3H54A

Crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 128
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h54A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h54A01
3VFLA 2JBMA 5K4XA 1JIBA 1UJPA 1WYIA 1OFEA 3RNDA 4LVBA 3Q2DA 3DDFA 5HJLA 2QDGA 4FX8A 3EWYA 4MJZA 3LOTA 1VLIA 4OWGA 3UQNA 2QCGA 1U5JA 3F1QA 4LV4A 3G8RA 3MYPA 1P0KA 4O4VA 3YPIA 2XIIA 1B0IA 4WJEA 2YXGA 1X1ZA 4QIUA 3NPVA 1QW8A 1R2RA 1OFQA 2BY1A 2EAWA 3IVUA 3A6OA 1S46A 2DORA 3UEQA 5EPDA 4JR5A 1MEIA 4ADUA 4PSPA 5K7JA 1MXSA 2FE0A 2PWGA 2DU2A 3PC0A 3RIKA 3BK0A 1A53A 5DCBA 4LS0A 4FNQA 1SW0A 1SZFA 1UH3A 1C9DA 1XDLA 3D52A 3STFA 3W7EA 1IZJA 4LU0A 1CXHA 4A2RA 5K9DA 2X1UA 2ZICA 1YTEA 3O6CA 3ZSTA 3L2MA 3LHYA 3TQVA 4XBSA 3QF0A 1TIMA 4B9ZA 1WZMA 2D0GA 2PRMA 2ZBTA 3D4YA 4GQQA 4O16A 4E38A 2PURA 2CXGA 3BVVA 5CZTA 5F1VA 3ZR5A 2PWDA 4J3UA 3DFSA 4MLRA 2ISWA 3RMJA 3KEHA 4FB7A 1QI5A 1F76A 1R2SA 4ML9A 1VQTA 2ZX7A 3GDRA 5AHNA 1VPXA 2E09A 2DZXA 3NXFA 1G69A 2TAAA 5I23A 3UXDA 1KXHA 3VNYA 1AL8A 1GVQA 3PAJA 3I65A 2EABA 3BARA 2TPSA 4B9YA 1JVNA 3VI2A 1RD5A 5KITA 2FHFA 3F4WA 4OKDA 1KTNA 2ZX9A 5H91A 2QCNA 2OT1A 1WPCA 3HBLA 1U33A 3EJQA 3WY4A 5DCDA 1TYGA 3DFTA 4BF9A 3UYCA 5TBOA 2YFNA 3PSVA 4UMBA 3R5EA 3MJYA 1NEYA 1VCFA 4HOXA 1O60A 2EQDA 3W3OA 3PUEA 3B03A 2F18A 4DPQA 2QCEA 5D2XA 3LI0A 2X2JA 4DBEA 1TPFA 1I45A 5F7UA 4A22A 1OFBA 5EA9A 1G7VA 4AYGA 1I8JA 1GT8A 4HSNA 3FKRA 3S5OA 4MZ1A 5L6UA 4QSHA 1G9HA 4MIMA 2CFFA 1Q6LA 3JS3A 4GKLA 1KXTA 2WV8A 5G1YA 3TXVA 2AAMA 1PHWA 4LVGA 5BOOA 4UTTC 5KTLA 4BK9A 4HOWA 4RR4A 4PSRA 1W56A 3FAWA 1SZGA 3STGA 3S0CA 1JRBA 4TU1A 3CTTA 2ZUVA 3ABOA 1GVRA 2GJRA 2P10A 1HWWA 2XN0A 4Q33A 1O95A 1JJKA 1G4PA 2DIJA 1SR9A 4UTLA 1XCWA 3LX9A 2VRKA 3WFAA 3GDKA 3CQ0A 1GVIA 4M6QA 2EAEA 2XFWA 1LZOA 3WK0A 2E8ZA 4XQ6A 3AXHA 3ZFHA 3GLCA 4H3DA 4DXVA 2IQTA 5J5RA 4JFSA 1TSIA 3BUBA 2E5BA 1D9EA 3WNPA 4CCDA 1TTIA 1CLVA 3NQGA 3NQDA 4Z1DA 3UY7A 1QX1A 4H6KA 1LWJA 1SO6A 3G1VA 3TNOA 3FJLA 5C2XA 1OGSA 1FUYA 1KA9F 1OK4A 2X16A 3GR8A 1GYNA 1QO2A 1E40A 2Y5EA 5FF3A 3QC3A 1F6KA 5I3FA 1KLZA 3W1MA 5K2ZA 3LRMA 1UD2A 3GXIA 1LRQA 3P84A 3CT7A 2A7NA 2QMKA 1O5XA 1VLWA 4H7VA 3PUDA 5F4SA 3GXFA 1JI2A 4UFLA 2XVGA 5E70A 1OFDA 5AC6A 3OIXA 2P1FA 1B2YA 1LOQA 1YADA 2J9XA 1MW3A 4UR7A 3KFTA 2ZX6A 4NQ1A 3UG3A 3GXNA 1N7KA 1SFJA 1CI1A 3ZOAA 4MUZA 3EJPA 3OA3A 2ZXDA 4PCTA 4WOZA 3VMOA 1OX5A 1ZFJA 4UNIA 5DBUA 2QCDA 1BKSA 2FJKA 2NSXA 4DEFA 2G97A 2WKLA 1GVSA 1UKTA 3PB2A 4FX7A 1H1ZA 3WFZA 3TQKA 3VCRA 1HTIA 2BXZA 4QQ3A 3JR2A 2QMJA 5E1QA 1TPWA 3A22A 4UTWA 4DQWA 1EP1A 1ZAJA 3MYOA 5TIMA 3W72A 4WSKA 2G95A 3BAYA 3GDMA 3CLMA 4UTWC 3CZKA 2QCCA 5E0KA 1FWWA 2R14A 2ZUWA 3L4UA 4U2ZA 3FOKA 5CZJA 1FY6A 2QUTA 3GR7A 2OYMA 2ZZ1A 1XSJA 3NQ7A 1MW0A 3LCIA 4LW7A 3GB6A 4UFMA 2YCEA 2C14A 1H5YA 3KL3A 3D0CA 2CLOA 2E8YA 1KM2A 3NL6A 2ZZ6A 4UR8A 3WJXA 3V1PA 3DX4A 1OX6A 3PUOA 1VYSX 1JG9A 2PRHA 5BW6A 3DHPA 4QNEA 3P60A 3KL0A 1AQMA 3S1VA 2J24A 4HPXA 3UG4A 4YCPA 1KWGA 5LKYA 5AYXA 3EWWA 2OZ0A 1XH2A 3LPPA 1IXPA 3BUDA 1PZ2A 3WY2A 1WDWA 2GJNA 2VOMA 3LI1A 1K8ZA 4AIEA 2ZZ5A 1T99A 2V30A 3W87A 1G94A 9CGTA 3ZO9A 2R94A 1QO5A 4JY9A 1JCXA 1TPDA 3C2VA 3CC1A 1SW3A 3LRLA 5AHMA 1VFUA 3Q58A 3IGXA 2EO7A 4MY1A 1G4SA 1JL8A 2BWGA 1QNVA 3EX6A 3K1DA 4OV9A 2DZWA 3VM7A 1GPWA 3IIPA 5SWUA 1FXQA 3ZT5A 2EKCA 3N34A 4GIAA 4AIOA 2B7QA 4HPJA 3W83A 4S2BA 3USBA 4XKYA 1XBYA 3SFKA 3EDDA 3W2MA 4K36A 1NFBA 1TPVA 3WN6A 1PIFA 4WUIA 4DO6A 3AJXA 2V5BA 3DHUA 4LV9A 1AQHA 3W7PA 2ZTJA 4QITA 3LBCA 3FW6A 2FLIA 1TJRA 1GG0A 4IMGA 4WZHA 1NSJA 1IGSA 2X2IA 2GQ8A 1I2QA 2NUYA 1THFD 5K9XA 1YTKA 1PAMA 3LCGA 4AH7A 2WNWA 3EXRA 4RV8A 1CXFA 3MBFA 1PE1A 1LOSA 1PCKA 4NT0A 3QJAA 4GNJA 4IMFA 4K8EA 4AHQA 2J9YA 4MJMA 4DF0A 1ZY9A 2WO5A 1QW9A 4BZYA 4IOTA 4BWLA 1CIUA 2GVYA 1RVGA 3FLUA 2B7PA 1J0IA 1K02A 2DZUA 3GNNA 2D2OA 5AHIA 2IGTA 2FYVA 4M5PA 2XN2A 3S1XA 3NM1A 4LS1A 1HVXA 2F61A 3WMSA 3VU2A 2FHBA 1HO1A 4JFWA 3MWAA 3K8LA 3P8JA 3P74A 1FCVA 3E49A 3OVRA 5LNWA 1OB0A 1VB9A 1TREA 1FDZA 3M7WA 4KMQA 2Z6JA 2A0NA 1MXDA 3RF9A 4FNTA 3BUPA 3VNDA 3K8MA 3TSDA 1O4UA 1VH7A 2V8ZA 1OJXA 1NOFA 5TD4A 3CWOX 6ALDA 1F05A 1XXXA 1HNYA 3NO5A 4LC6A 1NAL1 2FHCA 5AYZA 2ZA1A 4ORMA 2ALWA 3IJ9A 1NF0A 1OYAA 1SSDA 3W2LA 4LY8A 2NWRA 4R53A 1CPUA 3VGGA 3B0VC 1QAPA 1TB3A 3E02A 1LROA 5HNRA 2B4GA 5F1UA 1MW1A 4X22A 2ZXAA 5AOUA 1D3CA 1SO5A 1DTUA 3LRKA 3CIXA 3ZWSA 3L0GA 2Y89A 4OU1A 1A50A 1AL7A 3QQ0A 4Q32A 4CLMA 4NI3A 1KM3A 4Y8FA 4EWND 3NQAA 3S5NA 7CGTA 6TAAA 1MFVA 1WOAA 4LNYA 2Y88A 4AB4A 2WSPA 3U2OA 4IWWA 4JY8A 3S9YA 1H7OA 2ABAA 4JYFA 2TYSA 3H53A 2E0PA 2E77A 2CLKA 1P1XA 3ELFA 2C6QA 2H3BA 5MHBA 3BAIA 1KFLA 3CB8A 5D33A 4JTJA 1GWJA 3DX0A 1Z32X 4M7TA 1U2YA 1RV8A 5HUOA 1BLIA 2ZUTA 1S5TA 2VXNA 3L67A 3W7RA 4KFNA 1GOXA 1NF7A 1G4EA 2FFCA 1J0HA 5IBXC 3LTPA 4RK8A 4CNNA 1KBBA 3EDFA 4UOZA 4HPHA 4HNNA 4QJ1A 5IBXA 3WDHA 3FS2A 2NUXA 1TCMA 3VSUA 2Z6IA 3WK1A 4HA1A 3NOEA 1W5QA 2ZRZA 2ATSA 1B57A 4UC5A 1ZALA 3BLPX 3Q37A 1ML1A 4G1KA 4RXFA 1M7XA 3DKLA 4AEEA 3DI1A 4MLJA 3BMVA 4GXMA 1HX0A 4BI5A 2C18A 4YCOA 1ZCOA 1SO3A 3LBMA 3EXSA 1Q45A 4DELA 5LNSA 3BSHA 