFYA 5A9RA 2FHSA 1EQUA 3TF5A 2Q99A 4ESOA 1PSDA 4ND4A 3RCBA 5BNIA 4YJFB 3QVSA 1RWBA 2CSUA 4CMBA 3MJSA 5GZ1A 4GPD1 5KJCA 2D0IA 4EGFA 4CLOB 4TZTA 2Z5LA 3DO5A 2X23A 2HJRA 3QY9A 5DOVA 2JFFA 4GGPA 3E9MA 5ADHA 1X0VA 1SB8A 3EW7A 1MFZA 2Y68A 1PZEA 1KVRA 3T7CA 1YRLA 4AJIA 3NAQA 4KOAA 1KVQA 4AVYA 3U4HA 1O95A 4YT5A 3ROMA 2I99A 5CAEA 2IDZA 1A9YA 2QG4A 2E82A 3SLKA 4K28A 2V6GA 1N8KA 2EWMA 3OECA 2OORA 1C1XA 1PJBA 1KBZA 1F8FA 4J3FA 4RF3A 3WQQA 1ZK0A 1A27A 4W4TA 5B4UA 2CDAA 4YAJA 2FN7A 2NVUA 2Q4BA 3F4LA 4DREA 1BW9A 4CMGA 5ITVA 3C24A 1Y8RA 5KWEA 4MVJI 3LK7A 3AY3A 3IP1A 5TLSA 2FPPA 5TNXA 4KWHA 3VPXA 4Q3DA 1E7RA 2ZCVA 3PHHA 4GLOA 5DOZA 1X14A 4XQGA 1P1IA 5JC1A 3A9WA 2BGMA 2QZZA 3DZBA 3QHAA 4MOWA 4J16A 3B6ZA 4N5NA 2Y1FA 3MZ0A 1VSUA 5TJHA 3WYCA 2Y93A 1P45A 2ZB4A 4HP8A 4L4XA 3DQPA 1LLUA 1P0CA 2PZMA 2YUTA 3KBOA 3ZWMA 1WP4A 5H81A 3VPFA 3GEDA 5BQFA 2HK9A 4A03A 4J4BA 2EXXA 4JK3A 3H5NA 3T4XA 2NQ8A 2FP4A 3U4DA 1IPFA 3HE3A 3K9QO 4Z0HO 3PWSA 1C14A 1DBVO 3DBLB 3I83A 1I3MA 4PIVA 1LQUA 1J5PA 1RYEA 4CQMA 2VZ8A 3PHGA 3BMOB 2YHUA 1LXCA 5L7YA 4GX5A 1LX6A 5JAZA 1B16A 3MEQA 3Q3CA 3OA0A 3AM4A 3OJLA 3GPIA 5LDGA 3GAZA 5TS3A 1NWHA 3TFQA 3GVXA 3EDMA 1DLIA 1HYEA 3ZHBA 1XG5A 3WGQA 2VN8A 4EUFA 3TWOA 3BTVA 4XA8A 2G17A 1K6IA 1BTOA 3TZ6A 5DCUA 2VYVD 1XSEA 3CE6A 3KEOA 4XDZA 2BFAA 2P4HX 3FRJA 3WTCA 5HA5A 4BNFA 1GUFA 4NU6A 3E9QA 1NAHA 3RSHA 1V3VA 3F9IA 1PQPA 5H83A 5IZCC 3MJTA 4A26A 3RFXA 2ZTVA 4J1SA 3H2ZA 3K2BA 4HFRA 4P38A 3ZWYA 1LDMA 3GR6A 4M87A 2CVQA 2WDZA 5IJZA 2Z95A 1PZHA 2GGSA 1IZ9A 3OJEA 3VC7A 1PR3A 3JSAA 3O9ZA 4A0SA 1ZSYA 4Z0TA 3TJRA 3D3WA 2NLOA 3QA9A 1KIFA 3CH6A 4WCFB 3GDFA 3KM0A 4AJNA 4MVJG 3NGXA 2VYVA 3NEPX 3VVCA 4IZHA 2TMDA 5JS6A 3VAZA 1CDOA 4EJMA 3GN2A 4DLBA 1YONA 1D7OA 4O63O 1EE2A 1LSUA 5CHEA 4FD3A 4NR0A 2JJYA 3IKVA 3H65A 3G49A 5T57A 4YT2A 3ANMA 5IXYA 4D41A 3LU1A 2JCVA 4D79A 3ONEA 3QWAA 4IDCA 5CEJA 3EHEA 2JL1A 2OBNA 3MJEA 1LRLA 1W73A 4YAKA 5TT1A 3DTTA 2NVWA 4MIYA 4OKIA 3PTZA 3HADA 3PQDA 2QZ9A 3PEFA 3FCOA 4JJFA 3UXYA 3B70A 3UUWA 4XR4A 4CM9A 3V2GA 3H9GA 4D45A 5ER9A 4ZQGA 3LT0A 3PFFA 3SXPA 1VC2A 2AA3A 2X0RA 3RU7A 5GMOA 1ONPA 1ADGA 1YH3A 2X8LA 1K0UA 4AJKA 4QQRA 3F5SA 3JCZA 3DOCA 5DP1A 2O7SA 3ONDA 4OQYA 1XQ1A 5I9MA 3VH3A 2GCGA 2NM0A 3H5RA 3JD2A 2FSSA 1H9AA 1QYDA 3GRKA 3MJ4A 3ZW9A 4BKOA 4EUHA 5FWNA 3AM5A 3KYCB 5JDIC 4XGKA 1HDZA 2VHZA 5DF1A 1QG6A 1T1SA 4TVBA 2DM6A 1C1DB 2JCXA 1Q0LA 4M54A 3AW9A 4G81A 4WLEA 3HG7A 3PWKA 1MX3A 1OC2A 1KEVA 2HMSA 3MWDB 1TT7A 2TMGA 3JQAB 1H6BA 2NNLD 1E7SA 7MDHA 4J9UE 4DWVA 3IL2A 4ZHSA 2EIHA 2PZLA 2D3TA 2FZEA 3I23A 4IQGA 4YCAA 2DT5A 4B8ZA 2PGLA 3KYDB 1MLDA 2DTEA 2VUSA 3DBHA 1A5ZA 3GNQA 1XEAA 4YJDA 5T8KC 3VZSA 5G0VA 1R4NB 2PD3A 2VHWA 3S2FA 3ZNOA 4BNKA 1O9BA 1YVEI 3ORFA 4BQPA 2RIRA 1NVMB 4IMPA 5BNFA 2O3UA 1I33A 3CEAA 4ZQHA 2GF2A 1LTHR 2B35A 5ENDA 5F1KA 4CLRB 2AW5A 3IKTA 1VPDA 3L6DA 5BNTA 1SO8A 2YQ5A 5KVSA 4QUKA 2CD9A 1Q7GA 4W7IA 1LEHA 5TRTA 1T2FA 5ES3A 3ZV5A 2V7PA 3BYZA 1GQYA 4LN1A 4RZHA 2C20A 1ZBQA 1ZK4A 5A03A 3EAGA 3L9WA 1NFRA 2X6TA 1ZSNA 3PIDA 2FR8A 3PQEA 3K31A 1EUCA 1R16A 3JQ9A 4XIJA 4XYBA 4BNJA 2D1YA 4YJGB 1DRVA 4MVJA 4CQLB 4G5HA 4I5GA 4N5MA 4IZIA 3UH1A 5L7WA 4EJ6A 2QX7A 4ZVVA 3IIEA 4OGWA 3VH4A 1LDNA 4HKTA 3VH2A 3CTMA 4J6FA 3WICA 4BGUA 1DHTA 3FPCA 2B5VA 3GA0A 1E3EA 4CV3A 5I7FA 1UZLA 1HSOA 3PDUA 1YDEA 2DBQA 5I9LA 1T1RA 1B8UA 