3H54A

Crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
molecule tags Hydrolase
source organism Homo sapiens
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
total genus 128
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h54A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h54A01
3O63A 4MY9A 4HSNA 3WK0A 1E51A 3O05A 2D0GA 4JD4A 3L65A 1O60A 4AYSA 4XWUA 4J3TA 1S3HA 3EDJA 3EX2A 3DX0A 3GDLA 2A5HA 3LB0A 1G69A 1W3NA 3DI1A 5HXMA 1YDNA 4K7YA 3K8LA 3VO0A 4UTIA 4QAIA 4HP5A 4YMZA 1W3IA 1HG3A 4HPXA 1EP3A 2WJZA 5G2WA 1V5XA 3VSVA 2ZDRA 4JXCA 2XWDA 3TE9A 2YOCA 2A6LA 1FXQA 3LPPA 3CPUA 4JTFA 5D38A 4DF2A 1KCLA 1ADOA 3A47A 2X1TA 1F74A 2ZZ1A 2IQTA 2VR5A 3ABSA 3B06A 1QMLA 2AAMA 5T26A 3TSDA 1EB3A 4UTLA 4CLMA 4Z1CA 2FHBA 3TNOA 2CZFA 2GQAA 4MFDA 2DZTA 4KWUA 5AC6A 1ZJAA 5BRQA 1QHPA 4Z1AA 1TCDA 2CZEA 2X2JA 3K8KA 1JVNA 4BK9A 3L4TA 3G24A 4LXFA 3GR7A 3EWUA 5G4WA 1QW9A 5CSSA 5HDRA 2NT0A 3PULA 4HT3A 3CEPA 4PA8A 5F2LA 4UTUA 1K7XA 3DZ1A 3FIGA 2DJLA 1KFBA 1QWUA 1DOSA 1EO5A 4X3ZA 1VQTA 2FHCA 4FMVA 3P80A 4HPHA 1W8SA 4OJYA 1BLIA 5U4NA 1VIWA 2A2IA 4E2DA 3CQ0A 3C2RA 3GDTA 3GNNA 3PG9A 3IVSA 4ZZ9A 2ZFAA 4PH6A 3VGHA 4FF7A 5AHFA 5FF0A 1SO3A 1NSJA 3FLUA 3ECQA 1W1ZA 2CLHA 1DEDA 5AB3A 3W37A 4Z1DA 4HOXA 5ABTA 1TQTA 1H51A 3HOJA 4GUIA 5E0FA 5FEWA 2ZUSA 3UQNA 1KM1A 3MYOA 4E2OA 1KV8A 1QX1A 2CLLA 2DH3A 2ZRUA 4X9SA 1OFAA 1HWWA 1O5KA 1HNYA 5HUPA 2TMDA 1KXHA 3M6YA 3VNZA 1TTJA 1FWSA 3DKJA 2OW7A 4Y90A 4UNKA 3GTNA 3R2GA 3PUEA 4MYXA 2Z1BA 4BR1A 5AC7A 1FCBA 4JTLA 3G18A 1C8VA 1KGUA 3GDMA 2QCHA 4AWSA 1FWTA 3W2UA 3NL2A 4AW7A 1R2TA 4BWLA 5CZJA 3P74A 4U2YA 2C8NA 2E77A 1KWGA 2VFIA 4HN4A 1MEIA 2HMCA 2GJRA 2VUYA 4LVBA 3QRHA 4Y6GA 2B7QA 1DBTA 5H2ZA 2I9EA 1SUXA 2ALDA 3STFA 3NOEA 4H8HA 3CZGA 1J0JA 1G67A 4WLCA 3D50A 2QCDA 1TPUA 3TXZA 3LHUA 5F4XA 3I7SA 1U5JA 4E0CA 1SZNA 2PWEA 3TAOA 1HT6A 4RR4A 1R75A 3CTTA 1S46A 4JFVA 4HOZA 3S1WA 5DELA 1H61A 1GVQA 4DBEA 3DX1A 3P5ZA 3M07A 5FF3A 1O7DC 1K02A 3MWAA 5AHNA 3N2XA 2PURA 3KE0A 2E5BA 4LC8A 4GFSA 2Y61A 2DP3A 4AHPA 3WJZA 2C1HA 2VC6A 3ATYA 5D2WA 4FNPA 3QC3A 3VE7A 2WNQA 2VT0A 3BUDA 3IGUA 3PY2A 1XM3A 1KGXA 3AJ7A 3EX4A 4AMWA 1JULA 1YPIA 4K8HA 4RZ4A 3B0VC 4ICNA 2CLMA 4N2YA 2DZVA 1ZJBA 2QDGA 4FNUA 1TTPA 1K03A 2J6XA 1JDCA 1U33A 3GAKA 4AMXA 3L0NA 3OVQA 2JGQA 4XZ9A 3W75A 4A21A 5LGXA 1OF6A 3HBLA 3NQFA 4M56A 1H1ZA 4N9BA 2YA0A 2ZBTA 3NNTA 1S5TA 3NQ8A 5I3GA 2ZXQA 1JR1A 1JF6A 1TMHA 5L6UA 2OJPA 5A2AA 2E8ZA 4NZFA 3MP5A 3DX4A 3WY3A 3QMRA 4FO4A 5AOUA 3SGZA 4NU7A 3CLWA 1OYCA 4BFAA 1HFBA 3W7MA 1PV8A 3FAXA 3KL0A 3PBWA 5HR6A 1HXKA 3LHTA 3HZ3A 2DZUA 4WY0F 3BLBA 4NT0A 1MEHA 2BXZA 3CIXA 3FJLA 1VHCA 3IIZA 5I3IA 2YIHA 1AW5A 5LZLA 2VRQA 1T0OA 3WN6A 2WO5A 1VFUA 1PIFA 1LM1A 4PFMA 4FEZA 1XBYA 2NSXA 4U4MA 1HL2A 2YW3A 3TW6A 4WOQA 3DFNA 1WOAA 4M7TA 3KL5A 1WBJA 1WPCA 2EGZA 5EMUA 2ZRWA 3LXBA 3PC0A 4HA1A 1WP6A 1JL8A 3MHFA 3UY8A 1G4SA 3KL3A 5D03A 2CZ5A 1D7FA 5F1VA 4AB4A 3RF9A 3WJXA 3DI0A 4N02A 2QCNA 2WNWA 1GG1A 2E6YA 3C61A 1OF8A 3HJZA 3ABRA 5I23A 2WC7A 5I3JA 3TCEA 5DO8A 4CKQA 3RILA 2V8ZA 4RK8A 3PBUA 1PZ2A 3BLFA 2I1OA 4MKNA 1V3JA 1FCUA 3BLPX 1SMDA 3MP4A 2PE4A 1Q3NA 1PEZA 3NA8A 3R8RA 2AQWA 3QQ1A 3FFSA 1O94A 2J88A 3P5YA 3EWZA 5DLCA 1V3LA 4CCEA 3A22A 1XH2A 3VNDA 5LHEA 4LPCA 1THFD 1OJXA 3BAJA 2Z6JA 4YL2A 3ZR4A 6ALDA 1RVGA 4KFOA 1FY6A 3W22A 1BWKA 2WCGA 1S5WA 1OYBA 3EWBX 3K30A 1MSSA 4TIMA 3FKRA 3TDFA 4OGZA 1FDZA 5KITA 2V2CA 3BLKA 1OG0A 2GOUA 3EDKA 3IIVA 5BRBA 2DIEA 1KM6A 4GXMA 3W7KA 1XXXA 2WKGA 3FA5A 5LHFA 4XQ6A 1XCWA 1X8FA 3UXAA 2NXIA 4J7RA 3BG9A 4BWLC 4DEFA 4JTEA 3W1RA 1XFBA 1QDSA 4A2SA 1SSDA 1DJQA 3FEMA 2WPBA 4MLRA 4JY9A 2QR6A 3VU2A 3TQVA 4NZJA 3GLCA 4W93A 3WDIA 1KFEA 1GG0A 2EF9A 4LVAA 2E4TA 3VGDA 2E09A 1TSIA 2DZXA 3G3MA 4JTIA 4QNWA 4ZQPA 3EDFA 1R2RA 1TV5A 3DAQA 1SFLA 3KXQA 5BW6A 3WDHA 1W5MA 2QMJA 1I2OA 1SW3A 5IM51 1UASA 2X2IA 5FEXA 2YX0A 3BV4A 2F7OA 3ZOAA 3VNYA 5LKYA 4UQ9A 3GK0A 3TU9A 3BUIA 4NNBA 3WNMA 1MWOA 4GC4A 1EWEA 1XV8A 3TK7A 1ZS2A 1G9HA 3OVPA 2WOQA 4UCFA 1JDDA 4RXGA 2BXYA 1KFLA 1KXTA 1OVDA 5FESA 2A1YA 3G1VA 2WSQA 1ZAIA 3LV5A 5CPNA 1P4CA 4K38A 4PL1A 1W5NA 3L66A 4JTJA 3NXFA 3R5EA 5I24A 1BWLA 2AGKA 3S1VA 3W2NA 2Y85A 1XL9A 3EXSA 4FX8A 2EEXA 3BUQA 3G1YA 3WK2A 1W5QA 3QM3A 1F05A 3CZLA 5EA9A 3WFAA 4FNRA 3HQ1A 1TYGA 5F4SA 3EX6A 3OVRA 3ZS4A 1P6WA 5AYZA 2WNNA 3N34A 1ZHAA 2OT1A 3LM7A 1VYSX 3NQMA 3TR2A 4K39A 3IIXA 4LY8A 4FB7A 1TQUA 4UQAA 2X2HA 1SO5A 4XKYB 3O16A 3E96A 2VFFA 1WBHA 3CWNA 3GBEA 3GBDA 4GUHA 4ZL1A 1OYAA 1LBLA 1SSGA 2ISWA 1UD3A 3P82A 4UMBA 5CGTA 1VCFA 4O8RA 2XIIA 4JEQA 5E6YA 3ZT7A 2YYUA 3O07A 4R34A 1WA3A 1GJUA 3C56A 3BC9A 3TQKA 1Z32X 2WCSA 3CB8A 3PVFA 5AYXA 5K9DA 3UWQA 4FLOA 3ZSSA 1L6YA 3R13A 3UZJA 4PCFA 4L4LA 1LRTA 4O57A 3PB2A 1B4EA 3CWOX 2Y24A 3U2OA 3FYOA 4FIQA 1C8QA 1NF0A 2E6AA 4GJ1A 3L9CA 1AK5A 4PODA 4M5PA 5K7JA 1FCQA 2BXVA 1ZENA 3W38A 3GYEA 2V3DA 2YA1A 3P81A 4GI8A 3GKFA 4LVFA 5G4EA 5HWMA 2X16A 3OBKA 1UUOA 3TSMA 3TTSA 1UUMA 1EHAA 2YGYA 3QF0A 2ZX6A 4YCOA 2CU0A 2C14A 2A0NA 4ZQMA 3DKLA 2CHNA 1S5VA 1VH7A 4JX6A 4LV4A 3BSGA 1PHQA 2WVVA 2YW4A 