3H50A

Crystal structure of a tetracenomycin polyketide synthesis protein (tcmj) from xanthomonas campestris pv. campestris at 1.60 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
GMQYATLELNNAFKVLFSLRQVQAAEMVIAPGDREGGPDNRHRGADQWLFVVDGAGEAIVDGHTQALQAGSLIAIERGQAHEIRNTGDTPLKTVNFYHPPAYDAQGEPLPAGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with the binding of zinc acetate at the putative active site of XcTcmJ, a cupin from Xanthomonas campestris pv. campestris.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
molecule keywords Tetracenomycin polyketide synthesis protein
total genus 20
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h50A01
4I0BA 1EP0A 1RL3A 4Z82A 2XKOA 3CEWA 3LA3A 1H1IA 2IXLA 4IEWA 1QXRA 1OI6A 1WA4A 2XLAA 4FT8A 1NE4A 3E5XA 2XKPA 5I8SA 1J1LA 3S7IA 4DINB 5I8YA 1PM7A 3D0SA 2O1QA 3OF1A 1XE8A 4R52A 4XF3A 5FCCA 1ZVFA 2UY9A 4XF9A 2QDRA 5KHJA 4HVOA 3FX3A 2FQPA 3RYRA 4N9IA 5JAXA 2VQAA 3USSA 1ZZCA 4MV2A 3HT2A 4L2NA 1O7FA 2GC0A 4Q0SA 5KHKA 3S7EA 2PFWA 3FWEA 3G7DA 3EHKA 5I0RA 2B5HA 4Q0PA 3WW2A 3BCWA 5FPXA 3KSCA 4EV0A 1LKNA 2GH2A 4KU8A 1O3TA 4LEJA 3UKVA 4ZU4A 4PIXA 1DZTA 3BALA 4IEZA 1U12A 3GYDA 4LA2A 4MGYE 4IEPA 2BGCA 5JSPA 4QMAA 3WW4A 3H7YA 1RUOA 1ZNPA 1XE7A 1X8EA 5BPXA 3N4MA 1CAXB 1UPIA 5FPZA 2UYAA 2DCTA 3BB6A 1NZCA 2H6BA 4JTOA 4KL1A 3H3ZA 3ROUA 2P17A 3H1YA 4N9HA 4HSJA 2HJIA 5I0SA 3LOIA 1O5LA 4RD7A 2Z69A 1UD1A 4ZU7A 4YNIA 4HSLA 3R6SA 3SCHA 3BPZA 1EY2A 4MX3A 3O14A 3DV8A 4XF4A 2GU9A 2FMYA 3CL1A 2PAEA 2H0VA 4META 4BIFA 5J3UA 5JCTA 4WZCA 2PYTA 2EVXA 1O3RA 5F1RA 1JUHA 3EQEA 3KGZA 4HLTA 3WW3A 5EFUA 2OYZA 4AXOA 3D0JA 2OZ6A 1O3QA 5JR7B 5FLIA 4YSFA 5FDBA 4IEVA 3CLPA 4KWLA 4XEZA 4HBNA 3SHRA 4XFCA 3NSTA 5I8TA 3DN7A 3U11A 5I0TA 4E2GA 2GAUA 3E97A 3FZ3A 2WC2A 4KWJA 1ZRRA 4Q0QA 4PJYA 3RYKA 2PAKA 2WFPA 2ZCWA 3CJXA 4X6QB 4I02A 5AVPA 1CX4A 3DKWA 1CAXA 2MPFA 1OFNA 4MGIE 2CGPA 1RGSA 2XLGA 2IXCA 4J1XA 3HT1A 3LAGA 3NW4A 3H50A 5KBFA 1SEFA 3C3VA 2PHLA 4K8FA 5EZWA 1X8MA 4I09A 3UKTA 1RC6A 3MZHA 1EPZA 1SFNA 2IXKA 4PIYA 2BYVE 1ZX5A 4MH0E 4O9GA 3ST7A 1CAVB 1ZREA 4LUMA 3IWZA 5BUVA 4NVPA 1I6XA 3ELNA 3D82A 3L2HA 4EWAA 1ZZ7A 3WW1A 2F4PA 2D40A 3H1MA 5LRSA 3DL3A 1UCXA 4LUKA 3MDPA 3EO6A 3FE5A 2CAVA 3CO2A 3UKNA 3I54A 4GULA 2Q1ZB 4Z07A 3FFQA 4F7ZA 2B8MA 4XETA 3S0MA 1OMIA 4Q0UA 1LR5A 4ZU5A 2XHKA 4AVBA 1CAVA 4XFGA 2IXJA 3I59A 1ZZBA 1CAUA 3ZDSA 3NVCA 1O4TA 2QVSB 1WLTA 3CF6E 3HIFA 5BV6A 5CADA 1J3PA 1L3JA 2CAUA 1TQ5A 4FAHA 4HVQA 4ORFA 4I0AA 4KU7A 2ET1A 3JZVA 4HMZA 1Q3EA 4EWDA 3OCPA 5BXXA 4PIZA 3RPQA 3MYXA 2Y0OA 3NL1A 2C0ZA 4I01A 3E5QA 5FLJA 1Y3TA 3RZZA 1SQ4A 2ATFA 2EA7A 2UY8A 1NXMA 1HW5A 2GZWA 3FJSA 4E2QA 4D7TA 3QOPA 2I45A 4MZUA 1PMIA 3U0ZA 4Q29A 3ACLA 5KHHA 4XFHA 4HN0A 4IEYA 2HKXA 3ES4A 4EROA 4EWEA 5J7MA 3E6CC 3PNAA 1YFXA 4F8AA 1VP6A 3KMHA 4LLOA 2OPKA 1UW8A 3HQXA 2BEOA 2VECA 4BYYA 2K0GA 5E16A 4ONUA 2GC2A 3BU7A 4XFIA 1YFWA 2XL7A 3H3UA 1RTVA 1YUDA 1DGWA 1WGPA 3IDBB 2ETEA 1ZZ8A 4O9EA 5JSOA 4IETA 1VR3A 1YLLA 3IDCB 4YYOA 4IEXA 3H9AA 4UXAA 1CGPA 2BNNA 5E1RA 5LRRA 2MHFA 4OFGA 3I7DA 5D1IA 3SCFA 1X82A 3MPBA 1O3SA 1FI2A 3KGLA 4LULA 3OGJA 5HI0A 1ZZ6A 1J59A 1O5UA 3VHRA 4IEOA 3U10A 4QXKA 5C6CA 5T3NA 5I91A 4IERA 4YRDA 5FQ0A 2Q4SA 3RDIA 4Q0VA 1OD5A 4QGMA 2GC3A 4JTNA 1Q5OA 3LWCA 1ZRDA 3H1WA 2E9QA 4IESA 4MUVA 5I0UA 1RUNA 2VPVA 1ZZ9A 3PVBB 2MNGA 3KCCA 1YFYA 2QJVA 5CU1A 4HZFA 3EBRA 3LZZA 2UYBA 2IXHA 1NYWA 5BY5A 4WVZA 4H7LA 1FT9A 2GC1A 4J1WA 2BNMA 2V09A 1H1MA 1IPKA 5LEJA 4D7SA 4YARA 2QCSB 2XGXA 1CAWB 1Y9QA 4KWKA 4QX5A 2IXIA 2D93A 4XFFA 4A2UA 4CYDA 5JSRA 5FLHA 4WBBA 1QWRA 1QXJA 4R8HA 1UIKA 3SMHA 1GQGA 4B29A 3QACA 4QM9A 2PQQA 4I3PA 4E2SA 3IBMA 5J48A 3OD0A 2XL9A 2OZJA 2N7GA 3H7JA 4I2OA 2PTMA 1IPJA 4MGZE 4UBGA 4XFBA 4OLLA 3RNSA 4XFAA 3E6DA 4HVRA 1J58A 1ZRCA 1YHFA 4HN1A 1NE6A 3E6BA 1FXZA 4LTAA 3RYPA 2PA7A 4IEUA 3SCGA 2PAMA 3NKTA 4AQ2A 1VJ2A 4TLFA 3ES1A 1LB2A 1I5ZA 2D5FA 1ZRFA 4L11A 4BHPA 1V70A 3SXWA 5KHIA 5C8WA 5LEKA 2KXLA 2PHDA 1QY4A 2CV6A 3M3IA 4X6RB 2Q30A 3OTFA 4IEQA 3E5UA 1LRHA 4AQ6A 5CVRA 4BH9A 2EAAA 2H6CA 2O8QA 4MGKE 3B02A 3EJKA 3FHIB 5K8SA 4AVCA 4FAGA 4AVAA 3H8UA 1G6NA 1UIJA 5FQ0B 2D5HA 1YWKA 1DZRA 2Q0AA 3LA7A 1CAWA 2BNOA 4QM8A 4XF0A 2Z2SB 2K9ZA 2ZKLA 1Q43A 3TNPB 4JV4A 3PLQA 1X7NA 5I93A 2IC1A 4P9GA 2ET7A 2B9UA 1GQHA 1J3RA 1EYBA 2QNKA 1DGRA 1J3QA 3NJZA 4FBFA 1YFUA 3IIAA 2OA2A 4QGNA 4XF1A 3I59B 3TNQA 5KHGA 3LA2A 4LA3A 3ETQA 3GBFA 1XRUA 3M70A 4UBHA 2XLFA 4QGLA 4JVAA 1CAUB
chains in the Genus database with same CATH superfamily