5FF0A 1MZHA 1PS9A 2CU0A 4UQCA 2HMCA 4UTMA 4Y9AA 2H3DA 3HO8A 3W7HA 1QHOA 1A5BA 5I3GA 4NJGA 3VKJA 5AC8A 5E6ZA 2FPTA 1LDCA 4ZVJA 3B06A 3W7OA 1CXIA 2VNCA 4M56A 3LHZA 4U31A 1HFBA 3S5ZA 4JIPA 1AMYA 3KE0A 2CZDA 3PBUA 5CGQA 4H8VA 4AEFA 2YA0A 1QPQA 4K7YA 3A5FA 3GK0A 3KWXA 3NR0A 3W7JA 3NQ2A 2GOUA 2HS8A 3EWBX 3O1NA 1WXJA 2WJZA 4UTIA 4TO8A 3W70A 2WC7A 3OLIA 5I0DA 4H4IA 5DLCA 1R2TA 3N73A 5A8GA 1LLZA 4AW7A 3IV3A 4AF0A 3NPXA 2E4TA 4GUJA 1J0KA 2BLEA 4GBUA 4E0CA 2B7OA 3BG5A 2OYLA 2QCFA 3PF3A 3KL5A 3TQ0A 4Z1AA 3LHWA 2X30A 1H3GA 5AHFA 1SZEA 5DN1A 4MFEA 5BRPA 3R2GA 2OX1A 3DGRA 2FH6A 4O0KA 1H51A 1DHPA 4JDYA 5D04C 1SQ7A 3RLVA 3B4UA 4S1FA 3BVXA 4UZSA 1L9WA 1RPXA 3LERA 3LXBA 2A7RA 2QAPA 4O52A 4O12A 1FWRA 1ICQA 2Z1KA 1QHPA 1MEHA 5D2VA 3TK7A 3UPBA 1CYGA 1WZAA 3CTLA 3G1HA 1HUVA 3MHFA 3BH4A 2YPIA 3UWYA 2DZPA 1DQXA 1LYXA 2R91A 2ZX5A 1XBZA 1BPLB 5F4WA 4QM1A 4PA8A 3VM5A 3ANYA 4Y90A 2V82A 1DJQA 1W37A 4N2YA 8TIMA 4A21A 3I7RA 3NZRA 3WY1A 1UKQA 3C6CA 5LZLA 5I3HA 2CZFA 4OE7A 3HPSA 4UCGA 4FIRA 4MYAA 2PE4A 1F7BA 1GJUA 1XI3A 4XUGA 1SZNA 3CU2A 3TW6A 5KINA 3TAKA 1UUMA 2CLEA 3DBPA 3KVLA 2A4AA 1W54A 5DO8A 3QM3A 3QSTA 3MHGA 3SECA 3PG8A 2B0MA 3MI2A 5AHLA 4JTLA 1K7EA 2WCGA 1LWHA 2DJLA 3DC0A 5A2CA 2NV1A 3DFNA 4I7UA 5KZMA 1S3HA 3GDLA 3KVMA 3GBEA 3QSRA 3UXAA 3UG5A 2WSRA 1TPB1 5FI8A 3DU0A 5AC7A 1OFPA 4FLQA 4M7SA 5H2ZA 2Y7GA 4JX6A 4CVWA 1IIGA 4AVFA 1W1ZA 5HPOA 3GXTA 3ABSA 1ME8A 2E68A 1UD6A 1RQBA 3STCA 3WNKA 1XCFA 4JTSA 4UFHA 3LXCA 3HB9A 2C13A 2C0AA 4JFUA 2OMAA 4K39A 1IIHA 1LLWA 1WZLA 4NXKA 5E0FA 1D3GA 2DZVA 1TTQA 4MVAA 1PJ9A 3OVQA 5DFAA 3GXPA 2FPVA 1JQVA 4W9TA 2PCQA 3DHFA 1R46A 3C0JA 5L9FA 1XD1A 3NQVA 1R33A 1J4EA 3W7LA 4K38A 3CIWA 3NG3A 2XWEA 4UCFA 4EOUA 1E51A 5FEPA 3VE7A 3EKZA 1ALDA 1S5WA 3UERA 4JTUA 2PWEA 4J7RA 3EB2A 3TJLA 2Y7FA 2YGYA 3W86A 1JCNA 1DEDA 1UH2A 4GQRA 1L6SA 1VAHA 5F2GA 2QF7A 1TTPA 4IMDA 4GO8A 4IX2A 1SMDA 3KRUA 4WF7A 1MEWA 5D2TA 2NXHA 3VGBA 5D09A 4JTGA 4MZ8A 1QPNA 5U4NA 1WP6A 4HOZA 2OSYA 3NDOA 2Q8LA 3THAA 3NYZA 2WKGA 2BX7A 1KGUA 3OBKA 2XN1A 1QOQA 3Q94A 1QOPA 4POCA 4CN1A 2Y63A 3EEGA 5IM51 3N9RA 1WE5A 3P8IA 2Y7EA 3W7CA 3VO0A 3FFSA 3WJYA 3P7YA 5D02A 3FJ6A 4WY0F 4XWUA 4Z0JA 1ICPA 2CW6A 2YSWA 3TA6A 1YYAA 3N19B 1TPC1 5C6MA 3II1A 3DXIA 3W7DA 3G1AA 1HL9A 4FLOA 2Y4SA 1L0PA 1YDVA 1K8YA 1TJPA 1Z42A 4AWTA 3DI0A 3SW6A 2ZIDA 3BW4A 3FA5A 3TFXA 1N55A 2J9ZA 4YMZA 1LBMA 3NNTA 4DO4A 5F2MA 2GVGA 5A5WA 1O94A 4IMCA 4BWLC 2D0FA 5FF4A 2JK2A 3G1XA 4R7JA 1SPQA 2VFHA 4NVTA 4FNUA 1YDOA 1GQNA 2GUYA 4ORIA 7TAAA 3RFAA 1I2NA 4WY0B 4N6EA 4FLSA 3PSWA 3FEMA 3TONA 3BUQA 2QPUA 2EACA 4KWUA 3HF3A 1UH4A 2OW6A 1FCUA 3K30A 4NNBA 3EWUA 4HNVA 4GFSA 2Y61A 3IK2A 3HGRA 3HGSA 4Y6GA 4K8HA 4MY9A 1G7UA 2ZZ7A 3BGGA 4Q4KA 5G4EA 2NUWA 1IZKA 2EPHA 3BVUA 4HT3A 1CX9A 1BF2A 3DDGA 4LRSA 5G2HA 2H8XA 1KFEA 1KTBA 1DL3A 2FPYA 1JI1A 2OW7A 1OF6A 5G4WA 1TQXA 4PL2A 3E9AA 3UY8A 3BGJA 4J3VA 1DORA 3G1SA 3TOPA 4HP5A 2ATMA 2CWNA 4BI7A 4JCMA 3W7IA 2OYKA 3BV4A 1T8XA 1EWEA 1JF6A 3O06A 3PR2A 3B0PA 1N8FA 3TKFA 1IV8A 1A5CA 2GQAA 1B9BA 2ZQ0A 3UNDA 1BWKA 1QWNA 1XH1A 1JFHA 1Y0EA 4UFIA 1FCQA 3L5LA 4X9SA 3KHJA 1DJNA 5T26A 3W22A 2B7NA 4TMBA 2V3EA 1W9XA 1E3XA 1BSIA 5HXMA 4EIVA 3NPUA 3QFEA 4WX2A 3ATYA 1B3OA 1JDAA 1M7OA 2YR1A 3AMKA 3DHDA 1VYPX 1ZHAA 4E2OA 4RZ4A 4U28A 4PL1A 3NL5A 4GINA 1EA9C 2OSWA 1TTJA 5FEWA 2VUYA 3TC7A 5ABTA 4JFTA 2V2DA 3MHUA 3FAXA 3ZR4A 3N3MA 1DKWA 1VGAA 4PC8A 2YZRA 3W2UA 3GIYA 3TJXA 1FCBA 4NX5A 3GAKA 3T4CA 2XVLA 1MW2A 1OX4B 2FB2A 1EEPA 5AB3A 3KXQA 3C2EA 1CGUA 1XL9A 5HINA 4CQ8A 2EHHA 3L2LA 3PB0A 3W73A 3BCDA 3P82A 1XSIA 2WVTA 2XIBA 3HG4A 3G8EA 3GYEA 4CNPA 1AW5A 1GG1A 4OHQA 5FF2A 4CGTA 4P2VA 3ZWTA 2CLMA 1TQWA 4O50A 2J27A 3K8KA 3W1LA 3UWQA 2A21A 3NQFA 3BAJA 2E1DA 2AGKA 1SMAA 4O53A 2OJPA 2X1TA 1CDGA 3OVPA 4JIQA 1EUAA 5BMWA 4WSJA 5A2BA 1DVJA 2GVLA 4L4MA 4B5NA 4MPQA 5EYWA 5BNKA 4JXCA 1HXKA 4FLRA 2ZUSA 4TVUA 2RKXA 1R75A 2WPGA 1YPIA 3D50A 2E6DA 2F2HA 3KRSA 3L5AA 4ALDA 3BVJA 3W38A 2J88A 1LTDA 4HHPA 4MB1A 3O63A 4MOZA 1MSSA 2QEZA 3MP4A 2WKJA 3L4ZA 3PVFA 4RZ5A 3GX9A 2ZDRA 3W7KA 3EDEA 3L68A 3LLDA 3P61A 2ZRXA 3MI6A 3G0XA 2PC4A 1HL2A 3H55A 4PCFA 2CZEA 5I24A 1V3MA 3MW7A 2BXYA 1W5NA 5D2YA 1R47A 3BLBA 3DX3A 1QPOA 3L4XA 3VSVA 3BO9A 3M9YA 2BHZA 1GJWA 3DFQA 4OGZA 3VMPA 4DPPA 3O6YX 3T40A 1AVAA 1TQVA 1S5VA 5D37A 4CQAA 1MXGA 1DOSA 3OHIA 1GJPA 5LNRA 3LCHA 3TU9A 4UIOA 2A7PA 2C8NA 4QNWA 4FNPA 1C8QA 2WANA 1BWLA 3L9CA 1KXQA 3G3MA 1U83A 4LWWA 1CXEA 1MFUA 1FDYA 1WX0A 5I3JA 4NU7A 1KCLA 5CZSA 5D03A 4JTEA 3SZ8A 3UZ5A 3GNDA 4EF9A 3M07A 1OT2A 4O54A 2CLLA 2WVSA 1HL8A 3SR7A 3DX1A 1XBXA 4ZQCA 1JXKA 4BA0A 1EWDA 4NZFA 1OFAA 5K4ZA 4IJBA 5AYYA 1YXDA 3LCFA 1UB3A 4I7VA 5LNUA 3EJUA 2DZSA 1RQEA 4OT7A 3DZ1A 1VFOA 1D7FA 1PS3A 1IXQA 1VJSA 3C52A 3WY3A 3NEVA 4U33A 3C61A 3EWXA 4R33A 3W76A 4JTKA 1MO0A 3THQA 1WO2A 3QZEA 2NV2A 4XZ9A 1M6JA 5LNVA 3I68A 4RJEA 3UWVA 4EVZA 4H2CA 1BVZA 3W23A 2PWFA 3FIGA 1DHKA 4GJ1A 5DY3A 2Y24A 2FGZA 2KZHA 4LVAA 1Z41A 4Z1CA 3BW3A 4O10A 3I7SA 4ATWA 2XWDA 2A6LA 5DBTA 2A85A 1KTCA 2Y6ZA 2JGYA 3ECQA 1JCJA 5EY5A 