3H54A

Crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h54A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h54A01
1VLIA 1XBXA 2WNZA 3BAJA 1SSGA 2ZRVA 1PJ9A 3W70A 3NYZA 3A9IA 2DZPA 4M7SA 1RD5A 4UTIA 1MVYA 5C5YA 1HNYA 2DZSA 3TSDA 3SR7A 2ZRZA 1WP6A 3W1NA 5F4XA 3DXIA 4JTEA 1CXFA 4O16A 1K03A 3BG3A 5AFDA 3DFQA 1W31A 1KBIA 1I2QA 1YXDA 5I3HA 4ZQOA 3TONA 3W7HA 1QMLA 5KZDA 3LI1A 3GBDA 1I2PA 3MJYA 1EEPA 2R94A 1A53A 1KGWA 1WZAA 3WY3A 2A2IA 2CLLA 2E8YA 1QWGA 2F7RA 3M7WA 1DBTA 3L66A 1T96A 1PZ3A 2VC6A 3CQ0A 3TOPA 3VE9A 1XBVA 4JY9A 1UH4A 2D0FA 3W84A 3QRHA 4NJJA 4CKQA 1O7DC 3EJQA 3PWAA 1VYPX 2TRSA 2GQ9A 1IXPA 1OHLA 3W7QA 2VFGA 1X7FA 2E68A 2D3NA 3UWUA 3M5ZA 4IMFA 5U7SA 5I23A 1AMYA 3PG9A 3KRSA 4FXRA 3A5FA 4P2VA 1KTNA 1R30A 4UQ9A 4LVBA 4FX8A 1SQ7A 2YW3A 1FWWA 1SO5A 3TX9A 4U2ZA 4WLCA 3VE7A 2E09A 2OT0A 4NQ1A 5D38A 3NPVA 1DV7A 1XGZA 1BKSA 2E5CA 2J9YA 2F1AA 1ZENA 4UFJA 1GVIA 4AEOA 3VM5A 4UQCA 5AYXA 3DFTA 4MLJA 1ME9A 1I8JA 2EF9A 3C0JA 4Q4KA 3M44A 3VM7A 3IGUA 4K37A 1F6KA 3NQMA 4O11A 4P61A 2ZICA 5CZTA 4FMVA 4GJ1A 3B0VC 3MHFA 3W1LA 3NEVA 3EJTA 3E49A 2RKXA 1M6JA 3TIMA 3EWYA 3LV6A 4Z1BA 3SGUA 3ZT7A 1JCJA 2WNWA 3HO8A 4EWND 1QHPA 3TXZA 5I3IA 1JL8A 1JGIA 4UTWC 1C9DA 4FLQA 3S5NA 4UZUA 5IM51 3OVPA 3CZEA 1I4NA 3L67A 1KA9F 2BWGA 1QI4A 2C19A 1PHQA 1VB9A 2YSWA 5LGXA 3P5ZA 4RJEA 4HN4A 3N14A 3W3OA 4Z0JA 3BW2A 2DH3A 1QR7A 1RV8A 3OIXA 4YL2A 2R14A 4OU1A 5KINA 4FX7A 1G9HA 1OFQA 1GVSA 1VJIA 2NT1A 4UFIA 4OIFA 1TPC1 3DZ1A 4KWWA 4D2JA 3QF0A 3CB8A 3QPZA 3N19B 4GUHA 1GG0A 2NXHA 1WDWA 2CZFA 2A4AA 2NX1A 4NXSA 3C6CA 4TO8A 3O15A 3HPZA 3EX3A 3QH2A 1VH7A 3BG5A 4O12A 4XZ9A 5BMWA 3P81A 4JTJA 3T4CA 5E1QA 1R34A 2WVVA 3O1NA 2A5HA 5I0DA 1JUKA 2RDWA 3W85A 1DKWA 1E43A 5DY3A 4M6VA 1VFMA 1JCLA 2BHUA 4I7VA 3R89A 2GJNA 5HNRA 3WEMA 5SWUA 2QF7A 1UD6A 3ZR5A 5G2IA 1FXQA 4Z1DA 2ISWA 3DI0A 5MHBA 3FFSA 2WANA 5K7JA 1PHWA 4R53A 2V8ZA 1WZLA 4CCEA 3KRZA 3QZEA 2YCEA 1XCWA 1W0MA 5CZ0A 5EPDA 1PS3A 4H7VA 3CLWA 2FE0A 2CLEA 3EWXA 5CPNA 4CQ9A 3BVXA 3L21A 1WE5A 1LBFA 4TMBA 3SW6A 2QR6A 2ZYFA 4TIMA 3STGA 2BHYA 4B9ZA 3P62A 1CGUA 4DBEA 4ALDA 3VNDA 1YTEA 2Z1KA 3BUBA 4LPCA 4K36A 4GO9A 3ABOA 4HNTA 3HOJA 1OFDA 4BI5A 3HF3A 5HQEA 5I3KA 1VCGA 1C29A 1KM2A 4YLWA 2GQ8A 3B0UX 1LORA 3L0GA 4AAJA 3C2FA 3DFNA 2ZFAA 3ZS4A 4N02A 1AQMA 1S46A 2YXGA 1IIGA 1W5PA 3CU2A 3MYOA 3K8KA 3QMSA 4NJKA 1HVXA 3WENA 5EYWA 3AJXA 4O15A 1TQSA 2VUYA 3BUIA 3DU0A 4LC8A 4M8UA 1U2YA 2QCFA 4UFLA 2WVVB 1GPWA 2F61A 1R33A 2VKZG 5C2XA 4JFSA 2A85A 4AHQA 2EADA 1QCWA 3I6RA 4X2RA 2G95A 4RX0A 3OLIA 3I65A 4O4VA 4AEFA 5U4NA 1LRTA 4N4PA 1KLZA 1EIXA 3CZLA 3GR8A 3QYQA 4NX5A 1RP9A 3BLFA 1CPUA 4GRSA 1W54A 2J24A 1SU5A 2Y85A 3WDIA 1A5CA 5D2XA 1O5KA 1G67A 2QCGA 4AYSA 3EWWA 4UNIA 4J7RA 1QOQA 1OB0A 4JD4A 5E9AA 3DHFA 2E77A 3K30A 3GXDA 3N2XA 3WJSA 2Y24A 4TR9A 1OFBA 1EWEA 4RK8A 5G5IA 1Z32X 4JX6A 2WSKA 3CV5A 5DO8A 5H91A 4ZQNA 1XV8A 4FF7A 2YJQA 3NL3A 3LV5A 1NVMA 2CZEA 1L9WA 5IBXA 1OYAA 2DJXA 4LV9A 2QJHA 1JAEA 5A6LA 2J27A 5KITA 1H7XA 5EMUA 3TSBA 1F76A 4O17A 5BRPA 1XM3A 5TD4A 3LPOA 4WJEA 3V1PA 3ELFA 1J0JA 4JTLA 4CLMA 2R8WA 1VC4A 4E2DA 2J9ZA 4FO4A 3ZO9A 4J3SA 4FXSA 3ZSTA 4AB4A 3IVTA 3BMVA 3OEXA 4BI7A 4GUJA 2E6YA 3MHUA 1OFEA 5CPMA 3LB0A 3D52A 2QUVA 1XSIA 2OSXA 1NEYA 5FF7A 1FCBA 3WNNA 2E6DA 4PSPA 3W73A 7CGTA 1TQUA 3P60A 2WSQA 4RXGA 2BSLA 5C54A 4M56A 3L2MA 3ECQA 1KTBA 2VXNA 2YGYA 1JDAA 1DL3A 3IIZA 3GYEA 2WSPA 1UH2A 3KAOA 4QITA 2WVUA 3PY2A 3Q58A 1F7BA 2E6AA 4UFKA 5LSMA 3BW3A 4WD0A 4X9SA 3CC1A 3BUQA 1FUYA 2YIHA 3K8MA 2E1DA 3QPYA 4G1KA 3MP3A 4AHOA 1EPXA 3TSMA 5FI8A 3B06A 1A5SA 3GK0A 1KV8A 1W5MA 5F1VA 2CLOA 1W3TA 2CZDA 2X16A 3HPXA 3O6YX 3L0NA 3CIWA 4WZHA 1TQVA 1O94A 2QUUA 3LXBA 3LI0A 3W7LA 3LOTA 5D32A 1QFEA 1CGWA 1MW0A 3NNTA 1CGYA 3W71A 3TV8A 5LNSA 2A7NA 1WV2A 2FHCA 3E12A 2PC4A 4JIQA 1SUXA 4KWVA 3UERA 5EMYA 3S8HA 2WCGA 1WYIA 2V5BA 1P4CA 1PE1A 5AC8A 3M6YA 2VENA 3C3NA 4RR4A 5AHLA 3T78A 1MWOA 3BK0A 3AO0A 4UTUA 3HJZA 5G2HA 1U83A 2FFCA 3UY7A 3HQ1A 4O4WA 4NZFA 4PODA 2XVLA 1TREA 1M5WA 2P0OA 4AXKA 1ZAHA 3LM7A 4IPIA 3NDOA 3S0CA 3GIYA 4BA0A 1DJNA 3UXAA 1L6SA 3ZR4A 3NL2A 2A7PA 4Y90A 4UNKA 3RU6A 4JYFA 4CN6A 5C55A 3EXTA 1EUAA 1O95A 3GAYA 1KFCA 3MBDA 1ZJBA 2ZZ6A 2NWSA 4KKXA 4PL2A 1WO2A 5J5DA 1G6CA 2O7SA 4IMDA 1O5XA 1WXJA 2C13A 4UOQA 1WX0A 3HG4A 2GVJA 4MUZA 3WFZA 2R91A 2JKAA 3NQEA 3RILA 1B4EA 3GLCA 3UWVA 4WSKA 2BZNA 4O53A 4NNBA 1KFJA 3OVQA 3FW6A 3QJAA 4AYGA 4ZVJA 5AHFA 2GVLA 1F2JA 3C2OA 2NV2A 1H1YA 3EB2A 3LLDA 3O6DA 3EX2A 3VGDA 4KFNA 2Z2UA 2WNQA 1FDJA 1VCFA 4E2OA 4MY9A 3IIOA 5CGMA 4PEEA 4JTIA 1W8SA 4E2BA 2XWEA 1RZMA 1UB3A 4AIOA 1TPB1 2Y61A 3W07A 3HBLA 2ZUUA 3LCLA 3IIVA 3GKFA 4CN1A 4AEEA 4HT3A 5TQLA 4OV4A 4UC5A 4YCPA 1DTUA 4LUIA 5K4XA 4JCLA 3CGTA 1JXJA 1XFBA 1Q6QA 1EA9C 3R13A 4GQRA 1TJRA 1XSKA 3G1HA 2FHFA 3GR7A 3U2OA 3CZNA 1ZJIA 1NF7A 3TROA 4OHQA 2DP3A 5E93A 4HP5A 5HUPA 4FNSA 2ZUVA 3WY2A 4RZ4A 1ODUA 4MJMA 2VFDA 1QPOA 3LTYA 3M5XA 3EDEA 1N55A 3TW7A 4IMEA 1L2UA 4S2BA 4UTLA 3L2LA 5J5RA 2ISVA 1Y7VA 4ADSA 2ZUSA 1DVJA 1EO7A 3M5YA 1MEIA 3D4ZA 1YDNA 