2NWSA 2BZNA 2VKZG 3EDDA 3M43A 4JFWA 3EWYA 3A5FA 3WMSA 1J0HA 1LBFA 1TPFA 7TIMA 2QUTA 1I2NA 1ZJIA 3NPUA 1G7VA 2NXGA 3W7LA 4GNJA 4OV4A 3S1XA 1OFOA 2D0HA 2J25A 2VEMA 2W6RA 2DZPA 3K8MA 3W2KA 3UWWA 5CZSA 3EKZA 1Q6OA 2QAPA 5BOOA 3TMQA 4U3CA 3THQA 1J5TA 3QZEA 4JYEA 1GJWA 5DY3A 2WSRA 3L2MA 4O0KA 5AN7A 3HG3A 5BRPA 4TO8A 1C29A 1VJIA 3AXHA 4BI7A 1K8ZA 3MHGA 3T40A 1TTQA 4B9ZA 3LI1A 3IVUA 1L0PA 3WK3A 2ISSA 4M6VA 2FFCA 1WE5A 4MOZA 3VI2A 5KZDA 2ZX8A 4MJMA 1KFKA 2C6QA 3CT7A 2EAEA 1W56A 1NFBA 3M7WA 4Q33A 5TD4A 3RU6A 4ZMGA 3F4NA 1QPOA 5HPOA 1SMAA 2BHZA 1YLVA 3QQ0A 1UD5A 1UH4A 4IX0A 3I7RA 1M6JA 4JFSA 1OFQA 3W2MA 2G3NA 4QM1A 3M44A 1I2RA 3CZEA 2WQPA 4RX0A 3RMJA 2V82A 1UA7A 4BA0A 5LSMA 4X0NA 5A8GA 2A6NA 2PRHA 4RV8A 5KZMA 3W2LA 3STEA 4IXXA 1O95A 4NX5A 4BF9A 2EAWA 1IXPA 3NG3A 3HGSA 1XD1A 2X2GA 5CG7A 3LGEA 4R7JA 1UH3A 4ZQCA 3EEGA 3BW2A 3L0GA 4LU0A 4W9TA 1MZHA 4C1LA 3LXAA 1ME7A 1KGWA 1KBKA 4MIMA 3LCFA 4POCA 1F6KA 3BVXA 3JRKA 3EDEA 3UYCA 2FYVA 2OCZA 1YXYA 4CQ9A 4JYDA 3HPSA 5D37A 1WZLA 1JCMP 3ZT5A 4NJGA 3BH4A 1N8FA 3MHUA 3K1DA 4MAZA 2QCEA 4WY0A 2VFGA 3TUUA 4UOZA 1JRBA 1RQHA 2ZUWA 3OLDA 3E12A 2WVSA 3D0CA 3MO7A 1HO1A 1DVJA 3VMOA 1D3HA 5E70A 1TRDA 2A21A 3KVJA 2HSAA 4UQEA 4Z0SA 2H8XA 1CIUA 3INPA 5MHBA 4RXFA 1KWKA 2F7PA 1TPEA 3BUBA 1BEUA 3W6YA 2CFFA 3V1PA 1B3OA 4DPQA 2E0PA 4GQRA 2FB2A 2CW6A 3TSBA 4CVWA 1T99A 4GE8A 5DFAA 1UCWA 2H90A 3NVTA 3P67A 1LLZA 1EWDA 1GVOA 3DFQA 3BAWA 4JIQA 5LNSA 4FLQA 3QJAA 2FLIA 2Y7DA 1ZFJA 1A47A 4H7VA 4A2RA 1X1OA 4FNTA 4N9CA 3NQCA 2PC4A 3S9YA 3Q94A 4DF0A 5D09A 4CN4A 4IQLA 3PWAA 2Z0IA 3IJ7A 2FJKA 4WX2A 1LP6A 3A5VA 3G0XA 2H3DA 2GVLA 5LNUA 3RIKA 3O06A 3OA3A 3WJYA 3WNPA 3BW3A 2YYTA 2O7QA 3LCWA 1YADA 3L2IA 4AXKA 5FF2A 3VM5A 2WV8A 1IZJA 2ZXAA 3N19B 3VMPA 1SZFA 3WNLA 1XC4A 2RDTA 3QMSA 1TMQA 4O17A 2XWEA 3BO9A 1CXKA 3RFAA 5DY2A 3NM1A 2V0TA 3M5VA 4N4QA 3HG5A 4GUFA 4JDBA 2HTMA 3WJWA 2FGZA 1CX9A 1G6CA 3PUOA 1IV8A 4AHOA 1IXNA 2NWRA 1QNVA 2FTPA 1I45A 2EHHA 3L5AA 1XUZA 4MZYA 3FOKA 5LGZA 4AIOA 1QOPA 3W1NA 2YKKA 4O54A 2QUUA 4H6KA 4MZ8A 3TXVA 1H60A 1E3XA 1KV5A 4CCDA 2GVYA 1P1XA 1H62A 3LBCA 3B0UX 3TOPA 3ZSTA 3W73A 4E2BA 3SFKA 3QW3A 1PHWA 1LORA 1UA3A 4WQ6A 1YTKA 3VGEA 2G3MA 4B5NA 3M41A 3EWWA 5A6MA 4CN1A 5I3HA 1AMKA 1TPH1 3CC1A 4Y9AA 2ABAA 3GX9A 3S1UA 3W1XA 1SQ7A 1UH2A 1TV7A 4IUOA 3N9SA 3BVTA 3LRKA 2E6DA 3LX9A 3W9ZA 3C2FA 2IGTA 1BSIA 1G1YA 2OSWA 3HGRA 3LHWA 1JQVA 3M47A 3N3MA 4UUIA 5G1YA 1SW0A 1H63A 4GINA 3LV6A 3D4YA 5A2CA 3OLGA 1FUYA 5AYYA 3BMVA 3MI6A 2F61A 4MVAA 1JGIA 1WO2A 3PF3A 3BG5A 4HOWA 4WSKA 3MW7A 5A5WA 4OBTA 3II1A 3CEUA 1PVNA 4AWTA 3AXIA 3TC6A 3EJSA 3A6OA 1QPRA 3DFPA 3Q58A 2V5LA 3G0UA 3S42A 4WOZA 1MXGA 3G1AA 1FX6A 8TIMA 5FF4A 4O52A 4O12A 1Q45A 1ME9A 3CIWA 2D3NA 2RFGA 1EA9C 2WSYA 1ZCOA 2ZRXA 5CZ0A 3CLMA 2CZDA 4UFHA 3P8IA 1FDYA 3M5XA 4RLIA 4GO9A 3GDKA 1SU5A 3VGFA 3BGJA 2H3BA 3G8RA 4AMAA 3LBMA 2ALWA 4O28A 4M7SA 4EVZA 2C16A 3ABQA 1VS1A 5HJLA 3ZR5A 3B03A 3FJ6A 5K3VA 1QWGA 2YA2A 2NXHA 2GVJA 4J3XA 2V2DA 4FX6M 4LVGA 1W54A 1OK4A 2BX7A 3BAIA 4JICA 2GQ9A 2DJXA 3KVKA 3F03K 1TO3A 3PS7A 2VFHA 2ZX7A 3TTYA 3N2MA 1OFPA 1QPNA 5G2IA 1XBZA 2QJIA 1Z42A 2Y7EA 4MY1A 3L4YA 4UTKA 3MBDA 4HNVA 3L0KA 1GVRA 3OLIA 2WNZA 3S5ZA 3H53A 3MP3A 3NQAA 1G4PA 3IJ9A 1T8XA 3IVTA 5HWNA 3E02A 5DCBA 2C15A 3LPOA 3DX3A 4WJEA 2Y2WA 4LUJA 2JK2A 1GJPA 1TV8A 3P7YA 4K6AA 1PIGA 3LI0A 4JCMA 4K8EA 2FPVA 3PM6A 1CXIA 4IMEA 1TPWA 4Y8FA 1EP2A 1EEPA 3LLFA 3PAJA 3QPYA 4TU1A 3ZFHA 4IOTA 1A53A 2BLEA 1GCYA 3C2VA 4UZSA 1AW1A 4UCGA 2ZUVA 2D73A 1GYLA 1VCVA 4CNNA 2EQDA 3B04A 5CLTA 1IGSA 4KWWA 4GI6A 2NT1A 1H7XA 3W1AA 1PPIA 1BPLB 4JN6A 4AHQA 1TQXA 3SZ8A 2XVGA 1AQHA 2B7OA 1W9XA 1DQXA 4WXZA 4OQVA 4JX5A 3KWXA 3RK8A 3GXNA 4O15A 4ZQNA 3U6WA 1OX6A 5HUOA 3THAA 3UERA 2A85A 1PS3A 3KRUA 4JTUA 1YPFA 4DXVA 1X6UA 1AG1O 4UTJA 1VJSA 2Z6IA 3IIOA 4NJHA 1ICSA 5FF7A 5LNWA 4FIRA 4OKDA 3GXTA 4NNCA 1C9DA 4O1CA 3QSTA 3T78A 8CGTA 3FS2A 2EACA 3EJUA 3KHJA 3LDVA 2QLYA 2B4GA 2C3ZA 4IXHA 1XBXA 5TIMA 3SGUA 3W86A 3PSWA 3GKAA 4O14A 3R89A 4M6QA 4H4IA 3PBYA 3SI9A 4HIBA 5CSRA 1F7BA 5G1TA 3W1MA 3HMJG 4O4VA 3S5OA 6TIMA 1UJPA 3LLDA 1TQVA 2ABBA 1F2JA 4GI9A 2BSLA 4FX7A 1KTNA 4UZUA 2ZIDA 2CXGA 4JTTA 4O18A 1TB3A 2YR1A 3M16A 2ZXDA 4LVDA 4M8UA 3STGA 3BUPA 1K7FA 3A21A 1MEWA 1FWWA 4GWEA 3EXRA 1H7WA 2ZA3A 2BHUA 1EPXA 2EJ1A 4S1FA 1XSIA 1OT1A 4R53A 1TPC1 3TA6A 1IIHA 3IGSA 3QSRA 3BCDA 4BZYA 3O15A 3C2OA 3ZR6A 2Y70A 2PWDA 2ZZ2A 4CQ8A 2X1SA 4FLSA 4LW7A 3HGJA 3NPXA 4O19A 3C2EA 2ZZ4A 2RH9A 2FHFA 3T4CA 1QO5A 2XVLA 1M53A 2ZZ5A 2ZA1A 1U83A 3EJPA 1DQWA 3W3OA 4HNTA 3C8FA 3KRZA 5E0KA 2FIQA 3B8DA 3S2CA 1EUAA 2J24A 1NEYA 3YPIA 1EP1A 1WZAA 1G4TA 3QH2A 1QAPA 1HX0A 3IJ8A 1XGZA 3UG5A 1LOLA 2V2HA 4U28A 3EJTA 3VX0A 3A9IA 1CGWA 4K37A 3UPBA 5CLWA 2BY2A 3L67A 3NGJA 3M5YA 3O6YX 1GVIA 3LRLA 1B2YA 1V3KA 4CNOA 2I14A 4JNMA 1D3CA 1PE1A 2JKPA 2RDWA 3R12A 4ADSA 1PJ9A 1H5YA 4J3WA 1TPVA 4AEOA 1JUKA 3L68A 1ICQA 4LUIA 4Y96A 1U2YA 1ZAHA 3S8HA 4IPIA 1VB9A 3B4UA 4O11A 3BGGA 3HPXA 5F1UA 1EA0A 3IGXA 5I3KA 1MW3A 3DDGA 1UD2A 2E5CA 3EJRA 1K8XA 3W7RA 3CTLA 3WEMA 3C0JA 2QF7A 