3HZ3A 1J2WA 3TROA 3UZJA 3LV6A 1JD9A 4UQ9A 1VJIA 4XTIA 2G3MA 1EX5A 3LHVA 7TIMA 4NX0A 3L5MA 1KV5A 4O57A 5CPOA 3N9SA 1VYRA 5LHEA 2NX3A 3IJ8A 1DV7A 1E3ZA 2V2HA 3TCEA 1GVFA 1FX6A 2G3NA 1WA3A 3SY5A 1LOLA 1LRTA 3NL2A 1U30A 4DF2A 3VGHA 2FIQA 3W74A 3HIJA 4NJIA 1XM3A 3NQCA 4N9BA 4PEKA 3W2KA 4PCSA 2HTMA 4O28A 4GUFA 3PY2A 2P0OA 5EBUA 4JTHA 1OFRA 1EHAA 1M53A 2YOCA 5HDRA 3W37A 1B4EA 1H62A 2GUUA 4JTIA 1W3NA 4UTUA 1TV7A 2YA2A 1TRIA 5FF7A 2BSLA 4U2YA 1QMLA 1I2RA 5A6LA 3RILA 3WJWA 4CCEA 1CXKA 3TIMA 4WD0A 1TPEA 2Y7DA 5D38A 3OLGA 4J27A 1BVNP 5G2IA 3GKAA 4MKNA 2WVUA 3M16A 4HNUA 2EF9A 5BRBA 1V7YA 3HG5A 3P67A 4YXGA 1L2UA 3BPWA 2D73A 1R30A 1UKSA 3RU6A 1P6WA 3BUIA 3D51A 4PODA 5KZDA 3W1RA 1KV8A 1KFKA 3O15A 1UD8A 4IGHA 1JULA 1RPKA 3BAKA 3L0NA 3TV8A 1Z48A 4I7WA 3AMLA 2J25A 2NX1A 2NZLA 1VHNA 5CPLA 2A2IA 5K3VA 4J9JA 4ZQRA 2WSQA 3CPRA 3W7GA 3QMRA 1P0NA 1JAEA 2V81A 2TMDA 4NJJA 1TMHA 1CGVA 1ME7A 3WK3A 4TX9A 1BEUA 4AAJA 4JD4A 4GE8A 2Z1BA 3EDKA 3LCWA 4JN6A 3W84A 5E6YA 1VHCA 3LLFA 2VT0A 1EB3A 3C4UA 3LHUA 1QI4A 3S1UA 1VCVA 1H61A 1YDNA 4ZQOA 4TR9A 1TCDA 4H8HA 3M5VA 3OLEA 2VEKA 1X7FA 4CQ9A 3KRZA 1T0OA 5DXXA 2VC6A 3TDFA 1TPH1 4IX0A 3CM4A 2E6YA 2EJ1A 3QQ1A 4DO5A 5HWJA 2FTPA 3TX9A 3AJ7A 1W0MA 1JDCA 1H7PA 3WNNA 1H7RA 2JKEA 3TC6A 4KFOA 3KAOA 1EPXA 3F4NA 1KB3A 3R12A 4GC4A 4X2RA 3C2OA 4Y96A 3HMJG 1FQ0A 5I3KA 5D30A 3MMTA 3VGDA 2GPTA 4UTJA 3S42A 1YXYA 4AF0B 3G0UA 3G24A 1A5SA 3M6YA 1KM5A 2F1BA 4KFPA 2C7FA 4NJKA 1VS1A 3SSJA 2V0TA 3IIZA 3CEPA 4U3CA 2OSXA 2E5CA 1ZNNA 2VR5A 1G5AA 4JGDA 1ZENA 5BRQA 4GI8A 3DKJA 3LDVA 3WENA 3I6RA 3W1XA 1X6UA 3W71A 1CGWA 2CZ5A 1CGTA 3INPA 3SGUA 4IQLA 1OK6A 3ZS4A 4JTFA 3WEMA 5G1TA 3IJ7A 3IEBA 2Q8ZA 2YDAA 4JNMA 3TSMA 1LRNA 2BXVA 4E2DA 1I2OA 3KLKA 4AMAA 1KBKA 3O8AA 3A23A 5GVJA 5HR7A 3MO7A 4RLIA 3M43A 2C1HA 3T78A 3WNOA 2F7RA 1A47A 1L6WA 1V3LA 3QMSA 5HMSA 5HUPA 2QCLA 1WBJA 4ZQPA 2E9BA 5FESA 1UD3A 1PZ3A 3W1NA 2ZRWA 5TQLA 1M5WA 3UD6A 4Z08A 1OHLA 3GXMA 4DBDA 2Y2WA 1HO4A 1EO5A 1TRDA 1UBSA 3ABQA 3BG9A 4FNSA 4AMXA 3IGUA 2ZX8A 3S1WA 2VEIA 5AN7A 1XD0A 1PIIA 5A6MA 3QPYA 4OQVA 4I9AA 1QCWA 4W93A 4FHAA 4DF1A 3LCLA 3P80A 2C15A 1LM1A 4NXSA 3HQ1A 3MP5A 5C55A 2QDHA 4PEEA 1KM4A 2GJLA 1WZKA 2X1SA 3U6WA 4JL2A 5EMYA 4CKQA 2NX9A 2AAAA 3HGJA 5I3IA 2ZUUA 1PHQA 3CHVA 1RZMA 3CLWA 1C29A 2Y85A 1T96A 3EJRA 3SIZA 1KM6A 3LM7A 5HWMA 3ZSSA 1ZJIA 2G5WA 2WOQA 3UCQA 3P62A 3PM6A 4HN4A 4EF8A 4J3XA 5HR6A 4UMCA 1VFMA 2EADA 1K7XA 1O7DC 3HG2A 4NZJA 4AYSA 1O5KA 3HJZA 4FXSA 3L4YA 1XSKA 5F2IA 5AHEA 2QCHA 5CSRA 4UTHA 5E93A 5FEZA 5LGZA 3HOJA 5F4XA 1PVNA 1PCWA 1KGWA 2C3ZA 3LTSA 3SJ3A 3C2FA 4D2JA 2W0UA 1TV8A 2I14A 3A4AA 1HT6A 1XV8A 1VCGA 3AXIA 1ADOA 1OYBA 3DFPA 3NGJA 5BMXA 3GAYA 3CV5A 4AEOA 3TUUA 4J28A 5CGMA 3EX1A 4LUJA 1SO4A 1LORA 4JS3A 5EKYA 1XUUA 5CLTA 4S2CA 1D3HA 1BAGA 2A5HA 2YW4A 2GQ9A 3W1UA 3DAQA 3L21A 2I9EA 1KW1A 2BHYA 3BAXA 5HWNA 1RP9A 4X3ZA 3G1FA 5KSWA 3EXTA 3L0KA 1ODUA 3W1PA 2RHGA 3ZT7A 1Q6QA 3VGEA 3W7MA 1OX4A 4HNTA 3M41A 3NVTA 1XH0A 2EGZA 3EX4A 2VFDA 3KVJA 1TQUA 1OABA 2BY0A 3LPOA 4J3WA 1TPUA 6CGTA 1JRCA 2VFIA 4AWSA 3SGZA 1TV5A 3NQ8A 2ISVA 1Q4NX 2A1YA 4OV4A 1X1OA 1JUKA 3UPWA 3LTYA 3NQEA 2V2CA 2G96A 3O6DA 4KWWA 3A47A 2D3LA 4A29A 2E6FA 1Z44A 4WXZA 3ZR6A 1PIGA 1G67A 2JKPA 4O1AA 1W3IA 3QW4B 3C8FA 1J5TA 3EJSA 5U7SA 2YKKA 1HG3A 2ABBA 2YW3A 2CLFA 3M5ZA 2H90A 4AMWA 5C5YA 1M7PA 4ZZ9A 1F74A 3GXDA 2VFFA 2QKFA 3C2RA 4JEQA 1OYCA 3PULA 4UMAA 3LHTA 5CPMA 4O1DA 1UD5A 2FQIA 1JDDA 5DY2A 1YXCA 3NQ6A 4WQ6A 3QGVA 3W1QA 1BG9A 4UTTA 4FO4A 3M44A 4YLWA 1F6PA 1NM9A 1YPFA 2PRLA 3M5YA 4O18A 2QCMA 3H54A 4P61A 2OCZA 3W9ZA 4ZQNA 1PPIA 1JUEA 2NWSA 2ZRYA 2Y70A 1K03A 5HULA 2QR6A 3B04A 4LC8A 1PL9A 2AMGA 2V9DA 2RFGA 4O1BA 3TE9A 2TRSA 3IIOA 1KFBA 4O14A 5J5DA 1XKYA 2RDUA 2VELA 4JFVA 1DBTA 4UQDA 4IPIA 4M8UA 3G22A 2F1AA 5KEZA 2YX0A 1KFCA 3W1TA 2C19A 4JYEA 4N4PA 3L4WA 2QV4A 3CZEA 1GTHA 2YFOA 3G1YA 1FWNA 4E2BA 3N2MA 4UNKA 2HS6A 4GI9A 2DZTA 1OSEA 2YIHA 1ZJBA 3GTNA 3S5YA 4O13A 1GZGA 2DH3A 3CWNA 5CZ0A 3M1ZA 2VRQA 1TQJA 1GCYA 5KMYA 3DH7A 4UOQA 4ZQMA 4A2SA 1J0JA 3WEOA 3BLFA 2NT1A 3NM3A 4LS2A 2DIEA 1I2PA 4MFDA 4OBTA 3L2IA 4GUIA 1JF5A 3HG3A 3D4ZA 5E9AA 1V5XA 1IXOA 2WVVA 2ZXQA 4LRTA 1OF8A 3VGFA 2WCSA 1AG1O 4U4MA 3BW2A 3R8RA 1GTEA 4ICNA 1K8XA 3G1DA 2DJXA 4NNAA 8CGTA 3E96A 5KZEA 3NPWA 3W85A 3M47A 4JTTA 5CG7A 3B0UX 3TTSA 1TMQA 1FDJA 1ZAIA 4UXDA 2WSKA 2V5LA 4ONVA 2D3NA 4UTKA 1B4KA 4UZUA 3EX2A 1Q6RA 3P5ZA 3L4VA 4O17A 4NNCA 3RK8A 1EP3A 3GBDA 1XUZA 1JQXA 4FIQA 4ZMGA 4MY8A 1W5MA 1UA3A 2R8WA 3PG9A 4MYXA 2ZTKA 2QUUA 1UUOA 3VNZA 1H1YA 2VFEA 1FWTA 1WAUA 2Z2UA 3QRHA 1JXJA 1Y7VA 4AXKA 2V3DA 4KWVA 3T55A 4RX0A 5DELA 3WNLA 4FXRA 2RDWA 3U8GA 1W31A 4GO9A 2V3FA 1WV2A 2AQWA 3L65A 2QJHA 3E0IA 1KGXA 4LXFA 1FXPA 2C16A 3W1AA 3EJTA 2WSYA 3PWAA 3JRKA 3FYOA 1Q6OA 1ZAHA 2QJIA 4QISA 2CLIA 4FNRA 2X1RA 4OJYA 3MP3A 5A2AA 2F84A 2BY3A 1C8VA 1WOBA 2F7OA 3LV5A 3VX1A 3V75A 3TFCA 4O8RA 3DENA 2QLYA 1JCYA 4L4LA 2NLIA 2PWHA 2ZZ3A 1PV8A 2BY2A 4UFJA 5EL1A 1KLYA 3A9IA 2I1OA 2ZYFA 1OG0A 2HSAA 2DH2A 1SUXA 2ZRVA 3R13A 5HQEA 3IVSA 2BTMA 