4NX0A 1SFLA 3S1WA 4O1DA 3L65A 1OFRA 3S1UA 4KWUA 1EUNA 4N6EA 1JXKA 3W7JA 1CXHA 4NZJA 4LRSA 3OA3A 5CZJA 3S5YA 3RIKA 1YLVA 2ZBTA 2J25A 1ZHAA 3KXQA 5LNWA 3IJ9A 1RP8A 1XKYA 3UZJA 4GINA 4LQ1A 4H6KA 3V75A 1GG1A 2C6QA 1UD3A 4JGDA 2RDUA 7TIMA 2WV8A 3W2UA 3ATYA 3TNOA 2BXYA 3O05A 2H3DA 5E6YA 1GVQA 2XN2A 2PE4A 4X3ZA 2AQWA 5EY5A 3W87A 1J0IA 4GUFA 4Z1AA 5D02A 2VFIA 1WOBA 3HGSA 3TK7A 1K8XA 3U8GA 4AVFA 4FLRA 3W1TA 1F74A 1G7UA 9CGTA 5E70A 2EPHA 3P82A 4LVDA 1D7FA 4MZ1A 3MHGA 5LHFA 2F18A 1F73A 1HTYA 2Y5EA 3F03K 3MWAA 4N9DA 1MW2A 3W7KA 2JGYA 3W88A 1UUMA 1FWRA 1G4SA 4W93A 4NNCA 1SMAA 2ZCGA 3E0IA 1QO5A 1R46A 3IJ7A 3L9CA 1PAMA 4U2YA 1BTMA 3EDKA 3HMJG 3VMOA 3HGOA 5EL1A 3G1FA 2D0HA 3TXVA 3I68A 1P1XA 1Z42A 1GYNA 3F4NA 3QQ0A 2WPGA 3TQKA 3W37A 4CQ8A 3QC3A 5I3JA 3GZ3A 2G3NA 3BUPA 2YFOA 1LOQA 4EIVA 1QO2A 3GKAA 2DZXA 4UNLA 4ONVA 2GVGA 4ML9A 4BZYA 4GE8A 2V5LA 3W7RA 1UH3A 4GNJA 1H7NA 4O50A 1U5JA 3II1A 3BAKA 2VEIA 3G24A 3DH7A 3VI2A 1O60A 5HULA 5DBTA 1XBYA 3WNMA 2DORA 2Y62A 1SZGA 4GUIA 3ZSSA 4WOQA 3FKRA 4HOZA 3K8LA 2HMCA 3EJRA 3LTPA 1TQTA 1UBSA 3NQFA 2ZA3A 2ZA1A 1H7RA 1WOAA 1TPH1 1JQVA 4ORIA 2F7QA 5BMXA 2H90A 3M5VA 4C1LA 2BHZA 4HPHA 1YTKA 4JR5A 2PWGA 3WY4A 2X2GA 1XH0A 2ABAA 4IGHA 2E8ZA 1KGUA 4WUIA 1P0KA 5F2GA 1PIGA 4QNEA 3M16A 1C8VA 2DZWA 4FNRA 3AJ7A 3P67A 1HXKA 3W23A 4ZMGA 4YWIA 2EHHA 2EQDA 2WO5A 2V3EA 1G7VA 3KFTA 2ATMA 1ZCOA 3S1XA 1VQTA 3LERA 4PEKA 2G5WA 1NFBA 3W7IA 3BAIA 4HNUA 3GXFA 1HG3A 2WPBA 4MY1A 3S5OA 2C7FA 1ICPA 3P5YA 3DFOA 3D51A 3VGHA 3UWYA 1VYSX 4Q32A 4JY8A 3W1MA 1HUVA 5A2BA 4TX9A 3WY1A 5D05A 3NR0A 3G8EA 4AH7A 3G1YA 2C14A 3NOEA 2NUYA 1AW2A 1GVOA 3L5LA 1XDLA 4JTHA 3LHUA 1VHCA 2JBMA 3BLBA 3GXPA 2V2CA 2QLYA 4UIOA 3EJUA 3VGGA 4XUGA 1W3NA 2WC7A 4O0ZA 1VHNA 2J6XA 1TQJA 1MXGA 2EGZA 4ZQRA 1D3CA 3WELA 3D0CA 3S6DA 5F7UA 1FWNA 1IZKA 1SMDA 3IEBA 4LU0A 1KWGA 1KM4A 3IIPA 5HINA 2ZA2A 1SW3A 3T40A 2QCNA 3BAXA 3QFEA 4GUGA 4BWLA 1OJXA 5K3VA 5A2CA 2ALWA 3P84A 4A21A 2ABBA 1XI3A 1JUBA 3G0UA 1TPWA 4I7WA 5E0KA 3B0PA 2GJRA 2CLHA 2TSYA 1BVNP 1OVDA 4O18A 4U3CA 2BY3A 2V3DA 2X30A 2O7QA 1OX6A 1D3GA 4HSNA 3UPBA 3GXMA 3BLEA 1AVAA 3OLGA 1KFEA 1OX4A 1H7WA 4AMWA 3P74A 3A23A 1G4TA 4XKYA 2VELA 3PULA 4TU1A 3RLVA 3UQNA 1MW3A 3A21A 4JL2A 3FLUA 2C16A 3BVVA 2VEPA 2JKPA 4JL1A 1KLYA 4IX0A 5D04C 1V5XA 4CNOA 2FJKA 2QJGA 3CPRA 5LNRA 4UTTA 4X9YA 2QAPA 2FHBA 3KL0A 1GEQA 4Z0SA 1WZKA 1CW2A 1QOPA 2OW7A 3A6OA 1XDMA 1VYRA 4J3UA 2WKGA 1Q4NX 5CLWA 3W9ZA 2VFFA 3EXSA 2CZ5A 1IIHA 4JTSA 4J27A 1Q3NA 3LBMA 5HUOA 5DBUA 3PBUA 3STEA 7TAAA 1EA0A 2G96A 2F84A 3H55A 3WEOA 5HPOA 1EWDA 4R34A 3UG3A 4R33A 4XQ6A 2DZUA 4TVUA 3FJ6A 1JF5A 1IF2A 2EJ1A 2W79A 1THFD 1OGSA 4JFUA 5HJLA 2Y4SA 1N8FA 2CU0A 3KVLA 3FYPA 2NSXA 3MMTA 4LY8A 3KVMA 1VCVA 4ADUA 1ONRA 3DC0A 2HSAA 2G97A 4FIQA 1WA3A 1OYCA 2HS8A 4FEZA 2DIEA 3C2EA 1UD5A 3T44A 2PRHA 1T8XA 1XH2A 1EP1A 1KM6A 3B03A 1NM9A 4GQQA 1H51A 1TPEA 3N9SA 4RCXA 3THAA 1OX4B 2FGZA 3DDFA 5G1TA 5D09A 4MOZA 4XKYB 4O1CA 1Z44A 4MY8A 1XSJA 2XFWA 4IMCA 2XN0A 3CT7A 4CQAA 3W1RA 1GZGA 1OYBA 3BH4A 2KZHA 3N73A 2FYVA 1O4UA 1OG0A 5HWNA 1K02A 1KXVA 1HL9A 1TYGA 3L4WA 4GWEA 3W86A 2EACA 2FH6A 3QSRA 1VAHA 4O28A 3IJ8A 1SW7A 4GXMA 3UWZA 1B3OA 3RLUA 2I9EA 1H1ZA 2QCMA 1I75A 4PFMA 1C8QA 2ZXDA 2OT1A 3AXIA 3FAXA 4NI3A 4JTGA 2EAWA 3TCEA 3W2MA 1RVGA 2DIJA 1SZFA 4UCFA 3BVTA 2HTMA 4UTWA 2C1HA 4UQDA 3VNYA 5LGZA 5LZLA 3GNDA 1GOXA 4LC6A 1P6WA 3EX1A 1YXYA 4JCMA 2Y89A 2GUUA 4NUWA 2D73A 2OW6A 1M7XA 1LP6A 3UG5A 3W22A 4LW7A 3TW6A 1I45A 2VOMA 4MKNA 3S5ZA 3VSVA 5FF2A 4H2CA 2GOUA 2GJPA 4LVGA 3BSGA 3QSTA 1KFKA 2X1RA 4LS0A 1Q6OA 3P61A 4MJZA 4JFWA 5I5RA 4Y8FA 1E40A 2FPTA 1PEZA 1S3HA 1JCXA 5FEXA 5AN7A 3W2LA 2AGKA 3R8RA 4JDBA 3UCQA 2QCCA 3L2IA 4K8HA 1TCMA 1V3KA 2WNNA 4FNTA 3QW4B 3BW4A 4MYXA 2WKLA 3QGVA 4AIEA 2QMJA 5KEZA 1H7PA 1LBLA 5D2TA 3VNZA 4Q33A 5DXXA 5ABTA 5AHIA 2UV8G 1HT6A 4MZYA 5H2ZA 5CPOA 3CPUA 2H8XA 2VRKA 1PPIA 4JX5A 3I7RA 5F1UA 5G1YA 3FJLA 1EP2A 3JRKA 1R75A 2J88A 3SJ3A 2YYTA 4LUJA 3K1DA 4M7TA 5FF4A 3S9YA 2F7OA 1JVNA 2PRLA 3OHIA 3W7GA 4DPQA 5HWMA 1GVRA 2EKCA 6ALDA 2E4TA 4U31A 5FF3A 1TJPA 1JCMP 4FB7A 1CGXA 2WKJA 1KW1A 2CXGA 1TMHA 2ZZ5A 3INPA 1Q45A 3TFCA 3WMSA 1JULA 3LRKA 3WFAA 3BCDA 2WQPA 3W2KA 1OSEA 2YR1A 1KM0A 3QQ1A 3NGJA 3BAWA 5D03A 2RDTA 3GXTA 2Y7DA 1IGSA 2B7OA 5BOOA 2RFGA 3KL5A 3LCWA 1N7KA 4M5PA 2YKKA 1H5YA 5DCEA 3DENA 3EDJA 1T99A 2JK2A 2ZZ7A 4Y96A 3PB0A 2B0MA 3SECA 1TTPA 2Z0IA 2CHNA 2YZRA 3I7SA 3DDGA 1MFUA 3HJEA 1ZFJA 4A2SA 3LXCA 3NA8A 5DLCA 3AMKA 4UFMA 2D0GA 4IXXA 3NO5A 3SGZA 3G1AA 1UASA 4UR8A 1AW5A 4RKAA 4KFPA 1H61A 4CNPA 1CXKA 5LNUA 1Y0EA 2ALDA 1OT2A 1HL2A 1R2TA 4LXFA 5CPLA 2QDGA 2IGTA 1S5TA 1W5NA 1LBMA 1YDOA 3W1XA 4WXZA 5AOUA 3BCFA 3E9AA 1UJPA 5HR6A 3IGXA 3BC9A 3GDTA 3CEPA 3CZSA 3WDHA 1L6YA 3LHWA 3WDJA 3WJXA 1LTDA 1S5VA 3ZWTA 3PS7A 1E3XA 6TIMA 5LNVA 1YDVA 5G2WA 1TTQA 3DKLA 3LCIA 1FQ0A 3W72A 4GIAA 2EO7A 1TTJA 1QNVA 4DQWA 3DFSA 4CN4A 1SZEA 2Q3RA 2AMGA 1HTIA 2E0PA 5F2MA 4ICNA 2GUYA 1RQEA 3ABSA 3DX3A 1BWKA 2A6NA 1AG1O 4GI9A 2A7RA 3WNPA 1CI1A 4WOZA 4MPQA 2QPUA 3W1PA 3SI9A 