4I0BA 3VL8A 1EP0A 1RL3A 2RR11 3MF6A 4XJZA 5FP9A 3CEWA 2BZDA 1JZ8A 2IZWA 1ALYA 4DEQA 4K20A 4P9XA 4ITCA 3M3EA 1WA4A 4OI0A 1GOFA 4FPGA 2D7FA 3ZFGC 4FT8A 2I2SA 2BBAA 3D5OA 2VY0A 1BBT2 1NAEA 1HQWA 4ISRA 4WZFA 1IS4A 4A44A 2JDMA 2W5FA 4YVSA 3JBG2 4Q27A 3D0SA 2FCTA 2WQZC 3P3NA 5IVEA 1ULGA 2J1EA 2O1QA 3OF1A 4R52A 3VB9A 2UWCA 1PK6B 4XE9A 4A6OA 1V6JA 4JDMA 5G05L 2P1BA 1RJ7A 1SPPB 1XC6A 3ILNA 4XF9A 4COWA 3OEBA 5FOJB 3IDAA 4A42A 1AYN3 2FQPA 5FWEA 1U5ZA 1C8NA 5GM0A 1FMD2 3B9IA 4E27A 4BU2A 4BQ5A 2WNUB 4NR1A 3WXPA 4XXPA 2GC0A 3H42B 3KHCA 3ON7A 4QPYA 4ISQA 4N7IA 1XNDA 1SDWA 5LY2A 4AGVA 5BYNA 4YZ4A 5APAA 3RFRA 3VL9A 2J1SA 2GNBA 3QH6A 3S7EA 3VV1A 3MIHA 3X29B 3ZLIA 4CCKA 4FPEA 2WBKA 5JXGA 3AYCA 2J1UA 3ACGA 1JN2P 3EHKA 1GP4A 4UW6A 1A78A 5CKQA 1VBE3 3GXUA 1OKQA 5DUXA 1GNZA 2ERFA 3CKHA 5FPXA 3RGBA 1YNAA 2JE8A 4IUGA 4QQOA 5FXWA 5CBLA 4LHSA 1LKNA 1AJKA 3L9JT 1PIV3 1REEA 1PZ7A 2A3YA 4KU8A 3AVSA 1O3TA 4LEJA 3UKVA 1NA1B 5A7OA 1W2UA 1OF4A 5CEHA 3UNPA 1OPMA 2Y60A 2RE9A 4YG0A 1FPN1 4MGYE 5LW9A 1N47A 1RJ8A 1SLTA 2WRAA 3H7YA 4RS5C 1H9PA 3NRUA 5CISA 5GZCA 4OUMA 2JD9A 1DBNA 1ZNPA 3VBRB 4C0BA 4PF1A 1X8EA 1T6GC 2NPIA 4JGYB 4CCDA 5C5UA 3K4AA 1LODA 5IAXA 3QH7A 4Y4YA 1VPHA 1CAXB 2E31A 1UPIA 1QMJA 4L9BA 3HD8B 4YW6A 5J1XA 4WM8A 1ND2C 2TEPA 4XACA 3TOJA 4UFHA 2RM23 1NZCA 4FTSA 4KL1A 1WWYA 2P17A 2NQYA 4LKDA 4Q4Y1 3NNLA 3J9SA 3ZFGB 3H1YA 3POGA 3UJQA 1TNRA 1UZWA 2EXJA 3VZJA 4XYXA 3ZXDA 3J8F2 1WCDJ 5A7SA 1CZSA 1K12A 3C8XA 2VMEA 4HSLA 4YNIA 3R6SA 3WOGA 4BQ2A 1EY2A 2TBVA 1ODNA 3FHQA 5FY4A 3AL5A 4AHXA 5BNNB 5GZEA 1OOPB 4GXLA 4Y20A 4UFKA 4B7KA 2H0VA 2HWE3 5IAVA 5L7OC 4XIKA 1WLCA 5FY5A 4IDZA 4N43C 1DIWA 3ACFA 5HV0A 4UFIA 1R091 4B8EA 2W94A 1O3RA 4QKFA 4AI2A 1JUHA 1ULDA 5FZEA 1AR73 3EQEA 3NMBA 3PTYA 4H7MA 1ASJ1 2OKXA 2DDUA 1QQP2 2JEMA 4O61A 5EFUA 2OYZA 1IOAA 2BV4A 3D0JA 4CP0A 1HB3A 1W3VA 2OZ6A 3K3NA 1ZBE2 2R063 3OUIA 1O3QA 4YGCA 5JUVA 5JR7B 2HWF1 2YZ4A 1OUXA 3T0AA 1NX9A 4MO3M 1TG7A 4FPHA 2D43A 2LALA 3AK0A 4KWLA 4FP3A 2OXBA 3AL6A 4CU8A 3NSTA 5I8TA 1BKZA 4P14A 3CJIC 3VBOA 2DUQA 2JG8B 2BPA2 4E2GA 1C5HA 1JHJA 5LBEA 2WAOA 4GMP1 4KWJA 4QKBA 5F39A 5IJRA 3D4KA 3T1LA 2R32A 2PAKA 2WFPA 1J1TA 2GMEA 1BVP1 2ZEXA 2EIBA 3AP4A 3GBWA 4Y33A 1UZ0A 5FREA 1HQNA 3I2KA 4I02A 5AVPA 3WD5A 2XJUA 5JXIA 1OA3A 3KHBA 3VBFB 1DYOA 4Y1YA 3H8XA 4MGIE 4LOSA 1AR82 4QB2A 1ZBA2 3BTAA 3UGHA 2QZ2A 2WR9A 1HQLA 2D6PA 2Y33A 2CGPA 1TE1B 4LE3A 3LDRA 3C7GA 2RS11 3HR9A 4J1XA 4JCKA 2ZGUA 3HT1A 1VIWB 3OBRA 3H50A 2QFEA 5D2AA 5FXVA 3THDA 5KBFA 1POV0 2E33A 2AEYA 1QJEA 3LB9A 4LBOA 3KVAA 3DF0A 5LWBA 2FCVA 1GWKA 3PIGA 2J7MA 2V5DA 3BODA 2VOTA 3VBHB 3MIEA 3ST7A 4AQSA 3PUIA 1RUI3 3ZVXA 4Y1VA 3IWZA 1PO11 1MVEA 3AP6A 1H6XA 1L7LA 3L2HA 1JZ5A 4MADA 4LBLA 2RMU3 4CDXA 1ZZ7A 2CNAA 2HEVF 3MFAA 3WW1A 4YW5A 1W6OB 2W91A 5FZOB 2R072 3MDPA 1H2NA 3EO6A 5T54A 2CAVA 2QE3A 5IVJA 2OW4A 4R4ZA 1YJLA 3I54A 2CY6A 3LPGA 2ZMNA 3IAPA 1VBB1 1LAJA 3FFQA 2WN2A 5JZGB 3LQCA 2ORXA 2WJSA 4FPLA 1OMIA 2YYOA 5EYYA 1DQ5A 2WZEA 4G3YC 2P3YA 3PJQA 3VHOA 2GMPA 2BGPA 3CU7A 3OSDA 1CAVA 3PJYA 2IXJA 4P9WA 5C71A 1TZOA 1CAUA 3NNFA 3DEMA 3NVCA 4KQ7A 1SHWB 4OHXA 2WNVB 2VW2A 3WINE 3S57A 3BTYA 2AR6A 1HRI2 1L3JA 3RI9A 1TQ5A 2PELA 4W50A 5C4WB 2VQTA 4AK3A 3R4UA 1LGBA 1BCXA 1VBA1 1IPSA 2VL4A 3ACHA 1PO21 4QX3A 3RJ2X 1PVC2 1PZ9A 1QJZA 3OBAA 4IW3A 1WZXA 3I2JA 4H14A 2Y0OA 4RR3C 4RR3A 1SBFA 4I01A 3E5QA 4QAWA 5FLJA 3POEA 1VBC2 4YM2A 1N1VA 1GSLA 1GANA 1SQ4A 2EA7A 4OZOA 4QB1A 4YW3A 5KXCA 2R16A 4Q4W1 5FZBA 1NCRA 5BNOC 1NXMA 4AAXA 1HW5A 2RR12 3OUHA 3WP4A 1JOBA 3FJSA 3JD71 4YZ2A 5JOZA 2WWUA 4MZUA 5B4XA 2O14A 4M3CE 5IK8A 2DCYA 2KA3A 4LQRA 1VAKA 1WMFA 1C8M2 1QU0A 4G9SB 4XFHA 1RVF1 1F35A 4IEYA 4XABA 1SFYA 2HKXA 3MLLA 1PK6A 3ZFFC 1WCUA 3ZKUA 3JUUA 4JGZA 4CEYB 4RHV2 3LEGA 2E7QA 3VD7A 4F8AA 3UL2A 3KMHA 3PIJA 2OPKA 3HEIA 4UFLA 2VBPA 4RQPB 4IGOA 4B4QA 3VDDB 4H55A 4A3ZA 3IMMA 2XOMA 5JXHA 3ZYJB 3THPA 5DG1A 5FXXA 5CIRA 2YPJA 4QXHA 4QHBA 2VXJA 3BU7A 3NJYA 4L92A 4AI0A 5KXEA 2Y6FA 2ZPXA 4SBVA 2KM2A 5LZ6A 3HBKA 4DIQA 1YUDA 4UYBA 1DHKB 5DMYA 4OHWA 1ZZ8A 2XBO2 5FO8B 4IETA 5H9PA 3IDCB 3FLRA 1LTEA 3JCIA 4FI9A 4PBPA 4MYEA 4UOJA 5FZHA 3WCSA 1IS6A 4ZZ8A 5K0UC 1CPMA 1G9AA 2TUNA 4OHZA 4A7KA 3LD8A 2HWF2 3L2YA 2NLRA 3OUJA 4OYUA 3VD5A 2P34A 3I7DA 5FIXA 1W6PA 4NHMA 1QJU2 4JQTA 1X82A 1UWWA 5FWJA 1RB8G 5T55A 4D7YA 1Z7S2 2BWAA 5A32B 4XBLA 3TN92 3OGJA 4WM8B 1ZZ6A 3AX4A 4UFMA 4YLZA 3ZMNA 4OUSA 4C1XA 3WT3A 3PU3A 1W28A 1PGL1 2VQ0A 1X50A 2CHHA 1G8WA 5T3NA 5I91A 1A34A 1MS4A 1Y9GA 3CBNA 1JUIA 4YG6A 4YRDA 2ZACA 3B69A 2WWSA 2Q4SA 2E7AA 2WSVA 3B93A 4DFSA 3T0DA 3PMSA 3LFIA 1AYN1 1S4CA 1CVNA 4YFWA 5FZ3A 5FYSA 4ATEA 4FPOB 4IESA 4AAPA 2VJXA 1OVPA 5IWFA 1XB9A 1YJKA 3KT4A 3T3YA 1BEV1 3OB8A 4OHYA 1W8ZA 2ZGMA 3KCCA 3ZYRA 2VZUA 1K3IA 1C1LA 1RUJ1 3KT1A 3WG3A 2R6QA 2QQOA 4Y5Z0 3I2FA 3SQOA 1EV12 3OPTA 5ACA2 4KI5M 1PVXA 3EBRA 5EXOA 3LZZA 1RUC3 1OA2A 1FOD1 1WMDA 2D3SA 2IXHA 3HN1A 4LK7A 5FYUA 2DVAA 4BJ0A 1FT9A 2VXRA 4J1WA 2DWRA 2EIDA 3HPNA 1H1MA 5CKMA 1RXGA 2WA3A 1IPKA 4Y20B 1ENQA 3SH4A 2Y6LA 5FMDA 1D4VB 1ODMA 1DDLA 2E6VA 4BK4A 4CEYC 2J1TA 1Y9QA 3O12A 3HWJA 4XFFA 2VTXA 1DF0A 5F2SA 1FPN3 1QXJA 4QKDA 4R8HA 1NLRA 1W8WA 4W65A 5KWRA 1GQGA 4B29A 4XUQA 1T2XA 4C8DA 3N9NA 5JPMB 5L7OB 4A45A 2QDNA 1LHWA 2JXAA 4Y22A 3BN6A 5JDBA 3LGRA 3OD0A 3BU0A 3OG2A 5FPBA 2N7GA 4I2OA 2W46A 3V65A 4CCMA 4WM7A 3WEZA 4MGZE 2ZAHA 4CPBD 4CU6A 3GZTB 1JYNA 2E32A 2C9KA 3KV4A 3MIFA 2ZBJA 3RNSA 1AX1A 4GA9A 4LITA 4LXLA 2LM3A 4HVRA 2P2KA 1W6MA 3CQOA 1YHFA 3PUHA 5DZGA 3ZXLA 5IT6A 5CG9A 2CWSA 4HN1A 4JDOA 2YY1A 2IFRA 1NE6A 3OOXA 4LTAA 3NAPB 1GYKA 4QXCA 3RYPA 5JR2A 1XNBA 4XILA 5SV5A 3O1SA 5C3QA 5FZMA 4YGDA 1YQ6A 4DUVA 1AYM1 4TLFA 3ZFEA 2WZR2 1RIRA 5C9AC 2HH9A 1LB2A 3R4DB 4MXVA 3KQ4B 3U37A 