3QPZA 3M0ZA 4ADSA 2VENA 1QPRA 4IUOA 1QFEA 2YJQA 4PFMA 1HTYA 1RQHA 2GVJA 1OT1A 3VX0A 2H6RA 4XTDA 3W75A 5LHFA 3OG3A 3CZNA 4LUIA 2EEXA 4ADTA 3GDTA 4AHPA 2VKZG 4KKXA 1JUBA 2J6XA 6TIMA 2JGQA 2ZZ2A 1P4CA 5LGXA 3TAOA 3E12A 3WNMA 1XCXA 3O05A 2E5DA 1CW2A 2TSYA 3NAVA 3BVWA 1UD4A 3TXZA 2XVKA 4IXXA 2GJPA 1F73A 1WBHA 2F7PA 4N9CA 4HKPA 3O16A 3IGSA 2QJGA 4YWIA 1OVDA 1ME9A 1KBJA 1H7XA 4JX4A 2ISSA 2Z0IA 3WELA 2ZWZA 3PBWA 4BI6A 3PBYA 1L6YA 3NA8A 1AW1A 2FDSA 3QEZA 4NJHA 4UNLA 3CPUA 3CZLA 4FEZA 1KM0A 3PBVA 4JX5A 1ZJAA 2WNNA 3OEXA 1XGZA 3MBDA 2E6AA 3QYQA 2ZXBA 4N4QA 1V3KA 4J3TA 4CN4A 4UQAA 3B05A 3QW3A 1ICSA 4C1KA 3IVTA 1IF2A 5DCEA 4RKAA 1A5AA 1UCWA 1GVOA 4M6PA 4GI6A 2W6RA 1H60A 1BTMA 4O1CA 3CEUA 3TH6A 2ZFAA 1GEQA 2FB3A 3WDJA 3OLDA 2ZRUA 3W7NA 1K3UA 2D0HA 4UQEA 1W5OA 3BG3A 3CGTA 1QDSA 4GWEA 3N2XA 2O7QA 1SU5A 2WVVB 3HGOA 1KM1A 1MWOA 2DP3A 3O07A 4GUHA 4RCXA 4CNOA 4N9EA 3W6YA 1JCMP 2WNQA 4RZ6A 3KOFA 2RDTA 2LLEA 2QCDB 4GRSA 4WXYA 1G4TA 1KXVA 2YYUA 5DXYA 2BZNA 1DQWA 4LPCA 3DX2A 3ZQ9A 2VEMA 3TMLA 2NXGA 4JDBA 1TQTA 4JCLA 3TTYA 1KBIA 2QAFA 5CSSA 3TSBA 2NXIA 1YTDA 2QUVA 5CXPA 1SSGA 3PS7A 3TW7A 3AO0A 4K6AA 3QH2A 4FX6M 4LVDA 1ONRA 4N6FA 4UQBA 4JICA 3WK2A 4K37A 1PEZA 2H8ZA 1LP6A 1QR7A 3WJSA 2F7FA 1WQ5A 3T44A 2ZZ4A 1CXLA 4JL1A 3GZ3A 1EO7A 3WDIA 1KWKA 1XBVA 1QWGA 1UA7A 1W8SA 1V3JA 3VSTA 1VR6A 5F2LA 4OIFA 1QPKA 2YYTA 1H7NA 5G5IA 3IRDA 1MVYA 3LB0A 1H63A 4BFAA 2CLHA 4JYDA 1RP8A 3P81A 3BVTA 4YL2A 5D2WA 3NZ1A 1UOKA 2ZE0A 4N9DA 1EP2A 5FEXA 2RH9A 4GUGA 3STEA 1VC4A 2QPSA 5I5RA 2OT0A 3BLKA 4IMEA 1YLVA 4MZYA 3BSGA 3NL3A 3C56A 4O19A 3W7QA 4A3UA 2WQPA 2Q3OA 1FWSA 2BHUA 2ZWYA 4H8UA 3VMNA 3BC9A 3HPXA 3S6DA 2UV8G 1JCLA 4LOCA 5D05A 3A24A 5K9CA 1QWUA 3G0SA 3LXAA 3A5VA 3KVKA 1ZS2A 1EUNA 4HSOA 3VE9A 3EDJA 3GKFA 1FBAA 3IIVA 1JGIA 3ATZA 3N14A 3W07A 3EX3A 4PTNA 4XKYB 3R89A 2X2HA 3FKKA 4QAWA 1JD7A 3KLLA 1VRDA 1EA0A 3IIXA 3BLEA 2O7SA 3SI9A 1QI3A 3UWUA 3S2CA 3G18A 1SW7A 4PH6A 4J3SA 4K7VA 3TR2A 4O15A 3LGEA 3I7QA 2W79A 5CLWA 4N02A 3BMWA 3MI3A 3RLUA 5D32A 1SFLA 1KCKA 4IPJA 1R34A 4X0NA 2VEPA 4UFKA 4X9YA 4WLCA 1F2JA 5CPNA 4Z0SA 3ABRA 1XDMA 2FH8A 1CGXA 1AK5A 3A21A 3P5YA 3QMTA 3S8HA 4FF7A 2Q3RA 2CHNA 2CPUA 1LCOA 4TMCA 4LQ1A 1G6CA 1P5BA 3L4TA 1F5ZA 4WY0A 3ZT6A 4LVFA 3B8DA 4WOQA 3M5XA 3BAWA 4C1LA 1XFBA 4MAZA 3KX6A 3BCFA 5CGTA 2JKAA 1H50A 1K7FA 3HJEA 4O11A 1LBLA 2ALDA 3HPZA 1CGYA 4XB3A 3L66A 4Z1BA 1GYLA 1AMKA 3TMQA 4XBKA 4CN6A 3DFOA 2YA1A 5C54A 3CZGA 3F03K 1E43A 4NUWA 2A6NA 1W5PA 1X8FA 3EWZA 3NQMA 4M6VA 5G2WA 3BLIA 4O0ZA 1VIWA 1TO3A 5EMUA 1IXNA 2WNZA 3EKLA 4M19A 5AFDA 3G3DA 1EH9A 3LCXA 4AHOA 1LBFA 1NVMA 1JR1A 2X2GA 4LTSA 3W2NA 1TQSA 2VFGA 4TIMA 4FMVA 4QAIA 3FYPA 5CKSA 2NT0A 4O4WA 4R34A 4BR1A 2Y62A 1KFJA 1H7WA 3CZSA 3GVGA 1G1YA 1W3TA 1RR2A 4AWUA 1OFOA 1Q3NA 2F7QA 4HIBA 2ZA3A 4ZL1A 3UWZA 2ZCGA 1EIXA 3W2JA 2ZA2A 3WJZA 1AW2A 1UASA 3W88A 4LT9A 4CCCA 1XC4A 1I75A 2WPBA 1VZWA 3C3NA 4RXGA 3UWWA 4IXHA 3T7VA 5LSMA 4UUIA 1I4NA 3MUXA
chains in the Genus database with same CATH superfamily
3VFLA 4OCWL 4ZB0A 4JGJA 2Y5TA 5HD8D 1EEZA 1JIBA 4BFOA 5H35B 1IQDA 1WYIA 4MJIE 4L9XA 2VLRE 2XFRA 2V33A 5DJYA 5F7DA 3KNBA 3VU1A 5K9JH 5GRWA 1IWPA 3FJ4A 3DDFA 3GSRB 5HNTA 4Q8VA 2W5FA 2QUMA 4NO2A 3B9AA 4G8GD 4YBLC 3T2OA 1N4XH 1JFXA 3S4TA 1RIUH 2FYYA 5T9BG 3PGDA 4KQ4H 4P05A 2QCGA 4Y7EA 4AD4A 3QCUH 3JWDH 5D5ME 5A8QA 3WO4B 4NLHA 3UEZA 3WJLC 5D4QA 3MNVB 4HGKC 4LV4A 4RX4A 3EOBA 3QEQB 4ODWA 4XNYL 4RGNE 3AMCA 2ADGA 4GAJH 1BXUA 2HLEB 2YXGA 5BMFH 4YIQB 1RHCA 2VDNB 4KNTA 4M80A 3TNMA 5HHME 4PUMA 3HBZA 4C7GA 1I1AB 2R0KL 1K8CA 3ARGC 1R1CA 2UZPA 3MFFA 3VYNA 4G6AC 1XR8A 4DGVH 1TTUA 4HCLA 4L1WA 4C6DA 4YWGH 1NARA 5BROA 2ACUA 3IJHB 4YVXA 4RH4A 1CBVH 1E1CA 4HQVA 5K7JA 4LDCA 2PWGA 4TUOA 5KYUB 1MXSA 2IV8A 5CPQA 1XIWD 4ES9A 2E7MA 4IL2A 5DCBA 2DLIA 5AKTA 1XS2A 5DDHA 1SZFA 4N6QA 3TNNA 5LXEA 4HIQA 3TYAA 2OK0H 4AGLA 1BFOB 2Q6WA 3HZMB 5EU6B 3RAOA 4A2RA 5C2BL 5CCZA 3K4DA 4JFYA 4TOQA 3IS0X 1P7KB 3ARXA 3TQVA 1MNZA 1RK7A 1RUKH 1SEBA 4DK5A 5IBUG 1FAIL 2POZA 3T6QC 2AJYL 1P43A 1TVBB 4Y8AA 2C3HA 2ZSVB 5DU7A 4E38A 2CXGA 4PJCE 1ZWIB 2WINA 4BELD 2IAND 3MBXL 2PWDA 3VFUB 5FYKE 2NY6D 4BFFA 2E7HA 3VXUA 3KEHA 2ISWA 1K77A 4YXKH 1DBJH 2IFGA 3PQYB 2ZX7A 5ESAB 4PLKC 3F7PC 2ZXWB 1E9IA 3GDRA 4LSBA 1N4XL 5AHNA 3CC5B 3GSUB 3RVVD 2DZXA 3NXFA 5D4HA 3PZMA 3QZAA 4R9OA 5DMLA 1OW0A 3WS6C 1Z89A 3EFDH 3MRRB 2TAAA 1XBRA 4ZR8A 1AHWA 1E4WL 4WUUA 1MFEH 2P48B 3GRWL 3MLWH 1GVQA 1FZOA 3K71A 5EF1A 3BARA 3NZQA 4J4KA 4W70A 5D4YA 3D06A 1M6UA 2TPSA 4JRYB 1ZAGA 3O2WH 1NANH 3PAYA 5IBTL 5KITA 3MA9L 2L3BA 4PLJC 2P43B 3O9WA 2ZX9A 5JO5B 2CO2A 4AQZA 2QCNA 2XETA 5H91A 4IJ3B 1LT7A 4WEBH 5HANA 1N9PA 3VFMB 3QAZB 2PMZA 4A7UA 1U33A 4HFWA 4XVTL 3QXTA 3HBLA 1TYGA 1VFAB 3KCPB 1EAQA 4Z0BL 2PUQT 5K5YA 4DCQB 4LRIA 5TBOA 4C6LA 1RA5A 3IJHA 4KQ3H 3DXAB 4UMBA 3R5EA 3MJYA 4PGDB 4UIKL 4HOXA 3ZUCA 3DLQR 1VCFA 3QR3A 2HFFB 2ROXA 3NVQA 4E9TA 4POZD 2DQXA 3DYMA 3L08A 4WTQA 3QJFB 2JEQA 1KGYE 3C09C 2QCEA 2B0SH 4M43L 1Z6KA 1BF8A 4UV4H 4L7ZA 2X2JA 1TPFA 3PTMA 2YPLD 1GIGH 5EA9A 3NZPA 