3W1LA 1KM2A 4UQCA 3UXDA 3G1HA 3KFTA 3TAKA 1YTEA 3KLLA 5C5YA 4J27A 3TC7A 3NQ6A 1KCKA 1JUBA 2C7FA 3BAXA 3AJXA 4OE7A 2G95A 2E68A 1YDVA 4UOQA 3HG2A 1XCFA 2YPIA 1W37A 1B4KA 5DXYA 3GIYA 1KW1A 2QDHA 4LV9A 2GJLA 2H6RA 3BW4A 1GVSA 4LTSA 4UQDA 4AEEA 1N55A 1JCLA 2OSXA 1WQ5A 1JG9A 2ZRZA 1J4EA 4HSOA 5D2XA 3GVGA 4JY8A 2KZHA 2ZE0A 1WDWA 2Y7FA 1A5BA 2C18A 3IV3A 4MUZA 1XCXA 4JCLA 5KTLA 1B9BA 5CPLA 1KFJA 3QFEA 2E6FA 4ML9A 1NM9A 1GEQA 3OIXA 4LC6A 3GB6A 2RHGA 3CV5A 2F18A 4IJBA 2QCDB 4A3UA 2UV8G 2QAFA 2QV4A 4IMDA 4H2CA 1PCKA 5F2IA 1P5BA 3BMWA 1NAL1 5CGMA 1K8YA 4MYAA 3SIZA 2B0MA 4FXSA 4S2BA 1EH9A 3NQ7A 5K2ZA 5G5IA 4ADTA 3DDFA 4HNNA 1PS9A 2ZRYA 3M5ZA 1N7KA 1G4EA 4KFPA 2X1RA 2BY3A 5K9XA 1A50A 1JD7A 3WY4A 1KLYA 1JD9A 3BAKA 1XDLA 4JTKA 3UCQA 4Z1BA 1K7EA 5AHMA 3NQVA 1LRNA 2V30A 4JFTA 1QPQA 3AMLA 1BKSA 1VLIA 3CM4A 3HO8A 5J5DA 1RPXA 2YFOA 3DH7A 4GO8A 3UG4A 1QI5A 3EKLA 4I7WA 3TONA 4AF0A 1W0MA 2NX9A 3LCLA 1H7RA 2HS8A 4CCCA 3SY5A 3W71A 4ONVA 3LCHA 4PL2A 1I2QA 3NYZA 1LOQA 4WD0A 3RNDA 3ABOA 1E3ZA 1PIIA 1TQJA 1P0KA 2OYMA 2ZX5A 1GPWA 4BI5A 3BSHA 4PEKA 2LLEA 2YCEA 2XN1A 3DBPA 3T7VA 1LRQA 4N6FA 4FNQA 1YTDA 3A4AA 1KBBA 2YXGA 4NJJA 1Q6QA 3L4UA 2AAAA 1OX4A 3LHZA 4P61A 3M0ZA 4KFNA 1X7FA 1R2SA 3ATZA 1OGSA 1LCOA 4WSJA 4H3DA 3LRMA 1CW2A 4PC8A 3WK1A 3HJEA 5EPDA 1QCWA 1OFBA 3MI2A 4OHQA 3NAVA 4EIVA 2VFEA 4O50A 2R91A 4O53A 3UWVA 1WZKA 3V75A 1X1ZA 2YDAA 1OB0A 1B57A 4P2VA 2ZZ6A 3PB0A 2WVUA 1W5OA 2Y6ZA 3NQGA 3L4ZA 2VELA 4HPJA 1IIGA 3P61A 5KINA 3GNDA 3VGBA 2C13A 1TJPA 4XBKA 3KLKA 3TIMA 5L9FA 2QPSA 1VAHA 1UD6A 3W7JA 2A7NA 3KVMA 2D3LA 1J2WA 3G1XA 4QAWA 4MPQA 2VEIA 1VGAA 1QWNA 3OLEA 3ELFA 2XN2A 4JTGA 3EJQA 2NLIA 3E9AA 4UTTC 5TBOA 3DFOA 1FQ0A 4JYFA 1BTMA 2BTMA 2RDUA 1IF2A 1PCWA 4PTNA 4DO6A 1JFHA 4M6PA 5AC8A 4ATWA 1CXFA 5K4ZA 4U33A 1DJNA 1OX4B 2ZTKA 5FEPA 2NZLA 3TQ0A 4JDYA 2GUYA 1GOXA 1H50A 1KBIA 3DENA 1YXDA 3IIPA 1WV2A 4GRSA 3TJXA 3BPWA 2YSWA 4DO4A 2QCGA 4EF8A 4JTSA 5C6MA 1ZY9A 4Q32A 2H8ZA 3VFLA 2CPUA 3A24A 4JR5A 3WNNA 2JKAA 1JJKA 1XH1A 4J3VA 3MJYA 2Y63A 3SJ3A 3BCFA 3WNOA 2VRKA 2ZYFA 2CLKA 1DORA 1BVZA 4LS2A 2CWNA 4CNPA 4WZHA 1L9WA 1HVXA 1TTIA 1EX5A 3QGVA 1I75A 1RD5A 5CPOA 3USBA 4AIEA 1ONRA 5GVJA 3VX1A 3LOTA 1FBAA 4H8UA 1JCXA 2WPGA 4LS1A 3GAYA 3MI3A 2FB3A 3VE9A 5HINA 4PCTA 2PWHA 2Q3RA 3LCGA 3LHVA 3WEOA 4EF9A 3FKKA 1JF5A 2WANA 2V3EA 1JUEA 4UTTA 1T96A 1VR6A 1MXSA 2FH8A 2ZUUA 1J0IA 1TPB1 2P0OA 2EKCA 5CPMA 3BG3A 3HF3A 3NO5A 3I68A 3WNKA 1KA9F 2QJGA 4UR7A 3W2JA 3DHDA 2RKXA 2ZA2A 1LDCA 2F2HA 3GXMA 4DO5A 3L4VA 2DZWA 2WVTA 3RLVA 2J9YA 1Q4NX 4RKAA 1GYNA 2WSKA 3KRSA 1AW2A 4BI6A 3B0PA 3KX6A 3L21A 2QUVA 2Y4SA 4Z08A 4XTIA 1QW8A 4X2RA 1TREA 4WXYA 1GZGA 3S0CA 1TPDA 4UFIA 4UNLA 3I6RA 3W7DA 1NVMA 3OG3A 1RP8A 4N9EA 3GXPA 1XBVA 3WDJA 4XUGA 2Y89A 1W31A 4QJ1A 1AVAA 4IPJA 2PCQA 1BVNP 2Y62A 1EO7A 1HO4A 1QFEA 1SZEA 1VRDA 2QKFA 3BVUA 4JTHA 4QQ3A 1CGYA 4AEFA 1LYXA 3LXCA 2EO7A 2C0AA 3NM3A 1WXJA 2NV2A 2HS6A 5IBXC 2ZWYA 3GXFA 4RCXA 3ZWSA 1QO2A 3G1DA 4IGHA 3W7EA 5DXXA 3LTSA 4FXRA 4MZ1A 4ADUA 2JBMA 1UKSA 1CGXA 1OSEA 1I8JA 1KM0A 2ZWZA 3GXIA 2C19A 3ZO9A 4QISA 3W1PA 2PRLA 2E1DA 2GVGA 4O1AA 2WVVB 3G1FA 4NVTA 2V9DA 3NZ1A 2F84A 5K9CA 3U8GA 4MFEA 5E93A 2EPHA 3S5NA 5DCEA 3F4WA 2PWGA 3TJLA 2VFDA 4YCPA 3PUDA 2V5BA 4AVFA 5AHEA 4NXKA 1MW0A 2FPYA 1M5WA 4K36A 2TYSA 3PR2A 3W7PA 2ISVA 1A5AA 2FE0A 4YLWA 4KKXA 5HNRA 4UMCA 1RZMA 4AWUA 5D32A 1OFEA 3G3DA 4XKYA 3QMTA 1TQSA 1GTEA 3Q2DA 1HL8A 3BVVA 3NPVA 2VEKA 4I7VA 4M19A 3D4ZA 3EX3A 1TQWA 2ZXBA 4FLRA 4KMQA 1RQEA 3C6CA 3O6DA 1XI3A 3OHIA 1H7OA 3NQEA 1W3TA 3N14A 3LCIA 1FWRA 2BWGA 3N9RA 3DC0A 3W7GA 4UMAA 5D30A 1KXQA 2F1AA 2F7QA 5I5RA 3IK2A 3TH6A 1QR7A 4H8VA 4AAJA 4AF0B 4JFUA 4IMFA 2VNCA 1JI1A 3DX2A 5F7UA 1KM3A 5AFDA 4HKPA 1QPKA 4X9YA 4UTMA 3CZSA 1CXHA 4DF1A 5IBXA 3HIJA 1WYIA 1DKWA 3WFZA 4QIUA 5HMSA 5LNRA 1M7OA 2ZZ3A 4LS0A 4AH7A 2BHYA 1RPKA 3Q37A 4XTDA 1V7YA 4A29A 4OU1A 1W5PA 4NNAA 1DTUA 2FDSA 1BAGA 1UBSA 1R34A 1GQNA 1HUVA 3C3NA 1QHOA 1OFRA 1WZMA 2R94A 5C55A 3RLUA 3CGTA 4JGDA 3WY1A 3KVLA 4QITA 1QI4A 1KM4A 3P62A 5E9AA 1BF2A 2ZICA 5AHLA 1VPXA 3MUXA 5BMWA 1XD0A 1YYAA 1FCVA 3F1QA 5D2YA 4MB1A 1A5SA 3E49A 1LOSA 2NX3A 5KSWA 3W83A 4PSRA 1CGTA 1A5CA 4NJIA 1AMYA 3DHUA 1JCNA 1M7PA 1CPUA 3LCXA 3W1UA 3BAYA 4LRSA 1DV7A 5FI8A 5DN1A 3EXTA 3TFCA 5BMXA 3UD6A 9CGTA 4UIOA 3TW7A 1FXPA 1Q6RA 1JCJA 4E38A 6TAAA 1OX5A 1ML1A 1F76A 1JQXA 4L4MA 3AO0A 7TAAA 2OT0A 1O5XA 3G0SA 2ZTJA 2W79A 2WKLA 4I9AA 2CLEA 4JS3A 1M7XA 5EMYA 4D2JA 3KEHA 1G94A 4NI3A 4Z0JA 1R33A 1CGVA 3W7OA 3O6CA 2DU2A 2QEZA 4GKLA 1I4NA 5J5RA 2A7RA 3TKFA 1JXKA 3VSUA 2QPUA 1UOKA 5A2BA 4RJEA 4YXGA 3ZQ9A 3O1NA 2QCFA 2CLIA 5C54A 1TJRA 4I7UA 1H1YA 2GJPA 5F4WA 1CGUA 1VCGA 3E0IA 5CZTA 3NDOA 2FQIA 4GQQA 3DHFA 3MBFA 1B0IA 1VHNA 5F2GA 2PWFA 3M9YA 4O10A 3NL5A 5CGQA 4EWND 4JL2A 1LZOA 3G22A 5EYWA 2OYKA 4UC5A 2WSPA 4NQ1A 3DGRA 4DBDA 4ZVJA 4DQWA 4JIPA 1GTHA 4UFJA 1JXJA 2B7PA 5KZEA 4UTWC 1PL9A 2OSYA 4J3SA 3JR2A 2E9BA 1CYGA 1NF7A 2V81A 3SR7A 4K7VA 5C2XA 3EB2A 2QJHA 4NXSA 1HL9A 1FDJA 2VOMA 1GVFA 5TQLA 2ATSA 5CXPA 3S5YA 1L6WA 2BY0A 2Q3OA 2GPTA 