2W52A 1YQCA 2XJQA 4OULA 4HPKB 3WNXA 5K9YA 1GOHA 2P6HA 4P5HA 3I2IA 4K1ZA 1MS8A 4BHPA 3POBA 3SXWA 2ZGLA 1YIFA 2D97A 3O1UA 1QY4A 2XDVA 1W8TA 2XQRA 2X29A 2Q30A 3OTFA 4XUTA 1PGL2 1RMU2 2WAAA 1VALA 5DAVA 4YZ3A 4RYDA 5FRAA 5FZIA 4CP2A 4P08A 2V73A 1UO9A 5CVRA 4DO0A 1KRIA 1OLME 4JZRA 1CZVA 1ND3A 4BIOA 5GLUA 3SH5A 1WCKA 4Y22B 3B02A 3B00A 1C28A 5FJKA 1I3HA 1BMV1 3HVDA 5LBCA 4D69A 3FHIB 2WNVA 5L73A 2P3KA 3GJBA 1QIQA 5LA9A 2HWF3 1D4M1 4BMBA 2AGSA 4AVCA 5FZ0A 3H8UA 3VHPA 3VZLA 3WHTA 4PCRA 4P5YA 1UIJA 1CIWA 2JDNA 1VRH3 1LHNA 5FUIA 5LK7B 1CAWA 3OD4A 4XF0A 1JTZX 2Z2SB 3WF3A 4J6GA 1QH7A 4IE5A 1KDMA 4LBMA 4BQWA 1RUD1 5JOWA 1ZYBA 3ZX7A 3TNPB 2VTXJ 2C4XA 2CTVA 1C3HA 3PLQA 4GB32 2DVFA 3LF7A 4XTPA 4H3WA 4U2AA 4XJWA 5EQUA 1XNCA 5FK8A 4K3UA 5FY0A 3KS7A 4J25A 1GQHA 5DG2A 2TNFA 1PHMA 1DGRA 1J3QA 1N1TA 3NJZA 1GBGA 1W2NA 5CAZA 1OOPA 2RDSA 3AMQA 3A7QA 2A5ZA 3LCPA 2VQUA 2EF6A 5C4WA 3ZXFA 4HPKA 1XSQA 3I59B 3TNQA 1H9WA 3WX5A 3ETQA 4Z2AA 4CP9B 1XRUA 1OHFA 1SLBA 5L36A 3VBUC 3WSOA 1LEMA 4UBHA 5A3UA 1ND3C 4M3CF 4XQ4A 4QX1A 2RR13 4RR3B 2W1QA 2XKOA 3JQWA 4M01A 4CUGA 4AEKA 2J1VA 3R05A 1H1IA 2IXLA 1B09A 1NG0A 1W6QB 1O4ZA 5FPVA 1W8HA 1A8DA 1QXRA 2MEV1 4LO5B 3RRDA 2XLAA 4UFJA 3NV4A 4LBKA 5KC5A 2D6OX 4PI0A 3GZAA 5GJ6A 1B35C 3J7MA 3VDAA 4E8DA 4P9LA 2W39A 1Z7S3 3S5QA 3B9CA 1CONA 2NN8A 1S0DA 1W06A 2VCBA 3IIIA 4PF5A 4Y4RA 3S7IA 5A3PA 5I8YA 1H2KA 1V6LA 5I0DA 3C7EA 5F5CA 4MGSA 1NY72 1YQ5A 2VZRA 5JI7A 4AFBA 4DY3A 1MQTC 2UY9A 2JENA 4HT1T 5FP8A 3FX3A 3T1MA 1MS1A 5FJHA 3USSA 4MV2A 3TWIA 3T0BA 4NN0A 4F83A 1ULOA 5LBFA 4Q2FA 1FOD2 2RS12 3HN3A 1PMHX 4GJZA 1B35B 4Q4V1 3SEEA 1GUIA 4O7XA 4HKLA 2VW0A 4EYUA 3V0BB 2OX0A 1JYTA 1LCLA 3FWEA 4UW4A 3S6PA 1KFUL 1NCQA 1RINA 1VBB2 3V64A 4UAPA 4Q0PA 1VBE1 1V6OA 4Q4X2 3WW2A 4NIGA 1UY3A 1GQPA 3VBFA 4IV1B 3G6JB 1V00A 3GHNA 4HONA 2RJ2A 5DAXA 3KM5A 2A6WA 5C70A 3BI3A 2A6XA 1KD7A 4CDWB 1PIV1 4EV0A 4NHYA 1RUF1 3CIHA 1ND2B 3A4UA 3DYOA 3LEKA 1LULA 2VTFA 4JQRA 4BMEA 4PLNA 4V2WA 1OBNA 2XBO3 1TMF2 3B94A 1H4GA 4IEZA 4LBNA 4WVMB 5FP4A 3FMGA 3N9QA 1HJGA 1QOOA 2Z42A 3KZ4C 2XJRA 4IEPA 4CP9A 3M3OA 4Y5TA 4JHTA 3HQUA 3ZKYA 1RUOA 1LEDA 3MIDA 1LOAA 4JC1A 2RV9A 3WP5A 1XE7A 2YPDA 3AKPA 1RVF3 3POSA 2GSYA 3FN9A 3O1TA 3W58A 5SV8A 2YB7A 2DCTA 3BB6A 2RMU2 1V0AA 3ZPYA 2DBIA 2H6BA 1HRI3 4JTOA 4QQ2A 5LB6A 1R092 5C5TA 4JHZA 1JHNA 3WUDA 4XQWA 3VZOA 1UMHA 1LESA 1LNSA 3WNMA 1YRZA 5I0SA 1E5IA 1K45A 3LOIA 1VMJA 5FYHA 4EN9B 4GD4A 5JPNB 1O5LA 1WCSA 4RD7A 4AEDA 3OPZA 2P4EA 4ZU7A 5JIAA 4QPIB 4KG8A 5FKCA 1XSRA 2P3JA 3TBDA 1UXZA 2D6NA 2WDBA 3WR0A 5EP9A 1VMFA 3NV2A 3O14A 2OUHA 1HRV1 3ALQA 4HFSA 2GU9A 5FYIA 2PAEA 3VZMA 2QKDA 5J3UA 1JOPA 3BYWA 1W8OA 1GNYA 1OVSA 1PGW2 1GMMA 2PYTA 2EVXA 4FO9A 2W3JA 3MLJA 2V72A 3K48A 5F1RA 4AE2A 3UJOA 3H3LA 3WW3A 4PDWB 5L9RA 4AF9A 2HWD3 4BA6A 2GNTA 2FCUA 2DBNA 2CDPA 3AMMA 3PDQA 3RWNA 1TME1 2R1BA 4CCLA 3B01A 3P5BA 1QF3A 2DFCA 1POV1 5FDBA 4JKLA 4XEZA 1F9KA 1DZQA 3WP6A 4BDVB 4AVVA 4BQ4A 5A3NA 3DN7A 3U11A 2Y34A 3AYEA 4LOTA 1VBC3 4OMDA 2YUEA 2AZ5A 3MW4A 4PI2A 1X9TA 5F2WA 3VBOB 4HXCA 2FDGA 1R1A3 3ZFGA 3AM2A 4NIIA 3E97A 3FZ3A 3WF1A 1PVC1 4OUEA 3UGGA 4KNCA 1ND3B 4IGQA 1UYPA 3D6EA 5F5QA 2BP6A 1GOGA 2RS32 1SBEA 1CX4A 1KITA 1CAXA 3ZYBA 2MPFA 5C3OA 2X5IA 3PHMA 1KFXL 3WLUA 4DQAA 3I2HA 3I3BA 4GKYA 3KT7A 3AJYA 2JKXA 1G9CA 3TEYA 1CESA 1RUC1 4D6SA 3S5AA 1R1A2 2Q8DA 1FOD3 2XLGA 4CDWA 3LDBA 1NCQC 4KH9A 2ZHLA 3WNPA 4XPVA 3B7MA 2Y6HA 4NROA 2ZX2A 1C8M1 3WQ7A 2B46X 2QQJA 4CDQC 4NAOA 2DVGA 3APBA 5EZWA 4P9JA 2OQ6A 4FPCA 3UKTA 2WT1A 5IFPA 3MZHA 1MACA 1SFNA 4NJ4A 2BYVE 4AWDA 1W39A 1UYYA 3POYA 2EXIA 3OY8B 4MH0E 4O9GA 5DDJ3 2ZX0A 3M3QA 4QPIA 5GLTA 4EZ4A 3OGVA 1H8TC 1CZTA 2CDOA 1ZA4A 2DV9A 3NNJA 2WWJA 1POQA 3VD3A 1W9TA 1OURA 4ASMB 1SFPA 4C1WA 1DYKA 2D40A 3H1MA 2RS51 5ERLA 2YHJA 4ZXKA 3RJRA 3FE5A 3K46A 2DTWA 3UK9A 4FTBA 1PO12 2HWD2 2J1RA 4NWVA 4Z07A 3N9PA 4QX0A 2VGDA 3ATGA 4LKEA 1F5JA 4BK5A 5CA6A 1RUE3 2R0HA 4Q0UA 1SZBA 4AI8A 2E26A 5JOYA 4ZU5A 2XHKA 5FMOL 5FZAA 1AHSA 4QDRA 3I59A 3BGAA 1ZZBA 2UURA 1JZ6A 4GH4C 4CXYA 1VMHA 4LMFA 5JZGA 2V5YA 4LNVA 4PT6A 3MIGA 4WVWA 4YVSB 2YU2A 5CADA 1OLRA 3K4DA 1W6NB 4NIDA 5LK5A 2CAUA 4HVQA 4CCEA 3N3HA 4I0AA 3NQHA 4B3NA 3JZVA 4DB5A 1Q3EA 4URAA 2J22A 4Z2WA 2RS52 2BTVC 1W04A 4HK9A 2A73B 2ZGTA 1ZM1A 2VR4A 1UYZA 5JZGC 3ZSLA 1WD3A 1FATA 2AUYA 4A41A 4YPJA 2VBDA 5FMCA 1Y3TA 3RZZA 5C3PA 5FMBA 2ATFA 2P5BA 5F6LB 4W6YA 1S2KA 1GFF2 2RDRA 5IFTA 3LIGA 2F17A 3AMNA 4IXLA 2WNUA 4LHNA 5A33B 4FFIA 1HN1A 4IE7A 5T5LA 1JZ7A 1J84A 5A7WA 3VBOC 1TMF3 4ASKA 4AI9A 1PMIA 3LSDA 2BFUL 1BYHA 1TNFA 3P3PA 1LJ7A 4JDNA 2NMOA 4EROA 5F7UA 1OQDA 1QQP1 3DPRB 4ARYA 3BIEA 2YC0A 3GCXA 3PTRB 4A4AA 3ORJA 1YFXA 2ILMA 1AR81 1VP6A 4CDQB 1UW8A 4Q4X3 3Q8EA 3Q8AA 3I2GA 2JECA 2VH9A 4RQPA 3RWKX 1X9PA 3HQXA 4CE8A 2X05A 5CFCB 1NCQB 3KV5A 4IL7A 1XU2A 4LO4B 2K0GA 1IKQA 4PDWC 3U78A 3POWA 3ZFEB 2XVGA 2PHUA 3MICA 3NKGA 4K7JA 5CFDB 1AXYA 1MEC3 4JGYA 2XR4A 1UU4A 4RGGA 2YDEA 3QD6A 3H3UA 2RDNA 1H2LA 2WO7A 4XMAA 1NQJA 3MIBA 1QH6A 4NRMA 5BNNC 4CDWC 4FFHA 2W87A 4DRRA 4FPFA 4QHOA 5FYZA 4TLGA 3RI8A 3B3QE 5JSOA 4MOAA 3MV11 4OVEA 1VR3A 1YLLA 3MBWA 2BGOA 