3D0OA 3W1VA 3ZV4A 3QJ5A 2BFPA 3IP3A 3VPGA 1OZAA 4IIUA 3C7DB 3O8QB 4YRAA 3O38A 4H7PA 2DAPA 4YAEA 1J4AA 1O5IA 5L4SA 2PLAA 5FI5A 4OMUA 1FDWA 1AXEA 3PP8A 5B1YA 4UUNA 3B1FA 4YPOA 1UH5A 4RVHA 3IUPA 1J6UA 4GQAA 3FN4A 3INGA 2OP0A 2VUUA 4CLOA 2H1SA 1P31A 4BV9A 2WMDA 4KQWA 4BS9A 5KVCA 1KVUA 3JD0A 4TWRA 5B37A 3NJ8A 1GEGA 3HDQA 2RCYA 3SBOA 4IXWA 4FCCA 4YDRA 4K1LA 4OSOA 3RC2A 4ZRMA 1TB4A 4RCVA 2E49A 3ON5A 4R9SA 4ZQBA 5L3ZA 3COSA 3STHA 1TA4A 1W4ZA 3ZU5A 4OOFA 1B7GO 2QYTA 1JKJA 5IDYA 4AG3A 2X0IA 1ARZA 1UAGA 5DBIA 2XXJA 1MUUA 4RZIA 4OHUA 1BXKA 2DFVA 5FYDA 3MOIA 2ZQYA 3I4CA 5IZ4A 3DZJA 1W6UA 3V1TC 4I1IA 3UF0A 1E7YA 1ZUD1 1X1EA 3OETA 1BG6A 4Y9DA 5IDWA 3DOJA 3E8XA 2GERA 4B4UA 2VTDA 5EMHA 4O5OA 4BNVA 1ISMA 1IULA 4DYDA 3QWHA 4XDYA 4RPLA 1SMKA 4JN6B 4Q3BA 4RDHA 2Q1WA 2BI7A 2POQX 3FHLA 2HMVA 1GV1A 4E2WA 4J1TA 5H82A 1JQBA 4BO3A 3UFXA 2YDYA 2D4AA 1E3JA 1E7MA 3LF2A 3JQBC 5JNLA 2I5PO 4ZRNA 1H0KA 1NBOA 2WYVA 5L9AA 1F0YA 4BKRA 2R2GA 4NDNE 3HHPA 3Q11A 4CV1A 3MCVA 3ASUA 3N7UA 4D3DA 1ML3A 2HMWA 4Q3AA 1Z7BA 1HYHA 5JO9A 3FWZA 4C4OA 2GRAA 5HM8A 6LDHA 1BXGA 2SCUA 3FI9A 1AUPA 5T5QA 4QSMA 4RV9A 2FPGA 4J2HA 4MKXA 5AXDA 3BMQB 2R00A 1B2LA 2XAAA 4NU5A 3S55A 3WR5A 3PDJA 4ZA2A 4EZBA 1ZW1A 1GR0A 1ZK3A 3DMTA 1R0LA 2PZJA 3F46A 1E6UA 2WD8A 4MVJP 4QFCA 4PN3A 2R6JA 1SB9A 4C7JA 2CUKA 3U0BA 2DC1A 3LC1O 3VVBA 1YL7A 3FNEA 1GL3A 2ZYAA 3HN7A 3OIGA 3W8EA 3WGZA 4WLOA 3HFGA 1DRUA 2Q2QA 3JQ8A 3PYXA 4CL8A 3S2GA 3RAJA 1MG5A 3S2IA 2CVZA 2PD4A 3L9XA 4ALNA 3FTPA 5HTOA 3B1KA 1BSVA 2AMFA 4BIIA 4YJHA 3JQ7A 5KVVA 1EFLA 1HEUA 4Z0PA 3RWBA 3PIIA 1Y5MA 3DONA 1VKOA 4B3IA 1QYXA 2CFCA 3ASVA 4L9RA 3GZ4A 4OYRA 3NTRA 1YWGO 1Y8QA 3GVIA 1NHGA 4H15A 2J5QA 3LVFO 4BMVA 1EDZA 1RM0A 4CL3A 2NVUB 2DFDA 3ROKA 4CPDA 2PH3A 4NH4A 2RAFA 1LDBA 5LCXA 1RM4A 4MP8A 4DQVA 4WLUA 3EVTA 2EV9A 4JX8A 4QTZA 4U5QA 1F8GA 2QRKA 4RVUA 3C1AA 4BNTA 1DPGA 1L7DA 3X2EA 1YQXA 3EY4A 1GZ4A 3R0IA 1FXSA 1CQJA 3Q6IA 4NBRA 4WCFA 4BGEA 2JD2A 4E5PA 1UUFA 3AI2A 3ZNQA 3KETA 2BD0A 4Y8VA 4GX1A 4GI2A 1PGJA 1WW8A 5TF4A 1GZ3A 2ZYDA 3ZW8A 2PWZA 1U3VA 4XYLA 2H5LA 2OUIA 2BGKA 2EJVA 5EINA 4UVGA 2HRZA 4BNHA 1GU7A 4CLDA 3QSGA 2IZZA 1PX0A 4NBVA 3BMCA 4TRMA 1YJ8A 4OH1A 4IMRA 5F3RA 5JC8A 1JA9A 1U3WA 3P5SA 3RUIA 1LLCA 2O3TA 4F45A 4AJEA 1SBYA 1P9LA 2G82A 1Q7BA 1Q0QA 2BF7A 1E3WA 1GYRA 3PJGA 2XXBA 4G65A 4ND5A 3TRIA 1VRWA 2X22A 4B7XA 2VT2A 4R1NA 5AXBA 2WYUA 3QWFA 3PQFA 4EBFA 3H3FA 1ULSA 4NBUA 1O8CA 5TC4A 2J5RA 4K6FA 4GAEA 2A94A 1WDLA 3HNPA 3M2PA 3ENKA 1GD1O 5JDCC 4BUCA 3C8MA 3KLPX 2W2LA 4I8XA 4ZGWA 3W6ZA 4I5FA 1T24A 4CLRA 4J0FA 2VWHA 2HCTA 5G4KA 5AYVA 3U09A 3VZPA 3RI3A 3HJAA 3VPHA 5AQ1A 3NX4A 4JCOA 4PRKA 1QYVA 3UCFA 4CUKA 4IBOA 3ZN2A 2GD1O 3GUYA 4PLFA 2NACA 4XQEA 2X86A 2YW9A 3D5QA 4BB5A 2BI8A 3G3EA 3I9OA 4J7XA 3RFVA 3VDQA 3NTOA 4OSPA 2AQKA 4UEKA 4O1MA 1HXHA 3GLQA 1GUZA 5JBIA 3K30A 4GVXA 1ENOA 3FTNA 3TZKA 5COQA 3G17A 5KKAA 5GZ3A 1Y81A 3K73O 3WLEA 2XPCA 3KEQA 2VHVA 4DC1A 3WGGA 4FN4A 4TRRA 4CM8B 2JFGA 2ZQZA 3S8MA 2C5EA 2OP1A 5JLAA 1DIBA 3BZUA 3F1LA 5LC1A 1H93A 1N1EA 4FOOA 5F1PA 1ZFNA 3M6IA 3ETEA 4DQXA 1VJTA 1U5CA 4JNKA 4MP3A 1HE5A 1XIVA 1W8DA 5T64A 3UCEA 5K9ZA 3IUSA 1A4UA 3H8VA 1NFQA 4KDEA 2Z1NA 1PJCA 4W82A 1ZNQO 1MV8A 4YT8A 2HRBA 4R1UA 2ILTA 4IGFA 1QYCA 1ZVMA 2PKQO 3TN7A 4BMSA 2HMUA 3ANLA 2IRWA 4DPLA 3BTOA 4KQXA 4K26A 3HWRA 4JBIA 5KJ1A 3INTA 2VTEA 