3KOFA 2BY1A 1D9EA 2A7PA 2OW6A 5D05A 1Y0EA 2QCLA 3HGOA 1O4UA 3W7QA 1MFUA 2R8WA 4AYGA 1XH0A 2AMGA 3WELA 5LNVA 2G5WA 3C4UA 1JCYA 1OT2A 2X1UA 1OABA 3LTYA 4QNEA 4TX9A 1MW1A 3HG4A 3UPWA 1LWJA 3HB9A 2WKJA 3O8AA 4PEEA 3IRDA 3HPZA 2VXNA 1CDGA 1R46A 1LLWA 1TIMA 1CLVA 1OK6A 4CN6A 3UY7A 3FAWA 3VMNA 2J27A 2GQ8A 4RZ6A 3P84A 2JKEA 4MY8A 1L6SA 4MLJA 5KEZA 2P10A 4O16A 5DCDA 1MW2A 4UTHA 3L4WA 4PSPA 4GBUA 4PCSA 2GUUA 4OWGA 2TAAA 1F6PA 1R47A 1SW7A 2YJQA 2O7SA 1VZWA 4OT7A 1TCMA 2ZZ7A 2G96A 1OHLA 3W76A 2X30A 3NL6A 3VGGA 1KLZA 1SZGA 2NX1A 3GXDA 3L2LA 4ZQRA 1UB3A 3UG3A 2R14A 1JDAA 2JGYA 4OV9A 4LRTA 3QPZA 4R33A 4J28A 4ORIA 3CU2A 4G1KA 4B9YA 3UEQA 3D51A 4KWVA 4TR9A 5HR7A 1ME8A 3W1TA 2ZQ0A 1P0NA 1QOQA 4QSHA 3STCA 3TV8A 2OX1A 4HHPA 3NQDA 3AMKA 4RZ5A 4XB3A 1CXEA 1KBJA 4UQBA 3W7NA 3I65A 3WENA 5G2HA 1PZ3A 5HULA 1F5ZA 5EL1A 2Y7GA 3PG8A 2VEPA 5BNKA 4JX4A 3W7CA 4OIFA 2OMAA 3NEVA 2QCCA 3CZKA 1MO0A 4EOUA 4JL1A 4WUIA 3DHPA 3BLIA 1DL3A 2F7FA 3W88A 1DHPA 1MFVA 3TX9A 1Z48A 1LROA 1XUUA 5CKSA 1SO4A 5I3FA 2Z1KA 5EKYA 1KFCA 1JAEA 4N6EA 2B7NA 4N9DA 2XVKA 1AL8A 1AL7A 3NQ2A 3FYPA 1L2UA 3ZT6A 3KAOA 2E8YA 4MJZA 3H55A 2QMKA 3G1SA 1HTYA 2CLFA 2XIBA 3QYQA 5SWUA 2J9XA 4UXDA 1UKQA 3DFSA 3GZ3A 4DELA 3NZRA 3CHVA 5FEZA 1YDOA 1FWNA 2ZCGA 5D33A 3D52A 4CGTA 1ZALA 2EABA 1EUNA 1SR9A 3G8EA 4YWIA 1ODUA 3W70A 2P1FA 1H7NA 1E43A 3ZWTA 2GJNA 4O1BA 1GT8A 2DH2A 5HWJA 3S6DA 4CQAA 2Q8ZA 2DZSA 5DBUA 3UWZA 2DIJA 4XBSA 2E5DA 2J9ZA 4UR8A 3OEXA 4WF7A 3W74A 4J3UA 1KTBA 1VLWA 2DORA 3QEZA 3TMLA 3LHYA 6CGTA 1D3GA 3W7HA 3H54A 4O4WA 4X22A 3B05A 3BVJA 5D2TA 5EY5A 1GWJA 4FNSA 2QCMA 1U30A 1WOBA 4IMGA 1IZKA 4UNIA 3VCRA 3WY2A 4N4PA 3EX1A 4IWWA 4LNYA 5HQEA 1SO6A 3EWXA 2ZX9A 4GUJA 2ZRVA 3VM7A 4TMBA 1MXDA 1OFDA 2CLOA 3SW6A 1XKYA 1VYPX 1Z44A 4HNUA 4UFLA 3MYPA 3DXIA 3QW4B 5K4XA 3BK0A 1NOFA 4O0ZA 1R30A 2V3FA 2VENA 4NUWA 3JS3A 1G7UA 2ATMA 1I2PA 1Y7VA 3W84A 3N73A 1TRIA 3UWUA 1DHKA 2D0FA 1XDMA 3P60A 3TROA 1UKTA 2ZUTA 3GDRA 2D2OA 4UFKA 5E6ZA 1J0KA 3P8JA 1E40A 3W72A 3SECA 3CZNA 2F1BA 3W7IA 3W07A 1G5AA 4U31A 2FH6A 3UWYA 1SFJA 1KXVA 2Z2UA 3MMTA 4LT9A 2Y88A 4WY0B 3NR0A 4Q4KA 1H3GA 3LTPA 3NL3A 5U7SA 3TFXA 3WJSA 1IXQA 2FPTA 4O13A 1RV8A 2W0UA 1LBMA 3VSTA 3DFTA 1BG9A 1WAUA 1VFMA 1XSKA 3BLEA 3PBVA 4S2CA 5D2VA 2A4AA 1F73A 5EBUA 2NUXA 5F2MA 4LQ1A 3FW6A 2F7RA 2PRMA 5KMYA 1Z41A 3C52A 4IX2A 3CPRA 4O1DA 1CI1A 1SPQA 4ORMA 3W85A 1JRCA 1KTCA 1VC4A 3NPWA 1ALDA 3DU0A 1ICPA 1ZNNA 4J9JA 3W87A 3VKJA 1KB3A 3ANYA 3UNDA 2TSYA 1EIXA 3M1ZA 1XSJA 4GIAA 3I7QA 5DBTA 1V3MA 1AQMA 1MVYA 2XN0A 3BVWA 3W1QA 5E1QA 7CGTA 2EADA 3A23A 4UFMA 4GUGA 4LOCA 4U2ZA 3T55A 1K3UA 1RQBA 3BARA 4C1KA 5AHIA 3L5MA 1RP9A 1WX0A 1JIBA 2Y5EA 1Q6LA 5I0DA 4IMCA 5A6LA 1UD8A 2OZ0A 3GR8A 1LWHA 2NUWA 4ZQOA 2YFNA 1VFOA 4NJKA 1PAMA 3UZ5A 1VYRA 3PSVA 2TRSA 5D02A 1KM5A 1HTIA 4NX0A 3W23A 3SSJA 4UTWA 2Q8LA 2G97A 2NUYA 5H91A 3T44A 3LERA 1YXCA 1IXOA 3L5LA 5D04C 4A22A 1H7PA 1CXLA 2OYLA 2TPSA 3IEBA 4TVUA 4DPPA 1RR2A 1ZAJA 1QI3A 3L4XA 4ALDA 1UD4A 4LWWA 1LTDA 1JI2A 2XFWA 4FHAA 2YZRA 4TMCA 2NV1A
chains in the Genus database with same CATH superfamily
3FFDB 2VIRB 3O63A 4K23H 3SOTA 4Q0XL 4IRJC 4IW4C 1XDJA 4S3KA 1E51A 3WK0A 3N2JA 3O05A 1F61A 5I77A 2Q7YB 1YJDH 1GS6X 1MQKH 5AVYB 3D0AA 1SJEB 1UCBL 4ODTL 1Q7ZA 3PGCB 3UO1H 3MRMB 4L1HA 2CO7A 1J8KA 3DX0A 1KSRA 1GAFL 2AI0H 2VDPL 3DUSA 3OQEA 3IGAA 2WKOF 2BVDA 3WFBH 5HXMA 3BV7A 2BCKB 3K8LA 4Q4RA 3QJOA 3APMA 2ZUXA 3WQVA 4B5SA 4UTIA 4ZNEA 5JOEA 3KBVA 2Y69B 3WQDA 2QVMA 2NMSA 4YNYB 1EP3A 3FB5B 1COBA 1FNHA 3QUML 5EU4A 1HSBA 3DMMC 1A3RH 4H0IA 1V5XA 3WKQA 1SQ2N 3G6JA 3MFGB 2P48B 2D20A 1H3PL 2GWNA 3E2SA 1Z3GL 5DRWA 3O2VL 3LPPA 1I8UA 3CPUA 1D5BA 3KLHC 1DJGA 5D38A 4DF2A 3FFCD 4Y5YC 3WLKX 3C08L 3V8OA 3HI6H 1FA4A 1MJ8L 3U46A 4DHGA 2Q0ZX 1N7MH 1UB6A 4TMPA 4JZOA 3QNXA 2VR5A 4LSDA 35C8H 2ZQKA 3CDZB 3VTTA 3ENLA 5T26A 1EB3A 4HYWA 2BOBA 1AIZA 4L5FH 3VXOB 2GQAA 3OZ9L 4HUWB 4MYWB 1E1CA 1I0DA 3KYMA 3GMNA 1MCCA 3NJGA 2CESA 3LN3A 4C6JA 2H6PA 4G7VH 1EDHA 1FHNA 5BRQA 4Z1AA 4LJ3A 2XG9A 2DW7A 1TCDA 4PS8A 5IESL 4XBPA 4ZOAA 1JVNA 5IBLD 3MLWL 3LS5H 3MRKB 4LXFA 1X7IA 1YEYA 4JO5A 3THML 3H4WA 5TK2A 3LKNA 2YD8A 5CSSA 3PULA 5F2LA 1QO3A 2MKWA 3FUNA 3UJIH 3QPXH 3P0YL 2ODIA 3FIGA 2HJKB 4NQDA 2GTZA 3H4GA 3UADA 1A7BA 2DB8A 2JE8A 3QUXB 1KFAL 4XVOA 4D6HA 1KUMA 1H6UA 3WG7B 4L61A 4KWOA 3OAUH 4Z18A 2K4AA 3RLHA 3U2IA 5IUCA 5FGCB 2YL6A 1EO5A 5HY9B 4X3ZA 2K9UA 2WMIA 2AEIT 3TZVD 2ZCLL 1A1NA 4S1DC 4E9QA 5I2IB 4Y9NA 2ITDA 1K4HA 4BSVB 3FK3A 4IIGA 2E9GA 1K4CB 4FQXC 3UTTE 3F04A 1B3YA 1GW9A 3GNNA 3CLEL 1YNTA 5FS5A 3PG9A 5C3IA 2G3IA 4NASA 4PH6A 4OZ4B 3DMMB 1PL3A 4GRWE 1V7NL 5IMOA 3HRZA 5ANMB 2GJXB 1SYTA 3FLUA 2ZAIA 3ECQA 4MDPA 1H15B 1YKWA 4XX1G 4Z7VE 4K3JH 4PVNA 1W1ZA 1IBHA 3AISA 3EH1A 4IBYA 3RB7A 4RX0A 4D8LA 3TZNA 1Z2KA 1T5WB 4MJ5B 1BX2B 4QG9A 3BYTA 3VAEA 4DIXA 2VRAA 4GYPC 3UTTD 2VDLL 5FIPA 4UTBH 3T0EB 3ZJ8A 4MJHA 3L3OB 3NJFA 4QXGH 1KM1A 1TA3B 1J1PH 1CFTB 2AAVA 3MRJA 5E6IB 4E2OA 1W3KA 1EXBA 3O2DH 5HDOA 1KV8A 4PBXA 2DH3A 2CLLA 1RJRA 4YU1A 4XAZA 1O5KA 1X96A 1YMMB 4HK3J 2FFIA 2TMDA 