4AMXA 3CWOX 4LS2A 4LT9A 3RFAA 3USBA 4S1FA 1U33A 5K4ZA 4J3WA 4LVAA 1JUEA 2WVSA 1K7XA 3NQ8A 3DFPA 1X1OA 2XN1A 5TBOA 4B9YA 2IQTA 1JD9A 3NQGA 4CCDA 3L4YA 3KWXA 3P7YA 3RMJA 3WK3A 3OG3A 2ZX7A 5F4WA 5KSWA 1I2NA 1BVZA 5K9CA 4JTUA 4KFOA 1SO4A 3G1XA 3UYCA 1HO4A 1W5QA 2FLIA 4N9EA 3PR2A 1FDYA 4WXYA 5CZSA 4A3UA 1GCYA 1QWUA 4UQEA 3GDLA 1TO3A 2ZTJA 2D3LA 1TIMA 1LDCA 2FB3A 5BRBA 4A22A 4BF9A 3DHDA 3PF3A 1M7PA 1OK4A 5AHMA 3C56A 1MW1A 2ZRXA 4GBUA 3TFXA 3LRLA 5EBUA 1TRDA 2NX9A 4UUIA 2E6FA 1JJKA 1GVFA 4WSJA 4FLOA 3E02A 4IXHA 5FEZA 5CG7A 4DF0A 3DHUA 3VGBA 1TPDA 2V9DA 3QMTA 1OK6A 2FIQA 1NSJA 1D3HA 1KGXA 3RK8A 3VKJA 3ABRA 3VX0A 5HDRA 2B4GA 2FPVA 3FEMA 4JICA 4HOWA 1JRCA 1NF0A 6TAAA 3HPSA 2A6LA 3CZKA 1XL9A 4UTHA 3C61A 3EDFA 2JKEA 3SSJA 1J2WA 2Y2WA 3HGJA 5F2LA 4M19A 3KLLA 3QEZA 3BGJA 3PBWA 1TV7A 1W3IA 1L6WA 4H8HA 2ZX8A 1BG9A 1KTCA 1G94A 1BEUA 4E0CA 4C1KA 8CGTA 1FCVA 1BSIA 1J5TA 1DOSA 2B7PA 1QAPA 4LVFA 3W38A 1LLWA 3MI2A 3GDRA 2YDAA 2ZRUA 4ZZ9A 1ADOA 1OF8A 3DHPA 1QHOA 3IRDA 1CIUA 3O06A 4UZSA 1TPVA 3MP5A 1XCFA 3Q37A 1RQHA 2BY0A 2ZXAA 1ZAJA 1PL9A 1LM1A 3C8FA 3N2MA 2QCDA 5D33A 3GNNA 2DH2A 4BI6A 4UTMA 4AW7A 2WJZA 4GKLA 5D2YA 3S42A 3LHTA 4L4LA 3M9YA 1EP3A 2AAAA 3HB9A 2OJPA 3PB2A 4JTFA 1K7FA 4QM1A 1R2RA 3D4YA 2WCSA 5KZEA 1ICQA 1FWTA 1H60A 3WJYA 3WJWA 4OGZA 1RQBA 5AHEA 3L4VA 5DCDA 1CXEA 4OE7A 1TB3A 3TQVA 3E96A 4JX4A 4UMAA 3MO7A 1HWWA 4IMGA 1LRQA 3GVGA 3FIGA 2ZTKA 2FPYA 1K3UA 5CXPA 3RNDA 2CWNA 1K7EA 3NPWA 3FS2A 4UMCA 2CW6A 2AAMA 2GVYA 4NU7A 1ZNNA 1GQNA 1Z48A 2C0AA 2Z6IA 3SIZA 1B57A 2NLIA 3G1VA 3G1SA 5DCBA 3NXFA 3TH6A 3ZQ9A 3NPUA 2CLMA 5AC6A 2NXIA 3BSHA 1AL7A 3VX1A 4OT7A 3ZWSA 2Y88A 3OLDA 1PV8A 5D2WA 4UOZA 2ZZ1A 3B4UA 4HHPA 1V3MA 1IXQA 3MYPA 4XTDA 1KV5A 1TQWA 1PZ2A 1IXOA 1LZOA 3LGEA 3A5VA 3G18A 4QQ3A 3BMWA 2VEMA 3CIXA 4BR1A 5BNKA 4DO4A 1Q6LA 4H4IA 3PBYA 2NT0A 2QCDB 3C2VA 3DBPA 4LWWA 5C6MA 4O1AA 3WK0A 3W1AA 3BARA 3NPXA 2JGQA 5EKYA 3Q2DA 4HKPA 3D50A 2ZWZA 2D2OA 4UTTC 2ZUWA 4BK9A 1G69A 3NL5A 1SZNA 3TU9A 2ZQ0A 3TKFA 2F7PA 3UPWA 1UCWA 4FNPA 1XH1A 1VLWA 4POCA 1OABA 3N3MA 2Y7FA 4FX6M 1F5ZA 2P1FA 5AHNA 3OVRA 4LS1A 1V3JA 2BTMA 1YPFA 1G4EA 3GXNA 3BVJA 4O19A 3T7VA 1SO3A 1RR2A 2GJLA 3I7QA 4JEQA 4MAZA 3ATZA 4IOTA 3BAYA 3N34A 5DN1A 1GTHA 4U33A 1DHPA 3KLKA 2Y7EA 3UNDA 4ZQMA 1BPLB 3G8RA 2ATSA 2CLKA 1Q6RA 1P0NA 2V81A 1KFBA 1FCQA 3BLPX 4NJGA 3QM3A 3IVSA 4HOXA 3P8IA 5LHEA 1IXNA 1SR9A 1KBKA 3W1QA 2OSWA 1UKQA 1V3LA 1VRDA 1AL8A 1WZMA 3KOFA 3WNKA 1VZWA 4CCCA 3LCFA 4FLSA 3WNOA 1JD7A 1UA3A 5FESA 4O14A 2FB2A 4N4QA 2V30A 2Q8LA 3PAJA 3ZT5A 3TC7A 2XVKA 1A5BA 1MFVA 2YX0A 1HX0A 4Z1CA 4PH6A 4KMQA 4J28A 2H3BA 4EF8A 4LV4A 1DJQA 5DELA 2E5DA 1KXQA 1MZHA 5CGQA 1EB3A 3L4UA 4UTJA 4XTIA 5A2AA 1E51A 4CNNA 1KFLA 3KVKA 4HNVA 2VR5A 4LNYA 3DGRA 5BRQA 3WNLA 2Z6JA 3O07A 4OQVA 4BFAA 3BLKA 1CGVA 3EXRA 4NT0A 4OKDA 4O8RA 2TPSA 3UXDA 3BVWA 1J0HA 3AMLA 2YA0A 3VSTA 1W37A 1VS1A 2OYKA 1RPXA 2XIBA 3L4TA 3B8DA 1GJUA 3CZGA 2H6RA 1H50A 3PUOA 4LTSA 2ZRYA 1QWNA 4UQAA 2H8ZA 2NWRA 2FQIA 3IVUA 1SFJA 1I2OA 5K2ZA 1TV5A 4HPJA 2ZXQA 1FCUA 2BX7A 4ZQCA 2NUWA 4Z08A 3VFLA 1A50A 1FWSA 5EA9A 4HNNA 1KM1A 4EOUA 4PSRA 3A4AA 4RXFA 3EJSA 2OMAA 2YYUA 1MO0A 2YA2A 2RHGA 3PVFA 5IBXC 1WQ5A 3M1ZA 3STFA 3TE9A 2P10A 3LHYA 1EH9A 1P5BA 3FAWA 4QAIA 3GAKA 3MUXA 8TIMA 1QDSA 3NM3A 4O0KA 2C15A 4B5NA 3BVUA 4GI8A 4UMBA 1ZS2A 2BY2A 1UD8A 2OSYA 3MI3A 5HXMA 3G1DA 4FHAA 2W6RA 4JS3A 3VO0A 4N9BA 1DQWA 1KWKA 4HIBA 3UD6A 3UWQA 1MEHA 3W7OA 1KBBA 4O13A 1QW8A 4O52A 3W2NA 1NAL1 2QCHA 4RLIA 2VRQA 4FIRA 3Q94A 3NVTA 2CLFA 1HO1A 3JS3A 2C8NA 2PCQA 2E9BA 3LLFA 3IK2A 4GC4A 4MIMA 1J4EA 1PIFA 1VGAA 4OV9A 5AYZA 3M41A 1VR6A 5T26A 2VFHA 1W5OA 1RPKA 3VSUA 4RZ6A 3LCGA 1XCXA 2GPTA 4UQBA 3BLIA 5BW6A 1KM5A 4YXGA 1LWJA 1GJPA 1VPXA 1EHAA 4K39A 3EEGA 1GWJA 1H7OA 1XC4A 3STCA 1W56A 4JYEA 3CHVA 3TA6A 2Q8ZA 1G1YA 5KZMA 4NNAA 1JCNA 1R2SA 3C52A 1UD4A 2ZX9A 1S5WA 1YTDA 1VJSA 1B9BA 5D2VA 1KM3A 5AC7A 2RH9A 1JCYA 5I24A 1G5AA 4Y6GA 3SY5A 3VMPA 4MB1A 1FBAA 1GT8A 3WK1A 3HZ3A 2BXVA 4IPJA 3NQ6A 2EEXA 4GI6A 3NZ1A 5FEWA 2OCZA 3LRMA 1HFBA 3P8JA 2NXGA 4AWUA 3KVJA 3HIJA 2Q3OA 1QX1A 1CX9A 2W0UA 3S1VA 3OLEA 1UKSA 2PWDA 4W9TA 2YOCA 3LX9A 3GDMA 3WK2A 5HR7A 3M07A 1SSDA 2NUXA 3UEQA 1ME7A 4J3VA 3CM4A 5L9FA 3TTSA 1SPQA 1B0IA 3PC0A 4PA8A 1MSSA 1JI1A 3TJXA 2ZX5A 1CDGA 2ZZ3A 3HG3A 3LHZA 5DFAA 1K8YA 4OWGA 2PWFA 2ZX6A 2ZRWA 3EWZA 1JFHA 4NXKA 2X2IA 2GQAA 4EVZA 1ZY9A 3BO9A 1ZALA 1M53A 2X2HA 4K7YA 3UY8A 4RV8A 3L4XA 3GX9A 5GVJA 1OF6A 2I14A 4J9JA 1YPIA 1H3GA 4WQ6A 5A6MA 4J3TA 2TMDA 1FDZA 3W83A 4JFTA 3BGGA 3R2GA 5E0FA 4WY0A 2J9XA 2ZDRA 2E5BA 3W2JA 4QJ1A 4UCGA 3W74A 3UZ5A 4IQLA 3IV3A 2Y70A 3EJPA 3TC6A 2QJIA 1PS9A 3SFKA 2QV4A 4JIPA 1TMQA 5D37A 3TMLA 1DEDA 1IZJA 3R12A 4DBDA 2V82A 3L68A 2BY1A 3EWBX 5LKYA 4ZL1A 2NX3A 2ZIDA 3CTTA 2B7QA 2PWEA 3ABQA 1ZAIA 3M47A 1G4PA 1UA7A 4JN6A 1YYAA 4O1BA 5DXYA 3NQDA 1IV8A 2VNCA 5I3GA 3UG4A 3W6YA 4U28A 2Z1BA 3THQA 1YADA 2DZVA 5L6UA 3QW3A 4JTTA 1WAUA 3LXAA 3BPWA 4X0NA 4O54A 2F7FA 1XXXA 5CGTA 1LOSA 2BLEA 3PUEA 1JQXA 1WBJA 4JFVA 3L0KA 3ZFHA 3LBCA 