2NU6A 3H2SA 2X7HA 4WCFC 1QP8A 1WLYA 4IJVA 4XD2A 5I7EA 2C29D 2X0NA 4K9DA 4N54A 4NIMA 1J0XO 4YTEA 1NR7A 4HNHA 4R1SA 5KCZA 3A28A 3ZWXA 3D1LA 2Y0EA 3RUAA 2YJZA 1IB6A 4WLFA 5A1TA 1PQWA 4ZD6A 1PJ2A 3FR8A 1GDHA 1PR9A 5BSHA 4EITA 2AEJA 1D1TA 4I5DA 3GEGA 3WLFA 1E1LA 5CEFA 4W6ZA 3ZHYA 1Y9AA 5L40A 2EW8A 2JCYA 3DAGA 4E32A 9LDTA 4GSKA 4XB2A 1A9ZA 2DU8A 4IDEA 4Y98A 5JCJA 4UEOA 2VHXA 1MA0A 4XR9A 4YB8A 4F3YA 1LC3A 4R51A 4WCDA 1R6DA 1Y6JA 4NMHA 4BNNA 4RF2A 5ILGA 1UXIA 5A9SB 1LLDA 3OEWA 4HWKA 1C1DA 1WPQA 3D5TA 4Q3CA 5A04A 4N18A 2JHGA 2C7GA 4JROA 2RHCA 1I3LA 4E2ZA 2O3JA 4GWKA 4EUEA 1OFGA 3TFOA 3E6AA 3RUDA 1U3UA 3LT2A 4XQ9A 3GHYA 2X4GA 4MIOA 2VT3A 2BKAA 4GLLA 4BMNA 1QV6A 3I9JA 3RUHA 1R15A 3GUCA
chains in the Genus database with same CATH superfamily
1PYDA 3LYHA 1WD5A 3D64A 5IC6A 4F4UA 2WTUA 3I42A 4FJ2A 3UK7A 1JPJA 3DPSA 1QHHB 1XVUA 4PSDA 3AF1A 4QDXA 4ZV4A 5CBKA 4C0XA 4DUGD 1PN3A 4NARA 1OBCA 1DJPA 2ZOSA 4WINA 1HNWB 1UJ2A 3LP6A 5K20A 4RZ2A 4DTCA 1KMIY 1VSTA 4QM6A 1LKZA 4EFKA 1JLLA 5T41A 4PX9A 1BE0A 3VYWA 2IW3A 1CF4A 1JFTA 1M0SA 2V45A 3R3ZA 4RADA 2WP8J 4RL6A 5EQDA 5J5CA 1PJSA 3TLEA 2RHOA 2QTNA 1GKLA 2Y77A 3QE3A 4PPFA 4TS1A 4QFBA 3R8CA 5CT9A 3QVOA 1RAIA 4QT0A 5IWAB 4ZTZB 3MYRA 4YAWA 2MMGA 2FG6C 3GP5A 4R1OA 4P4TA 1HNZB 5COAA 8AT1A 1DKPA 3CZAA 3ESQA 2QRVA 1HT1E 4IF6A 1OJLA 1ZU5A 2D0PB 1KEUA 4UVEA 2TMYA 4C0WA 3EGCA 4PSAA 3SXJA 1MXHA 3ORSA 5G0TA 2PX3A 4C78A 4YHBA 1TD1A 1WNTA 3WIBA 3R4VA 1LDEA 1NVGA 1E60A 1SHJA 3RS4A 3WIVA 3HJUA 1TEXA 2KYRA 4IDHA 4U63A 5DX8A 5LR6A 4HN2A 4JHXA 4RA6B 4QPJC 4XJXA 1SIBE 4TROA 4YAOA 3U3MA 2VNSA 5K09A 2GTHA 4ARCA 2ZVPX 5JFOA 1P7PA 2P3LA 1PT9A 3IOYA 4EZEA 5ILQA 1GQSA 4OQ4A 3V8NA 4PPYA 3WGMA 1U6IA 3IIMA 4JJAA 1GGNA 2OO5A 1T2EA 2YTZA 2GFIA 3OQVA 2YHBA 3DVSX 4ID3A 1GILA 3LY7A 1M74A 3ZQ4A 4D3SA 5CB0A 2FWBA 3A2KA 2M2IA 3AHIA 4R8SA 1SKBA 4E30A 5K8CA 4URWR 5FIUA 3BFPA 4KQFA 4IHJF 1FUEA 4B0OA 5I45A 4L28A 3W7BA 5J23A 3OVMA 1LBTA 1KPGA 2A30A 3R0ZA 2WWIA 1ONNA 1AQ6A 1GPLA 1NQXA 2H18A 1YS9A 1QV7A 4UBNA 2NXJA 1E3DA 5EMMA 3UY4A 5COBA 4EARA 4CETA 1J00A 1XUOA 1TAHA 1TLLA 1NN5A 2CMHA 2DSTA 4XM0A 2CCJA 2DJ5A 2CEKA 2ZBPA 2C99A 4WLNA 5EIBC 4ZVOA 1N5OX 2K87A 4FFVA 5JTUA 2WTMA 1JDBC 2FE4A 5DWQA 1A8HA 5FUWA 4WNIA 4AB1A 2C96A 4C43A 1T6YA 1ZXXA 4GHWA 1BVYF 5DB4A 4A8TA 4CR8A 3LFTA 1Z34A 3OICA 1TJNA 2PXXA 2GETA 4G0NA 3ADDA 1D4ZA 2GHTA 2XWPA 1H3FA 3V32A 4BLWA 5LLTA 1QQ6A 2JLYA 4IXTA 3VPAA 4EFLA 1QTNA 2Q6LA 1NVKA 2O23A 1C7RA 2WU3A 2JK0A 2GK4A 1XD9A 4ZHQA 4WUVA 3UB4A 3FD8A 2QL9A 3DVLA 4YQZA 3TSWA 4YQEA 1XOIA 2ZYGA 3UMCA 4ER6A 1G8GA 2J30A 3ESRA 3TECE 2QSJA 4Y2QA 2LR0A 1T2DA 1VLHA 2O7RA 4A0RA 4YCMA 1JEOA 2P4EA 3GJ7A 2J3HA 3HLYA 4NYIQ 3LQQA 4U3JB 2F1IA 1R9GA 1Q12A 1LK7A 3UOGA 4GOOD 2YWHA 4HD8A 3F3MA 3NHMA 3K1AA 4K7JA 5THKA 2VTBB 5DYGA 4WESB 1YRBA 3KC2A 1KY4A 3UKJA 4BB6A 3EIOA 4DIFA 4HHEA 2R751 3RHZA 3OPYA 1G8JA 1SXGA 3UATA 1KBQA 2DMRA 3V5NA 1V25A 1DC6A 3KKOA 5EMNA 5K8TA 3FPHA 5D5PA 1V7CA 2XI4A 3PX3A 1FLNA 5D84A 2B3TA 5P21A 2C2XA 5FAXA 4IJMA 2QU7A 4ODIA 5EIFA 2DPHA 2P4SA 3GT0A 3EGWA 4MHOA 4Q4CA 2O59A 3KXDA 2LRHA 4TN1A 3FJ1A 3P4YA 4KDFA 2DTXA 1AHNA 4RH1A 4D9GA 4FI3C 4YCNA 4UFNA 1F60A 3PGXA 1OBVA 4JXKA 1GADO 1D2CA 2B21A 2OXFA 5ESRA 4RU1A 2ZWVA 3ETHA 3STVA 2FPIB 3QBJA 4R40A 3SKVA 4C3OB 3Q1LA 5T3YA 2XDQB 3JWIA 4MW2A 4D42A 5CDUA 3HKDA 3LG2A 