5EU3A 3SOBL 4NI8A 1TTJA 1CWVA 1OCZB 2KLSA 5C0IA 4FA3A 4JDEA 3VOHA 4MCZB 3QFWA 4JHMA 1NPUA 3QHFH 5IT2H 1LEIA 4PG2C 3K2MC 5AC7A 1QEWA 3KEDA 1A21A 5DRIA 1C8VA 3N15A 4XP9L 1T21A 2H2PD 2QCHA 2XVNA 4K23L 3JV4B 4AWSA 1OCWL 3EO0A 2AK1L 3GSMA 2GIXA 4NSBA 1Q1JH 3N18A 3GMQB 1OVZA 3V7AE 3GMMB 2E76C 3MTRA 4ABQA 3EXLA 4PJDE 1UJ3A 1EXHA 2PP9A 3VD5A 1ZL1A 4DAIA 5CBEA 4MASA 1B30A 3C86A 3NDZA 3GSUA 1F86A 2HE8A 4E4FA 4NO3A 3PWIA 3RWCB 4AZBA 1Y5WA 3BDBA 3QWRA 5LGJB 5CG0A 2OR9L 2C8NA 2P5WD 3E0FA 1QSFD 2E77A 5F0MB 3RKDC 1HOCB 1MEIA 4K3JL 1RZGA 4KITB 1X9UA 3H1ZA 2IH1B 5C08E 3QRHA 4I3RH 5GGSY 1PSCA 1NICA 1U8HA 2I9EA 3NYKA 3QQ4B 5JW4R 1WC7B 1BFVH 1LD9A 3VW3H 3STFA 2YXMA 4W6YB 5LCVL 3VXRA 3H22A 4YTSA 3CZGA 2NLYA 4PW3A 5CMAA 1M9WA 3ULUH 4IIBA 2WXJA 3WMPA 1V51A 2YEZB 1G67A 3CYJA 4K7PX 5CHNB 1AXIB 4NNYA 5I16A 4HNLA 1AR1B 3TXZA 3LHUA 4L2LA 3MDJA 3I7SA 3UVAA 2VXTL 3OR6A 1SZNA 5C3LD 3GU9A 1ISWA 1MFNA 4KPHL 1XCTA 3NQKA 1J1XH 3M6DA 4HS8H 1Q72H 1P0SE 3BPOB 5DELA 3N2BA 5IMLA 1RIVH 2F6UA 2MSPA 4I1PA 1R19A 2WQAA 2X6MA 4PWGA 5ISZE 3P5ZA 5J57B 1U6AL 3M1BA 1O7DC 5TE4L 5AHNA 1SVBA 2JJWA 5IXEA 5IOPB 3PNWB 1DCEA 5CP7B 4DGIH 4E2VA 2G3JA 4R88A 3UJJH 4W6XB 4N8CH 3V4VL 4KXAA 3UPMA 2EKSA 2Y61A 4WR3A 1DWGM 3EHBD 4US6A 4HWZB 5ES4B 2VC6A 4NZ4A 3TN6A 5IROC 4OQTL 4OTXH 3QH3B 4FNPA 3IAGC 5C9WA 4WFED 2WNQA 1IKNA 3BHBA 3MUY1 3PY2A 4HTBA 1G7HB 3CN1A 4BH7B 1MFAL 5ABAA 3MUGB 5JMUA 4LLUA 3NCBB 1JGVH 1OM0A 2IPFA 2F5AH 1JULA 2PTVA 3BZ4A 3ZL1A 3M0KA 2FX7H 4RZ4A 4N2YA 3B0VC 1JPSH 5FDWB 1ZBVA 4FNUA 1OINA 2WIIA 1K03A 1CD1A 3LXUX 3RQ3A 2J6XA 1JDCA 4WWKB 3SUVA 4AYFB 1CFMA 4AMXA 1DDHB 3L0NA 3CSGA 3OVQA 3W75A 1BJ8A 4E3VA 1F56A 4EPEC 4IP7A 2K9FB 4M56A 1BFSA 1H1ZA 2CDGB 3ALWA 3GH4A 1D6VH 4N9BA 3P9WB 2ZBTA 3NNTA 3GG8A 4H8WH 1GMEA 3SB0A 4MSWB 3FTGB 4ATTA 3GLDA 1JR1A 1JF6A 1TMHA 2Y2YA 2XWTB 2X4SA 1MDAA 4LVEA 4UTBL 5A2AA 5K9QI 2MHAB 2BNUA 1CBGA 2B39A 3RDTC 4AQZA 6PTDA 4RQQB 1P7QB 3PXJA 3QMRA 1V55B 3OKEB 4NU7A 4KY2A 4F15C 2VVNA 4KWSA 4F7TA 1D9KC 5F9OL 1BQUA 3KVQA 1GOIA 1HFBA 1S9XA 2EDFA 2A4EA 3KCPB 1Y8BA 3PBWA 3LHTA 4I5BA 4E0RB 4MRBA 3IVKA 4AKQA 2LAAA 2R2BA 2BXZA 3O4OB 4XXDB 3FJLA 2FJFB 4DP8X 1UP0A 4PRBB 5I3IA 5SWZD 1K77A 5LZLA 4JIEA 2A9MH 4AEHL 3X11A 1PIFA 2Z8RA 3GIVB 1XBYA 2NSXA 1BVLA 3S88L 1IBGL 1A3LL 3LEVH 4QF1B 5AVQB 2YW3A 1WOAA 5JZ7C 4WOQA 1A6ZB 4LPXA 1WPCA 4R7DB 3D39A 3OAUL 2I07A 2X4RA 5I6XB 1D5MA 3G9AB 1IMHC 4XHJD 1BQHA 1QRND 3DA0A 3MHFA 4JQXA 5DHVA 1A8ZA 5SWZE 2JIEA 3ME3A 5D03A 1T41A 3GT6A 1XIWA 4DI9A 3MRQB 5ABGA 4QGCA 5F1VA 2BJMH 3K7UA 4AB4A 1NCAL 1VACB 2ESVE 4P5RA 4WUUD 4Z7WA 3S0PA 3THMH 4Z7WF 2CKRA 3DI0A 3IPWA 3WJXA 4X7FC 3B9KC 4LQFL 2WNWA 1GL4B 2UZ9A 3V5HB 1E7VA 4MX7B 4WW2F 1EHNA 3H21A 1NFDB 4L4VD 2DD8L 3T3PF 1OCNA 1QRNE 1T8QA 4TUOA 4Y1AD 1T2JA 4R4FH 5I23A 3KUMA 4FFYA 5DO8A 5D2LA 4QYOA 3O3BA 4XK2A 4RK8A 1I7UB 3OMAB 1FO0H 1V3JA 1UVQA 3DKHA 1L7IL 3BLPX 1SMDA 1F58L 2XWJB 3FUHA 3HQ1A 3P0XA 3QG6B 3E80A 3NGBC 4S1RL 3GNML 3F4VA 4LLYB 1UKPA 3KBSA 4OD2B 3FFSA 3VB9A 4R96B 5BOJA 1J5OL 1A3QA 4HC1A 1ZLUH 2FIRT 4ANUA 9XIAA 3I9IA 2Q8AL 4CD4A 4CCEA 5E6UB 5DXWA 4LEEA 4NUJB 4GRLC 4KUZH 4LPCA 4CSZA 3TEYA 1OJXA 3VIJA 2EDXA 1QHQA 3HURA 2A38A 4N0CC 1DO5A 1YG9A 2OPCA 3NSJA 2Z6JA 4GLEA 3X14B 4UILL 2NY2C 1WAEA 3POHA 4FQPA 3L4CA 4NL1A 4PY7B 3GO1H 1GGBH 3WLWC 4KFOA 2K3HA 1R3QA 2F19H 5JIDA 1FY6A 3WQOA 4DX3A 4DXKA 4LSVH 1S5WA 1CD0A 2WCGA 1H0IA 2N59A 3EWBX 2ZVIA 4X9IA 2OOGA 4NN7B 4TLSA 2VZ1A 5AECA 2VSKB 2MPVA 4UDUB 3CSYA 3W26A 4NRYA 2Q86A 1F4XH 2BGQA 3W7KA 1JPKA 2VX4A 3DUHA 4D9PA 1XCWA 1X8FA 3C6LB 5G4NA 5BO1L 5BZDA 5KSAA 2NXIA 3ISRA 4JTEA 1G1CA 3G6JF 3W1RA 1KEML 1QDSA 4LSBA 2MOGA 3TA9A 2YCKX 3PZUA 4H04A 1HCZA 1DJQA 3NVDA 3BWAA 3UNTA 3QKEA 3B4NA 3VU2A 3OO2A 4TNVK 3PG2A 4HH9A 3OR6B 5EDXA 4FXTA 2C4FT 2VL5B 3EJJX 1TTRA 3NQIA 3R4RA 5DJZB 1KJMA 4NNYB 3U4FA 2J6EA 4TRPL 2X0WA 3N5AA 1GG0A 2X28A 2KX9A 2EF9A 4I77H 1NGZB 4JRYA 1YEDA 4B9IA 5CMAB 3LZ5A 3TTQA 1AH0A 3AWOA 1L7TH 2X4QA 4Q4OA 1TSIA 2DZXA 5HYSA 2QIWA 1TWIA 3NPSB 1AGBB 2BSDA 3JV0A 2DS4A 2X2YA 3DAQA 1DZBA 2NXYB 3CHRA 3BWUF 1F18A 3MV7D 2Y25A 4DZHA 2X2IA 2ZPKH 1U91B 1NWSA 1NC2D 4XN7A 3MA9L 1M3UA 3GI9L 4XODA 3K6DA 3QNZA 4JFXA 3P4LA 3VFUA 4OIAA 2CG9X 2F7OA 3VFMB 3RU8X 2RBLA 4RA0C 4UQ9A 2QF8A 4Y2DA 2FQEA 4GFTB 4V1DA 4CMMA 5REQB 4YO0A 1T5XB 3BUIA 5AW3B 4NNBA 3VKKA 4FALA 2CRYA 3CXHK 2Z31B 3G6DL 4WTWA 4DW2L 2YZ1A 3SUTA 2XWBA 1IGYA 4MD0B 2CDEB 1N19A 3KWWB 5EU7C 2D8KA 3HZVB 4IRSD 1JDDA 2W94A 4HISA 2BXYA 4ZTPH 4C6QA 1QEWB 1KXTA 4G5ZL 3OB0H 2AZAA 1GQLA 1O7AA 3PP7A 3LSCA 4WU7B 1TTBA 2WSQA 1ZAIA 3G1VA 1BHGA 1QFPA 3GSRA 4YFEA 5MKGB 2DUAA 5DVKA 1W5NA 5IDIA 3L66A 4NWUH 1II4E 1LE9B 1BWLA 2NY0C 5T5NF 4JUTA 4FS9A 1L6XA 2HVJA 3ALPA 1RPUA 1UMLA 1XL9A 2JQXA 1AS6A 1S7UB 2EEXA 3VFPA 4FX8A 1FWIC 1F05A 3WFAA 2HFGH 3C5SA 5C08A 1QLEL 2CKBH 1IEXA 1M2OA 1Q2RA 4MXWL 4PJHF 5EU5A 4OB5L 1P6WA 5EU6E 2W1NA 2J6EL 3D33A 3NZPA 1MJJA 4IDJL 4XGZA 2ZE3A 3LM7A 3Q0HA 4K39A 3FDWA 4LCWD 2HLAB 4AUUA 2DT3A 4LY8A 1FNSL 2QUMA 3CV6A 4G43B 4P2RE 1SO5A 3UR7A 2ROXA 4F24A 2YAOA 4PTUB 3D0VB 4BHYA 