4GIQA 1LOBA 4AHWA 1WW5A 2X5IC 4UXAA 4Z92B 3N7MA 1UU5A 2KD7A 4YW1A 1EAH1 5E1RA 3GALA 5C8CB 1UZYA 1ZBE1 2WSUA 1WMEA 1COV3 2WZ8A 4XUOA 5CFDC 3SCFA 2GMMA 4IE0A 2K2SA 1O3SA 2VBBA 1FV2A 4EJRA 1KJLA 3N7JA 4CP1A 5HI0A 1ULFA 2QZ3A 4EZHA 1JS9A 1QJX2 1LU1A 2WFF2 5IVYA 2XB6C 1XXNA 2GALA 5A70A 5FOBB 1Q56A 3C7HA 3GZUC 3N9LA 1N3PA 1UY2A 2XH6A 3VBSB 2UWBA 1RUF2 3RDIA 4Z8BA 4Q0VA 1GP5A 1OD5A 5FP3A 2GC3A 4JTNA 3T08A 4N90A 3LWCA 1ZRDA 1YO8A 3H1WA 3J8F1 5A7QA 5TSWA 5B2GB 5L9VA 1WLWA 1RUG1 2YGLA 4HANA 1VBE2 3MHZA 4TN7A 4K6BA 4AFCA 1VB2A 3PVBB 2PLV2 2AH2A 2ZA9A 3R0RA 4Q8LA 3N9OA 1NLQA 4DOUA 2FBEA 4IV1C 1W6PB 4Q5OA 5CU1A 4XCBA 3N7KA 4N43A 1H8TB 4EE2A 3I4IA 4LR4A 1SLAA 3ZDVA 3ZXGA 4JAAA 3GGLA 3IB3A 2XONA 3N36A 4GALA 2JG9C 3PUQA 1DGLA 1EUTA 1HXS1 4GB33 4TTGA 1JMUB 1H0BA 3KQRA 4YWAA 2R49A 2GC1A 1AL22 2BNMA 3GZEA 4GJYA 5JIUA 4QX2A 4AEDC 3MUY1 2YMZA 2VMCA 4YARA 1QJFA 1RUF3 2QCSB 3AMPA 4CXWA 1WUVA 2Y38A 4KWKA 3B5LB 2GN7A 4R9DA 4A2UA 5JSRA 5JWPA 3ILRA 3AJZA 5FLHA 2RDQA 2AREA 1SPPA 4YM3A 1BVVA 2BBVA 1GU3A 1W0PA 4LIUA 3SMHA 4LIVA 1JOJA 3N9MA 3U14A 1PK6C 5HXMA 4ZZ5A 5AC91 2GP3A 2D44A 1AX0A 2VE1A 3SC7X 3IBMA 3I3DA 2A3XA 3H7JA 2WINB 1C5IA 1IKPA 1K5MA 5E88A 1HJFA 5LA2A 4XFBA 4DPNA 3ZR6A 5FZ1A 3ZYFA 4NPRA 2Q8CA 1GR3A 2DURA 5J09A 1PNFA 1J58A 4RFT0 1UX6A 1OT5A 3EMRA 1FMD1 1SDDB 2PA7A 2HWC1 1GV9A 2JKBA 1M06G 1AYN2 2VOWA 2D5FA 3LEIA 1PX4A 1ZRFA 1NQDA 3ILFA 1NY71 2WNUC 4FXKB 4YM0A 3TAYA 4L11A 5KHIA 3JBG1 5C8WA 4E9KA 4SLIA 3M3IA 1V9U2 4AFMA 1BBT1 3E5UA 2D3PA 2DCZA 1UY0A 3Q8FA 2WL1A 1LECA 3WUCA 5M0TA 3H0OA 2DFBA 4C90A 2R30A 4D8MA 4TXWA 2R0FA 3T4VA 2RJKA 3BOWA 1UOBA 3F95A 3IKWA 1JW6A 3ACIA 4AVAA 5A3LA 1G6NA 2W92A 4YZ5A 3JU9A 4QX7A 5FQ0B 3ZFFA 2D5HA 4D0QA 1D4M2 3ECQA 5CYYA 1YWKA 2BU9A 2HWB3 3AKSA 1BMV2 1JU4A 4QM8A 4R9BA 2ADDA 1VBC1 3KWVA 1RUH3 4COUA 1CJDA 3EB7A 5DXDA 2RHPA 1Q43A 1KDKA 3KCXA 3T4HB 1VBD3 2RG4A 2GNMA 5EJ3A 3ZIWA 1V9U3 1X7NA 3GNEA 4N8MA 4MHUA 3WQ1A 4N53B 3LE0A 1J3RA 1AXKA 4FTEA 4AZZA 3HNBM 4B1LA 5HCAA 3J7HA 3GM8A 5LA1A 3IIAA 4Q4Y3 1RUD2 2OIIA 5H9QA 2A1XA 4QGNA 2QQVA 1QHDA 4OHVA 1DGRN 3ZSMA 2FDFA 1R083 2A6YA 1MZ5A 3O0VA 4XJ9A 3RZHA 4NPMA 5F9TA 1JH5A 1YIPA 1OOPC 2ARBA 2E53A 3ZSKA 3MFCA 5JLVA 1JZ3A 2XLFA 2NMNA 1UU6A 3KLSA 1YYNA 2DVBA 5ABJC 3O1VA 4Z82A 3UESA 5CFCA 1AR61 4U36A 4IEWA 3ITQA 3AP9A 4E4HA 1OI6A 4M3CB 1K5JA 3AP5A 4L97A 3AP7A 3O1RA 3GCWA 1NE4A 4XVHA 1U5YA 1BLZA 3E5XA 3BOPA 1H4HA 1D7PM 1ENXA 1RMU1 1WCQA 2VMFA 2XKPA 3CJIA 3J7NA 3NWKA 4ZONA 5I8SA 2NP0A 1VBA2 2NM1A 5FZKA 2LROA 4RSUA 1COV2 2AC1A 3DYPA 4NWWA 1HV1A 2PLV3 2R061 4CCOA 5FYBA 2C1FA 1NXD1 2BFUS 4CDXC 5FCCA 1ZVFA 1O59A 2VNRA 2J1AA 1YCIA 1MS9A 3MUZ1 3W21A 3RYRA 1WMXA 4IV3A 4N9IA 2VQAA 4DUWA 4UT5A 1YQ8A 3VBHA 1ZZCA 4D94A 5JAXA 2WYSA 3HT2A 5EIYB 5FPLA 1HXS2 3WNOA 1HN0A 2VOKA 2VZ3A 2VZVA 3AXDA 4LBQD 4ZXEA 1RUC2 3IPVA 2ES3A 1E5SA 1Z0HA 1DQ1A 5T5PA 3U1XA 3G7DA 1Q8VA 5GKAC 5I0RA 3W5NA 5A1FA 3V0AA 1OKOA 4OCTA 1OUSA 3WDVA 3W59A 4FFGA 4CDUA 1VAVA 3U4XA 5AC92 3I3EA 1R64A 1IHMA 3AZVA 3BCWA 1QOSA 5C8CA 2VMHA 5AFEA 2Q8EA 3ABZA 2QQIA 1QNYA 4CPBA 4FVVA 4HKOA 2Y8KA 4OQ9A 3AZXA 1YXWA 1DZTA 1O91A 2QUOA 2WN3A 3BALA 2I07B 1H1AA 5ANNA 4OI1A 1W9YA 4EN6B 4Y24A 1U12A 4AHYA 4BISA 2D3RA 2YU1A 2ZABA 2VD7A 3DUIA 2JDYA 4LA2A 4COZA 4RFRB 3VDBA 5C7GA 3TN93 3I2OA 5GLVA 4Y5SA 1LOFA 1QJU3 5A3MA 2ZGQA 1QQP3 4RS5A 3RMXA 2ID4A 4JKMA 5FPZA 2UYAA 2VCAA 4AFDA 2YG0A 1AR83 1ZBA1 2ZX4A 1QOTA 3ROUA 1RUJ2 1PGW1 1ULPA 1URXA 1AX2A 2QQMA 3T2TA 2B45X 4K21A 4CEYA 3IN9A 3PUSA 2V4AA 3KF5A 4HSJA 4INDA 1W05A 5C8CC 2WO1A 1LOFC 4Q8KA 5EJ1B 2OQ7A 5BNPC 4FOVA 3SCHA 4ZHNA 4MX3A 2GN3A 3DV8A 3URFA 1AUYA 4DRVA 4DXSA 4BIFA 5JCTA 2QQLA 1W2TA 2VG9A 4GKXA 2RVAA 5H9SA 1SBDA 4NUBA 3AFKA 4LBQA 3MEPA 3DECA 3VBSC 2ENRA 1H8VA 3KGZA 5HCBA 2VMGA 3WDYA 4BE3A 2DU1A 2SLIA 4IE6A 1RVF2 4AXOA 5A1AA 2Y64A 1UKRA 4NMIA 5FZ7A 3I2DA 3WNLA 1NA1C 3ZYGA 3J26N 5A1LA 4JGZB 2JG9A 4CXXA 2A3WA 5FLIA 4COYA 5BNNA 4PLMA 4QHZA 5F5AA 1POV3 2VUCA 5LATA 2JDHA 2X8KA 5E89A 4UW3A 2BW8A 4E8CA 4YSFA 4QQHA 3VKLA 2FDHA 2VOXA 4V2VA 5FYCA 5FY7A 4HBNA 5FYTA 4Q4W3 1Q8PA 2QTWB 2B39A 4XFCA 2RJLA 2P3IA 1RHI3 5FZ8A 2D6MA 4FSJA 1BK1A 5A3TA 1MZEA 3CDZB 1HB1A 4P02B 4PHZA 3ZMOA 2VZQA 3M1HA 3U4SA 4QWNA 3WDTA 4BLIA 3JB8A 5D8AC 1GNHA 3CZJA 5HV4A 1PX3A 4Q0QA 1OQ1A 1RUG3 1GLHA 5A7NA 2ZCWA 4X6QB 3DKWA 1FNYA 1DQ2A 2G1MA 3DPRA 1FV3A 1LHVA 1OFNA 3FLTA 3SEPA 2RM22 4FXGB 5K7PA 3QLQA 1W6OA 3FL7A 4R9CA 2YC2A 1F8VA 2CWMA 2IXCA 1MQTB 4JRAA 1AL0G 3LAGA 1HXS3 1PM4A 3GJAA 2ZEYA 1SEFA 1UY1A 3C3VA 2WT2A 3ZN6B 5FO9B 2LTNA 1HKDA 4GMP0 4YW2A 1X8MA 4ES9A 4AEDB 2VCCA 5IW0A 4PIYA 2WIIB 1ZX5A 5FTTC 1S0CA 1CAVB 1UPSA 2HWE1 1ZREA 4LUMA 4QDSA 2ZOEB 4CUAA 5BUVA 2YFZA 4MGQA 1I6XA 1W8NA 2G19A 3GDBA 4AR2A 2R071 3ELNA 3D82A 1LHUA 2W08A 1W0OA 4QU2A 2BJSA 2ZMLA 5E8AA 4DUXA 1VAMA 5JVVA 2LS6A 2FZ1A 2F4PA 1IGOA 5LRSA 3DL3A 1UCXA 3PURA 4LUKA 2VULA 5FZFA 3UKNA 4CCCA 5A3OA 4GULA 5L9BA 4QPGA 2D6KA 2Q1ZB 1L7RA 4LHLA 1AR72 1LGCA 4F7ZA 4ZY9A 2B8MA 4XETA 3OYWB 2ZX3A 5JOXA 1JYXA 1RUE1 1JODA 3TEWA 1LR5A 5LCWL 4B4PA 4AVBA 1GWMA 1U5XA 4XFGA 4KGGA 1W9WA 1MVQA 2EXHA 2VZPA 2ZJCA 4MVTA 1O4TA 1O4YA 