4R9RA 4YJKA 4KE7A 4KDCA 5L6MB 2OXTA 2GBCA 2JLSA 2V7BA 5A0FA 1FF9A 2JLRA 5JWHA 3PYLA 4JL5A 5FNVA 4D8VA 1AD2A 3FAZA 3DWFA 2EARA 2AR7A 3LS2A 4EYQA 3BF8A 4R4JA 2IP4A 3PT9A 5LD2B 1GV0A 3Q15C 4UUOA 5HQJA 2EW2A 3O8QA 3RYCA 1XMOB 3EIHA 1K7CA 2DBZA 3LE8A 4PG7A 2ZZNA 1HRKA 1KS2A 4LJRA 2NXCA 3AR5A 1HMYA 4MJLA 3GG9A 1DRKA 1BS1A 2VEDA 4LTDA 2HAEA 2PKQP 5BQOA 3UWOA 4KO3S 4JC8A 3PX2A 2OWDA 3SC4A 5A3QA 3HXMA 2AH5A 1XXLA 3CNNA 4TZKA 1B6TA 3K0AA 5FRDA 2WWTA 3GZTB 3GRCA 4FWIB 1F2UA 1L7XA 1WCV1 4CF7A 4M4SA 1YS1X 3EXHC 2BGNA 3K16A 2J31A 2X8JA 1N2OA 3NOXA 3PC8A 4L6IA 4HTAA 1NPDA 3T5DA 3UJ9A 3DOIA 4BRZA 4XB6B 4HSEA 1GL6A 5AKGA 5BR7A 3SF0A 4ZJYA 2J0EA 4RFVA 3B3JA 1W5BA 2PVSA 3A11A 1E2MA 4NZNA 2VDOB 2G88A 4AY3A 4KN5A 2VJYA 3WHPA 1UT6A 2ORYA 3Q9UA 3L8MA 3R7LA 3JYQA 5FBHA 5EIEA 3T5MA 5KVAA 1NQTA 3DEAA 2C9DA 4ALIA 2R85A 3E3LA 5JARA 1KR2A 4CUZA 2W5UA 4DJDC 4E1BA 4KTTE 4OI1A 1PDVA 3IAM1 4LFCB 4WOKA 3U4QA 1ODIA 1HF3A 1Q14A 1XX6A 2PA3A 1Z88A 2YW2A 4JQYA 3BJEA 3A1WA 3UQZA 1QC5B 2PV7A 2ATIA 1QCCA 5EJ5A 4IUDS 4GNKA 2GN4A 1I13A 1RMYA 1M2EA 2GHRA 3AIKA 5BT9A 5A03A 1ZCBA 1OWNA 2VUTA 4WFKA 3EF3A 5HX7A 1S5PA 1NRXA 1T15A 3AHDA 3EVGA 1V43A 5FNVB 5JNWA 4P5EA 3QBTA 2ZSUA 4QHTA 3QKTA 4EGSA 4BLTA 5A3VA 1GQQA 1ONSA 4M2LA 1BVHA 2PXAA 2XA1A 4JQCA 3ABZA 1XU7A 3FGOA 4RW0A 2ZS7A 4B2IA 1UIMA 2GLTA 4G56A 2IOYA 5LPNA 3BZWA 2B2NA 4HMQA 5AMXA 3AU9A 1ZUHA 1CETA 4RE6A 4M1SA 2OD2A 4GRDA 3EGIA 1AZTA 4CG0A 3OG9A 5HKOA 1THZA 2NPFA 3GN1A 5M2QA 2HJSA 1U8ZA 3CRNA 1XLUA 1C0KA 3OZBA 3T7SA 1GSIA 1XHFA 5JALA 1CDDA 4C21A 1X7YB 4D5GA 3UANA 3GEIA 1FK8A 1H94A 1PS0A 3C4QA 5AM4A 4BNGA 1PR0A 2QD1A 3JX9A 4ISCA 4LJAA 3TOZA 1XCPA 2WAXA 1T8UA 1WDTA 4TXJA 3AVUA 1Z6PA 2X3UA 2V6IA 7REQA 2OYSA 3ZD8A 1BE8A 1DJMA 3E9DA 4WZAB 4CMEA 4PTLA 4IDGA 4WKOA 1UEIA 4CEJA 3A1VA 2DT8A 2PV0A 5DU2A 4JJ7A 1R8YA 4NLLA 5AW5A 2IUUA 3HRKA 4HUQB 5C3UA 3L7AA 4EMUA 4MVJE 3IMGA 3JALB 3ORHA 1FU4A 2BFOA 2P3QA 1QZXA 1YOVB 2YWRA 1DARA 3ABIA 3I0NA 1I2ZA 1E9SA 1HT0A 2XDAA 3MLEA 4UZFA 2UUOA 4GPIB 3C6XA 4G9BA 2B1RA 1B3BA 1JDPA 2NNWB 3IHLA 3C5VA 4KZPA 3ZE1B 1HLPA 4F1WA 3C8DA 1K88A 3GH1A 4ER7A 2EGGA 4HY3A 1KI6B 1Q7RA 1K98A 2CCKA 2XTMA 2B37A 3WMRA 1TZBA 1QIEA 4EG8A 1J9ZA 1JHZA 1NDUA 5A6VA 5IM4A 2F67A 3PDWA 2UU9B 1NW3A 5ICGA 2QTTA 5JISA 1NXQA 3DP7A 2VLIA 4P58A 3QSYA 3KQYA 1UJMA 4JU9A 4OQPA 4EKNB 2C00A 3O83A 4I66A 3BHMA 4DBLC 1QVVA 1X7YA 2DWQA 3K5PA 2PUVA 1KDZA 1VLJA 4N5DA 5DIZA 3BTSA 2UYYA 3O47A 9LDBA 5FAKA 2H29A 4M0UA 4EB8A 3R9WA 1JVSA 1NXOA 1QXSA 1R0WA 1WXXA 4N5LA 3LLSA 3RC1A 2W8ZA 5IYZA 1K6XA 1QKJA 4F6RB 3R24A 3B48A 2F1OA 1TZ2A 2ZRNA 1N9KA 1NBIA 4J90A 4PYNA 4X84A 4NCIA 5BW6B 4D44A 4D8WA 1KI4A 5SZHB 2A35A 3G9ZA 4C88A 1PJ3A 5L3QA 4NQZA 5CG1A 1XVAA 2IBTA 5KOHB 2ZR9A 4TRNA 4V2UA 3O2JA 4LOKA 2NUTA 3R8XA 1E7WA 2OBFA 1QGAA 3CLKA 2IZ1A 5AK4A 2PUDA 5H80A 1D07A 3BXFA 4DW8A 1YU6A 1VTKA 4QYWA 5KJ6A 1R4MA 4BO9A 5LXTA 5IG2A 4YP1A 4ZO6A 1DGQA 3E5NA 1HQCA 1TCAA 1K2VN 3SFVA 4WFQA 4BVLA 3CSDA 4IEFB 1VCMA 3NHLA 4M55A 4ZVRA 5TPZA 1CIJA 4MVJH 1Y4AE 3ZGYA 1N6IA 3A14A 1WEKA 2JDIA 2CVOA 2WPDD 1N2XA 2HSJA 3Q5EA 5DBEX 4ZMBA 1SQ0A 3COWA 1JPVA 2X9GA 3VYVA 3MTGA 3ZEAA 5JSZB 4P7BA 1UODA 1HGXA 2GXQA 5B64A 3IMFA 4R54A 1KFJB 1TM4E 4NCAA 1D04A 2W6QA 1E0DA 1YCFA 1SXIA 3DOFA 1T4GA 4KVAA 1N7JA 5AT1A 5DASA 1B8VA 4NEGA 4B3DA 2TSYB 1AX9A 1NUAA 4RK7A 4CQLA 2ES4A 