5KTLA 3DI1A 4IUOA 2EAEA 3TUUA 1CGTA 3O16A 3NQVA 1TPFA 4HPXA 5D30A 5HMSA 2BXZA 3W7DA 4JXCA 3GTNA 4TMCA 1GJWA 1I2RA 2YFNA 5F2IA 1ME8A 1TQXA 4OJYA 2QEZA 1OFPA 5K9XA 3TR2A 2YW4A 1W9XA 1AQHA 1LRNA 3PG8A 1ICSA 4K38A 2WSYA 4L4MA 3TDFA 1MXSA 4UTKA 4J3XA 2QDHA 2OYMA 3GBEA 4O10A 3NQAA 4YMZA 1M7OA 4LOCA 1H63A 3TAOA 4PCSA 3DX4A 2Y7GA 1AW1A 4WY0B 1UOKA 2DJLA 3EWUA 1CLVA 1JRBA 1DQXA 4AHPA 2F1BA 1TCDA 3B05A 4XBSA 3L4ZA 4A29A 1QW9A 5DY2A 3DAQA 4K6AA 1VFOA 1VIWA 2V2DA 3DX2A 2A0NA 4S2CA 3RF9A 4Y9AA 1QPKA 1B4KA 1A47A 1LOLA 1F05A 3DX1A 3GXIA 4JNMA 2QUTA 4RZ5A 1VFUA 2QPSA 5CLTA 3W7MA 3B04A 2A1YA 1JDCA 3C4UA 4I9AA 4UR7A 1JIBA 3JR2A 3DX0A 1D9EA 1YXCA 3W7EA 1XD0A 1QI3A 4UXDA 3HG5A 1F6PA 1LYXA 4H8UA 5F4SA 4EF9A 2X1TA 1TRIA 5AB3A 4AWTA 3VGFA 1XBZA 2G3MA 3F1QA 4MYAA 1K8ZA 4NJHA 1SW0A 2OX1A 3O6CA 2CPUA 5E6ZA 3MW7A 2V2HA 3G3DA 3KEHA 2OYLA 3VMNA 3N9RA 4AWSA 4M6QA 3PUDA 3L5MA 4R7JA 2FTPA 3WN6A 5HWJA 3LHVA 2WVTA 1BAGA 1KB3A 2ZWYA 3FOKA 3H53A 3NAVA 3EX4A 3VCRA 4PC8A 4K7VA 3A47A 2Y6ZA 1TTIA 2ISSA 1FX6A 1GYLA 1U30A 1HL8A 2YPIA 4QISA 4JYDA 4MFDA 3SZ8A 1V7YA 2F2HA 3M43A 1KCKA 3LDVA 3GB6A 3IIXA 3LTSA 2XIIA 4AF0A 2X1SA 1CXLA 2LLEA 2NZLA 1XD1A 5G4EA 2DU2A 3CEUA 2V3FA 1LROA 1T0OA 4WY0F 2OZ0A 3W76A 4HA1A 4ADTA 3G0XA 4MLRA 1JF6A 4X22A 3TJLA 1PCWA 1B2YA 2QMKA 3NG3A 5I3FA 3W75A 3CLMA 3MBFA 4NJIA 1WPCA 2WSRA 1J0KA 5G4WA 2QCLA 3PSVA 4I7UA 4CGTA 4WX2A 3EKZA 1AMKA 3PM6A 3W7PA 4MZ8A 2QAFA 1PIIA 1ALDA 5AYYA 2QCEA 3H54A 4DEFA 2VEKA 2VFEA 3KHJA 1OFOA 3LCXA 1LLZA 3C2RA 3MP4A 3KE0A 3HG2A 1PCKA 3BG9A 4DO6A 2TAAA 2I1OA 4GO8A 4ZQPA 3S2CA 2A21A 4M6PA 4JDYA 3BV4A 3YPIA 4QNWA 3W7NA 3FA5A 3T55A 3A22A 4UFHA 3ZT6A 2ZZ4A 4N2YA 4ATWA 1KBJA 1H62A 5CKSA 3PSWA 1BF2A 4NVTA 4JTKA 1OT1A 4QIUA 5TIMA 1MXDA 2PURA 1BLIA 4LRTA 1X6UA 2XVGA 3M0ZA 1LWHA 2ZXBA 3KRUA 1OX5A 3FKKA 4ORMA 3W1UA 3NZRA 4QSHA 2X1UA 3MI6A 4YCOA 3VGEA 2CFFA 6CGTA 1LCOA 4PCFA 3NQ2A 4U4MA 2X2JA 4WF7A 4N6FA 4DXVA 4IJBA 1PVNA 3QMRA 1JG9A 3BUDA 2PWHA 1GTEA 3TMQA 3PBVA 3KL3A 2HS6A 4FNUA 3L5AA 4A2RA 4AF0B 1X8FA 1BWLA 4GFSA 4QAWA 1NOFA 1KCLA 3TTYA 1UD2A 3CTLA 1SO6A 3ZOAA 4H3DA 4PTNA 1QPNA 2B7NA 2CLIA 1DHKA 5K9DA 1OFAA 4PCTA 2YA1A 5CSSA 2V0TA 2ZZ2A 3TAKA 2XWDA 2C3ZA 1JDDA 2C18A 1CYGA 1TV8A 1EX5A 1XUUA 1JR1A 4DF2A 1FXPA 2DZTA 2FDSA 3IGSA 5A8GA 2TYSA 2NV1A 3G22A 4MFEA 3G3MA 3GDKA 1QI5A 3A24A 1R47A 1A5AA 2WOQA 3ANYA 3WJZA 5FF0A 2EABA 1W1ZA 2Y63A 3ZR6A 3KX6A 3W7CA 1UKTA 2ZE0A 1CXIA 3UWWA 4BWLC 1MEWA 4PL1A 1EO5A 2VT0A 5CSRA 3NQCA 3VU2A 3AXHA 4XWUA 1Z41A 1DORA 3NQ7A 4XB3A 1FY6A 4O57A 3TQ0A 1KXHA 1UUOA 3R5EA 4HSOA 1QPQA 5FEPA 4IWWA 4AMAA 3CWNA 1TPUA 1ML1A 1QPRA 4DELA 5KMYA 4IX2A 3EKLA 4XBKA 1WBHA 1L0PA 3FYOA 1ZJAA 1TSIA 4DF1A 3U6WA 3EDDA 2FH8A 1JI2A 4FNQA 3NM1A 3OBKA 2ZUTA 3LCHA 4E38A 1X1ZA 5A5WA 3DKJA 1E3ZA 4K8EA 4CVWA 4MVAA 1KXTA 3G0SA 3P80A 4DO5A 3F4WA 1XUZA 2PRMA 3EX6A 3HGRA 3O63A 4DPPA 4N9CA 4OBTA 3LPPA 3O8AA 2QKFA 3NL6A 1AK5A 4H8VA
chains in the Genus database with same CATH superfamily
1VLIA 3BAJA 35C8L 4A8IA 3UBXI 1CICB 5F4XA 1H8SA 3DFQA 1I2QA 1E4WL 1UZDA 4BFIA 5I8CB 3F7YB 4NZRL 4WFFE 4UF7C 1A4KA 2Q9OA 4IRJD 5FFOA 5I0ZA 3M7WA 4ZS7H 1J8RA 1AP2B 1PZ3A 2A74C 3TOPA 1BBJA 2PDNA 2F74B 1G0CA 5HNUA 4NZDA 1MMFA 2K6ZA 1P6FA 3OZ9L 2NVCA 1DVFB 4ZGYA 1MJJA 3AALA 4O2EA 5AAMA 1D9KA 1VKXA 3AHVA 1MFBL 1BKSA 2IDTA 4J1UA 4GKSA 4Y2LA 1O7DE 4N0YL 1IAOA 4FP1A 3O6FC 4LARL 4S1RH 4NKCA 1M1XA 1NELA 1P7QB 2RGSA 1USQA 2OZ4L 4WFGE 4KDWA 3VG0H 3CQPA 3CZEA 1KGYE 1R19A 3FFDB 1I4NA 3LQLA 2C19A 4YVUA 3LVTA 2VC2H 4YGVA 1KIUA 4Z7VF 2I5YH 3DN5A 1EDQA 1G9HA 1CECA 2V63A 1TEGA 3C6EA 1L6XA 3THDA 3R0NA 4B96A 3AG4B 4NBZB 4GAAA 1UR2A 5DY3A 1A02N 3R89A 5IIEB 2X12A 2DIAA 2QF7A 5EEXA 1OAUL 3EWXA 5FO7A 3N41B 3DIPA 5EOTB 4NZCA 4TIMA 4PJ7E 3CUZA 1S78C 3FN3A 1UC6A 4NNYB 2ON3A 1DVXA 3ESVF 3BUBA 2Q86B 1OFDA 3VJ6A 1UJTA 1C29A 4WI0A 2MHAB 1N4XL 1LILA 3TBBA 2YXGA 4GKZB 4JM4L 3MPCA 1MCHA 1HVXA 4ZUSB 3R8HA 4QRRD 1I7ZA 1U2YA 4NC0B 4F2BA 3C5SA 4UNVA 4X2RA 2VXVL 3PP7A 1ZOXA 1ECQA 4PBVC 2XV3A 5JPNC 1SU5A 3WDIA 3FCTB 1A3HA 4JD4A 5E9AA 3MKVA 5GISH 3UCCA 3RE0A 3M45A 1HINL 1YY9C 2WP3O 3IU3A 3FFCB 1R4XA 4JKKA 1OP3H 2A6IB 5C0CD 5DXWA 4BKSC 1V8EA 2HQAA 3WG7B 4NQSA 4QRAA 5HHXL 5DQDL 5EUOA 4OFKA 4JTLA 5DMIH 3BP6A 1VC4A 3WXVL 3MCG1 4J3SA 1V27A 3U0PA 4GUJA 2LT9A 3VH8B 5CEZH 3RHWK 2E6DA 1DE6A 4JO4L 1ORSB 4N90E 1HQRA 2NW0A 3M0MA 2O4EA 5KOVC 5GGTL 1YPZE 1OTUD 3FA4A 1SJEB 3TGXA 4WD0A 4RRPA 4N2KA 4PRDA 5A3IC 3K8MA 1V8HA 5C0EA 4AHOA 1EPXA 1D6VH 3DUHA 1P53A 4YBHA 1XYBA 3NH7H 3DOSA 5DD0L 1Z5YD 1JYWA 1QFEA 1RURL 4JM2D 3MUAA 2DPKA 4MD5B 4L3EE 4OZGF 1ZSDA 1MWOA 5A6TC 2EYRA 4KXZH 1D7DA 2P80D 4FXKC 4PU2A 3UJRA 3F6IA 2XVLA 2MFNA 3U4EA 1UWTA 3B2DC 3D07A 3HEIB 1EUAA 5SWQA 4KKXA 4TQPA 5AOZA 5J5DA 2E4FA 2NW3A 2C13A 3K13A 4UOQA 4ODSH 4LDCA 1K3ZA 3GLCA 3QFJA 4EI6B 3WLOA 2MEJB 2OZTA 3QGKC 1UB3A 2B1AH 3HBLA 3VOIA 4X0KA 2DSZA 5DQJB 3V6OA 1GVEA 1ODAA 3EKCA 4HIHB 1BVKB 1JXJA 1UCBH 4R7XA 3R13A 3IRPX 2C3HA 4PJ9D 5REQB 2DWDB 3CZNA 4RZ4A 3UC0L 2LAGB 5J12B 3QFDA 4Z0XB 4OF8A 4HBQA 4K3ZA 