4NM4L 3UAJD 3S5OA 5JXQA 1XGUA 3OR6B 4ZYKA 2K7QA 2BIOA 4QSHA 3WI9A 1AG0A 1G9HA 4WTZG 1EFXD 5F7YC 3WUWA 5AUMB 3L3HB 4MXVF 5C71A 3QDAA 1HKLL 2EDDA 5A6BA 1TETL 2AAMA 4LLWA 1UGKA 4DYEA 4RV3A 5BOOA 4QTIL 3BOLA 4M4RA 4UTTC 1T4WA 1XYLA 2J6EA 4MQXC 3GMNB 4RSYA 4LHJB 3GSUA 4BK9A 1WCBB 2V4LA 1A9EB 4HOWA 3KBEA 2APXA 3WEXB 4RR4A 1DVZA 1W56A 1SZGA 4NG3A 5JQ6H 1XWYA 5EC2A 1II4E 2ZUVA 4BKTC 3DGBA 3QMRA 3IACA 4GC3A 2ZUYA 1WFJA 2EYTB 1F1DA 3PWJA 3CFBA 3NJGA 4NPYB 4L4PA 1U58A 3D85D 3UJSA 5FOOA 1HQRA 1B0RB 5E7FA 1KB5H 1XCWA 3CVHA 3LX9A 3ELQA 4XWGH 3TA4D 2YPLE 1ZLVH 3CQ0A 3GDKA 3QV8A 1TG8A 3N55A 4AYEC 5I1IL 4DJEC 4KNQA 2YC1B 5H37A 4DIXA 3JT2A 3QT2A 4L4JA 5F8RC 1FHVA 4XMKL 3GLCA 4JEJA 4DXVA 1A1OA 4BSWB 5CZVL 4FFYL 5BRZB 3BUBA 1EANA 2R69H 1P5UA 3WNPA 1GZPA 3CXFA 3L5WB 4WUKH 5IV2B 2ZZUT 2AJSL 4GSRA 4GS7C 1K4CB 4FQHA 1Z7JA 3NQGA 1O9ZA 4QJ3B 2DF3A 1LWJA 1SO6A 4HC1H 4JTRA 3WN5B 2DKMA 1P0EA 2V37A 3PTKA 2BVOB 4XVDA 5BWFA 1OGSA 3LNGA 1FUYA 1OK4A 3WF4A 3H2AA 4LALA 2YO3A 2DQIL 3VTTA 5KYWA 3SCTA 1E40A 1I1AA 3CLFL 3SCVA 1X9QA 1Y07A 1F6KA 2JKNA 5I3FA 4IOFD 1KLZA 3D12B 4XO9A 4CGUB 1T5WB 3LRMA 2CMRL 3P84A 1LRQA 3NFPB 3GMQA 4BH7B 2ZKYA 3U1SL 5DHYA 1DJGA 2PODA 1A7RH 4H7VA 3QIWB 4OBRA 3RTQB 2IXVA 3LEYH 4LHUD 3LN3A 4P2YA 4GG6A 1W1B1 1CFQA 2FL5B 5FXCH 4UFLA 3ZIYA 3KPSA 3RP1A 1QNRA 1OFDA 5AC6A 3OIXA 5C0EA 3QPEA 3ARFA 4L3AA 2OM5A 2V9TA 4BEQA 3CXDL 4PTMA 1H2JA 2ACRA 2J56A 2ZX6A 4MD5B 3SE4A 2IBBA 5I6MA 2QXWA 3LKNA 4UTAL 3SE4C 2J5LC 4IGBA 1SFJA 1YECL 2OXGA 2WSDA 3MSPA 3TIDA 2VL5A 4ZA0A 4M1GH 5FHBH 1DFBH 1G7IB 3GMPA 5DZOA 3ZTJH 5DBUA 4JM2C 1BKSA 2FJKA 1SOQA 1MQQA 4PI2A 3WXWH 2A7BA 2JKIS 1BVLB 5AENA 4EI5C 3IN0A 4DEFA 3HTLX 4S3CA 1CIDA 1GVSA 1SJHB 1AZ1A 2ADYA 2EG8A 5DC2A 2E9GA 3RIFK 1PG7W 3PWUB 3BKYH 1FFPA 3JUZA 3ORJA 4H8WC 5C0BD 1S7XA 2IVFC 3WFZA 2WZHA 4US5D 4WR3A 3GSQA 1E9YB 3K46A 3LIZA 1V10A 1ES0A 4H00A 4DQWA 2WXOA 1I85A 3G08A 1EP1A 5A43C 2D03H 1ZAJA 3EKGA 3MYOA 3FK3A 3MRJA 2CCVA 2WQSA 1FO0A 1EAPA 2G95A 1JTOA 1NFIA 2F08A 2YD3A 3MRGB 3TF4A 2EECA 1J87A 5B4MD 4BBWA 3VA6A 2NQZA 2QCCA 1GGBH 1RZKC 4ZAKB 1G6RA 3U48A 1X3DA 3K0YA 1GGYA 4AGMA 1IGYA 4QRFA 3FT4A 4B53A 5IOPB 3FOKA 2C9PA 3FOMB 1FY6A 5FV2A 3WQOA 2OYMA 3IS1X 1FFOA 2FO4A 5IROA 7FABL 1YW1A 2Q86A 4WUKL 3KXFA 2HE8A 5F1SA 4AD2A 4WAFA 2C14A 2Y72A 1H5YA 1ZCRA 1O6SB 5FKPA 3D0CA 2WXIA 1F90H 2E8YA 2FKPA 4F7KA 3V1PA 3DJZA 4NRXB 4UQ3B 4RRPA 1DQDL 3P3UA 1V0LA 3KM2A 5BS0D 1OX6A 1JFQH 7XIMA 1JG9A 4JRLA 5BW6A 3DIFA 4Z7VB 1QQDA 3B34A 3VB9A 1JZ8A 2PDJA 3DESA 3VIIA 2YJLA 5CSZB 1WSST 2BSCA 1JHKH 2X4QA 2HXTA 2IW0A 4QCFA 3T1GA 4X98A 2UVEA 5LN4A 1ZGDA 2D7OA 3LA4A 5ETUA 5I15H 3K91A 3VXRA 5LKYA 3FF7A 3ULUF 2OZ0A 2EVFA 3MLYH 1OC6A 2W9DL 1PZ2A 5CN1A 3WY2A 3MTRA 2GJNA 5CC5A 5HDBE 3SHSA 2WUCL 2QQLH 2TODA 2H1XA 3ZXAC 1RIHH 4GUOA 4KWSA 4JPVH 2PPAA 3MUGA 4J12A 5AC4A 1F45A 1S2TA 5L2KE 1G94A 4H04A 1R3LA 3P6LA 1NCGA 1MHEA 1SYSB 1JCXA 3G9VA 2NY6B 5HHOA 4EIBA 3AT8A 3PJWA 1VFUA 3IWVA 5GGTH 5I8KH 4EPSA 2EO7A 2H41A 4Y4HD 5IW6B 3HV8A 3EX6A 3K1DA 4UU9A 4OV9A 1ULVA 4H9VA 2X41A 3QQ9D 4Y1AA 3IIPA 1XXDC 1XZWA 4R97C 3MMDA 2QULA 4GRWF 5ISZE 2C1OB 1MG2C 3ZT5A 2EKCA 1JVLA 4NJAL 2B7QA 3BT2L 4PWHA 3VWJB 3USBA 1TTAA 3BKCH 3SFKA 4N8CL 5KBMA 3W2MA 2F8XC 1IKFL 4K36A 4XZBA 4U6XB 4KT2A 3Q0HA 3BPNB 4Q7DA 3GUWA 4OD2A 3AJXA 3MV8E 1UFGA 3JWNC 3DHUA 1XGYL 2DI8A 3P73B 2XPGB 4FLHA 4MAYA 4RMTA 3VIKA 2Q6ZA 1TA3B 3LNFA 3M0YA 2ITDB 1BFOA 3K2GA 5TE6L 2ICES 3WKQA 1B4RA 1B4JH 2FVMA 1KC5L 4LH8A 3V0HA 4QITA 3FW6A 4NOBA 3GD6A 2FLIA 4FS9A 3QDGA 1U8KB 4YHPA 4OF8A 1SY6L 3GG0A 5MEPA 1GG0A 4IMGA 4MF4A 3C2AL 1NSJA 3GG8A 2A6DB 2DTMH 2W65B 1TSHA 3D3VB 1UIPA 4MKSA 4GG9A 4PJBE 5KVMC 2H2PD 1THFD 2ESVD 1AYOA 3QUYA 5K9XA 4AG0A 1YTKA 2DMKA 4M7LT 1PAMA 4PWIA 1E4WH 3GC2A 2NRDA 3SPVA 1EL3A 5A6JA 4RLDA 2CDFB 5GIRB 4S1DC 1BGAA 2AKZA 1RK1A 3QXDA 4QGTA 4QRNA 1E8WA 2KBGA 1LOSA 2FB4L 3QJAA 1WH0A 2V69A 1IFHH 3RY5A 4IQJA 3QPQD 4DF0A 2BO0A 2YB4A 1ZY9A 4GD0A 4WWKA 4AT6A 4HTYA 4OGAC 1IGTB 3T8MA 4XOEA 2PYED 4KH9A 3DI2B 4BWLA 1CIUA 2GVYA 3QDMD 4HWBA 1NCDH 3V0DA 3QJTB 1I9JH 3QDJA 5E6UB 4DGUA 4EXPX 5C7HA 3DMMD 2D2OA 1LO5B 2IGTA 2FYVA 3MV9E 5T1MB 3WHXB 1RJQA 3NM1A 5EBLA 2IWFA 2P5EB 4B97A 4NN6C 4M6OH 3M46A 1ZL1A 3HTWA 3FRUB 4O8AA 3FO9A 4RMSA 4FTVA 3MO1B 5D7JA 2DMHA 4E8DA 3ZL1A 5ILTL 2C91A 2VZ1A 3VI3A 4JFWA 3P0GB 4PD4K 1S7RA 3K8LA 1UWAA 5T5NG 3OVRA 4G8FB 4NO5B 4PJFF 2Z24A 4GBXC 5KANG 5BO1L 3DKHA 4R7NB 1EGJL 3QC0A 4PMQA 2EYRB 1S9VB 4N2DA 2ZWNA 4M1CC 1FP5A 1S7TA 5HVWA 4HCFA 1MXDA 4QOKE 1ITUA 4FNTA 1KV3A 1HE8A 1XF1A 3K8MA 3NRPA 4XH2A 3S6TA 2W0PA 3DJRA 4OVXA 3VXSD 4GAJL 4OCSH 1M3JA 3QDGB 4Y16C 4Y5XB 4GI4A 4TVCA 1REIA 4XPFL 5TF1L 2F53B 3I6KA 3DUSA 3L3IB 1IBDA 1HJCA 1FWBC 1XXXA 5BOFA 1OCNA 2BSRB 1NAL1 2FHCA 3TYBA 4X6FA 1DDHB 2VH5H 3OX8B 3ULVL 1RIUL 4L3ED 1M6OB 3ARYA 5AYZA 4WW1A 2P5WD 3KVQA 5FCUH 1G7IA 1NF0A 1WBXA 2A6JA 2BSED 4JG1L 2PDBA 4X80L 2UY5A 4LY8A 4BSJA 2VX5A 3QDGE 5KSAC 4ZCWA 1XRVA 4NZ5A 4PJIB 4LLWB 4EJ1C 5IUCA 1QAPA 1TB3A 4H0LC 3JVGC 4K7PX 4ODVH 2OULB 1H41A 2ZXAA 2PXYD 3BPCB 4NB7A 