1D6JA 5E6UA 2EL7A 4FE7A 4CEHB 2DG2A 1T5DX 2C4UA 1DIAA 2QLFA 2QAGC 4ZAFA 3JATB 2BSAA 4EA8A 1UQUA 3W7AA 3EULA 8ATCA 5KWSA 3AUKA 1GZUA 1SBHA 4H77A 4DANA 4EG1A 3NFRA 5HIIA 5LQJA 4ZYXA 1VKNA 3SGLA 4RMHA 5F2OA 3I0ZA 1A9TA 1BD4A 1YO6A 1EB9A 2VP5A 5BSKA 1U3FA 1I7QB 2WKRA 1T13A 2J5XA 4ZKDA 1JKXA 3LW8A 4Y2TA 1ZAYA 3BAZA 1OE0A 1ULUA 4YRJA 4CF3A 1BA3A 1FJGB 4UUMA 1J24A 3G9UA 3BDVA 1SVOA 1AV6A 4EKGA 1RYZA 2IYYA 1C7QA 3Q2KA 3AQ4A 3PJFA 3ZKWA 3UMRA 5K6TA 2WV7A 4WL0A 1YMUA 2WIAA 3H87A 4W5WA 3UV3A 4F9FA 4C2TA 1I80A 2I29A 2QVYX 1NW9B 1D4AA 4FYVA 2CEAA 1KYXA 4EHKA 3WLSA 3JASB 4U1RA 2G83A 1PL7A 2IYQA 2FW7A 4ZQEA 3RWOA 1KH2A 2SECE 1GIAA 3A36A 2B83A 2R8PA 2CV0A 5JW6A 3I32A 3T7TA 4WGFA 3CH4B 4OHWA 5EPEA 3TGPA 3T1YB 3O8OB 3LXRA 1YIDA 1U8FO 4D8YA 1NMXA 1NQWA 2JA2A 2O9JA 4E0BA 1OB5A 1Q1NA 2FFAA 3IAAA 4V0NA 5AJZA 1HYBA 5THQA 5JEDA 4IH9A 4DR3B 4EA9A 4Y0AA 1IPEA 4H7IA 1ZCFA 2IXDA 1N3YA 3AR3A 2HH9A 4PQRA 3G13A 1QF9A 1E5VA 5AUOB 5EJGA 4TV8B 4JBLA 3U16A 4FU0A 3VU9A 2C1ZA 2R68A 2RBEA 1MH1A 1Z16A 2GEBA 1P9WA 1G3QA 2RGWA 2C7PA 3EQ6A 1UOQA 2GSDA 3L7DA 5IDXA 3HU2A 1V8BA 3OX1A 5UKDA 2PLFA 3L92A 4GLFA 4V1CA 4JEUA 1CZUA 5F52A 1JHQA 2C95A 2PMCA 2XA2A 3VAYA 2DPXA 1VA5A 3PQ3A 5BUQA 3K94A 1A8UA 1Z2NX 4FFDA 1STOA 3NAZA 4ZAWA 4L27A 4GXTA 4WBNB 1O0BA 3N6XA 4HGNA 3R7NA 5JRJA 1UZMA 3P9XA 1IHOA 1XTZA 1D7AA 1E6LA 1HSZA 1VKZA 4FDMA 4Q37A 5J4KA 2ZB8A 1PT8A 3I9MA 4Z86A 2JEOA 2ZTHA 5TQ0A 1AZLA 3U4QB 1ZVJA 2IPMA 2W2TA 2DBRA 3LC0A 4F3RA 4XPZA 1V1RB 5CFZA 2O8EA 3WK5A 5HW0A 4HC4A 2P0AA 3TK1A 1QANA 1QZUA 1TCCA 4PHGA 4PQYA 2Y71A 3FNIA 5K8IA 1U1CA 4N41A 5HS4A 4ZOLF 2OAP1 3G0DA 4RLHA 1J8QA 3AKYA 5CNJA 1NM5C 2BBTA 2QY9A 4YR9A 3H5IA 4CFSA 5D5QA 5A5FA 2DUWA 2IE0A 3IEVA 1RPAA 4Z53A 3ECSA 1RWKA 4L9WA 5DX1A 5K6RA 3IE0A 5KQGA 4OB8A 3U80A 4DQKA 3FKSD 1FUIA 2WF8A 3WAGA 4GZLA 5TPWA 1XTJA 3F96A 3MLBA 4O08A 1QM5A 2OCIA 4XUGB 4U8GA 3TNFA 4DEXA 2XA9A 2Y1EA 2VPPA 3ESBA 1MP0A 1RJDA 3OTWA 2WFZA 5ABPA 1N78A 4UHBA 3ZE7A 1ZISA 3KKEA 4W6QA 4V03A 3MJHA 1DZ3A 2CXOA 2VRCA 4Z9BA 4ZZ1A 4LFAB 1Y3BE 2I6UA 4I19A 3GL9A 3OJ0A 5BR1A 5K6AC 4C07A 3DLCA 1EUYA 2G4VA 3EYWA 4CG3A 5BQ5A 5DJ5A 3G2MA 5E7MA 1U63A 4TOIA 1Y5NA 4L50A 2C9CA 2YVKA 2O7VA 1AS2A 4N7RA 2XOXA 1Q50A 1DV2A 1QC5A 4L1KA 1MFPA 3I1JA 3UH0A 2W4QA 4M1KA 4A9AA 1YQ9A 1F17A 5IVHA 1JFLA 5AW2A 1GNQA 1Z13A 3FMIA 3L1UA 3OFSA 3GPBA 3CR7A 1X1TA 2W4MA 3LY5A 2LCFA 3EIXA 3QKWA 3WB1A 5FH9A 4RV5A 4YLGA 2RGNC 4CIBA 1PFQA 4H3HB 3PEYA 4C06A 1XWWA 4NNOA 3I3OA 4RTKA 10MHA 1G5IA 1PJAA 1QHHA 2QN1A 4LYFA 1SC4A 3KTDA 4EZIA 1DX4A 2CHEA 3AV0B 5AI8A 3KNZA 4NJEA 1U2DC 3THOA 1DIGA 2ZJFA 3QLVC 1F0PA 1JQEA 2RGEA 1LA2A 2QI9C 4UBJA 4ZQCB 5FBLB 1RVDA 2JHFA 2OYRA 3KKPA 5K8LA 5WRFA 1USWA 3BE8A 2VZ0A 3PFGA 1VBKA 1K7EB 5D1HA 1TC1A 2OZEA 4PR0A 2VRBA 5G3ZA 1BYIA 4QYTA 4ZVQA 4AYWA 3VNRA 2VCHA 1JH9A 3DD5A 4G2TA 1P75A 1JBQA 2A0YA 1XTRA 2LPMA 3WBBA 1Z5OA 3T1TA 1ZYUA 3RAFC 5M04A 4K0KB 3PICA 2E55A 4CMEC 3M70A 2XTAA 4KQHA 3OJOA 2AR9A 2HV9A 2RHTA 3DZFA 4JKYA 3R9IA 3OPXA 2AE1A 1SBZA 5LUBA 1Z68A 1ZRSA 3BULA 5EWMB 5BV0A 3THWA 2I6TA 3JQ6A 5I7HA 2RGXA 1XZDA 2HSZA 3WGHA 3C1UA 1Z5NA 4W63A 4WOBA 2JJ2A 5C18A 2CVPA 2OILA 4ZVUA 4EGCB 4ES6A 1N77A 4CR7A 2CHUA 4CXMA 4GYJA 5LFAA 1N9GB 2E85A 4ESVA 4RXTA 4MKRA 4XXHA 2BH9A 4AJPA 3VBCA 1WJGA 4YA6A 1Z2EA 5FPYA 3UB3A 4EENA 3AUAA 1NG9A 3L7NA 1WXDA 4MYCA 2PKYX 