4WV8A 1F4AA 1BXHA 2QVSB 4NHXA 1WLTA 5B4NA 3V56A 4YVSC 2XPJA 5EJZB 1R093 3HIFA 5BV6A 5A7PA 3T2QA 3WNKA 4AW7A 4FAHA 2XHNA 1AR71 2E51A 4GH4B 4KU7A 5IHRA 1H8TA 2ET1A 1BQPA 4HMZA 1ZRIA 1OQEA 2RS33 3NAPC 4EWDA 2ZHKA 1RUJ3 4M3CA 3DXUA 4FQZA 2H0BA 1BBT3 3WG4A 4LKSA 4PIZA 3ZPOA 1XPWA 4GZ9A 5KR7A 2OS2A 2VZ1A 3NL1A 5DZFA 4AL9A 2RS13 3OBZA 3UT0A 3VZKA 2A7AA 2C0ZA 1NZIA 5FYMA 3ZOIA 1Y7BA 2ZGPA 4NRPA 2HLEA 2ZGRA 1GZWA 3HAGA 1O8PA 4DS0A 1KEXA 2GZWA 5FMOS 4D7TA 4E2QA 5FY1A 4XDQA 3A0KA 1UL9A 1XYPA 4WM7C 3ZFEC 1W6MB 3ETPA 5AVAA 1EPWA 1IS3A 1UN1A 4Q29A 4XURA 2WA4A 2WABA 3KF3A 5KHHA 3BUCA 5H9RA 3K51A 4CDUB 2XUEA 3ES4A 4BLJA 1W0NA 2VNGA 3OYWA 3O5SA 5FY9A 2W0XA 4G4FA 4XCAA 2IFWA 4P9IA 2CYFA 1W8FA 3MI8A 4BWOA 2BEOA 4XUNA 1VBB3 2FZ2A 1KGYA 5FYYA 4AVTA 1QKQA 1BHGA 1OC1A 1I1EA 3S30A 3DXTA 2JG8A 4ONUA 1AYM2 4C91A 1WD4A 4NE9A 4YVWB 5J36A 5JXJA 2B42B 2BOJA 5IK4A 4XOGA 1LGNA 1WGPA 4Y1ZA 3IDBB 1HV0A 1OPOA 3N7LA 4Q1PA 2ETEA 2HEYF 1V6IA 4K8RB 3SISA 2JIGA 4XBNA 1RUI1 2JE7A 4O65A 4Q4Y2 1Y4WA 4QPIC 3VKFC 4IEXA 5F3EA 5F5IA 3H9AA 3H8RA 4FFFA 4A6SA 2W1SA 2D98A 2RMU1 1JZ2A 3BKZA 1CGPA 2BNNA 4XXAA 4E4DX 1TME2 5LRRA 2MHFA 2XUMA 4PQQA 5D1IA 5DUWA 4XZPA 1NT0A 4XQDA 3MPBA 4NRQA 1FI2A 3KGLA 5LA0A 3VKOA 1DQ6A 1RMU3 2HBTA 4S2HA 2PHTA 3VHRA 1HDKA 3ASIA 4QXKA 1OA4A 3ZYHA 4M0NA 3SLIA 3AC0A 2JIJA 2DYCA 3DPRC 4IERA 4Z1VA 4M00A 3ZFFB 2VMDA 5FQ0A 4EN0A 4NPLA 1D4M3 1F15A 4NO4A 1QJY2 2G9ZA 2WZR1 3P1IA 4QGMA 2F4LA 5D21A 1Q5OA 1SLLA 3HNMA 1CPNA 3FBYA 1S0JA 3MO4A 4MUVA 1AJOA 4JKKA 5FZ4A 1R082 2VZOA 2VPVA 2JB4A 1ZZ9A 3C2UA 1AR92 3MV01 3HJRA 4BQ3A 2MNGA 5C3SA 1YFYA 4XIOA 1AZDA 1VBA3 2QJVA 4OMCA 3A22A 1PO23 1N1YA 4HZFA 4S2GA 1BJQA 4D6RA 2OUJA 5L7OA 2ARAA 2ZXQA 1WA6X 4ASLA 1NYWA 4L0PA 4WVZA 2EICA 4H7LA 4PQ9A 3KD4A 3AB0A 2WNEA 4IQPA 4AEJA 1M4WA 4QX8A 4KWUA 3U75A 2YGMA 5FZ6A 4BM8A 5HPOA 3QBQA 2JDUA 2QQUA 3VBSA 3WCRA 4D7SA 4IGPA 1FAYA 1GP6A 3WNNA 4GWJA 1SCSA 4YVWA 3ZIXA 4QX5A 1G9BA 3FUQA 2D93A 2Q1MA 4K1YA 4KGQA 5T50A 4CDUC 4CYDA 1JYWA 1PIV2 1FX5A 3USUB 1ND2A 1ENRA 1S55A 1UIKA 2A75A 1A3KA 3CZUA 4IE4A 5ISLA 4WM7B 3PU8A 3QACA 4X8NA 4CVUA 2WS92 1OD3A 4QM9A 1UX7A 3LSEA 3OJBA 1V6NA 4IV1A 5GALA 3WHUA 3NJVA 5FR3A 1QJU1 5F3IA 3AYDA 2PTMA 4UBGA 2FHRA 1P8JA 1B35A 1MS5A 1OH3A 3RS6A 4OLLA 1N1SA 1EV11 3ZXAC 2Y0IA 5ACA1 4LO7A 3GBGA 4XHBA 1UQXA 2E63A 4KMQA 4MHRA 4QQLA 1ZRCA 1S0FA 2JX9A 5E6HA 1BEV2 1O8SA 2CSGA 2Y6JA 4D6QA 1RUH2 3E6BA 3PVOA 5ABJA 2HWC3 3SNMA 4IEUA 3AYAA 3NKTA 4BZ4A 4AQ2A 3VDDC 4HG6B 5JMOA 4RA0A 1VJ2A 1UZZA 4YG3A 3W9AA 3ES1A 2CGOA 3NAPA 1I5ZA 1JYIA 4FPYA 4DMIA 5FYVA 1UMZA 1PMJX 3LIHA 4GWMA 1BEV3 4ZKTB 4MGTA 2Q8OA 4HOOA 5LEKA 3T2OA 2KXLA 4CUBA 3LOBA 2CV6A 5J37A 4IEQA 3SITA 1LOEA 4DZGA 5IYYA 3K75B 4XDOA 4XW3A 2YV8A 1AVBA 4AQ6A 5CB7A 4R9AA 4N53C 4BH9A 3KV9A 1Z7S1 2H6CA 4Y3OA 2O8QA 3ZYPA 3VBFC 4OI4A 3KV6A 5A6YA 3RVHA 1IZ3A 4RGAA 3UV9A 5DUUA 5K8SA 2JDPA 1US3A 2YBKA 4XBQA 2WLPA 1Z78A 1XYOA 2W95A 3VLBB 2O8OA 5FV3A 1UKGA 1L7QA 2IWGB 3LDKA 1DZRA 4B7EA 4AI3A 1U5IA 2JG8C 2XBO1 2BNOA 3VUOA 1RHI1 2ZGKA 4M4PA 5ABJB 5GLZA 2K9ZA 3ZO0B 2ZKLA 2XWBB 3NNMA 5DAQA 4Q4V3 1JYVA 3VBHC 3J4UH 1XNAA 4JV4A 2ZKNA 1DG6A 1PO22 2ZAAA 1V9U1 5C33A 2GDFA 4A7ZA 2IC1A 1PNGA 2IUWA 4HK8A 2B9UA 1K5MB 1WLDA 4QPGC 1EYBA 5A32A 2QNKA 1WW7A 3R4SA 4K9SA 4FBFA 3M8LA 1W6QA 1YFUA 1LHOA 2BERA 1W2OA 1YC61 4GAZA 5HCHA 3ENRA 1E5HA 1ULEA 2R1DA 2R7EB 5A33A 5KHGA 2G9FA 1SMVA 5CZKA 2A6VA 1I9RA 1UOGA 4FOYA 5CG8A 1DQ4A 5FBJA 3M70A 4LJHA 2YBPA 1MEC2 4QGLA 4JVAA 1CAUB 4EN8B 1XJAA 1DGWX 1AR63 5IK7A 3LA3A 4MXWB 3SKJE 4CA9A 3VD4A 4AEMA 3LFMA 1GZCA 5FUPA 4CDQA 1TEIA 2VVDA 2R073 1DLLA 2W68A 1WKYA 5F8PA 2XJSA 4QU1A 2HEWF 2W9XA 3AZWA 3OGGA 5GZDA 1DFQA 1FNZA 5C9AA 1J1LA 1JU3A 5KXBA 1EUUA 2BOIA 1KXGA 2VUAA 3ZM8A 4DINB 2QQPA 4LT5A 1PM7A 1X33A 2XVLA 5F3CA 3V0BA 2LW8A 1OSGA 1TME3 4AOCA 1XE8A 2ZEWA 2WKKA 5FPAA 4XF3A 2FD8A 3POFA 1NKGA 2Y6GA 3AZZA 2BUKA 2QDRA 3OBTA 1OLQA 4QPWA 1NA1A 5GZGA 4HVOA 5KHJA 2J42A 2FDIA 1IQDC 3MPPG 1AYM3 4IV3B 3OY8A 1DP0A 2V4VA 3WG2A 1HRV3 5FPUA 4L2NA 3OPWA 2ADEA 1O7FA 1SCRA 4Q0SA 4Y26A 1JXNA 2C6SA 1PVC3 2DCKA 5KHKA 4OZXA 5DUVA 2PFWA 3GHMA 1QDOA 4S2DA 5A6ZA 5LY1A 4XJAA 1AR91 4BXFA 3ZXEA 2B5HA 2HWD1 4LE4A 5EV7A 1RUG2 1NOVA 3POIA 3LKJA 4EN7B 2BWCA 2WS93 2O0OA 4ZPIA 3KSCA 1IQAA 1QDCA 4KBZA 1ENSA 1U0AA 3K3OA 1HX6A 2ARXA 2VUDA 1QJY3 2WLQA 1C57A 2GH2A 1VLNA 1ONAA 4YZ1A 1C8M3 2YC4A 4ZU4A 4PIXA 2VNVA 5HBAA 1NCRB 1STMA 2B4KA 5D8AA 3WDWA 5IVCA 4FP2A 4D3WA 3GF6A 2WFF1 3GYDA 1JZ4A 1UY4A 2BGCA 4FQ4A 3VBRC 5JSPA 4QMAA 5DPNA 5FY8A 3WW4A 1K5MC 2JWPA 3AVRA 4QPGB 4DXRA 2CL2A 3TN91 2XG3A 4CU9A 4QKNA 3BTXA 5BNPA 1AL23 3VDDA 4LO8A 1H2MA 2ZTNA 2B9VA 4N43B 2OPWA 5BPXA 3MLKA 2JDZA 3N4MA 4NHKA 5FXZA 1D2QA 1DYPA 1EAH2 3IZOA 1C4RA 3WP3A 4ATFA 1ZBA3 2G9GA 2VNOA 4AHZA 3H3ZA 5T5OA 4CZSA 4E4SA 4QD2A 3VDCA 1YI7A 4MG2A 1T6BX 2ARCA 2D6LX 4N9HA 1QXPA 2ZGOA 3A23A 5A7WB 1OFSA 2PXJA 3K4ZA 2HJIA 5FZLA 3NJXA 3ME2A 4LO6B 3PVNA 5FZGA 4GQ7A 1V6MA 2Z69A 1MZ6A 3IAQA 3MF9A 4CRQA 1UD1A 1VRBA 1XU1A 5K0UB 1HB2A 1REFA 2JD4A 5HCFA 3BPZA 1JBCA 3AKTA 4OI2A 1UAIA 3IDEA 2G4IA 2XXZA 4ZS3A 4XF4A 4OQ8A 2FMYA 3VBUB 3O7OA 3CL1A 