4NPJA 1MYRA 1SO5A 5INCA 4KMLB 1QMUA 3LRKA 3U36B 5AL8A 1S1PA 3GSQB 1A4CA 4BK5A 5JPNC 1E9PB 4MS6A 2NX5E 4Y19A 1Y8BA 1CLOH 1TPXC 4OU1A 3ZRCC 4EDXA 2C34A 3QQ0A 3MRLA 5F1OB 3TH2T 4LE8A 4Q32A 1OGAB 4C7FA 1KM3A 5A8NA 3S5NA 3HZVA 1QO3A 2R69A 5EDSA 1WZ1L 3DUGA 4F79A 4EIGB 5FF6B 2Y88A 2YAMA 1GKPA 4QOKA 2FZDA 3ARDA 2ONEA 3GSNB 3ITOA 3SY0B 1FSKB 2I7OA 2YPKA 5ACMA 2ZKXA 3VG9C 4XI5C 1P1XA 1FGNH 4L4VD 1URIA 1J10A 2C6QA 4MJ2A 1QU4A 3IIXA 1MFBL 1WFUA 3BAIA 3ZUNC 1KFLA 1F9CA 3V4UH 3QIWD 3DX0A 1Z32X 5D9SA 3RTQD 4FXLA 3T2PA 3G77A 1K4CA 1XRSA 1M7IA 5HUOA 3ERPA 1FRBA 4M61B 1H3WM 1KJMB 1I8AA 4P4RA 2IDFA 3LPGA 3OMZA 4K23L 3ESNA 4TQIA 3WKPA 4JBRA 2FGLA 4WJKB 1G4EA 3FT0A 3CDGB 1EC7A 2INFA 1B3YA 4LIQH 4XSMA 3QUGA 5I3DA 4B3ZA 5IBXC 4LOUD 1W1TA 5DT7A 4X9HA 4Y5XA 3EDFA 4QJ1A 5IBXA 2XNAA 4NNYA 1I8MA 1MHCB 4XISA 3FS2A 4LAJH 2DWYA 4QFUA 1TCMA 2HXAA 2P80D 1DQDH 4JZNA 2LAGB 3SBQA 2IKGA 4H19A 5BZAA 3DSFL 3FSUA 3WK1A 2WXJA 3NOEA 1G0CA 2ZRZA 1JUFB 1XH3A 1ZALA 1D9KB 1YN7B 3PGFL 4KK5C 2KLRA 4ZUVA 2ITDA 5IQ9A 3T09A 2FGBA 4RXFA 1NDMA 5FR3A 3EXLA 1W1A1 3FFDB 4TSBH 4AEEA 3H8NA 5EIVA 1HYSD 1D7KA 1DWHM 2IDUA 3W9EA 3EZ8A 3ARVA 1S78D 3OKEA 4MB3A 1HX0A 4A2GA 4A2FA 2BOGX 3S8FB 4YCOA 4CD8A 3VILA 3LBMA 4AXWA 3P2DA 2QGDA 5K9QI 3EXSA 2O1AA 3TN3A 3UF9A 4C54A 2G5BB 4XNBA 1MZHA 5IM7B 1XLIA 3QW9A 5ENWA 5F89B 3HQPA 2CBJA 4P3CL 1IGIL 2P24B 4UQCA 2CU0A 1AHKA 2OLHA 2V38A 3ECBB 4TQPA 3AICA 3O4OB 4I3SL 1OD7A 1ESOA 2VDKH 3OHXA 4L4TD 1N8ZA 2BGQA 1XMEB 5TE4L 4P9MH 1YEKH 4RZKA 3EH4B 1PTGA 3N13A 4WRHA 3MXWL 1W3JA 1MDAA 3V0FA 1U8OB 4MWAA 4AT6B 2BVUA 1PEWA 1SJHA 5AVUB 1AMYA 3ZTNL 3BGFB 1G7MB 3RO6A 3PBUA 4OLWH 3WSUA 2ED8A 3BKJL 3C60A 4AVJA 1XW8A 4LBEA 5CGQA 5DQPA 4H8VA 2PDCA 5FSEC 1OTSC 1EQPA 1E2WA 4O51A 1NFDE 3MXVH 5D9SB 1KJ2H 4CSTA 4V1XA 2WWMD 2F9BT 2OLSA 3NR0A 3LEPA 3AZUA 3SYQA 1E9QA 3V5KB 1YE4A 2WHMA 4LY4A 4BQ2A 5AZUA 1T8QA 3CS2A 2VCBA 1NAMB 4P8QA 5C9RA 5B7ZA 1BRLB 2FZ8A 3C5JB 3QEQA 5I0DA 1JYWA 4H4IA 1F5WA 3Q9QA 3FU3A 3P11H 2LABA 2PW2A 5FHAH 3N73A 8RUCA 1EUUA 1C12A 3Q8EA 3QJXA 3PWPA 4GY1A 4IT1A 3IV3A 4NKMB 2E4TA 5B7MA 4Y2DC 4PGEB 4GBUA 3RPMA 4E0CA 4Y88A 4FXFA 4K9JA 2PR4H 1BZ7A 4XAWH 2UXVA 3MV8D 1R24B 3KPPB 4NAMA 4HIHA 3RDTB 3PF3A 2E9WA 5HGAB 1E4HA 1U4FA 4W4OC 5BO0D 5I1DA 2X30A 1Q2SA 4H40A 1D5MB 2C26A 4MFEA 2OX1A 1H51A 3GLDA 4FG0A 3VFTB 3QZ6A 5G1MA 4JDYA 4GIRA 3WU1A 1ZVHA 4HWNA 4P23D 4U49A 4YXHL 1B3ZA 3B4UA 3NJHA 3HFFA 2AMUA 4LRIC 3V6FA 4QHKI 3XINA 2CLRB 2D31A 1KELL 2F58H 3EO9L 1NCTA 3H12A 4B92A 3I02B 1N8WA 1QHPA 3TK7A 1IR1A 4A2EA 3UPBA 2AQQA 3U30C 4JCWA 4KZ0A 3G1HA 1SJMA 4FMFA 3MHFA 3BH4A 4K94L 2YPIA 4WDUA 4XG1A 3UWYA 2HVBA 5DMGD 3HB3B 2OTPA 1XBZA 4S1RL 1A1NB 2CHZA 3DEQA 1HEHC 1OXYA 3ANYA 4H1LG 2V82A 1DJQA 4OZGE 1DBKL 1W37A 2Z28A 1BM7A 2QADD 3D4GA 2A3CA 4N2YA 1ONEA 4H88L 4FOKA 3CHOA 1AIZA 4A21A 2YHGA 1TZIA 3EG9A 2EICA 1ADQL 3RIAF 3WY1A 3VUSA 2FNBA 1ZK5A 2EPMX 4XX1G 1C9SA 1HJQA 2HT2D 5LZLA 2GJJA 3DTUB 2WLIB 4XN4A 5LGHL 4QHRA 3NCMA 4OD1L 2CPCA 2X9XA 1V3HA 4FC3E 3GFXA 4Q6IB 4NFDA 1GOHA 1N5YL 2AQOA 4GMSL 4OE7A 3HPSA 1UOLA 5AD0A 3BZGA 2XU2A 5HYJD 4UCGA 1OF2A 2EH7L 2PE4A 4MYAA 5EMLA 1LO4H 1DFXA 1GJUA 5I0ZA 1SZNA 1QBBA 4WWNA 1J11A 1MRQA 1AC0A 5KINA 5D8WA 2DI7A 3DVNA 5ACLA 4MSWB 4QROA 1DDHA 4AWJC 4MA7H 1XIBA 5DO8A 3MDJA 3ZO0A 3MHGA 1KQZA 3W0KA 3FCTA 3W3BA 5AHLA 1V6YA 3DX7B 3UYOD 5DJXB 1T0NB 4UAHA 4I3RH 1K7EA 1YEHH 5BWAA 2XG5B 1AZRA 5ID1B 1LWHA 3C08L 1MI5A 5A2CA 3EJYC 4FQXB 5ID0B 5EMMA 3CVBA 5KZMA 1P9MC 1JHTA 3SCQA 2DV6A 4KRPC 3GBEA 1KACB 1Z9LA 4KV5E 3S0PA 5L4JA 1M1XA 3QSRA 4LRNL 3PGFH 2BM3A 3PL6A 4ZNEA 3DU0A 1IGFL 4XXCA 1UM4L 3WS3B 1M2VB 3BDYL 4OGAD 4W81A 1OFPA 5H2ZA 5A2FA 1KCWA 4YE4L 2W9EL 3OZ9H 1UWGH 2J1XA 4BDVB 4F8QA 4RA3A 1JNEA 4HA3A 3ABSA 2VKWA 2PXYC 3SBWC 1UM6L 2DKUA 2NUTB 3D69A 4L3FA 3WNKA 1YJDH 1PFCA 3MCLL 1EHKB 3TN4A 4JFFE 3KW3A 5KZCB 1DIEA 4B41A 2VAAB 4GT7A 1LP9E 5FYLH 3FB5A 3LKSA 4N2IA 4OV5A 3MROA 4NWUL 3GZPA 3GW0A 1LO5A 3OHXB 2R4RH 1D3GA 2EDJA 1KB9J 1JWSA 2C1GA 1DQTA 4WWPA 4FYQA 4U6HA 4IU2A 4NO0D 4NQVA 5FD0A 3OQRA 3GSOA 2CUMA 1HOCA 4FF9A 1AJ2A 3WIHL 1AGCA 1DJIA 1E55A 1AHMA 5AVHA 5XIAA 4N2HA 1I8KB 1R46A 4KK9D 3OYXA 4TM9A 3B6SA 1R33A 1WKDA 3UAEA 1WQVT 3K7UA 4XVOA 2HAZA 4EOUA 5LGHH 1TZHA 3MQIA 3EFFA 2XG4B 5IJDC 5FEPA 4ODHH 1OSYA 2AK1L 2RR3A 4ZZFA 5HHXL 5C0CD 4TULH 3TJLA 3GSWB 2QFRA 4KX8A 2YGYA 3W86A 4PCYA 5AFAA 1DEDA 4N8VB 4FQQB 1S9KC 2Q8XA 4YNGA 4YVVA 1IQ8A 3ITXA 3GM8A 1VAHA 3PQYE 3WX7A 1TTPA 4D71A 4URIA 4BXVA 3E74A 4GO8A 3W00A 1P1VA 3HCVA 4JY4B 3DJTA 1SMDA 3L4CA 2OTDA 5D2TA 4UM8A 5D09A 3ILPA 4AYBA 2IPGA 1QPNA 3B8VA 2Y8KA 1OAQH 1U95A 5FCUL 5JW4N 3NP4A 4H6EA 3MKGA 2DIAA 4S39A 3O8XC 4Z18A 1XHHA 2Q8LA 4Q4PA 4WK4B 2J6WA 3D3VE 2BX7A 1YIXA 1KGUA 3OBKA 1A6AA 4WY7L 3U7VA 5D1QB 1QOQA 4NRZA 4F0LA 1W80A 2ENQA 2HJFB 4JFED 4RWYH 3LZ5A 1NC4B 2PTXA 3MV7E 3EEGA 1EHLL 3QEQD 3ZJAA 5EBWA 4YHNB 1QK0A 3OKLA 4MHHG 3P8IA 1H9VA 4UTAA 1IYXA 3NO1A 2Y1VA 3ABZA 3FFSA 1PY4A 4AL8L 1U3HC 4FXGA 3TPUB 4PTXA 1YPZB 3VK5A 4Z0JA 1FYTE 3HOGA 4K5MA 4EDXB 1FWGC 4B5UA 2CW6A 2YSWA 