3AFGA 3FNHA 4GGOA 3PEWA 3E5RA 3ADCA 2A14A 3KQUA 2ECOA 2FMUA 4LCBA 3GLGE 4H6VA 5L6LB 3A2MA 3VR4A 2AOVA 3HJGA 3QEAZ 3GGPA 3CURA 1GSOA 1SC6A 3I28A 1NSFA 4N03A 2FN9A 3DL0A 1P4RA 2CDBA 1YQGA 4BHTA 1YRHA 2H2GA 2WOJA 1CRZA 4IXDA 1C0LA 3SKYA 3DE2X 1N2CB 2XUDA 3GUHA 2EGUA 5DHQA 1UJBA 1Q7EA 1L6RA 1UZAA 3HC7A 3S40A 4YH1A 1M2OA 5JVDF 4ZOLA 1G60A 2ONCA 4LYDA 3C7CB 5DN6D 2FEPA 4B32A 2ODEA 4DLPA 4X71A 2YJ4A 3F2IA 4UNPA 2FP3A 4ECAA 2JJ2D 1SCNE 2Q4OA 3D81A 1PGNA 4FGLA 4PLYA 4Z8YA 4W9NC 3X1KA 2R1TB 5LZ4A 1YQQA 2ZBVA 5KKCA 1ODKA 4LDPA 4LHYA 4JJ6A 1KU6A 1OH5A 1C5KA 5SYAA 1MZVA 2UUPA 2BMWA 3SC3A 3UA3A 4DRZA 4P4LA 2E5WA 5DDIP 3KKQA 2ZXEA 2BMFA 3CR8A 2QW1A 5LLSA 1PVVA 3OJWA 3OZCA 1XGKA 3ITKA 1G8YA 1BCSA 3OCUA 3EF0A 1BRTA 4AZ0A 3NVKI 4EMBA 2O4CA 5BP7A 3GC6A 4MS1A 2DY0A 3NDRA 3TRDA 3UYLA 3TW8B 1ST3A 4UD6A 7ADHA 8MHTA 3UGKA 2H1WA 3HJHA 3HR4A 3OOJA 1N9GA 4FILA 4IJ5A 2WPNA 1EK1A 4Q93A 4UAGA 3S29A 5GM2A 5BV2P 4RACA 5JXWA 1E1NA 1FLVA 3OZIA 1DJNA 3KAKA 4G1MB 3FXAA 4JBGA 2ZSIA 2I3BA 2WG0A 2QVGA 3QTLA 3THWB 4KPGA 3T9DA 2GPSA 3B6KA 5BN3B 1O5TA 3TW6A 2PA0A 3BAFA 3MB5A 1UPXA 5GIPE 3BRWA 1JF8A 4H0NA 1G291 3T3MB 3D7MA 4CKBB 1MV5A 4N4AA 3NM4A 1CPYA 2Y0CA 5I7SA 4JC4A 5M7EA 2AB0A 3V3TA 2CLEB 1PUXA 5GAJA 2VQDA 2WW8A 4IM7A 3RUFA 3TM5A 2C07A 1A04A 2Y76A 3WKEA 4YRDA 1DTSA 1WB9A 3CE9A 1AKYA 1THMA 3LRPA 4KQMA 4RVDA 2NZUG 2NSLA 3L1VA 4DR5B 4EFMA 5JXHA 3C5WP 3G2QA 5L4NA 1J1UA 3C5HA 3PC4A 2ZE7A 4D6YA 4DDKA 4D4IA 3CT6A 3VRHA 3OLQA 4TYYA 2B1GA 2AOUA 2OFWA 4ZT2A 4X7RA 5G40A 5AVUA 2B69A 4HH0A 2ZSBA 3DSRA 2OCPA 4AWBA 4WIAA 5AKXA 3K0EA 3A9VA 1YDWA 1P74A 3TI7A 4LF6B 1YB2A 5FBKA 3S2SA 3IQEA 3DL7A 4IVQA 3TW0A 1E9BA 3LV8A 5BWCA 5I7VA 1L4FA 1XMIA 1X8XA 2W42A 3TJMA 5HKAA 1V9CA 2I67A 3B12A 3O7MA 1D6NA 3NP7A 3GPDG 6Q21A 2ZPUA 3OLXA 2IZ7A 5E6RB 3VX4A 5JRZA 1XZAA 4AJ4A 5LYJB 4HVAA 3EVAA 1NPYA 3LY8A 3QKSB 4BQFA 3DS8A 5BQXA 3NHPA 2QXYA 3K9BA 1I4OA 1KI9A 1WDWB 3AP1A 3GA5A 4N3BA 1FY2A 4BNZA 2OAQ1 5BV1A 1TO2E 4LRQA 4XJTA 4WNYA 3BE6A 5JVDB 1B26A 4JVOA 5HVNA 4H4DA 3RYTC 3HCNA 1ZCAA 3D2BA 1ZL2A 4BIMA 4ZAXA 2D06A 1M54A 1ZM9A 2UVPB 4MR7A 1EP1B 1V3TA 5JD6A 2JIDA 2YZNA 1C50A 3PT5A 3RD5A 4BVAA 3KQVA 4GKBA 1AKUA 4RENA 1Y80A 1JDUA 3IJPA 1EZ1A 1G64A 2C98A 3IAEA 2CFOA 4CTKA 2BDTA 3INYA 2WAAA 5FYQA 1SZPA 1O4VA 1EFKA 3DR5A 3WOHA 2PYZA 3PD0A 3ZHOA 1C9MA 4Q9AA 5CP8A 2EG9A 2MIIA 3AHGA 4IAOA 4PZ0A 4W8HA 2J9ZB 5DGXA 5FB3A 3IQHX 1BN7A 4DV1B 2DTDA 4R68A 2CNWA 2JJMA 2IPNA 4OUDA 3CVJA 1U98A 4Q16A 1N7IA 2PWPA 3RYFA 3TDKA 2FCRA 2LUOA 1H85A 2W8BA 5AW0A 5L7TA 3ZHVA 5A02A 3CA8A 1TYEB 5DSXA 2RJNA 2R97A 3L5KA 3M6LA 4K87A 4L0QA 3RRFA 4BO8A 4ESHA 5BMVA 3HCWA 3WWZA 1C3VA 3RTAA 1KO5A 1AKVA 3I01M 4LX0A 2X1MA 1UMCA 2AYYA 4QYMA 2XNCA 4DPMA 2A9JA 1YMVA 2A6PA 4CMAA 4W9MC 4JLNA 4DNXA 3AF3A 2XJ9A 4F2GA 4D3ZA 3PHCA 3KJIA 2VPIA 2J3KA 2D7JA 1U0OC 2WF7A 3HY3A 3KPUA 3CO5A 3LQ4A 4W9RA 1N32B 1P33A 5HE9A 1QX3A 3ZHXA 1E2BA 1I4LD 3DQQA 1F6WA 1QV9A 1YB1A 1R5NA 1P6XA 4K86A 2IITA 1GVHA 5MF6A 1O96A 3AEZA 2CBGA 3ER6A 4KR7A 2WNIA 4DBZA 3ZYZA 3GLFB 1E0SA 2HJWA 4RABA 3LXUX 1WCIB 1IJFA 3EEBA 4HPJB 3A32A 4CT4B 1K08A 4CM4A 4KUEA 4HZUA 3K72B 4PONA 4FQ7A 3N0TA 2P4UA 3SHOA 3AI1A 3RSGA 1UM9B 1EJBA 3BXXA 1MX9A 3HKBA 2FX5A 1G7SA 1W2HA 1YS4A 5EQJB 3ZXYA 1GR1A 2EQAA 1P1FA 1HG1A 4PC1A 3H5AA 1ISSA 5ER6A 4G5FA 3SVTA 3LLCA 2GH1A 4FX5A 5F33A 3VJKA 