1O1ZA 3M5YA 4NX0A 5I78A 2B14A 4B27A 2EG6A 1CFMA 4YXKL 3IDNA 1QK2A 3K1GA 5GGUB 1AC6A 1GGOA 2Q8AH 2ZBTA 3HI6H 1XKYA 4K71B 4KIRA 3MA7A 3MLUH 1FG9C 2HVJB 3GSQA 4W4QA 2DY3A 1DE5A 1N7ML 5D9SB 4KRLB 3O41B 1J01A 2YD6A 3U8GA 3ZIMA 3ZKSD 2EPHA 1B4TA 4W6XB 3RR4A 4N2EA 3G9AB 3F03K 3MA8A 3HMXL 5KVFE 3W88A 1UUMA 1QO5A 1OD8A 3G1FA 4LCCC 1JYXA 1Z42A 1GYNA 2WPGA 3W37A 4XHJD 3CVIL 2BVEA 1E6OL 4LCRA 2WTRA 4N2HA 4Z1PA 4ODWB 1ZEAH 2J7LA 1KV3A 4J4PA 4HOZA 4PV9B 5AW6B 5MP6L 1VPOL 1YEHL 1S7TB 2EXWC 1EAQA 4QOKB 1X5HA 2Z7YA 1LJYA 3OJDB 2KBGA 1PIGA 5E7BA 1YYLL 3DBNA 3PXJA 3LERA 3BAIA 3IDXH 4X99A 4CKVX 4QBXA 4G8EA 4UUJB 4KJPC 3DFOA 3U4KA 3UWYA 3QNYA 3U6XS 4PMQA 3G8EA 1DQLL 3LSOB 2PDXA 4R96A 4IICA 4DJEA 4ZSOB 3IJSB 1XR2A 5D1QA 2BOBB 1DWAM 1Z2KA 4LGXA 4XVUC 1FBIL 2VLRE 1C12B 1CLOL 1FWNA 3U7YL 2WMIB 3LYRA 3L3OC 1RV6X 5FJOA 1HZLA 5G4MA 2XT1B 3MRRB 4MKTA 3HPLA 4PRAB 3FU5A 2QTEA 5FA5A 1TSRA 4IBYA 2V3DA 3F4DA 3WYZA 2GQHA 3WN5C 3OLGA 4U1HB 2PTYA 4UU9A 4B9KC 4U6XB 3ZZQA 4GAJH 4HIXH 3FKUS 4KQ4L 4Q8WA 5EC2B 4FQQA 5D04C 2LTQC 5I73B 3AXMA 2QJGA 4AYMC 1OTSC 2HT4D 4G8AC 4JPQA 3C86A 5BXSA 1IIHA 2AEPL 4UV4L 3ARYA 3ISWA 3VB9A 2DI9A 2PR9A 5ALCH 1NFAA 3ARUA 1NMCC 4WK2B 3GSVA 1IAKB 1VCVA 1FRGH 2HSAA 4QT5A 3FH5A 1OANA 4IU3A 5E6IA 3MV01 2ADFH 1XH2A 2F58L 4BK5A 3MRMA 5BXTA 3A4FA 1TPEA 2H26A 5IW6B 5JHAA 1TZAA 3POCA 4RSVA 5C0BA 2N59A 2FX8L 1I9CB 4PRBB 4P3DB 3FUKA 4QXGL 4PJGA 3BH4A 1OB1A 1CFSB 1EAJA 1NLBH 4RAVB 3FYIB 2GK2A 3GYCA 3WKML 3T4AA 5HGDB 1SY6H 1DLHB 4JKLA 4U1GB 4F7PA 2VSDA 4ISVB 4LC6A 3G6MA 3AFBA 2H3KA 3MRJB 4F48A 1U95B 4BHUA 5DVMA 2VOMA 1JDEA 4MJZA 3CDFA 5I8EB 1FO0H 3XIMA 2DYPA 1DFBH 1U8LA 3R8RA 3FT2B 1LL7A 2B5IB 4N2CA 3PXLA 4FQXD 4FTVA 1HT6A 4KKLC 2BRRH 2OPCA 4DP2X 2YYTA 1FH5L 4QKTA 4XP5L 2IWGA 3DBXB 1E27B 1AZZC 1NCHA 3GMNB 3K6FA 4UILL 4IKKA 3MNZA 2EILB 2IANB 1RBLA 3W2KA 1QTPA 3ALWA 3QCTL 3ALGA 3WEAA 3LEYL 4JFHE 3QORB 3DDGA 3QIBA 1DDHB 4AXNA 4MWAC 1BEYH 6XIMA 3EIFA 5BO0D 3VIIA 5C0ND 2Q0ZX 4NPJA 2N56A 4G3YL 4N68A 3LGDA 3ONCA 2EP6A 3TBCA 1L6YA 3OF6A 1M2VB 2XZCH 4DJMA 5A7EA 3B9KC 4B5TA 1OP9A 1SN2A 4U3AA 4XP1H 1NEUA 1KRCC 3LKSB 3SDDC 4WOZA 4YTTA 1GOWA 3WXWH 2WLIA 4UR9A 2ATPB 1U33A 3FB6A 1FVEA 5TBOA 4B9YA 4L2YA 4ZAKA 3R4IA 2H8PA 4JTUA 3HRZB 1HO4A 4A2DA 5D93C 5I0XA 3N6HA 1AJ7H 4LLUA 4YHYB 3OM3B 4GHRA 4DM1A 2J1XA 4LCIL 3IFOB 3TFXA 1M57B 2FJHB 1TV2A 4KMLB 2I17A 5CG7A 1CB4A 1Q94A 3VX0A 2VC7A 1LQAA 5HDRA 5G55A 4NT6B 2VWEC 4PGDA 3A67H 3TOYA 4M1DH 2Y2WA 2G4FA 3O81A 4UTBH 4PJBB 2ZX8A 5I6PA 2E7MA 4JFOB 5HVGB 3T65A 3BJTA 3QKZA 1J5TA 3U1SL 2B7PA 4WZ9A 3REVB 5C0AA 1XGEA 4KXAA 5FW6A 5FO8B 1E5NA 4ALAL 1Z7AA 3C0SA 2K3TA 1SDDB 3DJTA 5I2IB 5EU7C 3Q37A 5IQNA 5LA1A 5C0GB 3LA4A 1LM1A 3NUKA 4MCMA 2ODOA 3N2MA 1AANA 1HH9A 5DLMH 2BNRD 2R4RL 1KJ2L 3BO8B 2D03L 5IOBA 4LQFL 3RRAA 2JCCE 2IAMB 4GG8A 1RQBA 1SJAA 3UNTA 1ZTXH 5DCDA 3ETBJ 3TQVA 4KOBA 4JX4A 3EOOA 3CV7A 4D0CB 3LN4B 1WTLA 3FN0H 5CXPA 1J8HE 4ZPVA 2GUOA 1Z48A 4XWGH 2NYYC 3VFMA 5L0QB 2BMBA 5B22A 5EOCJ 4BR1A 3QA3A 3PNWB 4XMVA 1V6TA 4GUQA 4HU3A 4G8GE 1DSFH 1AD4A 4LSTH 4LF2A 2ZUWA 3H4FA 1A5UA 3TU9A 3Q05A 1XR8B 2AJYL 3E8UH 4XPAL 4EZJA 3MS8A 5JBDA 2IDCA 1SPDA 3B9AA 4PUMA 3BAYA 2OMWA 5FSEC 1AY1L 1NC4A 3DUSA 4BFEA 1H8LA 5J6HA 3VWKC 4PJXB 4D8AA 3L9EA 4C4KT 1ILSA 4LRIC 2VQTA 4JO3H 3F7VA 1OEPA 5D1XD 3KLAA 1IGMH 4Y1AB 3TJHC 1S7VB 4MTMA 4E5XB 1HX0A 3C09C 1E51A 2WTOA 4GSQA 1M03A 1JNDA 3EA1A 1MQ8A 3IFPA 1AYOA 3JZYA 1VA9A 2JIXD 3EXRA 3CSFA 2PO6B 1ZE3C 4MB5A 3FHQA 2YA0A 3LZFL 3VOJA 2XIBA 3VD5A 5T3XL 1GJUA 2H47C 1XEUA 1JRHH 3B34A 4FQCL 1QSFD 2H8ZA 3AY4C 1SFJA 1NC2A 3RX8A 1M1SA 1NJJA 1I1WA 3ULUL 3WF4A 2J2ZA 4QYAA 4PMXA 4R9XA 1FN4A 2FL5A 1WQ5A 3Q01A 1MCPL 1U36A 1XF2A 1BZ8A 3LHYA 3KBPA 1US2A 1A49A 2W88A 3AS3A 3OAUH 1QDSA 3MRIA 1ZS2A 2CDFA 3G1DA 1WK0A 4KHTH 4J3ZA 1I8IA 3WFDH 3ZIYA 3UD6A 4TTDC 5CIPA 4RLIA 1E4LA 2C8NA 4PVMA 3FEQA 1J4EA 1R5IB 4ENLA 3M41A 3F4CA 2YAEA 3KR3L 3LCGA 5AYBA 2JKTM 4GY0A 1H7OA 1A6TB 2J6VA 2DQHH 4XOBA 1GC1H 1B9BA 1PKQA 5IJVB 1YKWA 3WFEL 1H0DA 2YD5A 2Q09A 3VRIA 4JFYB 3FONB 4K9JA 2BP0A 3LRMA 1KKRA 2OCZA 5HI4D 5I76A 5CINH 3DUUB 3LMZA 3RHWF 2WB7A 4I9WD 3OX8A 4V15A 1BXBA 2WAQA 5E99L 3GSOA 4F58L 4XVJH 4P9HL 2W59A 4LUSA 5CCHE 4P2OD 2GFTA 1JFHA 5F21B 4D9LH 2Q2LA 1XLAA 1XGTA 1ED3B 3MRNB 3BRGC 1OADA 4I5RA 3D05A 3GMMB 4QJ1A 1TJGH 5IHSA 4NI6A 5IJKC 3BKJL 3R12A 4RWYL 4HGXA 1ZVNA 2O93L 2NR6D 4AVKA 1G4PA 1UA7A 3HNSL 5AAWA 3UTTA 1A7OH 3H9SE 4ES4A 4U28A 2Z1BA 1U3HD 1PY9A 3QW3A 4X0NA 5IVNA 2F7FA 4JFVA 3KBHE 5C2CA 5KTLA 5A2LH 1B4RA 1FGVH 1AOHA 1YN6B 5EIIG 2RDXA 1LRNA 1AR2A 1MXSA 2WMPA 3HAEH 3TYBA 3TYZA 5GJTL 4K0OA 1ZBVA 3WJJA 4LYQA 1TCDA 4HC1L 1EGJA 1VFOA 3F65A 1JWMB 1S2AA 1AZ2A 2LV4A 4WGHA 1VFUA 2UYLB 1UIOA 3RWFB 3ZDYB 2FVLA 3SYAA 5IB2B 1ASPA 1EZWA 3ARFB 1ZMYA 3BFOA 43CAB 1NL0H 3U4BL 1II4E 2AXGA 1WWCA 2PP7A 5ESQA 4AZBA 4R7JA 3PHQB 3V36A 1KB3A 3TP4A 5FO9A 5C8JB 2FJFA 2PTXA 2POZA 1FX6A 3G5VB 3RWDA 3N2CA 4H8WC 1T1YA 4S1SL 4QE4A 3R06B 2Q7AA 4H88L 1XLJA 4YDLC 2UY7A 4AWEA 4E9TA 1GW1A 3AT9A 4YHZL 4MLRA 2CE6A 4QEHA 