2JB8A 3NO8A 4M4RA 1N3OA 4META 2FMDA 2GNDA 2UU8A 4NAMA 2WUHA 4QDQA 3LEMA 4WZCA 2MEV3 4JGYC 4YVWC 3TEZA 2Y26A 1S0GA 3OGRA 1QGLA 1QJX3 4URTA 3H8OA 2VCMA 4RS5B 2X09A 3VN4A 3LPFA 4FPKA 4HLTA 3O0WA 1ASJ3 2X53S 3PL0A 3TYJA 2AEZA 2RS53 3EYPA 2Q1FA 2Z79A 2JDAA 3Q9OA 1J83A 1XE0A 4XC9A 3WF2A 3SKVA 1HLCA 5DDJ2 1X36A 3AFGA 4XHXA 4WM8C 4KG0A 1JYCA 4NIHA 2XJTA 3ZSJA 1Q8QA 3BIWE 3W20A 5L19A 5BNPB 4IEVA 5IUQA 3CLPA 4BB3A 1RUI2 3SHRA 4YFZA 2VOVA 5FK7A 5FZCA 5I0TA 1F5FA 2GAUA 4CTEA 4XUPA 5EYXA 3ZN4A 1LU2A 1Q8OA 2WC2A 4CCNA 1ZRRA 3WDUA 2DCJA 2Z4FA 4PJYA 2B7YA 2VM9A 4FCAA 3RYKA 2PHRA 1GKBA 3CJXA 2C24A 2LUWA 3RSJA 1XNTA 3WQBA 5GLWA 5IK5A 4HETA 2VVFA 2VUJA 4NOTA 3VD9A 4BQXA 2W47A 2DF7A 1SG3A 2Y6KA 1QEXA 1G9DA 1HRI1 3KB5A 3WY6A 2R043 3AXEA 2CGNA 1PGSA 3PMEA 3RZKA 3WVJA 4RHV3 1D2SA 5A80A 4BPZA 2PQSA 2ZZQA 2AACA 1RGSA 2ZS6B 4CDXB 3NW4A 5C4WC 2P37A 1NCRC 3A0NA 5FKBA 5JI9A 2PHLA 4TZDA 4QQPA 2PN5A 4K8FA 4I09A 3T09A 1RC6A 1EPZA 4AVSA 2IXKA 2YXSA 3JD72 1K42A 1GICA 1HB4A 4COVA 2XJPA 3SH3A 1TMF1 4F3JA 2JG9B 4Q4W2 5K0UA 5IVFA 3RQ0A 3I3QA 2XQXA 4NVPA 4TSVA 2EIEA 1PO13 3ZN6A 5HXVA 4EWAA 2X5IB 5FZDA 3I97A 3ZSEA 1MQTA 1RYYA 1SLCA 1NUKA 4I30A 1O6UA 4DEVA 4ET7A 1KS4A 4AFAA 4LBQB 1YEWA 2ZMKA 3ZYIB 3KVBA 4Q4X1 4QT6A 4DY5A 3CO2A 1ZA7A 3WQ0A 3JB4C 1VE0A 3JQXA 3M2MA 1UMIA 1WBLA 4DXTA 1AR62 2ZHMA 3FUOA 5FP7A 2PHXA 4LBJA 4AQTA 3S0MA 2I74A 4AGRA 3D3AA 4Y1UA 5FUNA 2DUOA 5ANQA 2CU5A 2DVDA 4W6XA 3O0XA 1S0EA 1S2BA 1GZ9A 1CN1A 1SLIA 5KXDA 4CUCA 1MS0A 5CFCC 3ZDSA 3F2ZA 4WVMA 4BQYA 4LK6A 1R1A1 4NHLA 3CF6E 4ZS2A 4ARXA 4YGEA 4PLOA 2QQWA 3RMYA 1J3PA 1RUE2 2W1WA 1YQ2A 4C0HA 1DQ0A 5C9AB 2OT7A 3Q8BA 4XTMA 3BPSA 4ORFA 1EAH3 2NZ9A 1RITA 4W4ZA 1ZBE3 2R062 1OF3A 1CR7A 2RS31 4BQ1A 1MZFA 1COV1 2HYXA 3BTZA 2VAUA 3OCPA 5J98B 1F2NA 5BXXA 3RPQA 5KC6A 1LOCA 4XAAA 2NYYA 4BOWA 4GWNA 3MYXA 3O1OA 2EXKA 4HL0A 2LRPA 1KJRA 3C7FA 4GH4A 3DCQA 3JXSA 5LBBA 2MEV2 1D0HA 1RHI2 3IPVB 1W6NA 4LLFA 4YGBA 3TEXA 2HWE2 1VRH2 2WYFA 5JMCA 2ZEZA 2UY8A 4QXBA 3O1MA 2C5DA 3QOPA 2I45A 3JD73 2GP5A 2WQ4A 2FDKA 4FOQA 3MGUA 5DDJ1 1APNA 3U0ZA 4XZUG 3J8F3 1AF9A 2F6BA 3ACLA 3AMHA 1PZ8A 4DNYA 5DN2A 4CCJA 4HN0A 4CEWC 1VB4A 2WO3A 4EWEA 3T30A 3AKRA 4TWTA 5J7MA 3E6CC 1MS3A 3V0AB 3PNAA 4L8QA 5IATA 5G04L 3MW2A 1V6KA 1W90A 2RM21 2WNVC 2R042 3PUAA 4LLOA 5FZ9A 3ZN5A 4AGGA 4BXSV 4XJUA 1Y9MA 2JE9A 1F4HA 2VECA 4BYYA 5E16A 4DXZA 2X10A 3FLPA 2K46A 4GB31 2XMLA 2GC2A 4XFIA 4YW7A 5GZFA 3RZMA 1YFWA 4LORA 2XL7A 4A7YA 5IVVA 1RTVA 2WT0A 1W9FA 5BNOB 1ACCA 2HWC2 2PHWA 1DGWA 4AG4A 3FHAA 2AENA 1UF2C 4O9EA 1LOGA 1H30A 2VW1A 1DCSA 3DYMA 3CNAA 3W5MA 5D8AB 4YYOA 3ZR5A 1XNKA 4UWDA 3IMNA 3HBZA 4NIAA 2C9AA 1WW6A 1S0BA 4N53A 1ULCA 2BRTA 1W03A 2QQKA 1R1ZA 2VVEA 5AC93 4OFGA 1BZWA 1XQNA 2W2IA 4XJ8A 2QBXA 1UYXA 1XOYA 5F32A 1XYNA 2XWJB 4L99A 2JICA 4LULA 4RGKA 1ASJ2 1W99A 2Q5TA 3HMYA 3WZ1A 1J59A 1O5UA 4IEOA 4A3XA 3DGTA 3I8TA 1IG3A 3FBMA 3U10A 3AKQA 3N35A 5C6CA 2KR2A 2ZGSA 5DABA 4Q26A 1CWPA 1HRV2 4RN5A 4Y1XA 2EIGA 3ZXKA 1GZWB 2WZR3 4K40A 1FMD3 3WF4A 4UF0B 3RZLA 1US2A 2EAKA 4GMP3 2IVIB 5F6KA 2E9QA 2HWB1 5EHDA 2VC9A 1IG0A 3QCWA 2ZX1A 4UI9L 5I0UA 1RUNA 1W9SA 3A21A 4LHKA 4B1MA 4UW5A 1RUH1 4XDPA 3WG1A 3RZGA 4BCUA 3JBG3 5FBZA 1FYUA 1S1AA 4MLOA 1MPXA 3WF0A 1VBD1 1A6CA 1DU3D 1ST8A 4LKFA 1OH4A 1VBD2 1UZVA 5K4LA 2DTYA 4AYUA 3CJIB 2PHFA 2UYBA 1AR93 4Q4V2 4X8PA 3VBRA 2WNOA 1W2AX 5BY5A 3OGSA 4CSWA 5F37A 3FC0A 1HIXA 3NV3A 1H6YA 3I3MA 1RXFA 2WS91 2VO5A 2HWB2 3P6BA 2V09A 4I3GA 3VGIA 1OLMA 3EXUA 3HOBA 3OEAA 4M0HA 5FFOC 2WZPP 1FPN2 5LEJA 1UXXX 4YM1A 1QJY1 2L9LA 2C26A 5T5JA 4W6WA 1F31A 2XGXA 3BVCA 1CAWB 3IT8A 4H2AA 3E1F1 4HKWA 5LASA 3POJA 3VZNA 1GWLA 1UOFA 2IXIA 2BVVA 4IV3C 3T2PA 2IVJA 4CEWB 2PMWB 2ZZJA 4QB6A 2WFF3 4WBBA 1QWRA 1G7YA 1W3XA 3UETA 5CNAA 1AL21 4S2FA 2PQQA 4I3PA 4TYSA 1JI6A 1G9FA 4E2SA 5DAPA 5J48A 3VKMA 4V1PA 2XL9A 2OZJA 5A3WA 1UOJA 2JDKA 2EALA 2UWAA 2VZTA 1IPJA 4JX0A 5A6QA 3USUA 4JRLA 1EV13 4XMIA 5T52A 1SACA 1OXCA 4FPJA 1KQRA 1KS5A 5DZEA 5ACA3 2BQPA 3I49A 4XFAA 1MEC1 3E6DA 3MW3A 5AFBA 1WW4A 3Q8CA 4Q1RA 5C3RA 4MXWA 4I0WB 1Q8SA 2PLV1 4PBOA 4RL7A 4UF0A 1CIYA 5BNQA 3M3CA 1FXZA 1R081 4LPLA 2XVKA 3CMGA 3UYJA 2ZGNA 2BDRA 1UNBA 1S0IA 2PAMA 1WBFA 3SCGA 4EQVA 4B4RA 3CHXA 4ES8A 4W8JA 5DAWA 2A70A 2AYHA 2YROA 2E7TA 1D0GA 1CJPA 1XBFA 3DKQA 3THTA 4E4ZA 5CKNA 2DUPA 2XJVA 5DQ0A 1V70A 3AZYA 2ORZA 1TVGA 3NNGA 1CQ9A 4MSVA 2PHDA 3HQRA 3NV1A 2P6CA 4X6RB 5CFDA 3TRSB 1QJX1 2OVUA 1CX1A 2QQNA 3C7OA 1LRHA 5F3GA 3UGFA 3KCYA 1C1FA 2VMIA 3HNYM 4PDWA 2EAAA 3PVEA 4MGKE 4WVVA 4XAEA 4CU7A 1I5PA 3EJKA 1BK0A 3RZJA 1S2EA 4FAGA 2A6ZA 5A6XA 2Z5WA 3RG0A 4P9YA 2YFUA 2GH8A 2VZSA 1W8UA 1NLSA 1IS5A 3TB0A 1Y43B 3J7LA 4CEWA 1REDA 1VRH1 2Q0AA 3LA7A 1G86A 1CD3G 2WQ8A 3O1PA 3ZXJA 1N3QA 5IVBA 1A8MA 4P00B 1RUD3 4RQPC 3WDXA 1DLCA 5FZOA 5J96B 2W1UA 2YBSA 2BVBA 4GWIA 4JGZC 5EPAA 1GZTA 5I93A 2WO2A 1E57A 3FFZA 4FOWA 4P9GA 2DU0A 2ET7A 2SBAA 3INAA 5FAXA 1MR5A 1YI9A 2R041 3K2OA 4R4XA 2VU9A 2A71A 1E5RA 4RHV1 3VBUA 3VHNA 2HYKA 2OA2A 2ZHNA 1AXZA 3THCA 3U07A 4XF1A 3VKNA 4KBBA 3WV6A 4AI1A 3LA2A 4LA3A 3GBFA 5BNOA 2HBUA 3M7AA 4N7UA 3IM0A 2JJ6A 4YW4A 5EWSA 3K77A 5FO7B 3M4FA 1LENA 3D8CA 1QNWA 2FDJA