3GBEA 3GBDA 1HK6A 1DWHM 3I10A 1SUHA 4JO1L 2WZ6A 3VXSE 2O6FA 3VIGA 1QWHA 4GT0A 5T1DH 3HMCA 4BSVA 4S39A 3QXUA 4FOJA 4PJEA 4ZFMA 4P5SA 2XIIA 3RX8A 3STZA 3SDDD 2MCAA 3DX8B 4L1GA 4P2RD 3ZT7A 3QCVH 3TLRA 3MLUL 4CVZA 4TQTA 3V6OC 1MWAB 4UT9H 4YZFE 2WQ8A 2A6IA 4O9HL 1WA3A 2JIXB 4U3SB 2DSWA 3TQKA 3HZYA 3CMJA 1MJ8H 1Z32X 2OMTA 4K9EC 3L7RA 3PVFA 4ZFCA 4JRXE 2PDQA 2X9XA 3VH8B 4PCFA 1FWBC 1NJJA 4W5UA 4O57A 4CC1A 1U2HA 1DUYB 4NQSA 1MNSA 4W7VA 2Y24A 1IWAA 5I5MA 2DQWA 1WCBA 3H7RA 1H09A 4HNCA 4OD1H 3DX6B 2PDUA 4N2HA 4D6EA 2DT0A 4JKPL 5JPMB 4E4UA 1OTSC 3IMTA 5K7JA 2BXVA 1TXKA 4BFIB 3W38A 4R97B 2YA1A 4TQIA 1JZ8A 1V77A 2PP0A 3R1GL 1T04A 4L64A 2OZ4L 4GI8A 3GKFA 4Y5VC 2PGRA 1BVNT 3DRQA 4C4UA 3VXQA 1UUMA 4MNGB 4ECLA 1AH1A 3FCSB 4JFHD 3P4MA 3DVFA 5JW5B 3BKYL 2CO6B 1M7DA 3TIEA 2FO4A 4GVHA 5IB1B 1M03A 4RZBA 2PLCA 1KENL 1TDQA 3GI8H 2H1PH 2WLZA 4MMZC 1RZ7H 4APXB 4PR5B 1JJUA 3FT4B 1JSYA 4PRIB 3G6JB 2VKZG 1EHLL 1MCIA 3M43A 3Q44A 1V4YA 1HGYA 2IXVA 3BYYA 5HANA 2Q2LA 4EZMA 1J0HA 3T4AA 1NC4A 2QVFB 1ZLVH 4DGVL 3LNMA 3NPUA 5IFJB 3JTTB 1KIRA 3PIQA 4W70A 1W3HA 4IRZH 3DPDA 3WLWD 2TODA 4W84A 2CO7B 1NC2B 3K8MA 2WCAA 1PS9A 1SJEA 4G6CA 3W2KA 5CZSA 1TPXC 1TENA 2VQ1A 5B8CC 3E5PA 1BTCA 2HT2C 3GUWA 4ZXBA 1AJ7L 3VI4B 3WCZA 4OBSA 5EO0B 1I3UA 2W60A 3PQYB 4U3CA 4Z78A 2XETA 1J5TA 1EDYA 4JYEA 2XYBA 3MXWH 3CU1A 3FUEA 3WFEH 1FH7A 4WWKC 2OZ4H 4ZOBA 4CU8A 1P1VA 3L2MA 3WTYA 5BOFA 2AMUA 4NDMA 5AN7A 4HCRH 1VFSA 4L48A 3HG3A 4KKAC 1C29A 5IVZB 1VJIA 5GGSA 2VDRH 1S7TA 1YEGL 3D0LA 3ZUCA 5JPMC 1XISA 1QUNA 4JFZL 4DP6X 5EBWB 5BV7C 2EPOA 5EMJA 4GW1A 3P11L 1RK7A 4B9ZA 1TTQA 4RFEA 1Z9AA 3KS6A 4CD7A 3QZOA 3ROOB 1B0RA 4MOZA 2KS0A 4WY7H 3WD3A 1NCUA 3EOLA 2R1MA 1OB1B 2EAEA 1S9WB 3E0GA 3LIUA 4X6FB 3FUIA 4XBEL 3SKNB 1K70A 1M9HA 2PAJA 3AU2A 3M7WA 4QRUB 4NAFA 2PLTA 1E4WL 2XXCB 3S4SB 5CR1A 3S8GB 2E86A 2PYFA 4Z7QF 1YNLL 1A5OC 3F4NA 5CEZD 3KBWA 5CC3A 4TUKL 1QPOA 2BHZA 1AO7E 1UH4A 1WITA 5FO9B 5EOTB 3BE1L 2UX7A 1NDGA 3FTVA 4S2SB 1FL5B 1B3WA 3W2MA 4O00A 1ETB1 4NUGL 4AEIH 1GRWA 5B3JE 2EE6A 3GSQB 4L8DA 4F57L 3OZYA 5DURD 3HC2A 2R0WL 3E7JA 4PREB 3D12B 3GGWB 4U6XA 5KW9L 1K1DA 4MA3B 2QV5A 3VUAA 5I30L 2KT6A 4BA0A 5IEHA 1KXVC 4Q14A 5D72H 1MUWA 1UXLA 3IPEA 1MI5E 1FVCB 1AO7D 1A66A 1SZRA 5HI4C 4OECA 1WD9A 2WLNA 1YPZE 1R6VA 1ZXQA 3RY6C 4MBRA 1BWMA 4NX5A 5A6JA 2GK0B 7ODCA 1IXPA 2Z35A 3KTSA 3HGSA 4LUTA 2Q3ZA 1Q94A 2VGFA 3LD5A 3HVNA 5B7MA 3WS6A 1GZJA 4R7JA 3IJEB 2NQJA 2RB8A 3IETA 1R4XA 4LU0A 2NXHA 1JPGB 4IS6A 4I5UA 1AQKH 2ZP8A 1PWMA 2KPWA 2XZCH 3I84A 4XNMB 1MFEH 1FCGA 1A7QL 4AENA 1KBKA 2YXXA 4XO7A 1XKJA 1UWEH 5SWQA 2B0SH 2I32A 3A4XA 4AVKA 1MRDH 4TUJB 3PK7A 5ENWB 2OCZA 2WAQA 4AD5A 1PKYA 4XPAL 2GSGB 2KZKA 3SCMC 1YXYA 2ZSVA 3VFTA 4JYDA 2GFBA 3HPSA 2H32B 4QEEA 5A8MA 4Z2HA 4U5IA 1WH0A 2A3EA 1S6NA 4GCXA 5HI5C 1F8TH 3CV1A 3WN5C 1QLEB 3B9VA 5CPQA 2PYEB 3QDMB 1BWVA 2XV2A 3N11A 3FU7B 4IT1A 3K1DA 4K73A 4BF5A 2P24A 4HUCA 4CD6A 2VFGA 4CNIB 3S2JA 1W72A 4NKDA 1RQHA 4FI4A 3TUUA 5T3XH 3ILPB 4PAZA 1CDCA 3CH8A 1O0VA 1Q0EA 3ITCA 2GPZA 4XO3A 3LKOA 5ESQB 5CZRA 1D3HA 3P9MB 3RNKA 3XIMA 4PJHE 4OAWA 3FNDA 4TVPE 3ZIYA 2FJGA 2F7PA 3AWEA 1AI1L 3EGSA 5DJCB 5J12B 1AFVL 4BH8A 3BUBA 5JHDB 4YVXA 1X39A 3DOSA 1GZPA 4HQQH 2FIKA 3QEHA 1B3OA 4F2ME 3VTRA 4WJG3 1RVFH 5EIIA 4GQRA 3SADA 4GKTA 3H9SA 2E4FA 3DBXA 3UGXA 4X8XA 2F58L 1KN2H 1T99A 4IG2B 4L29B 2VR4A 5DFAA 1RUPH 4A66A 3CFKB 2HX9A 4CC4C 2H90A 1EWDA 3D08A 3DFQA 3ZDYE 2DLFH 3QJAA 4I2XB 4WHYH 2YLLA 4OV6F 1PG7W 2JQZA 2BP8B 2XOTA 4ODWA 3MLYH 1G9NL 4N24A 5IM7A 4M1BA 4RFNC 4JJOA 4GKSA 1GCFA 3S9YA 4PUBL 1VCAA 3GEWB 5LIWX 1GNXA 4DUWA 3PXHA 4I0PB 2QKSA 2BASA 2K8MA 4ROPA 4U3AA 1LP6A 2APSA 1CE1H 1FIGH 2NVAA 1FV1A 1NEZG 3X3GH 1VPOL 4L9LB 3FO1B 3NJ3A 4DO7A 2VWTA 3USZA 2MH4A 3K6SB 1CICC 1ETZB 3W9EA 3WJYA 1T4WA 2FJHA 5GJNA 3CXDH 1MEXH 3HMXL 4Q6KA 3L2IA 4AXKA 5M3WA 3PTQA 1ACYL 2WV8A 3S2AA 1UWFA 2VXQA 3WFCH 2HJFB 1TJHH 4PJ9C 1FHGA 3KLDA 3WNLA 1C8XA 1XC4A 2RDTA 3QQ3B 3BO9A 4XZIA 3B7SA 1YJDL 2NY2D 3HLAA 5DY2A 5DRNA 4G5ZH 2CIIB 3L3KB 2P5WB 2OX5A 4GUFA 4JDBA 2HTMA 4BZ2H 3U36A 1VPOH 4H8WC 4O2EA 4XE5B 1G6CA 1T5AA 1UR1A 4U1MA 2RQEA 3PUOA 3VCLB 4KRZA 1SLUA 3CVIL 3IDUA 1SJBA 1WDQA 1I45A 2FTPA 2W62A 2DJUA 3X1BA 3O0RL 1XUZA 3O41A 3ET9F 1SJAA 4MZYA 4J3OH 5BYWA 1RZFH 5TGBA 4ZSTA 1FVPA 1W32A 1VDGA 2YKKA 4IEFB 4O54A 5E8PA 1EAPA 2EP6A 4JQVA 1DXIA 3BP7B 1QTWA 4E9WA 4UF7C 2ATKA 5GZOA 1IUZA 1DR9A 1E3XA 4B91A 4PJFF 4X61A 3DHMA 4AJ0A 3HNVH 3K71B 1A22B 4LALA 1T6VN 1E9OA 3Q3GB 3SFKA 1KELL 1PHWA 5CN1A 2RALA 1OAUH 3GHBH 4JLRA 4MA1B 1SN2A 3TIDA 2EEAA 5HHNB 2BWIA 4HBCH 2N4IA 4K3EL 3W6MA 3WD4A 2WZTA 5HNUA 4YUEL 4YEEA 1I1CA 5A6MA 2G0WA 4CN1A 3EWWA 5I3HA 2E9JA 3VYLA 4ZCWA 4GSDL 1QLRB 1AGFA 1AJZA 4Y9AA 4RPPA 5D7LA 2NNFA 3S1UA 4GUPA 1BP3B 1NFIA 2FUTA 3D69B 3ULVC 2IWFA 4IGBD 1TV7A 1QA9A 3K1KC 4IGBA 1CDYA 4YDLB 3ARPA 4PUEA 2IGTA 1JN6A 2OSWA 3BO8A 4I0CC 1JQVA 2WBGA 2WMKA 5JIPA 3G5YB 3T0BA 3VJ6B 4M5SA 4XAGA 2C9XA 1JNNL 4L0ZA 4ACZB 4A6YB 4CAGA 2ACSA 4GINA 1YNKL 3KPLB 5E2TL 1CECA 3OQ3B 3T05A 1CFVL 1FUYA 4IFKB 3BMVA 8FABB 4CGUB 4EUPG 