4X22A 3AZTA 1IEAB 2OI9C 1PTZA 1WPCA 1J0KA 5G4WA 2GJZB 1LK3L 3WLSA 3T0BA 2BC4B 4XPBL 1ALDA 2VCBA 1UUNA 1DVSA 4HS8L 4YVPA 5DLLA 4G9FB 4RIRA 3HG2A 1TT6A 2YDQA 4CEXC 2XIMA 3A22A 3B56A 1M6OB 2QYGA 4MQ7A 1FRBA 1OT1A 2Q3XA 4NO3B 3QDGB 1LWHA 1R3VA 3FTWA 1W8OA 4WUKH 3VCLB 2DQEL 2GJXA 4JN1L 2WWDA 2V2WA 1EVUA 3GSMA 3TTYA 4B6ZA 3C8KB 3D12B 5C1MB 3IPEA 1H6FA 5L8JB 3NCCB 1JR1A 5HHOE 4Z2LA 3F2DA 1E9QA 3GDKA 1TV3A 5IQ7L 3WJZA 2F54B 4JRWA 4BK4A 4JUTA 4YTSA 1FV1A 3QUZD 3KP1A 3WEXB 1ML1A 2XZQH 2HN7B 5I8KH 4FHBD 5G4HC 3EYPA 5BRZE 3TNBA 3NABL 4E38A 4PRHE 4MVAA 4KDTA 2XHYA 3FQWA 3FQTA 5EZIL 1MRDL 3PNZA 1C5DB 2APWA 4ONGH 1SJBA 4MMXC 3BZEB 3VC6A 2FLBT 3FQNB 1PZDA 3IKCB 1MAMH 1EAPA 2YBVA 3CPGA 4N9OB 5EB8A 4K1WA 1I2PA 2ZYSA 3EA3A 1MCQA 4TULL 3RAJH 2VC6A 1BAFL 1CFTA 1PFCA 4NJJA 3KHOA 1E9ZB 4P2VA 3IAPA 3HE7C 1N2RB 3MAWA 4FX8A 1EJVC 5EU6E 3BSZH 1FWWA 3FJNA 5EZLB 5BV7H 1A5NC 2HT2D 4P04A 1KXTB 1IU1A 3JVGA 4RDBA 4NO2B 4LFYA 1TQCB 2J9YA 2X38A 1GVIA 4KT2A 3P4OB 5A6JA 4DQOH 5LWYH 4I3GA 3SUWA 1N18A 3OMZA 3AW5A 1UM4L 3AISA 2N4IA 3IGUA 4FA7B 1TJMA 2LFGA 3ZZ1A 1XIWB 4GRLA 3OKLB 2JKIS 3LV6A 1IC7L 2OQJA 2R59A 4NNXA 2BASA 4LBAA 4AQ8A 1NP2A 1L9RA 3ZKNC 2NY3C 3F01A 5J3HC 1S2EA 2H5UA 1HKKA 2H6OA 2ZOOA 4IBWA 2QQKH 1QR7A 1NEZA 2ODHA 5AOJA 5HD8D 1OFQA 1YY8A 5F7MC 3KCOA 1RU9H 5ES4B 4G9DA 2Z7UA 4G80A 3AU1B 4TO8A 3O15A 3EX3A 1VH7A 3T4CA 3IMRA 5IT2H 4I18B 2EKJA 3BL3A 4M6VA 4L9DA 1G4MA 4R9HA 1OAXL 5G2IA 3RI5K 3EOAA 2WANA 2AJXH 2O61B 1FWCC 3FO1B 5CPNA 1ZB5A 4KTDL 4U0QB 3R4RA 1A22B 3AACA 1GMEA 1DBJH 2HEJA 2J74A 4NG3A 5ADOL 1CLXA 4Z78A 2Z28A 4GSRA 2Z1KA 2QJNA 2XWTB 3V52H 4CADA 4H0IA 4PGCA 3BE1L 4AGNA 4M7KH 3VAEA 5KSAD 3ZXAC 4E9QA 2DQ6A 1JHLL 1P2CA 3MY9A 3I75B 1TQSA 1E5ZA 1WUEA 5EBGA 4POZC 3S35L 4Z2KA 1CC3A 1BA9A 4IIQC 2DQFB 4ABVA 5J6SA 4L37B 1BZOA 2PDHA 4QR7A 2OXHB 1OIMA 3WN5A 5E24E 1O5KA 2BO0A 4TNFA 4D9PA 3PUGA 4RK8A 1J9RA 3CAKA 2YJQA 4B7IA 2VUKA 1AGFB 2QJHA 1G87A 1XGUB 1F8MA 5TD4A 4KMTL 4MJID 2V7HB 1LM8V 5D7SH 1QASA 1MUCA 1DBML 1YNTB 1P9MA 1OHQA 1XSIA 3D48R 5GRYA 3QO0B 5JYLA 3N1GC 1UH2A 4MTVA 4C55A 4ZDHA 2EICA 3D3FA 3CC1A 2QZQA 4NQDD 2VGFA 3LKNA 5M17A 4R0LC 4OB5H 3SOTA 1D2PA 2EVGA 4HCGA 4WI7A 2XA8H 3SUTA 5JBEA 1RY0A 2J5WA 3NSDA 3LI0A 3CH9A 5HPCA 3S8HA 3LNPA 2P49B 4GW1B 5IOKA 4JRYA 3FFOA 1KELH 5KUMA 3C6LD 3BVNB 4O4WA 1PNDA 3M1BA 4MA8L 2O6EA 5ITBH 3UJTL 1DJNA 5T1KD 5TPWL 5J13C 3SQSA 1DJHA 4Z7NE 2NZ9D 3HPFA 3JU2A 3CSYA 4HCRH 3GSRB 1LO2H 4MUZA 5AW3B 3NQEA 4KPHL 3L3GB 4FYRA 5KYWB 4LB8A 1J1XL 3BISA 4L5ZA 2J4GA 4QJ4B 4UDUB 3QIWD 5I1DB 3F12B 3RO6A 4R26L 3EZ4A 3UYRH 3W07A 4P23B 3FDWA 3KJ6L 2YRPA 5IB3A 1BYBA 5HI3C 5ECVA 3GZKA 4ENED 1FZJB 2NQ9A 4GP5B 2CK0L 1LE5A 1QABA 1ZJIA 3GVVA 3ZE0B 3IETB 1NBZB 4AD0A 1SEQL 3LAFA 5DTFA 4S2BA 1RHHB 2OR9L 1V79A 1BG4A 5EV7A 3STZA 4Y4KA 1QHQA 2CKBA 1DQDL 4O5LL 1GPFA 4AQAA 2KH2B 2V33A 4D6HA 3PP4L 1H4PA 5IVZB 1U5HA 3B9KA 4F20A 1ANUA 5BMFL 5I3DA 4QCEA 4GINA 3WTSA 4LQ1A 3MACH 4H6KA 3SDDA 1OCOB 1C16B 4PUNA 4HYTB 1WC7B 4MJ4A 1GHFL 5EY5A 3W87A 1J0IA 1K8XA 5E9DA 5GZND 4GZEA 3MTWA 1RJYB 3P82A 5LHFA 1D7FA 4F9LC 2BW5A 4DN4H 3BEVA 5B8CC 2BIOA 1XLEA 2NTFA 3P0GB 4PJIA 4HJ0D 2EE0A 3CQFA 3TBWB 3OPZH 3MDWA 1HQTA 1FFOB 1SDYA 5C3LD 1QO2A 3O2DA 3ZKXB 1DUYB 3ARGA 4YDZA 3RZCA 3B0YA 3ABKB 3ARDC 5IV2A 2DV6A 3H7VA 5AVRB 4OOUA 5CCJA 1F1DA 4X4YA 1KCRL 1CLCA 4MVBD 1NIAA 3D85D 2HX8A 5F7FA 4OSUH 2V3EA 3O4LB 1LHZA 1NFBA 3TCXA 1HG3A 4Y4HD 4FHKA 4JOMA 1IE5A 3ZTEA 3OV6A 5A2BA 5F2FA 4WJ5A 1BWMA 3D6GA 4BFBD 2FB4L 1B5TA 2IDQA 4RE4A 3U82B 2P52A 5B21A 3SCVA 4S3EA 2X1OA 1DIEA 1EGVA 4ZFGL 3F7LA 1SJVA 1MCCA 1V7NL 3SKNB 4Y7EA 1NDGA 2QULA 1OVDA 2X1XR 1OX6A 3UPBA 1QRNA 2CUAA 3QWNA 3PJUA 1NSNL 3P74A 3NRPA 2GTWA 4XKYA 1E2VA 3ZHFA 2WBGA 3C60D 1BQHB 3BQUC 2JKPA 4M43L 3DTXA 1XRSA 2EG8A 4PB3A 2XTLA 1DVYA 2RA1A 2QVTA 2X89D 1IKFL 3SE9H 3PZOA 4DO7A 4PJCB 4M6ML 4Y9PA 2XTKA 4GIPD 3PWJB 3D06A 2FEEL 2ARWA 4KUZL 3CDGA 1J9QA 4PTWA 2CU0A 1P1MA 1TNNA 4M62L 4GEJA 4F7KA 4GZIA 1N10A 2C9UA 1QUNB 3LNGA 1KBWA 3PJLA 3I6EA 1E5JA 1XB6A 4MY8A 1XGYL 4PB0L 2HFEB 1GZGA 3N73A 1S2UA 5HWNA 4LASL 4HPOH 3D30A 2ORBL 2E27H 2CR0A 5T1MA 3IJ8A 4NKDA 1BLNA 2NZIA 1ND0B 1TFPA 1H1ZA 3O9WC 4AQ1B 3W2MA 3OAYK 4WWKB 4FJZA 2CHOA 1WIPA 3VNYA 2BWQA 4NUWA 1YEGH 3AY4A 2X87A 4LHUD 3DO7B 4XN4A 3BP7B 5F9OH 2GOUA 2IWEA 1LLOA 1YE6A 2C5DC 5AC4A 8FABB 4AL8L 4PJFF 1F97A 1V3KA 1S38A 3VNZA 2X4UA 1A3LH 1ECEA 4WW2B 2GW5A 1T03L 3QAZC 1UM6H 3WFLA 4YC2B 4H8PA 1QBLL 2H32H 1MFDH 4JFFA 2EDWA 1NY1A 1H2JA 3DROB 4AQZA 1SYSB 3O6LH 4MMZA 4HSCX 3NJXA 1FKWA 2G0LA 2GY7B 3LS4L 1O6SB 4QRPB 5EOCH 2HFGH 2HTLC 4RKAA 5B3SB 2YCIX 2KZ1B 2VR7A 1JBJA 3EGXB 2DWYA 4JQIA 2NNAB 3QJHA 4XWOD 1XCQB 3CZSA 3EF7A 1HF6A 3WDHA 1Q8JA 3QDMA 4PG9B 3FOLB 3Q9QA 3HZVA 4XAPA 4QHPA 3U9UA 2HH0H 3T77A 4J8RB 1N68A 4XVSH 3SDXE 5HDOA 4TL5A 4Z3TA 5C9JB 1CI1A 4F7CA 4MUPA 1B0GB 4LT9A 3USBA 5HYSA 4D8PB 1N0XL 1CR9H 1XGRA 4N2MA 2ODIA 1A4JB 1B1YA 3HS0C 2CESA 4U7SA 3KWXA 1BGGA 4LAKA 3P11H 3WK3A 4X6FB 4JQXA 1AGEB 4W9LC 2P45B 1AAJA 5DHVB 1CF8H 1GCYA 4UQEA 3SBPA 2W5FA 3GDLA 