1OGYA 5DHFA 4D0RA 4UVDA 5T6BA 4MW5A 2L19A 3ICQB 4JYZA 1ORIA 3RLIA 4JLDA 4S2UA 1U6KA 4JP3A 1XZBA 4UQPA 2PL5A 5CH3A 2R8OA 5TE9A 4CM6A 1G3UA 2XMQA 4J7CA 4I5IA 3KB8A 1I2CA 5CB4A 3R5FA 1NXTA 1E0KA 1W47A 1Z73A 2E5FA 3QUSA 2O48X 3WDKA 3PL1A 5DNYB 1EWVA 4NBWA 4L3WA 5KQMA 1L7NA 3AHCA 2BTQA 4TQGA 1X7GA 4XX0B 3MCWA 4OHFA 1ZD3A 2QN7A 3RKRA 3ZVLA 4BQSA 2NUPA 5JWRA 4OXKA 3T52A 5L53A 3G7NA 2X7XA 3TLXA 1G6Q1 4IGKA 2P6RA 3P0IA 1C0IA 5FEMA 1KORA 3OQNA 3V4RA 2W83A 1TPZA 3B3QA 1G4UR 1VI2A 3WGTA 1J0BA 3KR9A 2BFDB 3LPLA 4GM0A 2EGHA 4FYHA 3T4PA 3EXFB 3NBYC 2GUWA 3QY0A 4BX8A 3RJ5A 4Q9DA 1QP7A 1OU4A 1QFSA 4MEJA 1FNCA 3MG9A 1KP9A 2CV2A 1VPLA 4E2XA 4Q1EA 4TTSA 4CQNA 5LKAA 4H0CA 1OI7A 4DUPA 3B1JA 2BEWB 1WZIA 4GGMX 3MPUA 2YHAA 5CPBA 2A0WA 2VCYA 5T4BA 3T61A 3N07A 3FUUA 3SIPA 4LF7B 3FTDA 1HDOA 3L0DA 3OF2A 4M49A 1CQIA 4AURA 5FL7D 3LT4A 2L2QA 5CFMA 3IMKA 4EMTA 5DNAA 1XPUA 2P30A 2RC6A 5FULA 4C87A 4LNUB 4F72A 2VR1A 3STWA 5JH7F 3EPLA 1SXJC 2QG9A 3FVWA 1X94A 3R5SA 1Z8DA 1ENZA 2GMWA 3K0CA 5EKXA 2DQ4A 4IHKA 1DADA 4TRJA 2DKNA 3ZY5A 3QG5A 2RE8A 1IM8A 2J7KA 2REQB 3FX2A 3QF4B 1I6WA 1QSGA 1QHXA 1M6VA 2TYSB 1QWOA 3QQPA 2DR3A 1CSEE 3WGYA 3EH1A 3D43A 3B9QA 3VDXA 3WQRA 4XFJA 1S9HA 1U7TA 1GZ6A 1DP4A 2NU9A 3KQTA 3MWLA 4BN0A 4RA9B 3K32A 3ZY4A 5KQLA 4E4YA 2WYIA 1J8FA 1YKGA 4UTNA 4YP0A 5F98A 2FQYA 3OJFA 1E4OA 1MG0A 1XPOA 2LDBA 4MQUA 4E14A 5AI0A 1OCEA 1VB5A 3T95A 4ZICA 3F9CA 4RULA 1VQ1A 3T12A 1M5TA 4J1NA 3LTNC 2H7XA 2V9CA 4XEUA 1KNQA 4EO7A 3A4MA 3CNEA 2OHXA 4ARUA 5K3CA 3R6LA 3HBFA 5K2MA 3K53A 1K8QA 3BWEA 4LYAA 1ORDA 4DMFA 4QU8A 2I6GA 1SQGA 1TJ3A 3GLGA 1WTCA 1L5OA 1XI2A 3HYLA 4DM7A 3IP7A 4A2CA 1UDWA 3GNSA 3UA4A 4CG1A 1PP4A 3LVRE 4I9FA 1EUDA 4II2A 1M2NA 2QLNA 3L0PA 3VKUA 4UTVA 2GLXA 3H4VA 3CRRA 3QUTA 3LDHA 4BV8A 2HT6A 2VK2A 1BVRA 5AOCA 2R65A 1D2AA 2VYFA 4KRFA 4PPNA 3R4CA 4LHWA 3HCOA 1SHLA 4KN9S 4LXHA 3QLUA 2BMAA 2UVDA 1M1NA 1HK7A 1TE2A 1CUCA 4CMIA 4Z4QA 1EWTA 4GO1A 3UN1A 2ZYVX 3TEMA 5IWCA 2O19A 2YMLA 2AJLI 3KOZA 2WZBA 2Q29A 3QFTA 4IS2A 3A1NA 4RO0A 3C3YA 3VR4H 2EZ4A 3A70A 2QBYA 2OK8A 3GRRA 2QUAA 4CR6A 1T9GR 1VJ1A 2FYTA 1SUSA 1XLTC 2BHTA 3JQFC 2C5HA 4FKMA 1QGYA 5D3QA 4UJ3A 3P9IA 1KI3A 1R00A 4OHBA 2O05A 3WFJA 1GAWA 3FA2A 2QQGA 2F2TA 4B6FA 1JJ7A 1L3CA 3A6HA 3RRZA 4I1VA 1MC4A 1CEEA 1KJ9A 3G7SA 1DAEA 3B20A 3FG9A 3H3XA 5CDGA 3A1SA 3P9QA 4RVSA 4A8HA 4BNYA 4B85A 4IIYA 4TSKA 3RVMA 1CY2A 5JJLA 1TUGA 3CNHA 3NOOA 1L5QA 3QU5A 1U5AA 1OX5A 3RM3A 2IIVA 5C4MA 2OZKA 3N0RA 2CFRA 2H59A 5KSOA 4LVCA 4QQKA 4U7JA 4WXEA 5DCYA 3E9RA 4HH1A 4A3SA 4C4RA 3O8BA 2OV4A 1ZZGA 3PC8C 4JP1A 3UJ7A 1KEPA 2YV1A 1E63A 5A4KA 2NU9B 3UWMA 4GZMA 1R12A 2M98A 3TD6A 1IZ8A 1TI7A 2FOXA 1RCFA 2GTPA 2O2YA 1PL6A 1XCMA 3AV3A 3EC7A 5F5LA 4L9AA 4BO7A 4NX2A 3TR0A 4UTPA 3Q41A 1WVGA 2OV2A 2VZ9A 5AK5A 5IJ9A 1M6YA 1VGVA 3N0XA 1ZIOA 2N42A 5C37A 4FC6A 3GJ0A 2I54A 4LGCA 3DBHB 1MD9A 4W99A 4HVLA 1RZRA 4BMCA 1T2AA 2H5IA 2P75A 3TZLA 3P2JA 3SF8A 3NVDA 1Z22A 2Q4EA 8GPBA 3PRYA 3AUXA 4QXMA 3WS7A 2XB4A 3MT8A 4PO1A 1T4CB 3VYTB 2C5BA 1JAHA 2K7ZA 3VU8A 2FSPA 2NVBA 3RC3A 4FFBB 5CW1A 2J87A 3GLHE 3S27A 2FPOA 3H42B 2EZTA 4K6CA 4O3FA 1SKYE 2W6IA 4P1ZA 1V5FA 4G41A 3ZE9A 2GN2A 1ONBA 4B3BA 5JNTA 4PGAA 1JHOA 1RYHA 4FGJA 1PKXA 1KJYA 4MAMA 4CIYA 1L4LA 4DB2A 3ICCA 4JBYA 1MQ9A 4W5JA 4X62B 1QU2A 3GF4A 3DFUA 4N47A 1GUAA 1D0IA 3C4JA 2PUAA 1K5HA 3FSGA 