1B4TA 2F61A 3MI6A 4HCGA 4K1WA 4Z42C 5LO7A 1NQ6A 5K59F 4NO2A 3TURA 2C9PA 4FZ8H 2NYZA 1I8IA 4LLMB 1OQXA 2DPKA 4FL4C 2IPKA 2V2WA 5A5WA 5D8JH 4OBTA 1YMHB 3TZFA 2WM1A 4J1UA 1PVNA 2R6OA 4RAVA 4WDIA 3WJMB 3TC6A 3Q58A 1QPPA 4QRFA 2OYPA 1AKJD 2PF0A 3S42A 4FE9A 4AVHA 8TIMA 1U3ZA 1TVNA 5I6NA 1XRTA 3RWIB 3B9NA 4FS0A 1X5KA 5LIYX 4NRXA 5F3BB 1SBSL 4P9HL 4E5XB 3QCUL 2YMOA 4BQ6A 3QQ9C 2D3NA 2J5WA 2G0LA 3W53A 1CI3M 3IFPB 5F9JB 1EA9C 5KW9H 4Z7WE 3SCMD 4QOKB 4OI7A 2GT9B 3EGJA 4RMBA 2FX7L 2J72A 3UTTB 3BIKB 4QJ5B 3QUZC 1CT5A 4RLIA 4BFEA 3A3XA 4FMKA 1NAKH 2IIJA 4QCFA 4F2BA 4PJEE 3GTFA 3VGFA 1BOGA 1TVBA 2H3BA 3BGJA 4HHLA 4V27A 2CNZA 2Y06L 4R0LB 2L3BA 3ABQA 5HJLA 4PB5A 1DQLL 2E7HA 3OKDA 5I73C 2YA2A 3NA9L 1YEIH 3QFJE 3WMQA 5MHSD 1QWGA 3WKNA 2ZJSL 2V2DA 3Q1EA 4C60A 4GMSH 4LVGA 2C79A 5B38B 5HA7A 2YUVA 1W54A 1A4AA 3W9DA 3BSMA 2BX7A 5JIWA 5I6SA 1P9MA 1JGEB 2VLRD 2X44D 1FO0L 2HLFD 2WC4A 4JE0A 3PS7A 5D70H 3D30A 2QDGA 3M17B 3TTYA 3WLBA 3GF8A 2OCCB 3AB0C 1YEGH 2KHAA 4M7ZB 3U4EA 2IKIA 5FA3B 1BVKB 3FYYA 4L4TD 4PJ5D 2R1XB 3RX7A 1AO7B 2QFRA 2W9DL 1J11A 4JO4H 4Y4KD 1XBZA 1LG2A 1CK0H 2DQEH 2E6JA 4BJLA 1Z42A 2QJIA 3SB3A 2WMJA 2Y7EA 4MY1A 4UTKA 3MBDA 3DROA 1MPAL 4P5KA 5GRYA 4HEPA 5HGDB 5K9JL 3AIUA 4C90A 5TFSH 3QTPA 1G4PA 3D34A 1Q9KB 3K4DA 4K5PA 4HHAB 4QWWC 5AC5A 1SFHA 3L1OH 1RIHH 3MCOA 3M0XA 4TNWK 1RPQA 4I77L 3BQ5A 3WF4A 3F12B 3LQGA 1JRHL 3TU6A 4XCCL 3NJNA 2FPVA 4HCHA 4GW4B 2QDDA 2GJ6A 3EFDH 1VADA 3ZDYF 2IADA 3VQMA 4IMEA 3JU2A 1C8YA 2CBVA 3QI9A 4DQOL 3M0JA 4O2CA 3U4BH 4OUOA 1EEPA 1G7MA 2F68X 3AM8A 4JY6A 2DZAA 3LLFA 5E2WH 3APDA 2A9ML 4BBWA 1H3VA 5FGBA 4M7LH 1QKZH 3P30H 3PAJA 1VZGA 5AB9A 3CMGA 1RZKL 4DYKA 1QBBA 1SYSA 4MBOA 4IOTA 4PMRA 1SEQH 5F71A 4R90H 5K9QG 1VPQA 1GCYA 1UWGH 4NSKA 5M5DA 2BNRD 3FTSA 1A7NH 1CI5A 5F7NC 1DPMA 3N41F 5DK3A 1FDLL 2WZPD 3FB8B 4UCGA 1N6QH 2OL3L 3QUZA 1O6IA 3HPFA 2DMBA 3KVDD 1I3GH 1ZA3B 4L6DA 4CNNA 4EACA 2EQDA 1AZ1A 5HHXL 1WT5A 2PTTA 5GZOC 3SE4A 3KYOB 3MBEA 1FNAA 2F5AL 1BPLB 2P8LB 1LP9E 3MJ9H 4TQEH 1H7XA 1XGEA 4REQA 3BJSA 4JHOA 2Y23A 2J6VA 2IH9A 1CLYL 1N10A 1W9XA 4P48A 4PP2A 1DQXA 4WI3A 3MV8B 2X6BA 5DC2A 3RK8A 3HHRB 3GXNA 4FQ2L 2FVMA 3U6WA 3B37A 4MHBA 1CTOA 3TH4T 4RE3A 3FBQA 4XV0A 1ZHNA 4KQ3H 4X5WB 3VRLE 1WIOA 2P28B 5SWSA 4DZBA 4MMZB 4DZ8B 2JJTC 3QGAC 1X6UA 4B16A 1JHLL 5K39B 4DXVA 1WWCA 2VDQL 1T1ZA 3T4YB 5AENA 1XWYA 1AG1O 5GGUA 3JWDL 4L56A 3T0XA 3IJ6A 4NJHA 5E9XA 3MLTA 5F3HA 2EYRA 3D39D 1ICSA 4NNXA 4AMKL 5E8EA 2BOFX 2X89A 3UP6A 1QRKA 4RETB 5DD5L 3VWJC 3QJQB 4AQ8A 1EJ7L 2UWEE 1TNNA 2AITA 1N59B 1A8JH 1ROCA 3GXTA 5IW1B 3BW9B 3T2NH 2GK2A 1C9DA 3RUGA 1KR0A 3IRPX 3MCMA 4JPSA 8CGTA 4ODVL 1SDAB 2BB0A 4IM4A 4FQCH 5IB3A 3U9PH 3RVWD 4JFYB 4D0DB 1WA0X 4PJHA 1RI8A 1MWAH 1LP9F 1FL6A 3WGUB 5A6IA 2BMBA 4IXHA 2ZOWA 4NJ9H 5BS0E 4HSHA 2DQGH 2RGSA 3H70A 4EXBA 4GGBA 3SGUA 3PSWA 1GKEA 5BVPH 1FP8A 3E38A 1ELSA 2H3NA 5IQ9A 2FGLA 2Q87A 3FK4A 3PBYA 1SDDA 2AV7B 5CSRA 5EORL 4KJYA 3W1MA 5C07D 6TIMA 2X9YA 1FRBA 1UJPA 3PWUB 2LOEA 3ESPA 3H24A 2ABBA 4MZIA 5PCYA 4MNMA 1KTNA 5AW9B 4HYTB 2ZIDA 1RCYA 2BP0A 5D7IF 1YC8A 3G5ZB 2YR1A 2VH5L 3M16A 2HKAA 4LT7A 2DDQH 3QO1B 4BKSC 1TTAA 1CN4A 5HBBA 3IDJB 4NC2B 2DTSA 4P46A 4M8UA 5ID1B 5JR1H 1U8NA 5EZLA 2R8SL 5DHDA 3U9PL 3AYSA 1IGIH 1A9EB 4RGNE 1OPOA 4GWEA 3CFEB 3T3MB 1H7WA 1N0LA 3QZWA 4XPTL 1LEKA 2YAMA 2X4UA 3N3EA 4X4XB 1OT1A 1HHJA 1MHCA 4JHUA 3DV4A 3WDPP 2QHLA 4OF6A 4CVXB 1MFCL 2ZUQC 4S3JA 1PF3A 4QGYA 1T0PB 3P93A 3C2OA 4R9XA 2LTQC 2EBNA 3ICJA 2PWDA 1JHLH 3O8XB 3GMLA 3N6YA 2PPCA 4PCKA 3WE1A 2X1SA 1KRBC 3CAFA 2ZZ2A 4CQ8A 3OF6A 4Y16D 3B2UC 4LW7A 5GQBA 1I8KB 4QDPA 1HI6B 1M05B 2Y1ZA 3S8WA 4O19A 5I78A 4JRFA 3KWUA 1SJHA 1OOWA 1GTNA 1HH9B 4D6GA 3T4CA 3VFVB 4PIRF 1OAQL 5FXCH 5LBVA 4AIXA 1FZKB 1D5RA 1A1MB 2FBJL 1E9YB 2EYTA 1R3RA 1TKWB 2N0KA 3FH5A 1JVOA 3EJPA 4X9BA 3ZRFC 1U83A 2H9GB 1W8GA 4DUOA 5D72L 5ALCL 3EOSA 1I9RH 3KRZA 5HATA 3TLQA 3B8DA 4X4KA 2EXWC 3NGFA 5AW4B 2GI7A 3R94A 5I82A 5E8NA 1MH5B 5HVHB 1U58B 1MQPA 1I3VA 2J24A 1CLZL 1KJ2H 3ARFC 3HMXA 1VGEH 3OMNB 3FN0L 4JGUA 4CADA 3C60C 3P4OA 1J88A 5FDYA 5FYJE 1IEVA 2J44A 4PCNA 1G4TA 1QAPA 4N1EA 4LGXA 3MDUA 3GDCA 1LOLA 3HNTH 2KLTA 2YPKA 5KJRH 4G7FA 4N8UA 1NUNB 3VX0A 3A9IA 2CUAA 5BUGA 4XSLA 1Q8JA 5E24E 3UPBA 3SAZA 5CLWA 3FOLA 4X0KA 1D7KA 3L67A 1W3LA 3NGJA 3ESUF 4YDIH 2Q5BA 2JQMA 4JO1H 4JNMA 3D2UA 2CO1A 4Y4KC 2JKPA 4F40A 4J4PD 1GVYA 2VQTA 3GZAA 4D9LH 2IKHA 3LHAA 3TNNB 1FNSH 2JTDA 1ICQA 3D2UB 1I4FA 1U2YA 1IE4A 3RTQD 2VAAA 4S0SD 4DP7X 1ZAHA 2Z34A 2W5FA 1NANH 3HMWH 3MFFA 5MEPA 2ADJB 4PV8A 4O11A 3THDA 3U5YA 1EA0A 2WJ5A 1D5XA 3GTTA 3IV8A 3DDGA 4Z7UE 1UD2A 4FKKA 2E5CA 6PAZA 5IF0B 4HWUA 3D8MA 1CICD 1K8XA 5BW7C 3D3VD 3QUXD 4Y2OA 1WWWX 1XF2B 1G4MA 1BM3H 2DV6A 3WEMA 4YBLC 2UYLB 1JPEA 4WEEA 4BE5A 4PJDB 4UQCA 5L7XL 5EEZA 1EFZA 1EJSC 2QF7A 3UXDA 2FMNA 3DC8A 4LSUH 5JUEL 1YTEA 4GW5A 4KTGA 4C5YA 3KLLA 5AW8B 5C5YA 1NOAA 1L5GA 1BREA 5E95B 1ZHKB 1INEL 5JQ9A 1XIEA 2K0RA 2G95A 3MRDA 3JWOC 1WYJA 3SZKC 4FAAB 5HI3D 5D4YA 5I26A 3S36L 3DTUB 3HG2A 4PS3A 3SCNA 4AQAA 4UAHA 4Z3IA 3GIYA 1RJZB 4PRPA 1KW1A 