4OT1L 2EDTA 1UPMB 4XMTA 5KETA 3M0JA 1OK4A 5E8NB 3GIPA 2Z31A 4L8SB 4N0UE 2XSXA 1GZPB 4TSBL 5AWNH 4P7RA 4P5TD 6TAAA 3FA3A 3TIDA 3C61A 3SSJA 4CILA 2DQGL 4HEPA 2EDNA 1XIMA 4ACYA 5IQ9B 2OFJA 3LCYA 4QNPE 1I9RL 2I24N 2QADB 5F72S 1QAPA 3W38A 2ZG1A 4GB9A 2BNQE 3KW7A 4NN5B 4ZOCA 4I77L 1J8KA 2JKLA 4KC3B 4NRYA 3MP5A 2XN9A 4X80H 4WSHA 4JG1L 5HVFB 4GYFA 1KLFB 2BY0A 3UAFA 4IJ3C 4FFYA 2V38A 1FWIC 4B7LA 1V7ML 2YL5A 2YK1H 4WCYL 3PL6A 4QM1A 5IVXF 1RK5A 4B5WA 4ZXBD 4JKMA 1H5BC 4KGLA 4FJ6A 3TFKD 4UMAA 3MO7A 4QDMA 5I6MA 1M3IA 4XI5D 4GQ0A 1PBGA 4ZTYA 3NVDA 2NXIA 1FG2B 1KRMA 3ZTJG 3GUTB 4MRCA 2JJUA 1CFVL 1BOYA 3SPJA 3QN3A 1R5VB 5FUOH 4LU5H 3WHE0 3PHOB 4E9WA 4IFOA 5KBLA 2VR6A 4UTTC 4B3VA 3IARA 1SZNA 3B1UA 2F7PA 4JKNA 4GP4B 4LFHD 3RL2A 1OABA 3RWIB 1F5ZA 1RVFL 4DP7X 4XRCB 3HJ0A 5HVHC 3CX5J 3MLPA 2GJLA 5LBVA 3MWCA 5D2NB 4QTGA 4XMZA 4HIPA 3KLKA 3NIFB 1Q7ZA 2CLKA 2NY1B 4GMTL 3MUGB 3QEGH 2F6AA 1UR9A 3VFVA 3NOIA 3VI3A 3G6LA 4WHTA 1OAQH 1DXEA 2Y7QB 1KCUH 4LDOB 3BYTA 3ILQC 4J2XA 2V68A 2H3BA 3FF8A 2VZ3A 3RI5F 5CGQA 2QL1A 3D1MC 4WNQA 5A2AA 4XTIA 5KYYA 3T9WA 3DGRA 5JH2A 4PJFA 1CGVA 3OIHA 4YDKL 3RWGB 3D6NA 2CO7A 1YDYA 5LGJB 1P5UC 2G9KA 5K59F 2CGRH 1S1PA 3WIHL 2VLJE 1QLEL 5CEWA 2H9AA 2FQIA 2WC4A 3ZKMD 3OA5A 1ZA3B 4PSRA 2JJTC 1ZA6B 4XHQA 4RXFA 1WAWA 4HQQH 2RHGA 1AQDA 5CN1A 4X5QA 1YC8A 1N67A 3X11A 4XCEA 1OM3H 3MUXA 2PBOA 3GBML 3NESA 4ZMWA 2YD7A 2IH3A 2C1PB 1HI6A 4JFDE 4WGXA 2EPKX 3UWQA 1MEHA 4NO0A 1P0BA 1JF1A 1IQWH 1PY0A 3JWNE 4B5EA 3CL6A 4OVUA 1RZGA 1EFXB 1TKWA 5EZJA 3HE7A 3ARWA 2C34A 4PFHA 3S83A 2VIRB 3H2AA 2OTUA 2BWIA 4JE4B 1VJSA 2VW6A 2YRLA 5AC7A 3BH9A 3O7UA 3ZL1A 4KQ3H 4GLRI 1UACL 1ZSHA 3WEBA 3WNIA 8XIMA 4N0RA 2PUZA 3FOMB 4M51A 3WLMA 4P5MB 4GKTA 2XG4B 3G6JF 1L9NA 5I0YA 1DSYA 4DAIA 1B0IA 2Y7MA 2E9LA 4IRZA 1SRDA 3RJXA 4LPUA 2Y3NA 3FULA 1QNZH 4DGWC 4HMNA 5EZOL 3ID7A 4ZUVA 4YQXL 4JFTA 2RD0A 3H3BC 5E0FA 3OB0K 1LL6A 1Q2RA 4HK3N 2QJIA 1PS9A 3SFKA 5GZOA 4DJFD 1NCCH 4F0SA 4Q7BA 1Q9KA 4RFEA 3UYOD 5CKAA 1ULVA 2P8LB 3VOHA 3DSNB 4HK7A 3FUJA 4ZE5A 1R8LA 4E3VA 4G5ZL 3TNNA 6XIAA 3ORWA 5EDSA 2IEPA 3LBCA 3DI1A 3UIYA 1INQA 4JFED 5I5IA 5DHDA 4XNQB 2AV7A 3MUHL 4AYDC 3VXRA 3FSZA 5LNGA 2N1TE 4YZFF 3TJEH 4DJDD 5E00B 4LCYA 1CN4A 5TH2A 3DX4A 4WY0B 5IVXA 2F1BA 3SBWA 8A3HA 3ITVA 5DURD 2AV1B 2BSRB 5DS8B 2EXYC 3RF9A 4NHCL 4LOVA 4IIQA 4PJ5B 5FFGA 2CIIA 2XJ7A 1K4CA 2OTPA 3PQYB 1S9WA 4RZ5A 1EEQA 5CLTA 1JDCA 5AVUB 1SHMA 3E2HB 5JW5B 4UR7A 1ET5A 2CDGA 1QI3A 1MLBB 3UZWA 4XAGA 4WKHA 5DD6A 1HJVA 5FJTA 3V0AC 3QXBA 4HWZB 3KEHA 2IBBA 4P2QA 4AWSA 3U0WL 4N8VA 1JZEA 3WN6A 2B77A 1BAGA 1GGBH 3ALXA 5E94A 1TTIA 1JWSA 1MH5A 2ZCZA 3ARSA 1AD0A 3TVAA 3QDJD 1U8CA 4MFDA 4OFVA 2X1SA 4GG6B 2UV3A 4HA1A 2J62A 4JRXB 1KJ3H 3CZFB 4I6KA 4OZFB 3BV7A 2F8OA 1Q13A 3BXNB 4A2HA 4FGMA 3W7PA 3CMOH 2UY6B 4M93C 3O2VH 4DEFA 2VEKA 2R27A 1LLZA 2VYOA 1GYWA 2PN5A 3NK4A 3BG9A 4GSUA 4DK6A 2R7EB 3K2IA 3PSWA 4NY2A 8XIAA 5D6CA 3MLYH 1PD0A 3WUGA 5E7FA 1ITUA 1MREL 1TJHH 5KS9E 2P43B 3NIGE 3K81A 4PJEB 3SRHA 4K7FA 1HZHH 5E8PA 1NBVH 4HW6A 2A9NL 1GZJA 2QR0B 4MX7A 2CLIA 1UB6B 2I27N 1XIDA 1XRVA 1MCSA 5CFAA 4NCC1 4ZI8A 2CUMA 3G22A 5JORB 5J6GA 1YYMH 2R2BB 3A24A 4G5DA 1UXSA 4Z7VA 5F7YC 2ZE0A 4GFTB 4XWUA 4PP2A 1EEXA 4J6IA 4HSOA 4E9VA 4DELA 3KPRD 3U6WA 1T0MA 3EDDA 4KS0A 4N0CC 3CV1A 4A05A 4WDIB 3GHEH 4YHPB 4U1NB 1F4WL 5HYJE 4J3OH 2QSTA 1HSAA 5EU4A 3R0UA 1EZSA 4XNYL 5A16B 5C5YA 3EGDA 5DUMH 1V77A 1GPOH 3CBRA 4XBMA 3MRHB 5TE4H 3TONA 3W7HA 3LI1A 4F9DA 4MNQD 5AECA 3MJYA 3M8OH 4P2RD 4H1LH 2ZOLA 3L66A 5DR5H 3M17A 4MJ5B 3I74A 2D0FA 1O7DC 3S8FB 2GQ9A 4N5ED 1TVHB 4AE0A 3UWUA 4Q6JA 1IILE 2OJ1A 3G6JA 3W29A 2RAGA 2HE5A 3LKQB 1OF2A 1U91B 1KRAC 1NQ6A 2J73A 4RAUA 4D0BB 2BP8A 4MS8C 1LEGB 2NY2B 1M9WA 4IKIA 5IROA 2FZ9A 1ZENA 1TVNA 4E2VA 4LSQH 3DK2A 1WBXA 4B90A 4I90A 3P2TA 3UXIA 3C0JA 3B3DA 1ONWA 4JY6B 3HZKB 1PWMA 3S36H 4F9LA 2P53A 4YE0A 1EHLL 5B8CA 4AMCA 4AENB 4RDVA 2YBGA 1F6FB 3HMWL 2L7UA 2K6WA 4F91B 2WBJD 4NQED 3GC5A 4ODHL 1OQXA 2YSWA 2I16A 3FCPA 1MPAH 1BFSA 4E4PA 1IC5L 1IC4L 4FX7A 3MGOB 1TPC1 4KWWA 3LKOA 4KJYB 3RUGB 2QDEA 4ZSUA 1QKZL 1GG0A 3CXDL 2A4AA 1CD1B 4F2MB 1H49A 3MTRA 3ZLHA 1Z3NA 3W85A 5H94A 4POYA 2DEXX 5HNRA 1UXMA 2G3IA 3L81A 4W9IC 4ABUA 5CP7B 2J8UB 5CZ0A 5BS0B 5EPDA 2Q6WA 4D3CH 5H8DA 1QLEB 5HHPA 2IADB 4WHBA 3NSYA 3BI9X 5DO2C 3TN0D 1YJDC 3DTDA 2K8QA 2KDYA 1F6YA 4OZGA 3B2UC 3MANA 2GYIA 3MYOA 1MG2C 3CVHA 1AR1C 3VXNA 1UBPC 4LJ3A 2Z2AA 3WI9A 1RUQL 4I5BB 1NJ9B 1UZ8B 4N4PA 4UTCA 3VFWB 4HKXA 3BLFA 2C3VA 4AYSA 7PCYA 4BZ1L 3K30A 3N2XA 1OFBA 3BUYB 1H6TA 3MOAL 1TR1A 4J6RH 5LCVL 1YMMD 4BCZA 1X5AA 3MBEB 1V0MA 5A6LA 1ONEA 3EJYC 4XC1L 5F6IB 1XWYA 4WJEA 3P4LA 4KY2A 1FOBA 2JQXA 1D5MA 3S96B 1QFOA 4FXSA 3SUSA 1FAIH 4R2GB 1FFPA 3D52A 2QUVA 4NO5A 2PABA 5I1KL 1FCBA 1HP5A 1GGTA 4TSAH 3V6ZB 3TN6A 2PTWA 5FPIA 1PUDA 3IJ6A 3OZPA 3GIQA 5C09A 3QEQB 1US0A 5FC9A 5DUPL 4MSWA 3NO1A 4B95C 3QPYA 4ZX6A 1IARB 3LN3A 5D7JD 4QRSB 4XX1G 4LAQH 2E76C 4APQC 3MRDA 3BIAX 5K39B 4ZXLA 3CIWA 4WZHA 3BMXA 4FQLL 4HNCA 2XOTA 4QTFA 4CSSA 5IEHB 4ZQKA 1BMZA 3Q9PA 