3QRWA 4ZYLA 1GFSA 3O3CA 4J6EA 1LC0A 3AJDA 3CX4A 1LI5A 4EG5A 1US8B 5ALDA 1N36B 2RKWA 3H7AA 4BO5A 4HO1X 4JVLA 4DYVA 4HFMA 5JHHB 3OTQA 2UDPA 3AFMA 2G9UA 4RIFA 4UBMA 3PRKE 3GRUA 3DBRB 4X90A 5D01A 5C4GB 2IXGA 3GNLA 4QDOA 2NN3C 3KLBA 1COZA 1FTGA 3HGMA 2ZWMA 1NBMD 2PZBA 4Q4HB 1HL7A 2YFHA 1DAHA 3L0SA 4OHZA 5JXGA 4ENTA 3R20A 3DNFA 1SD5A 1MB3A 1RXYA 2PFGA 1E98A 2L17A 2GM9A 2PFKA 3N7TA 4RVCA 4WZZA 2UVPA 4MR7B 1OW3B 1Y7PA 2IYEA 2A9QA 2HHAA 4K81B 2C2BA 2RK3A 2QXTA 4TV9B 1XHLA 3OQHA 2IXEA 3VAAA 3AHEA 1AJEA 2D2XA 4WQMA 1YJQA 4B74A 4RA9A 2AOXA 1F12A 4XZ3A 4HB3A 2OV3A 1HA3A 4WK0B 3UAXA 5ICSA 5IRCD 1QRAA 1AO3A 4TWAA 4GRIA 3CUWA 1OXXK 2JLQA 3KB6A 4NHOA 4X3CA 3G8DA 2YHIA 2Q3EA 3FRIA 4Q1VA 1CJSA 4MQ6A 5J1TB 3TL3A 2ZBGA 1K66A 1JSLA 3G88A 3AIIA 1W96A 5KINB 4C6RA 1KU0A 2JGJA 4KMSA 4BDTA 4Z4HA 3FF1A 3GG2A 4AS3A 4N3GA 3KQNA 3ZR4B 2IQIA 3JTEA 4WECA 2WJPA 1UBMS 5FFMA 5LQRA 3SZUA 1C8LA 1EEHA 2PL9A 1EK0A 1QWSA 2X2OA 4OJNA 1WY7A 4P4NA 3FI0A 4BFXA 1DAKA 4E7OA 2IHZA 1HZJA 4RANA 4AY2A 4MICA 1DMRA 1F4VA 2OE2A 2LZ0A 5DBFA 4EKYA 3SJCA 9MHTA 2BUCA 3DPIA 4KWEA 1TXGA 4BYGA 1A9XA 2XV1A 1DFGA 1RKXA 1NT4A 3A9RA 4EHAA 1UDCA 3GRVA 1RJWA 2KM1A 1ISPA 4QNMA 1GPDG 1JU9A 1UBOS 2A9PA 4RSRA 4FOSA 3LT1A 3U5TA 2ODNA 2ZB2A 3ML1A 3RSQA 4ETMA 1U5BB 1UXOA 3C97A 3IYLW 3CW9A 2DCUA 4ZVLA 1SG9A 2PMWB 2VQSA 4OXXA 1BHSA 2PAFA 2GYWA 4N48A 4L8YA 4A73A 4CKEA 1GA1A 1BX3A 3TKAA 4ZPXA 4PWZA 3K5WA 3HB5X 5EWLA 1FSGA 3SX2A 1U0JA 2KW5A 4MV0A 4S1OA 2Q6IA 1UBCA 3WYAA 4QLOA 4CM5A 5JDCA 1J9EA 3WYFA 2H9IA 1JEJA 4CT5A 1RPJA 1U3DA 5I7AA 3RS5A 4CCAA 1XJ0A 2CY0A 4MGEA 3ZLBA 4R1TA 2VC2B 3BIOA 3CT4A 3ZUGA 2ZWPA 1CJCA 5C80A 1NGSA 3SMQA 1NY5A 4UHEA 4D5EA 2N9UA 3BIJA 2V5UA 4EF6A 4F12A 1UC8A 5CNKA 4AD8A 4ZI2A 1M0EA 1KVSA 3VYSB 2WG1A 4CQMB 1II8A 1W34A 3WDSA 1FX0A 5HJ5A 3AF6A 5BORA 2G3YA 2JZCA 5MDHA 1V5GA 3F7NA 1EJ0A 1PGQA 3ELBA 3QBEA 4QLBA 5HIKA 4KGXA 4X54A 3MIIA 2C5AA 4X44A 4P35A 4DNOA 2O5CA 2CDNA 3F73A 4XLZA 2WB4A 1YJAA 1YQTA 2ACVA 4FR0A 1USKA 1RMQA 4M37A 1INLA 5KJFA 1KGSA 2PH5A 4CVNA 4Q3LA 3E0XA 3F8TA 3OQIA 2BP7B 3VPCA 3HN6A 3L82B 4OYYA 4BO2A 1SRRA 3F6PA 4GBGA 1T9HA 3BHIA 1N3IA 3U44B 2CNKA 5BPFA 2VPYA 3H04A 3SS8A 2YZKA 3IMEA 3KU1A 3EWNA 5B58T 3ZGLA 1RWNA 4IV0A 4ND8B 2IOFA 3CV3A 4K9QA 3QP9A 1SD2A 1U11A 1X3SA 1CG6A 1YI0A 2X0EA 4CZ2A 4ZCTA 5A5EA 1J42A 2HF2A 2C94A 3D7LA 1KDTA 3RKUA 1LPPA 4R69A 1O08A 4BJ3A 1MTOA 4POAA 4JUBA 3DHVA 4H4CA 1H0SA 3TUZC 4EHLA 5EHZA 2MYNA 2VPZA 3QELA 2XMPA 1P1JA 3TBKA 1OC4A 3GLHA 2H31A 3S2UA 1Z5ZA 1QAMA 4FINA 3Q72A 1LI7A 1YDMA 1GJRA 4LVUA 5TDHA 2XT9A 1E1MA 2PMBA 1C4KA 4OL9A 3WLPA 1YFLA 1ULHA 2UKDA 3MTDA 4IS3A 1NPTO 1FLAA 3BL6A 1FYEA 3DFZA 1HNNA 4P08A 4F04A 5DYTA 5MHTA 3AJAA 4W7HA 1X15A 5T4HA 2B36A 2G1JA 1IJEA 2V65A 2HUNA 4UW9A 3A1UA 3X2FA 4EW6A 1K5DA 1C9YA 2GSWA 1Q95A 3DMGA 3EG5A 3V2UA 2A0XA 4FNOA 5IJWA 1G0NA 1TIBA 1UWKA 2MSCB 3PPIA 4P3YA 1ECJA 2PKEA 5AJUA 2WDPA 3G0OA 1E1DA 2VSXA 4B5KA 4BBJA 1PS8A 2D0DA 1U7HA 1WSAA 4IGAA 3P9RA 1CV2A 2H2AA 2WY2D 4MW6A 4S3MA 5FWYA 1ZXBA 1XE3A 3KPJA 4YXWD 3LX4A 1E96A 5HIMA 5GVRA 4YVFA 3JD4A 1MB4A 3RBXA 3PSAA 2CNBA 2FWMX 1XL1A 3ZGNA 4CMKA 1A69A 4X1KB 4F8YA 3DMDA 5CT5A 5C53B 1U0BB 2R25B 2AN3A 2WLSA 4MS3B 1AB5A 1TAQA 2A0KA 2PPLA 2QD4A 3CUEF 4DG9A 3GVHA 2X9QA 1PD1A 4RPHA 2MT9A 3A25A 3LP5A 4DIUA 1EVYA 3ZEIA 2WM8A 4HXFB 2IUFA 1EK5A 1T3GA 4I0W