2YZ5A 1V5JA 4GJIA 2X70A 4LV9A 4PJAB 1A3RL 4BV1A 1A3XA 1XLAA 3IF1B 4PB0L 4PMVA 1N55A 2EG8A 4B27A 1JCLA 1I8KA 2REQA 1WQ5A 4DAGH 1RK1A 2VLJA 4AY8A 2H1PL 4Z7UF 1WD8A 4M9PA 2Z3FA 3KGSA 3ZYZA 2GVEA 3IJLA 2VN4A 3QR2A 2ZE0A 1E9QB 1S2VA 2ENYA 3TCSA 4MZ3A 4TQEL 3TV3H 5I8CB 2Y7FA 1VFHA 3MGTA 1IKNC 4NBYB 2C18A 1FE8L 4NO0B 4PBVC 5HYQA 3FSTA 4HCFA 2OGJA 2DI8A 2OV0A 4JCLA 1N5AA 1B9BA 5CPLA 3B8YA 1J79A 1S39A 2JK5A 4FQLH 1ILUA 4WRHA 4BCEA 3RWHA 1MG2C 4KNTA 2NQ5A 4HV8B 2H0PA 2IMRA 3WLHA 4ML9A 1BYAA 1NM9A 2GITA 1YPZF 1GEQA 1FSKC 1RBLA 3WG6A 2XKNA 3OIXA 3WBYA 1CFNB 2WD0A 4FRWA 4ZX6A 4IJBA 2BVEA 5F7KC 2EE2A 2G9HA 2OSLA 2YPVH 2VXUH 3I75B 2WWMD 3V4UL 1J5CA 3VQ1C 3M88A 2AABL 3FYIB 4M48L 2YGNA 2AQ1A 3U7YH 2XHNA 2A3HA 2QAFA 2XZAL 4URIA 3VWKB 5AW2B 4ILSA 1P5BA 4X7EC 3BMWA 5KYUA 4XVDA 5B7EA 3ZLHA 1UXSB 5HHVL 4RBPK 2D3JA 1SDYA 1MLBA 3G5VB 3N40P 1OGTA 2QSVA 2B0MA 2PDKA 1TU2B 2LLLA 3QIWC 4U6YB 1I60A 4FXSA 1ADDA 4PJHB 5E94A 3NZHL 5D7JD 4NQED 3RLSA 1EGJL 3SQRA 2ANUA 5E2UH 5I71C 1R17A 3GYCA 2O92A 5LKNA 1M7IA 3QZ6A 3CASA 3CNKA 3O6FD 4HNNA 4PRTA 3IGSA 4HDIA 1JF1B 5E8EB 1V93A 4D8AA 3V4PH 1T7YA 4UAOB 4XMWA 3SQLA 4EN3A 1RJPA 3CVBA 1KLYA 5KVGH 2GJ6D 3L95B 1JNEA 5SWZA 1D6VL 1XDLA 2TRHA 1N6UA 5F88A 6REQB 4Z1BA 1E8XA 2HRWA 4I0KA 4WHTA 3MOAL 1LRNA 2V30A 2WLKA 3D4GA 1BKSA 1E4XL 2XUCA 4LNRA 2E9WA 4JFED 1RHHA 4PPTA 3GW0A 3UG4A 1SPDA 5H2BB 3ALFA 2A99A 1NMBH 4HF5H 3TVMB 1KCSL 4GRLB 3VI4E 1E0WA 2XV6B 3CIQA 1QBMH 2XV0A 4AZCA 3SPIA 2Q3AA 3WD5H 3U6RA 5IIEB 4QX4A 1OKEA 2P8LA 2A73B 4Y16C 4M8RA 2R23A 4NQCE 4EWJA 4K2UH 3LCHA 1NGPL 1ISXA 1OBAA 2LTQB 3NYZA 4INFA 4X2PA 1BD2E 5DDHA 3TFKD 1DSYA 5DVMA 3K4AA 3RNDA 1FZJB 1E3ZA 3GU2A 4TYUA 4CCZA 1P0KA 1TQJA 3P2BA 4HS3A 1D6EB 1R1CA 4PEKA 2YCEA 1QNOA 4A8LA 5D1ZB 5JW4Q 1HWHB 1H3PH 1XBRA 2NY1C 2AJVL 2X1XR 4UBDD 1P69B 4I0PC 4WHDA 3U2ZA 3ULUC 1TMLA 2CLRA 3OR7B 3WD5L 3BP5B 3B5TA 1MI5B 1U8IA 4MS8D 1NMAL 5E5CA 5HD8D 3HNSH 1X7FA 2FTYA 3ATZA 4BQ8A 4YL4A 3CAVA 1OGSA 4Z5RA 5FYJU 4LVOC 1E4LA 1FBIL 4WSJA 1LCOA 5D6DA 2GHWB 3PHSA 3WQPA 5EZJA 5EU6A 3KPOA 3ES6A 3L3IA 2RR3A 3PV6B 1CW2A 1F90H 4I87A 1P48A 4W7WA 3L81A 1G0DA 1TZGL 1R87A 5SWSE 3IGHX 4OHQA 2ADFL 4QUOA 2HT4C 4GEJA 3WIHA 2VDIA 2ADGB 1X97A 4P7NA 4EIVA 3PWJB 2FECL 5CIPH 2DT1A 3UWVA 3T8MA 5E6ID 1X1ZA 1XINA 4B5TA 5AYUH 2XVPA 4P2VA 2GHZA 2YQ3A 3GHEL 3BESR 3PFQA 4X80H 4MXQC 4MJ6B 3TBCA 4LMQI 4CDHA 1A3ZA 2DQIL 1BKHA 2YCLB 3MSYA 4HPJA 3P61A 3GNDA 4OUUB 4UTFA 2XBTA 3QORB 5G1MA 3UYPB 5F2FA 2F1EA 1MREH 5FM8A 1GZHC 1G9NC 4N85A 3WV0A 3QBTB 1O1HA 4BKLA 1QMUA 4GJTB 8XIAA 4HX1B 4ANWA 4HD5A 3QIUC 2JTYA 4M5YL 4PJFE 1NP2A 2A7NA 2D3LA 2C1IA 2RACA 1TQCB 4YDMA 4QAWA 5DR5L 3KVMA 3GJEA 1VGAA 4LH8A 4MPQA 3ELFA 3WQ8A 4QRBA 3AB0B 4GT7A 4TVPD 2JVUA 4JTGA 4PJ7E 3SPHA 3EOBB 1U4EA 1DIEA 3E9AA 1KBGH 1F02I 2WQUA 5AYQA 3C6LC 2UY6B 4N2DA 1TTUA 2V2XA 4JREC 4Y4FA 5DSCA 1BTMA 3RNQB 5MI0B 4G5AA 4XP6H 2D4FA 4ZD3L 4ZFFA 3QW9A 3UDWC 2GJZB 4MA1C 4BD4A 4ZG1A 3P54A 4PTNA 3RVXC 5AVRB 3L5JA 1N82A 4HUMB 1IR1A 1JFHA 1X9LA 3PAYA 4NKIH 5DD0H 1M7JA 3F05A 4RGMB 4YMPA 3CFBA 3PGFH 3MBWA 2LABA 2NZLA 1GKPA 4JDYA 3Q8BA 1GOXA 2VCCA 4TXVB 2VW6A 3DENA 1ZWIB 1YXDA 4X63A 2BWQA 5AZ0A 5F93C 2NUPB 1IEAB 1R3KB 3MZTA 4JAMA 4YJ5A 3NFPA 1SYVB 2JI3A 4JFFE 4H88L 2YSWA 3LKPB 4DO4A 1NEPA 3GUTB 1PKNA 3O8XD 2PMQA 1EJXC 1ZY9A 4Q6IB 4AH2A 2H8ZA 2E1WA 4TSBH 3UROR 2CPUA 1KF9B 1ZA6B 3ULSA 1IM9A 4JR5A 1E6OL 5JUVA 3WDQA 4ZFGH 3WFCL 3AU1B 5L4FA 4LMQE 2Y7LA 3QSKB 4AVJA 1C5DB 3NIFE 1VFLA 3HG1D 3FFOA 2BW4A 4NIKB 4PBDA 1B5TA 3S3DB 2CLKA 4U1KA 2QULA 4ENED 2VSMB 3AICA 3QEQD 1BVZA 1X4YA 2PGEA 4WCYL 1EFXB 1NCBH 4JFQB 4ECNA 3LQZA 2C91A 3PC0A 1F00I 2C1PA 2UY7B 4MNHA 3QVQA 2A6KA 4N2MA 3ORJA 2ZWKA 5LIKX 5CBJA 3LAFA 2QJDA 1DBKH 2BNJA 5C1MB 1EX5A 4I7ZC 4MHHI 4NPKA 1E7UA 4OW6A 5CM1A 2HWGA 3CXHJ 1RD5A 3PWPA 3Q13A 1FSKB 3TS8A 4B5EA 3TF7C 5ITBL 1EZLA 1HDMA 1T1WA 2MPAL 5GVJA 1QSFE 3GFUA 4YDIL 3LOTA 1KRCC 2D31A 5CC7A 5D1QC 5D7JC 2WPGA 2OMNA 4MJID 5F6IC 3C60A 5C70A 4LS1A 3GAYA 3MI3A 5A6TC 3CG8A 3VDGA 4O02A 2CDFA 3R19A 4JG0L 3ZE2E 3VE9A 1FI8C 5SX5K 4YHML 5KUKA 4LKXB 1FCCA 2CGYA 2XQYG 4GRWF 2JSFA 4Q2ZB 1JUEA 3AXKA 3FRPG 3UZYA 3LKQB 3L3DB 3C60B 4GBXB 4Z7QB 2DZBA 2Z93A 4LCUB 4HIQA 3K71A 1TPB1 1R0MA 5CPMA 4B92A 1L9MA 2FEEL 4W9JC 3I68A 4ICCX 4LCWA 4Q4QA 4L1LA 1Z3GH 4KKLC 1LDCA 5L6YH 2DQMA 3GXMA 3SYCA 3NXLA 4G8EA 1MCLA 2Z31D 2OK0L 1MFBL 1RH9A 4H5SB 2GEQA 4GBDA 4MNHB 2QGDA 2R0KH 2LU7A 3CFQA 4JG1L 3TBTB 3RLVA 3M0VA 2J9YA 1Q4NX 3L5XL 3GSVA 3MNDA 3SDCC 3GTXA 4BJHA 4XBMA 5GPRA 1AW2A 2P5EE 3B0PA 2QHRH 2XU9A 2X1WL 2Y4SA 4XWGH 5K9KA 5CWSA 4PZVA 4X2RA 2J1YA 2L7JA 5FF6B 3S0CA 1TVHA 1XGQB 1TPDA 4B0MM 5GS2D 5IQMA 3WO8A 3FQUB 1THAA 1RA5A 2UXVA 1YPZA 3S96B 2WJDA 2HRHA 4KCUA 4N9EA 3GXPA 3ZHKA 3WDJA 4QTHB 2ZKWA 3VG0H 2DTMH 3GEFA 1XBVA 3SOBH 2GAZA 5DEJA 4QJ1A 4AIBA 1DO6A 2R4SH 2PCQA 3D6NA 1OP4A 2VXQL 4KC3B 1NDVA 4PCPA 1EO7A 2WWKT 1HO4A 1AIFA 1RMFL 4UU9B 4QRQA 5E56A 5L2JB 4KI5F 1VRDA 1YE4A 5JW3L 1G7QB 4P3CH 5K69A 4J3OC 3ARDB 2HG5B 4OCYH 2DDQL 1Y65A 1LYXA 5C0DA 2D9QB 2QR0A 1UUNA 3LXCA 4L9LA 1FV1B