4CBPA 4CNIA 4Z8FL 1LG1A 5G2HA 3UY7A 3GU1A 1UFGA 1UXWA 1ZAGA 3L1GA 4G82A 2P0OA 4PUKA 2B1HL 1T21B 5L2KD 2Q02A 3NL2A 4JRFA 3DX7A 4Y90A 4G1NA 3GK8L 1ZJBA 4A6GA 4HU2A 5KYUA 3RBSA 2Y5TA 1T80A 4WTZG 1B4EA 1JTTA 2BINA 1RUPL 4NKIH 2Y5QA 1S5NA 3LNEA 3SE3C 2X0SA 1A4LA 5LA0A 5CIPH 5KSVA 4E9RA 3JBG7 3DPBA 2VDKH 4J2QA 3SO3B 3LLDA 2C4FT 3EX2A 4KFNA 1I3GL 4PLJC 3TVMA 3TR9A 2XWEA 5FHAH 5JA8B 4AIOA 4PTVA 1GZQB 3APYA 4UC5A 4YCPA 4KCVA 5K4XA 1XFBA 3VNMA 1EA9C 3N3TA 1TJRA 1JGMA 4HN8A 1J5DA 2AMXA 4HP5A 5HUPA 1RIHH 3KPSB 1ODUA 4F8TA 1EXGA 4HD5A 2WZPA 5KVDL 4ANXA 1CDYA 2ZUSA 4G7EA 4Q56A 4X98B 3D4ZA 3N3EA 4EZLA 3QW9A 3NFSL 4ZFOA 1KENL 4KCWA 1A80A 1CXHA 5FCSH 4LRSA 1GKPA 2DM7A 5DMNA 5JW4Q 4X7TB 2J25A 3WKYA 1EPVA 1WDRA 5LNWA 2PWUA 2CC0A 2DW5A 4NHVA 5L4FA 3ZJAA 2BSDA 3NIDB 1O5QA 4Q22A 2R69L 2MIZA 1LO0H 1FE8H 3MOQA 4MNHA 4RUBA 4Q0XH 2H41A 1R38A 4WHDA 4Q6KA 3ZLQC 1ZHNB 3CS2A 2PGRA 4ANVA 3E0IA 1FYTE 3VOFA 1AACA 2APBA 2IGLA 5I28A 4X5WA 3T71A 1P1XA 5CJMA 5K9QG 3EUUA 4B3KA 4EIVA 1ICTA 3QR2A 5C8BB 3I85A 3FN9A 1XGDA 4GE8A 3UAJA 1CIDA 1TQBC 3W2DL 3PZMA 2Z64C 3OZKA 1H11A 3D0VA 1KBPA 1QYGL 3VUAA 3TF4A 3PF2A 4WO0A 3O8XC 4WUIA 3O11A 3PWPE 1KJVB 1EGJH 4JTAA 3GGWB 2VLLB 5FCZA 4WWNA 5BZDA 2GDVA 2WO5A 3DYMA 1EDGA 15C8L 2NX5A 3CCHB 2FYYB 1HKLH 3S5OA 2BSEA 4KI5D 1DO6A 4F33B 3L5IA 1DBBH 5C07A 4TX9A 3EFDL 3AITA 5AZ1A 1C90A 4U3HA 4MNGE 4G1MB 4O0ZA 3LEPA 4YBLB 3L5WB 5FKPA 2HVKA 4LU0A 1UZHA 1NDMA 4Z42C 1RBAA 4ZS6D 1XI3A 3SQMA 3K6NA 2I60H 2JEQA 2X30A 3BQ6A 3GLDA 2CMRH 1RMFH 1X6LA 1OX4A 3T2NL 5IW1B 3RLVA 2VGLM 4F3FB 5F7LB 3S0PA 4IX0A 2Y07L 3X3GL 1T5AA 1LDSA 1IT8A 1SF5A 4G8IB 4UTTA 4XPHL 1NQBA 4KZEL 1M42A 3DIFB 4QRQB 3WFHA 4N22A 1KBGL 4YHEA 2VLKD 1PZ5A 4PWKA 4APXB 1G9NL 5HUOA 1CE6B 4RBPK 4X8XA 1MF2H 1IHIA 4GSDL 1QA9A 5IMLB 4R33A 3GY1A 2GGHA 3EG9B 1DWGM 3R11A 2A74A 3KVMA 3PWLA 3WLTA 1A6VL 1KDIA 2H1LM 3INUH 4GLEA 3DMMB 1KB5A 3GJFB 2PRHA 4RGND 2C0HA 1H51A 5DJ0B 2RGMA 5E9XA 2CERA 2ZCLL 4HFUH 3IUDA 2V7NA 3FDKA 3KWWB 1Z44A 3QUYC 1ZT4B 1DUZB 3CHCA 4IPPA 2GCYB 1G0XA 4IMCA 1YMHB 1W72H 3CU7A 2IS7A 1V0LA 4UANA 5B4MC 1D9KD 5ISZB 1TYGA 3ZVIA 4IUGA 1OAYL 3WMPA 3QSRA 1WA1X 5TDPA 2JNZA 1SW7A 3WS6C 4L0YA 1P1ZA 2I9EA 4YL4A 3UA4A 2ZXDA 3O6FA 2GSJA 5D5MB 3LPWA 2EDLA 2WOYA 4JFQB 3EYFB 3O0KA 2B4CC 1MRQA 3HZMB 5LGZA 4RA0C 1AA1B 4XPGL 2ETWA 2Y89A 2IOIA 3RG6A 5BWFA 4QMEA 3K72A 3NFPB 1I45A 2C1OA 2VN6A 4L1LA 1E40A 2VQ4A 4AZIA 2NY7H 3NGFA 1BQKA 3UX9B 5I1AB 3UJFA 4HGWA 2HLEB 5DK2A 5LBSA 4D7PA 3ML8A 4RV3A 2QBWA 3C6SB 5LNDA 3C0LA 4P48A 3BICA 5CPOA 3SE6A 3MXVL 5A94A 2AP2A 3NGBB 3GMLA 4HPGA 4MXWL 4IBTA 1VBHA 5MENB 2CXGA 1Q45A 5F89B 1CNVA 5D1ZI 3FSOA 1XICA 3LCWA 1H5YA 4E5TA 1QLRA 3LB6C 3PB0A 3EJZC 2GHWB 2Z0IA 4HBKA 1ZTVA 1OP4A 4UM9D 1NKGA 4IOFC 3ZHKA 1Y0EA 1SXSA 4LXFA 3SKMA 4CMHB 3B0XA 3KGRA 2N0KA 3WJXA 1LP9E 4A68A 1YDVA 3ROOB 2YCJA 3RFZB 4Z0BL 5JPNA 3CXHJ 1PYFA 2JWYA 2A6NA 3VD7A 3VRLE 1RULL 4P7QA 3VXPB 1KY7A 1Q9LB 2X3CA 3PXHA 2VD9A 3RFAA 5EEWA 2A83B 4Z2HA 2FVNA 3AOFA 1SN0A 1K9TA 2X0YA 1IM9B 4ATTA 4TOYH 4CCDA 5ABGA 1TVPA 3OG3A 3AMDA 1EJ6A 5E5MB 2X42A 3WFCL 1KTDA 4AIZB 1BVLB 1E4XI 1NKRA 3KBSA 3VQ1C 4ODVH 1TG8A 4WJXA 5FV2A 4A2MA 4D6CA 3HAEG 3MSYA 3D25A 4PJ7F 2BRQA 1I8AA 4JJHA 3UMTA 4RX4A 3M4HA 3GNXA 1XH3B 4LYPA 1XL9A 1UJ3C 3QR0A 2ZKXA 5ICYA 3PBWA 3PDOB 5E8EB 4DKEH 2ZSVA 1X9LA 5JNYA 4ZUTA 1FCVA 4DEPC 4YHNA 4H26A 3QHOA 1XRFA 3RO8A 2X3BA 2UXTA 5CD3A 3DK0A 4AVJA 4NZUH 1E28B 3MV8E 3UYPA 4KY1L 4MA7L 5JHLA 3BZ4B 2AGTA 2XNAB 4FXKA 4TV6A 5FYLE 1ICQA 2W81C 4U6HA 1R7AA 1YRKA 2VITA 4PBFA 4NB7A 2FPYA 2CWNA 3FY1A 3WQ4A 3N40P 3NJVA 1B57A 4E4FA 1FDLH 2VW4A 4HS6B 1AL7A 3B4UA 1NFPA 4MDIA 2YWYA 2PXYB 3T1FB 3QFJD 2XJLA 3BGAA 1Q6LA 3ARPA 2QCDB 1B3JA 3BARA 1OKEA 1YPZF 5DRZA 3WL9B 4X5XB 1KJ2B 1HILA 8PAZA 1JV5A 2WBXA 4ZUUA 2P1FA 1Q0EA 4X6CB 2P5WA 4Y16B 2HFTA 3BVJA 3V7AE 3QUXC 4QO1B 4CSTA 3CO4A 4NDMB 2EEBA 2Y7EA 4ZQMA 4EXKA 1P0NA 4ODBD 4NJGA 3IVSA 3P8IA 2BP1A 5LHEA 4MPKA 2OSWA 4OOZA 2ZOUA 4MD4A 2W27A 1MI5A 2W60B 4FLSA 5FESA 1OXYA 2XVKA 2GWGA 3EUDA 4X4XB 5ABFB 4ZSTA 1MZHA 1VF8A 3EBIA 3I9AA 1T7LA 3R18A 5DSCA 1ISXA 4RNIA 2X4QA 4X9FA 4XNXL 5F9JB 4L4VE 1LK2B 1VS1A 5AOMA 2EG7A 1PDKA 4P8XA 3DXAE 1LF1A 1OK8A 5K2ZA 4LCCA 2H6PA 2ZXQA 2Z29A 1IFHL 2F53B 3STFA 5AVYB 4Y0GA 3VE0B 3F4VA 5J8LA 1POJA 3AAZA 4MYPA 5DEGA 1UD8A 4X7EC 5EBLA 3AU2A 1FZKB 5DRWB 4Z7WB 4J4PD 3HVNA 5JMUA 4RL3A 1UWGL 4FIRA 2CKBH 4PRIB 4OV9A 2PCXA 2VFHA 4W5ZA 3QWRD 5KZCD 4YZWA 4XBGB 1VPXA 1M7IB 3P9LA 1J8SA 5KBNC 2HVMA 1CENA 5CD5D 1YTDA 3BDBA 5D2LE 2G9HB 4YYCA 3B8IA 4P57B 3HCVB 2VCOA 5DA4A 2OKOA 2EKSB 3D2UA 2NXGA 4DJED 3N13A 1SMOA 1JGUL 4PMDA 3QXVA 2J8GA 3RMEA 1ZVHA 4V27A 4FF9A 3IXTA 3L3OA 1OGGA 1W16A 4GQGA 4LL9A 5L7XH 2PGFA 3TJXA 3WUWA 4S3AA 4LCUB 4KV5E 3MRGA 3P0YL 3BO9A 3O2DH 4J9JA 1EK3A 1FWAC 3ECBB 2TMDA 4D71A 2AEOA 1RZ8B 2GTQA 5FYJU 4ZENA 4PJ7A 5BWAA 4DYKA 5D7LE 3QUHA 1UR8A 4KITB 4ETQA 4YHOH 1MFMA 1RSCA 4H00A 3QQ4A 3N9KA 4P7OA 1KLUB 3UAAA 1J11A 2BLEA 3KCPA 4XMLL 1EO8L 4JEJA 3UZEC 2A3CA 4F4RA 5IFHL 2LOEA 1S6NA 4M29A 5AW0B 1GXEA