5B3JE 2X4TB 4F0RA 3WLBB 4P5TB 4MNJA 3FQYA 2WZAA 1TV4A 3GHUA 3B8TA 1B3WA 3CIVA 2E74C 4NAFB 1MCKA 3T4YA 4N85A 5E6SB 5A7EA 2HG0A 3G1AA 4K15A 1ZGLB 2BNQB 4ZMXA 3FCGA 1H6FA 1ZLPA 4PJHE 2P5EE 1Z5YD 2FIKB 4RAUA 1GZ1A 4G8TA 2MHAA 3DI0A 3CUPB 4XPTL 1ID5I 2J4WL 2DS4A 2R1YA 3BW4A 3O9WD 3S3JA 4JZJB 4EQ3A 2FEJA 4PTTB 2J9ZA 2VQ1B 3LN4A 1I7TB 1J8SA 2JB5L 1O6TA 3HPLB 4HJTA 1PLBA 1QHQA 3MR9A 2AERT 3PNWB 4DO4A 5L2KB 4ENLA 5JBEA 1O94A 4ZFZB 3WBDA 1IX2A 4OJDH 3BO8A 4NKIL 3T42A 4C55A 2IMMA 5GZOD 4HJJH 5MEQB 4X0KB 3SKMB 3NA4A 3TO4B 3H56A 3HCVB 1ZRUA 4JY4A 3VB8A 2DPEA 4XE5B 8XIMA 1SFSA 1O0VA 9RUBA 2XWBA 3UABA 3VXRE 4YPGA 4Y0GA 3EGDB 4Y4KC 3CAVA 2DN7A 4AYFA 1T5AA 3V16A 2OQJB 2H4EA 1SPQA 1S7TB 1YDOA 4NVTA 5A6TC 4G3YH 4XPGH 4YSCA 4WO4B 3OAUL 4B7IA 7TAAA 1Y6NR 2FSDA 1R5VA 2YPLA 4GKSB 4KHTL 3J27A 4LEOA 4N5ED 3GB7A 4XN5A 1BHGA 5C6WH 1FTXA 3MLVH 1BQHG 2G0LA 2ZYHA 5JW3L 2V5SA 3VD3A 2WQUA 1NWSA 4F33B 2UWEE 4LHUG 5A7BA 1DVUA 3BUQA 4FQXA 3PFRA 4ZMWA 1BQHA 3HGSA 2TRYA 4K8HA 4P7QA 1CWVA 3D9AL 4AG4H 1M3UA 4TXVB 3AM8C 1ZK9A 3MFFB 4GW1A 3MV8B 3T0VA 5KVGL 1EZ2A 1IWBA 5E9DB 4Q4KA 2OMYB 5IDZA 3BVUA 2IALA 2NY3B 1IBBA 1H3UA 4H8PA 2HFTA 4FFYH 4E0RB 1ADSA 1O1ZA 1V4YA 5D7KE 1BF2A 3UZVB 4OECA 5IRPA 3SDCB 3T3MF 1AE6L 4IOIA 3P0YH 1XCQB 5F9DC 1JI1A 1XB6A 2OW7A 3DPBA 1OF6A 4Q8BA 1TQXA 4PL2A 4W6WB 1RUML 3OD3A 2VDPH 3FFOA 5KYXA 1IGML 1ECZA 1F41A 1UCBH 1HHKA 2DQGH 4PGBB 4A38A 4BI7A 4FQHB 4WEEA 1SXAA 1PMYA 4Q9QL 3JUGA 2JEPA 2YMXH 4M0XA 3V5KA 2WBJC 1XGPA 3MACH 2EG6A 4RWHA 3IAQA 2B59A 1OIOA 3QPXL 4Z95H 2GQAA 3UNDA 3SY0A 4HFWB 1BWKA 1XH1A 4OUUB 1JFHA 1Y0EA 1U8KA 1FCQA 4DW2L 3L5LA 4X9SA 4EPBC 1S8DA 4JFYB 1LDPH 5T26A 1TTCA 4OCRL 2XXGA 1T5KA 2ZCLL 4M6MH 1PU0A 4TQEH 4Y5YA 4UNTA 5D8JL 1ZLWH 3MLXL 1E3XA 4CNIB 1LXMA 1T6MA 2D20A 3ESOA 4D9LH 3MJMA 3G6AA 4XGZA 3VWJD 3QFEA 1NBCA 4MAYB 3ATYA 3A4WA 1MMFA 2B7DT 3T8XB 3SAZA 1BDYA 2R0WL 5LXGH 3LZRA 1WTGT 1GIGL 1EFZA 1M7OA 3DV4B 2VDML 4Y9CA 1GOFA 2B2XH 5FCSH 2QNEA 4M02A 3NL5A 1U8IA 1JBJA 3SQRA 4A4AA 2FQGA 5E99H 1ETA1 2LU3A 4KUCD 1DBAH 1XTMA 4L4VE 4CMMB 1QD0A 2VUYA 2JTDA 3OHXC 3TC7A 4JM2D 3WFHA 4JS7A 4IL0A 4S3KA 3NUKA 3MNZA 1DKWA 1DYSA 1VGAA 1FIGL 1VCAA 5IF0A 1FHLA 3T4CA 4ECLA 4ACPA 1ZLEA 1WIOA 4NT6A 2O9TA 1OX4B 1T04B 3SCRA 1NEZB 3VI4A 3KXQA 3ME3A 4XC3H 3O6FD 1ADDA 3SDAD 2G30A 1GGUA 4FA3A 4R2GD 4XOBA 3L2LA 4LPXA 2B8OT 4L29A 3FDKA 3FOLA 3GRWH 3P82A 1D2OA 1XSIA 1QTSA 5ABAA 4KO6A 4MCYA 5I74C 4HU3A 4WNJA 3FO2B 3GSVB 4F9LA 1MFCL 3WTUA 2EC8A 4OHQA 2XWZA 1GW1A 3RY6C 5FF2A 4IPPA 4P2VA 3ZWTA 4H83A 5IVXA 1C5DA 1JZGA 3HNSL 5AZEL 1DBJL 2X4NB 3QXAB 3ALGA 4YS1A 4LEXH 3ZVHB 1DVQA 1ITBB 1JPGB 4GBXD 4LCWE 1K70A 1ZTVA 2OZ8A 3UWQA 4MJ4A 5BJTB 4CJ0A 1FWCC 4W9DC 4BFRA 2BDNH 1V02A 4PTWA 4JPWH 4MSWA 1E28B 1EUAA 1T80A 3CK0H 2GBAA 3CK0L 3ECBA 3JVAA 4GXFA 2W0FA 3ESUF 2GVLA 1EGJA 2ZVRA 1NEPA 3TW9A 4L4MA 2HA1A 3GPSA 4G1MA 1CR9L 3NK4A 4LMQE 3LS9A 5T3XH 2KDYA 3AY4A 4N0YL 1HXKA 2CKBA 1JV5B 3G04B 3K2MC 3WTWA 2OMNA 3RGHA 5GNYA 1TNNA 3CXDH 2PKDA 2OXHB 1VESA 3U46B 1OE2A 2UVFA 4ZOAA 1UZ6F 3OJMB 3RWDA 2RKXA 5KSWA 3GYRA 4DWSB 3D50A 1V7NH 2F2HA 2H3KA 2AZAA 2QGCA 3CX5J 3IE4A 4LP5A 3QI9B 4XODA 5DHXB 4IHBA 2O0TA 2WW5A 4JJ5A 4PUJA 2YD8A 4JVUA 3RX8A 4JDTL 2WYSA 3RGVA 3O63A 4MAUL 5AZ2H 5HPMA 3SJVA 3WBEA 2XQBH 5CD3B 1GY2A 3U0WH 3L4ZA 2B14A 1B0RA 3NIFB 1GAFH 2EZ0D 2A4ZA 2WIIA 2XQYG 3CSTA 2OGYA 4N90D 4PIBA 1EZLA 2B1AH 3QG6A 2AK4D 1T1WA 4PAZA 5B7YA 5DS8A 4INFA 4D6JA 1HL2A 3H55A 1DSFH 5DK0B 5I24A 2CZEA 3CN4A 1OGGA 4ODUB 2N59A 2QQKH 2NLYA 4OFYD 1PJWA 2HSIA 2IDQA 5FDWA 3MW7A 3OODA 1YEFL 3MJ7B 2R1YB 3KMDA 4Q9RL 1R47A 3DX3A 1AS7A 5I2UA 3BO9A 1TUFA 3ARQA 1KPRB 1TQBC 4JKPH 1M71B 3I9GH 3RAJL 1Q9OB 4JFDA 2OAAA 3C0LA 2BNRA 1DANT 2XA3A 2BSSB 5HYSG 3GVRA 3SN6N 1UG9A 3GSNA 3ZVIA 3ITTA 3FQTA 1AVAA 2XTKA 4MB4A 3R0MA 4XCYA 4O58L 5D37A 1MXGA 2CKBL 3OHIA 4L8BA 3SO3C 4M7JL 4F3FB 3L6FB 4LK4A 2ZVIA 3LM3A 1XT5A 1KIRB 4Z9KB 3L45A 1JUFA 5B1JA 1BD0A 1KYUA 4QNWA 1FYHB 4B60A 1C8QA 1BWLA 3L9CA 4YWSA 4PJFB 3QHZH 1KXQA 3QIBD 3UGVA 4LWWA 1MFUA 2MKWA 2VX4A 4QPEA 3NSDA 3JWOC 4HHAA 1G9NH 2V5MA 4I1PA 5I3JA 2MNUA 4KIEA 2NXZB 3TTQA 3U4BL 3GSRA 4QTIH 1NGWB 2CGZA 1INDH 5D72H 4WI3A 2X7LA 4HMDA 3OOQA 3MODH 3MUUA 3SZ8A 4XPHL 2B4CC 3GNDA 2Y36H 2AXWA 1NCCH 4HW6A 3X11A 3WTTA 5SX5H 1A80A 2E28A 3AYVA 3PZQA 4TQTA 4MMYA 1XBXA 4FQ2L 3RFZA 4XR8C 2RDXA 4IU3B 35C8H 1OO2A 1F4WH 3TGXA 3L9YA 3IKCA 3N41F 5DEFB 5K4ZA 3TLLA 5F7MC 3LCFA 1UB3A 5IROD 1F8MA 3TEYA 4L4OA 2DZSA 2OP4L 4OT7A 2DQWA 2GTZA 1AO7E 2H2SC 2E7DA 1AZUA 1IXQA 1Y1DA 3T6CA 4P5RA 3WBWA 3KPLB 4Q8OA 4Y2NA 2WMJA 4R33A 5I77A 5I5MA 1MLCB 2W9EH 3OZ9L 3RG6A 4E3TA 2IBZY 3HG0A 1A6ZB 3NJLA 2A73A 5HP5A 1KBPA 2F8VA 4QXTA 2ZAGA 1T0PB 2BC4B 3UWVA 3MOQA 4H2CA 4KZCA 3W0WB 1D8CA 2A0LC 5C0RH 4MJHA 1MHHB 3SFWA 3MHZA 1Q94B 3FXIC 1ZGLM 4M7ZB 4AYDC 3QQ3A 3J7HA 1D5XB 5CEZH 5JIPA 4XMVA 3OKDA 3VD4A 1UR3M 2FGZA 2FEDD 1GW9A 1JWUA 3LH8A 3FT9A 4HK3N 2GGJA 5MF5A 4LVAA 1RZQA 4M6NH 2CKSA 1F4XL 3BW3A 2B5IC 3BZDA 1QAWA 2P4AB 3LRGA 1BXXA 1TZGL 1H3VA 4KTGA 4XHJD 3NJMA 3SGEH 1K9TA 