chains in the Genus database with same CATH topology
4I0BA 3VL8A 1EP0A 1RL3A 2RR11 3MF6A 4XJZA 3CEWA 2IZWA 1ALYA 4K20A 4P9XA 4ITCA 3M3EA 1WA4A 4OI0A 4FPGA 2D7FA 3ZFGC 4FT8A 2I2SA 3D5OA 2VY0A 1BBT2 1HQWA 4ISRA 4WZFA 1IS4A 4YVSA 3JBG2 4Q27A 3D0SA 2WQZC 3P3NA 1ULGA 2O1QA 3OF1A 4R52A 2UWCA 1PK6B 4XE9A 1V6JA 4JDMA 4COWA 1RJ7A 5FOJB 4XF9A 3ILNA 1AYN3 2FQPA 1U5ZA 1C8NA 5GM0A 1FMD2 3B9IA 4E27A 2WNUB 4NR1A 3WXPA 4XXPA 2GC0A 4QPYA 4ISQA 4N7IA 1XNDA 1SDWA 4AGVA 5BYNA 4YZ4A 3VL9A 2GNBA 3QH6A 3S7EA 3VV1A 3MIHA 3X29B 4FPEA 3AYCA 1JN2P 3EHKA 4UW6A 1A78A 1VBE3 1OKQA 5DUXA 1GNZA 2ERFA 5FPXA 1YNAA 4QQOA 5CBLA 1LKNA 1AJKA 3L9JT 1PIV3 1REEA 1PZ7A 2A3YA 4KU8A 1O3TA 4LEJA 3UKVA 1NA1B 1W2UA 1OPMA 2RE9A 4YG0A 1FPN1 4MGYE 1N47A 1RJ8A 1SLTA 3H7YA 4RS5C 1H9PA 5GZCA 4OUMA 3VBRB 1DBNA 1ZNPA 4C0BA 1X8EA 1T6GC 2NPIA 4JGYB 1LODA 3QH7A 4Y4YA 1CAXB 1UPIA 1QMJA 4L9BA 3HD8B 4WM8A 1ND2C 2TEPA 3TOJA 2RM23 1NZCA 4FTSA 4KL1A 2P17A 2NQYA 4Q4Y1 3J9SA 3ZFGB 3H1YA 3UJQA 1TNRA 2EXJA 3VZJA 4XYXA 3ZXDA 3J8F2 1WCDJ 4YNIA 4HSLA 3R6SA 3WOGA 1EY2A 2TBVA 4AHXA 5BNNB 5GZEA 1OOPB 4GXLA 4Y20A 4B7KA 2H0VA 2HWE3 5L7OC 4XIKA 1WLCA 4N43C 1DIWA 1R091 4B8EA 1O3RA 4AI2A 1JUHA 1ULDA 1AR73 3EQEA 3PTYA 4H7MA 1ASJ1 1QQP2 2JEMA 5EFUA 2OYZA 1IOAA 3D0JA 4CP0A 2OZ6A 1ZBE2 2R063 1O3QA 4YGCA 5JR7B 2HWF1 2YZ4A 4FPHA 2D43A 2LALA 3AK0A 4KWLA 4FP3A 3NSTA 5I8TA 1BKZA 4P14A 3CJIC 3VBOA 2DUQA 2JG8B 2BPA2 4E2GA 1C5HA 4GMP1 4KWJA 3D4KA 3T1LA 2R32A 2PAKA 2WFPA 1J1TA 2GMEA 1BVP1 3AP4A 3GBWA 5FREA 4CDWB 1HQNA 4I02A 5AVPA 3WD5A 2XJUA 1OA3A 3VBFB 4Y1YA 4MGIE 1AR82 1ZBA2 3BTAA 2QZ2A 1HQLA 2D6PA 2CGPA 1TE1B 4LE3A 4JCKA 2RS11 3HR9A 4J1XA 2ZGUA 3HT1A 1VIWB 3OBRA 3H50A 2QFEA 5KBFA 1POV0 3LB9A 4LBOA 3DF0A 3BODA 3VBHB 3MIEA 3ST7A 4AQSA 1RUI3 3ZVXA 4Y1VA 3IWZA 1PO11 1MVEA 3AP6A 3L2HA 4LBLA 2RMU3 4CDXA 1ZZ7A 2CNAA 2HEVF 3MFAA 3WW1A 4YW5A 1W6OB 2R072 3MDPA 1H2NA 3EO6A 5T54A 2CAVA 2QE3A 2OW4A 4R4ZA 1YJLA 3I54A 2CY6A 2ZMNA 1VBB1 3FFQA 5JZGB 2WJSA 4FPLA 1OMIA 2YYOA 5EYYA 1DQ5A 4G3YC 3PJQA 3VHOA 2GMPA 3CU7A 1CAVA 3PJYA 2IXJA 4P9WA 1CAUA 3NVCA 4KQ7A 4OHXA 2WNVB 2VW2A 3WINE 2AR6A 1HRI2 1L3JA 3RI9A 1TQ5A 2PELA 5C4WB 4AK3A 3R4UA 1LGBA 1BCXA 1VBA1 1PO21 3RJ2X 1PVC2 1PZ9A 1QJZA 4RR3C 4H14A 2Y0OA 4RR3A 1SBFA 4I01A 3E5QA 5FLJA 4YM2A 1VBC2 1N1VA 1GSLA 1GANA 1SQ4A 2EA7A 4YW3A 5KXCA 2R16A 4Q4W1 1NCRA 5BNOC 1NXMA 1HW5A 2RR12 3WP4A 3FJSA 4YZ2A 3JD71 5JOZA 4MZUA 5IK8A 4M3CE 2DCYA 2KA3A 1VAKA 1WMFA 1C8M2 1QU0A 4G9SB 4XFHA 1RVF1 4IEYA 1SFYA 2HKXA 3MLLA 1PK6A 3ZFFC 3JUUA 4JGZA 4CEYB 4RHV2 2E7QA 4F8AA 3UL2A 3KMHA 2OPKA 4RQPB 4B4QA 3VDDB 4H55A 3ZYJB 3THPA 5DG1A 5CIRA 2YPJA 4QHBA 3BU7A 5KXEA 4L92A 4AI0A 2ZPXA 4SBVA 2KM2A 1YUDA 1DHKB 4OHWA 1ZZ8A 2XBO2 5FO8B 4IETA 5H9PA 3IDCB 3FLRA 1LTEA 3JCIA 4PBPA 4MYEA 3WCSA 1IS6A 5K0UC 1CPMA 1G9AA 2TUNA 4OHZA 4A7KA 2HWF2 3L2YA 2NLRA 2P34A 3I7DA 1W6PA 4NHMA 1QJU2 1X82A 1RB8G 5T55A 4D7YA 1Z7S2 2BWAA 5A32B 4XBLA 3TN92 3OGJA 4WM8B 1ZZ6A 3AX4A 4YLZA 3ZMNA 4OUSA 4C1XA 3WT3A 1PGL1 2VQ0A 1X50A 1G8WA 5T3NA 5I91A 1MS4A 1JUIA 4YG6A 4YRDA 2ZACA 3B69A 2WWSA 2Q4SA 2E7AA 2WSVA 3B93A 4DFSA 3PMSA 1AYN1 4YFWA 1CVNA 4ATEA 4FPOB 4IESA 1YJKA 3KT4A 1BEV1 4OHYA 2ZGMA 3ZYRA 3KCCA 1C1LA 1RUJ1 3KT1A 3WG3A 2R6QA 4Y5Z0 1EV12 5ACA2 1PVXA 3EBRA 5EXOA 3LZZA 1RUC3 1OA2A 1FOD1 1WMDA 2D3SA 2IXHA 3HN1A 2DVAA 1FT9A 2VXRA 4J1WA 2DWRA 1H1MA 2WA3A 1IPKA 4Y20B 1ENQA 3SH4A 1D4VB 1DDLA 2E6VA 4CEYC 1Y9QA 3O12A 3HWJA 4XFFA 1DF0A 1FPN3 1QXJA 4W65A 4R8HA 1NLRA 5KWRA 1GQGA 4B29A 5JPMB 5L7OB 2QDNA 1LHWA 2JXAA 4Y22A 5JDBA 3LGRA 3OD0A 2N7GA 4I2OA 3V65A 4WM7A 4MGZE 2ZAHA 3GZTB 3MIFA 2ZBJA 3RNSA 1AX1A 4GA9A 2LM3A 4HVRA 2P2KA 1W6MA 1YHFA 5DZGA 3ZXLA 5IT6A 5CG9A 2CWSA 4HN1A 4JDOA 2YY1A 2IFRA 1NE6A 4LTAA 3NAPB 1GYKA 3RYPA 1XNBA 4XILA 5SV5A 4YGDA 5C9AC 1AYM1 4TLFA 3ZFEA 2WZR2 1RIRA 1LB2A 3R4DB 4MXVA 3WNXA 2W52A 2XJQA 4OULA 5K9YA 4HPKB 4BHPA 4P5HA 4K1ZA 1MS8A 3SXWA 2ZGLA 1YIFA 2D97A 1QY4A 2X29A 2Q30A 3OTFA 1PGL2 1RMU2 5FRAA 1VALA 4YZ3A 4CP2A 1KRIA 2V73A 5CVRA 1ND3A 4BIOA 5GLUA 3SH5A 1WCKA 4Y22B 3B02A 3B00A 1C28A 1I3HA 1BMV1 4D69A 3FHIB 2WNVA 5L73A 2P3KA 2HWF3 1D4M1 4BMBA 2AGSA 4AVCA 3H8UA 3VHPA 3VZLA 3WHTA 4PCRA 1UIJA 1CIWA 1VRH3 1LHNA 5LK7B 1CAWA 3OD4A 4XF0A 1JTZX 2Z2SB 4J6GA 1QH7A 1KDMA 4LBMA 5JOWA 1RUD1 1ZYBA 3ZX7A 3TNPB 2CTVA 1C3HA 3PLQA 4GB32 2DVFA 4XTPA 4H3WA 4U2AA 4XJWA 1XNCA 4K3UA 3KS7A 1GQHA 5DG2A 2TNFA 1PHMA 1DGRA 1J3QA 1N1TA 3NJZA 1GBGA 5CAZA 1OOPA 3AMQA 2A5ZA 3LCPA 5C4WA 2EF6A 3ZXFA 4HPKA 3I59B 3TNQA 1H9WA 3WX5A 3ETQA 1XRUA 1OHFA 1SLBA 5L36A 3VBUC 1LEMA 4UBHA 1ND3C 4M3CF 4XQ4A 2RR13 4RR3B 2XKOA 3JQWA 4M01A 4AEKA 3R05A 1H1IA 2IXLA 1B09A 1NG0A 1W6QB 1O4ZA 4LO5B 1A8DA 1QXRA 2MEV1 3RRDA 2XLAA 3NV4A 4LBKA 5KC5A 2D6OX 3GZAA 5GJ6A 1B35C 4P9LA 2W39A 1Z7S3 3B9CA 1CONA 2NN8A 1S0DA 3S7IA 5I8YA 4PF5A 1H2KA 1V6LA 1NY72 5JI7A 4AFBA 4DY3A 1MQTC 2UY9A 2JENA 4HT1T 3FX3A 3T1MA 1MS1A 3USSA 4MV2A 3TWIA 4F83A 4NN0A 4Q2FA 1FOD2 2RS12 4Q4V1 1B35B 4HKLA 2VW0A 3V0BB 1LCLA 3FWEA 4UW4A 3S6PA 1KFUL 1NCQA 1RINA 1VBB2 3V64A 4Q0PA 1VBE1 1V6OA 4Q4X2 3WW2A 3VBFA 4IV1B 3G6JB 1V00A 