2DICA 4WO0A 4E68A 5DBTA 3ZYOA 1FZMB 3DFHA 2QZRA 1IGJA 2FT8A 2QDVA 5TFSL 3F12A 2WQWA 3UA4A 5JHLL 2HZGA 4A7QA 2PDLA 5XINA 4OD1H 3LS4H 4P46B 4Y9MA 4UQ9A 4XTRC 3OKOB 1I6NA 2V6HA 3VI4F 4QIRA 1KIPA 1WC7B 7TIMA 4G43B 1R3LB 1UXLA 5T1LA 4ZUTA 2BX5A 3PZ9A 1QKZL 3D1MC 5B8CB 1BFNA 1KYFA 2NX3A 1PQZB 3K1GA 3IJ8A 1DV7A 1P4IL 1WFTA 2WJFA 3IWUA 4MXWH 5HGDA 2PYEB 2GEQA 5LIWX 5C9KA 5MEOA 2V2HA 1EJVC 1AS6A 2EXSA 2XBZA 5ANMA 5AOIA 1FX6A 4A6GA 4GEIA 1RZ8A 5DUBB 5FOBA 1WGOA 5JLZA 5MEPB 5JA8B 4IGNA 1LOLA 3JV4B 2OJEA 5BS0B 2YD4A 4GIEA 3WD0A 1U95B 1AJZA 1TVNA 3I3EA 2FIQA 3GSMA 4AHQA 1ZLUH 3BQ5A 4L8SB 3PGDB 3NO3A 1FH5H 3D8MA 1LE9A 4HZ6A 1I3GH 4QXTB 4PEKA 4KKRA 4PCSA 2HTMA 2W60B 4V33A 3VIOA 2CETA 4EZLA 3ARPA 1BVOA 5REQA 1A8JH 5DD1H 3SO5A 3SCSA 2O5YL 1M53A 2GSGB 2YOCA 5HDRA 5LDSA 3TN0C 2YXVA 2ZUQB 4PJDB 3I9AA 5KSAB 3IDXL 4GQZA 2EG7A 4Q6IA 1L4IA 4JTIA 4B90A 3P9LB 1C5DB 3SB3A 3ZVVA 5CBBA 5KVDE 2VN3A 3MLUL 4H7ZA 5HTSA 4LMQI 1H0DA 3DRQA 2CK0H 3FOMA 1NOLA 4CCEA 3RILA 4ROPA 4P04A 2PDGA 3BH9A 3TIMA 5T1DH 3IF1B 2DZEA 4QF1A 3FU7B 4GGBA 1ZTXH 3EG9B 4JN1H 5AW6B 3OLGA 3JZYA 4ZG1A 3H9SB 2HRLA 1KPRA 1AD4A 4XBJA 1FSKC 3WUZA 5KSBB 2WGXA 2MSPA 3DX9B 3TJHD 3LAFA 3P67A 4R96A 1MVFA 3Q7JA 1R30A 2ZC8A 1P6WA 2N7SA 1KKOA 3D51A 2XYLA 5F6IC 2J71A 1KBVA 4PODA 3U9UB 1GTNA 1H09A 1KV8A 4UOJA 3S2AA 1KFKA 2QKIC 5D1XB 4LKCA 1P7TB 43CAA 3PHOB 3O15A 2GAZB 2UZIL 2A2QT 4Y4HA 4GK8A 1QUNA 4YBQC 1S9VA 3BAKA 1NIDA 3L0NA 3E2HC 1E8YA 3VXRB 3QI9A 1BM3H 2D4DA 3TBVA 1KEGH 3I10A 1NIUA 3WLPA 3VJ6B 4ZO8A 2VZSA 2F74B 4NN5C 4Z3TA 1SVDA 5M3WA 1OGTA 2KQNA 5HPMB 4JFPA 4PJEF 1MHPH 1N68A 2WSQA 1IEBA 5I07A 3W7GA 3HAEG 3GS0A 5FK9A 4DK3A 2V81A 2N1KA 2VSDA 1RAKA 1DQJA 1CGVA 3WK3A 1BF5A 1UQYA 3KOYA 4F7CB 4JD4A 4PBFA 4HKXA 4R2GB 1KT2A 1C91A 1YNQA 3B3DA 3Q2LA 2ODHA 3EDKA 5JUEL 2CRMA 1VADB 1HXMA 2O72A 3LUTA 2BIQA 3WLWD 4OUIA 3FT1A 4Q7BA 4ILDA 2R4RL 2ZKWA 4AQLA 1N8OE 4ZD3L 3WSQH 2IDSA 2X4TA 4XMZA 5LJYH 2A9NL 1WJ3A 2C9UA 2E9LA 2FSEB 4MMZA 3KZPA 2AKMA 3M5VA 4H8HA 2ESVA 2YAQA 3QUYD 5C6TH 3NABH 1KR1A 5DXXA 4R9XA 3UXIA 4QHNA 4BFKA 1HSAA 4UUJA 1D7DA 2BIPA 2CR6A 1WBZB 3E6FB 3RWIB 4Y16D 4CC4A 4HUXA 3WKML 2GITA 2VGLM 3LKRA 2NOYA 5HWJA 4K55A 3AJ7A 1W0MA 1F3DH 1AYRA 3RWEA 3GSVA 4YLBA 1H7RA 1MJUL 5D7HA 4WHTA 1TJXA 5GSRB 1EPXA 3BOXA 3KAOA 2QGYA 3O3RA 1W8GA 3R12A 4GBDA 2P44B 3VC5A 3EMZA 3GGWA 1QATA 4P23B 4Z0BH 3T1FA 1OCQA 3TO4A 1GHSA 1FQ0A 4OOUA 1MCSA 2WXLA 4I13B 4Y2DA 3U9UA 3VGDA 4MS8D 1IC4L 5CJOH 4M8QA 4W7WA 3WDQA 4QR7A 1YEGH 4AF0B 4JDVB 2A83B 1N64H 1QLRB 4MYPA 3IRPX 4GKOA 5FO7A 4F91B 1E1FA 1KM5A 4KFPA 4A04A 3SSJA 2B59B 5IQNA 4IBZA 5M2FX 2AEOA 1REQA 4FTVD 5TDNA 3VD9A 3N18A 4N0UE 4WU7A 4KTDL 5TGBB 5T5NF 2EUZA 1F00I 4ZS6C 1U3HD 2YUWA 1RSYA 2VR5A 5LCVL 2IH1B 5IW1A 6REQB 5LNEA 1YMMB 2J75A 1OGAD 1CDCA 3CMOH 1UOVA 1GS6X 3Q2VA 1ZENA 3EJJX 3R06A 3SCPA 2BP3A 2JKWA 4PVLA 1FL6B 5GSVB 2Y06H 2Z8SA 3ZBMA 4ABWA 4AENB 3CCHB 4DUXA 2Z1SA 3KH4A 1LM8V 4LL1A 3SBWA 2IS7A 5B21A 1IAOB 5CFAA 4D8ZA 2XBDA 3IJ7A 3CXHK 3KPMA 4PJ5E 3V0VA 3WAKA 4KITB 4FOUA 4C6BA 1LRNA 4AZCA 4A1RA 1A7QL 1OAUL 5D1QD 3V7MA 4XT1C 2HVKB 3HI5L 5DD6B 1IT7A 1I2OA 4E41A 9XIAA 1KBKA 4MNQD 2Z8VC 3BQUC 1F42A 4IEFB 3O8AA 4ABUA 4OZHA 1ZPTA 3EBIA 3A23A 3MNZB 1TJGL 4OI7A 3MO7A 3MJ8B 2YN3A 4G7FA 1KELH 3EO9H 3M43A 4W8LA 4EXBA 3PHSA 4X6BA 2AJ3A 1I3RB 3ZYZA 3WNOA 2F7RA 2NY1C 5BUGA 3BWZA 4X6DA 5TF1H 5JTWA 1K4DA 2ENYA 4AQAB 4YFEA 2IUZA 5A16B 1HEZB 2POTA 2RJGA 3HR5A 5E03A 3QMSA 5CLZA 2FLRT 2JJTC 3P2VA 1FJ1B 2ZXEB 1MRAA 2NY4D 4CC1A 4ZQPA 1PZ3A 4BEIA 3USZA 3V5DB 3IUHA 1GS8A 1U8MA 2J6EL 4BRJA 2ICEB 2WWCA 3EGDA 2ZRWA 5TQLA 1MJ7L 3LMYA 2NY3C 2WMFA 1C08B 2G9HA 4N3TA 1X5XA 3CDZA 5EOCJ 3V5FA 5E23A 2J7HA 4KGLA 2Y2WA 1Z9OA 4Q3MA 3C8KA 4I8YA 4ADIA 1YNYA 1EO5A 2FEDC 32C2B 1I1FB 1TRDA 3ABQA 1QW7A 4TTUA 5B1KA 4CVZA 4O5LL 4EI6B 5IVXB 1QNQA 5KZ6A 4YIWA 4XNUH 3QJOA 4XZ4A 4BFGA 1V6UA 4S3AA 4M9PA 5AN7A 5FYLE 1PIIA 3IMVA 1BRLA 1Z9SA 1YMMA 4W93A 1EEUA 3H2WA 5AYTA 4A55A 2J4GA 2EDKA 4FHAA 3WMPA 4GY0A 3NQBA 1KFAL 4L56A 4NGHH 4RMVA 1UR8A 4K3EH 5MKGA 3CZ8A 4J6IA 3HQ1A 5C0BA 3DARA 3SYAA 2DMGA 4CVUA 4EN3B 3GRBA 1K85A 4PMZA 1I9JL 4XD5A 3G9AB 2X1SA 1UWTA 3U6WA 5EMYA 4JDZB 5AOZA 4NEHB 1NLDH 1P4BL 2MFNA 3HGJA 4ELKB 1ROCA 3CFCL 1DZ0A 2VLME 1PHQA 4Q89A 3VRLE 1OW0C 1U3YA 3KWWB 4L9LA 1JN6B 3CHVA 1RZMA 1YMYA 3CLWA 5SWQA 2VN4A 4DN3L 1IFHL 1HKMA 4TSCL 4WHCA 1A6WH 3JTSA 4NUWA 1YEJH 1FNSL 1C93A 1NCAH 3EJRA 1NGZA 1KM6A 2RGMA 3MRPA 5J8OA 3UG8A 3PM6A 3UCQA 2XIOA 2VN7A 2YZ5A 2V9QA 3PZOA 5HR6A 4UMCA 1VFMA 2BFVH 2ZP8A 1IM3A 5CHNA 2G0WA 4B4HA 4A7GF 3I02A 4GH3A 4L9YA 2R23A 4NJ9L 2NR6C 1W72L 4M61A 4P4RB 4AYSA 4RMUA 4RNJA 2DLFL 3P3RA 4FXSA 5EBMA 3NA9H 4NYUA 1PDYA 4M48H 2QCHA 1MCJA 3G6DL 3H85A 1W8EA 2CKBB 3G04A 5GZNA 4YX2L 5TDPB 4JB9H 2JELL 3RL1B 5IB3B 2WTOA 1DQUA 3P3YA 4KETA 5F4XA 3WL9A 3CFUA 3FUNA 1V6TA 2C3ZA 2BV9A 1EXPA 4CKVX 2AJXH 1UOWA 1TV8A 4GVFA 1L6GA 3B1TA 5BU6A 5C09B 3V7PA 1E28A 1B4TA 2J6VA 2MCPL 3AXIA 4NQDD 2K1MA 4G5ZL 4Y5XC 5EEUA 4H5SA 1ADOA 1KRCC 4FQQA 4HV8A 1KCVL 4WSHA 5CGMA 3AIQA 2HMIC 4WWID