3GHNA 3KM5A 2A6WA 2A6XA 1KD7A 1PIV1 4EV0A 1RUF1 1ND2B 3A4UA 1LULA 4JQRA 4BMEA 4PLNA 2XBO3 1TMF2 3B94A 1H4GA 4IEZA 4LBNA 4WVMB 3FMGA 1QOOA 2Z42A 3KZ4C 2XJRA 4IEPA 3M3OA 1RUOA 1LEDA 3MIDA 1LOAA 4JC1A 3WP5A 1XE7A 3AKPA 1RVF3 3POSA 2GSYA 3W58A 5SV8A 2DCTA 3BB6A 2RMU2 3ZPYA 2H6BA 1HRI3 4JTOA 4QQ2A 1R092 1JHNA 3WUDA 4XQWA 3VZOA 1LESA 1YRZA 5I0SA 5JPNB 3LOIA 4EN9B 1O5LA 1WCSA 4RD7A 4AEDA 3OPZA 4ZU7A 5JIAA 4QPIB 4KG8A 3TBDA 2P3JA 2D6NA 3WR0A 3NV2A 3O14A 2OUHA 1HRV1 3ALQA 4HFSA 2GU9A 2PAEA 3VZMA 2QKDA 5J3UA 1PGW2 4FO9A 2PYTA 2EVXA 3MLJA 3K48A 5F1RA 4AE2A 3UJOA 3WW3A 4PDWB 4AF9A 2HWD3 4BA6A 2GNTA 3AMMA 3RWNA 1TME1 2R1BA 3B01A 1QF3A 2DFCA 1POV1 5FDBA 4XEZA 1F9KA 1DZQA 3WP6A 4AVVA 3DN7A 3U11A 3AYEA 1VBC3 2YUEA 2AZ5A 3MW4A 3VBOB 1R1A3 3ZFGA 3AM2A 3E97A 3FZ3A 1PVC1 4KNCA 1ND3B 3D6EA 5F5QA 2RS32 1SBEA 1CX4A 1KITA 1CAXA 2MPFA 2X5IA 3PHMA 1KFXL 3WLUA 4DQAA 4GKYA 3KT7A 3AJYA 1G9CA 1CESA 1RUC1 1R1A2 1FOD3 2XLGA 4CDWA 1NCQC 4KH9A 2ZHLA 4XPVA 3B7MA 2ZX2A 1C8M1 3WQ7A 2B46X 4CDQC 2DVGA 3APBA 5EZWA 4P9JA 4FPCA 3UKTA 2WT1A 3MZHA 1MACA 1SFNA 2BYVE 4AWDA 1W39A 3POYA 2EXIA 3OY8B 4MH0E 4O9GA 5DDJ3 2ZX0A 3M3QA 4QPIA 5GLTA 1H8TC 1ZA4A 2DV9A 4ASMB 4C1WA 1DYKA 2D40A 3H1MA 2RS51 2YHJA 4ZXKA 3RJRA 3FE5A 2DTWA 3UK9A 4FTBA 1PO12 2HWD2 4NWVA 4Z07A 2VGDA 3ATGA 1F5JA 5CA6A 1RUE3 2R0HA 4Q0UA 4AI8A 5JOYA 4ZU5A 2XHKA 5FMOL 1AHSA 3I59A 1ZZBA 2UURA 4GH4C 5JZGA 2V5YA 4LNVA 3MIGA 4WVWA 4YVSB 5CADA 1OLRA 1W6NB 5LK5A 2CAUA 4HVQA 3N3HA 4I0AA 4B3NA 3JZVA 4DB5A 1Q3EA 4Z2WA 2RS52 2BTVC 4HK9A 2A73B 2ZGTA 1ZM1A 5JZGC 3ZSLA 1WD3A 1FATA 2AUYA 1Y3TA 3RZZA 2ATFA 5F6LB 4W6YA 1S2KA 1GFF2 3AMNA 4IXLA 2WNUA 4LHNA 5A33B 5T5LA 3VBOC 1TMF3 1PMIA 3LSDA 2BFUL 1BYHA 1TNFA 3P3PA 1LJ7A 4JDNA 2NMOA 4EROA 1OQDA 1QQP1 3DPRB 2YC0A 1YFXA 2ILMA 1AR81 1VP6A 4CDQB 1UW8A 4Q4X3 2JECA 2VH9A 4RQPA 3HQXA 5CFCB 1NCQB 4IL7A 1XU2A 4LO4B 2K0GA 1IKQA 4PDWC 3POWA 3ZFEB 2XVGA 2PHUA 3MICA 3NKGA 4K7JA 5CFDB 1AXYA 1MEC3 4JGYA 4RGGA 1UU4A 2YDEA 3QD6A 3H3UA 1H2LA 4XMAA 1NQJA 3MIBA 1QH6A 5BNNC 4CDWC 4DRRA 4FPFA 3RI8A 5JSOA 3B3QE 4OVEA 1VR3A 1YLLA 4GIQA 1LOBA 4AHWA 1WW5A 2X5IC 4UXAA 4Z92B 3N7MA 1UU5A 4YW1A 1EAH1 5E1RA 3GALA 5C8CB 1UZYA 1ZBE1 2WSUA 1WMEA 1COV3 5CFDC 3SCFA 2GMMA 2K2SA 1O3SA 1FV2A 4EJRA 1KJLA 3N7JA 4CP1A 5HI0A 1ULFA 2QZ3A 1QJX2 1LU1A 2WFF2 2XB6C 1XXNA 2GALA 5FOBB 1Q56A 3GZUC 1N3PA 3VBSB 2XH6A 2UWBA 1RUF2 3RDIA 4Z8BA 4Q0VA 1OD5A 2GC3A 4JTNA 4N90A 3LWCA 1ZRDA 1YO8A 3H1WA 3J8F1 5TSWA 5B2GB 1WLWA 1RUG1 2YGLA 4HANA 1VBE2 4AFCA 4K6BA 1VB2A 3PVBB 2PLV2 2AH2A 2ZA9A 3R0RA 4Q8LA 4DOUA 2FBEA 4IV1C 1W6PB 5CU1A 3N7KA 4N43A 1H8TB 3I4IA 4LR4A 1SLAA 3ZXGA 4JAAA 3N36A 4GALA 2JG9C 1DGLA 1HXS1 4GB33 1H0BA 3KQRA 2R49A 2GC1A 1AL22 2BNMA 5JIUA 4AEDC 2YMZA 4YARA 1RUF3 2QCSB 3AMPA 1WUVA 2Y38A 4KWKA 3B5LB 2GN7A 4R9DA 4A2UA 5JSRA 5JWPA 3ILRA 3AJZA 5FLHA 2AREA 4YM3A 1BVVA 2BBVA 1W0PA 3SMHA 1JOJA 1PK6C 5AC91 2D44A 1AX0A 3IBMA 2A3XA 3H7JA 2WINB 1C5IA 1IKPA 1K5MA 5E88A 4XFBA 4DPNA 4NPRA 1GR3A 2DURA 5J09A 1PNFA 1J58A 4RFT0 1UX6A 1FMD1 2PA7A 2HWC1 1GV9A 2JKBA 1M06G 1AYN2 2VOWA 2D5FA 1ZRFA 1NQDA 3ILFA 1NY71 2WNUC 4FXKB 4YM0A 3TAYA 4L11A 5KHIA 3JBG1 5C8WA 4E9KA 4SLIA 3M3IA 1V9U2 4AFMA 1BBT1 3E5UA 2D3PA 2DCZA 2WL1A 1LECA 3WUCA 3H0OA 2DFBA 4C90A 2R30A 2R0FA 2RJKA 3BOWA 3IKWA 1JW6A 4AVAA 5A3LA 1G6NA 4YZ5A 3JU9A 5FQ0B 3ZFFA 2D5HA 1D4M2 3ECQA 1YWKA 2HWB3 3AKSA 1BMV2 4QM8A 4R9BA 4COUA 1VBC1 1RUH3 1CJDA 5DXDA 2RHPA 1Q43A 1KDKA 3KCXA 1VBD3 2GNMA 5EJ3A 3ZIWA 1V9U3 1X7NA 3GNEA 3WQ1A 4N53B 1J3RA 1AXKA 4FTEA 5HCAA 3IIAA 4Q4Y3 1RUD2 2OIIA 5H9QA 4QGNA 4OHVA 1QHDA 3ZSMA 1DGRN 1R083 2A6YA 1MZ5A 3O0VA 4XJ9A 5F9TA 1JH5A 1YIPA 1OOPC 2ARBA 2E53A 3ZSKA 3MFCA 5JLVA 2XLFA 2NMNA 1UU6A 3KLSA 1YYNA 2DVBA 5ABJC 4Z82A 5CFCA 1AR61 4U36A 4IEWA 3AP9A 1OI6A 4M3CB 3AP5A 4L97A 3AP7A 1NE4A 1U5YA 3E5XA 3BOPA 1H4HA 1RMU1 1ENXA 2XKPA 3CJIA 2NP0A 3NWKA 5I8SA 1VBA2 2NM1A 4RSUA 1COV2 4NWWA 1HV1A 2PLV3 2R061 2C1FA 1NXD1 2BFUS 4CDXC 5FCCA 1ZVFA 2VNRA 1YCIA 1MS9A 3RYRA 4IV3A 4N9IA 2VQAA 4D94A 5JAXA 3VBHA 1ZZCA 3HT2A 1HXS2 2VOKA 3AXDA 4LBQD 1RUC2 3IPVA 2ES3A 1Z0HA 1DQ1A 5T5PA 3G7DA 1Q8VA 5GKAC 5I0RA 3V0AA 3WDVA 3W59A 4CDUA 1VAVA 3U4XA 5AC92 3AZVA 1IHMA 3BCWA 1QOSA 5C8CA 2VMHA 5AFEA 1QNYA 4FVVA 4HKOA 3AZXA 1YXWA 1DZTA 1O91A 2QUOA 3BALA 4OI1A 2I07B 1H1AA 4EN6B 4Y24A 1U12A 4AHYA 2D3RA 2ZABA 3DUIA 4COZA 4LA2A 3TN93 5GLVA 1LOFA 1QJU3 5A3MA 2ZGQA 1QQP3 4RS5A 3RMXA 5FPZA 2UYAA 4AFDA 1AR83 1ZBA1 2ZX4A 1QOTA 3ROUA 1RUJ2 1PGW1 1URXA 1AX2A 3T2TA 2B45X 4K21A 4CEYA 3IN9A 4HSJA 4INDA 5C8CC 1LOFC 4Q8KA 5BNPC 4FOVA 3SCHA 4MX3A 2GN3A 3DV8A 3URFA 1AUYA 4DRVA 4BIFA 5JCTA 2VG9A 4GKXA 5H9SA 1SBDA 3AFKA 4LBQA 3MEPA 3VBSC 2ENRA 1H8VA 3KGZA 5HCBA 2VMGA 3WDYA 4BE3A 2DU1A 2SLIA 1RVF2 4AXOA 1UKRA 3I2DA 1NA1C 3ZYGA 3J26N 4JGZB 2JG9A 2A3WA 5FLIA 4COYA 5BNNA 4PLMA 1POV3 4YSFA 2X8KA 5E89A 4UW3A 2BW8A 4QQHA 3VKLA 2VOXA 4HBNA 4Q4W3 1Q8PA 4XFCA 2B39A 2RJLA 2P3IA 1RHI3 2D6MA 4FSJA 1BK1A 1MZEA 3ZMOA 3M1HA 3WDTA 4BLIA 3JB8A 5D8AC 1GNHA 4Q0QA 1OQ1A 1RUG3 1GLHA 2ZCWA 4X6QB 3DKWA 1FNYA 1DQ2A 3DPRA 3FLTA 1FV3A 1LHVA 1OFNA 2RM22 4FXGB 5K7PA 3QLQA 1W6OA