3H54A

Crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 128
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h54A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h54A01
1W0MA 4LVDA 1KFCA 3GXNA 4QM1A 3W1XA 4CCCA 3UG3A 1O94A 2H3BA 4MJZA 1S5WA 1T96A 4QIUA 2Q3RA 4FO4A 5AYXA 1I2QA 3KVMA 4IUOA 3S42A 4AWUA 3W1TA 1RPKA 3OEXA 2FHFA 3IJ8A 1PV8A 4UTJA 3FEMA 2I14A 4MUZA 1V3JA 1H7RA 4CVWA 4J7RA 4WXZA 4OHQA 1VRDA 4M56A 4UTHA 1K8YA 3TA6A 5CPOA 1PPIA 4A21A 4RR4A 3NYZA 4MVAA 5BNKA 3AJ7A 3QPZA 2TMDA 3DKLA 1YXDA 3IJ9A 3CWNA 4GRSA 1ZHAA 3ZOAA 4AEFA 3WDIA 4IJBA 1CXEA 5AC7A 3W7OA 2EGZA 3KL5A 4UQAA 1H62A 4WOZA 1OG0A 2GVGA 2NWRA 5F1UA 5CSSA 3UG4A 1UD3A 5LNWA 1DL3A 3BW2A 2YR1A 1W56A 1SZNA 3PY2A 3S1WA 3CZNA 2DIJA 3UD6A 3PAJA 4JTLA 5KZDA 2CU0A 1UA3A 1VJIA 1QI3A 3HPZA 3LCGA 5DBUA 2HMCA 2RKXA 1CXKA 4TO8A 3RILA 2C15A 4MY1A 3WJYA 2VFEA 5LZLA 1XD1A 4UQDA 2QCDA 4UFMA 2ZA3A 3G3DA 4RZ6A 3WMSA 1VIWA 4WY0A 5LNSA 1JDCA 1ZJIA 3MUXA 4ZVJA 4DF1A 4NQ1A 3M44A 3OIXA 2ZQ0A 1OT1A 2FYVA 3DI0A 2GQAA 4LC6A 5E93A 5FESA 4B9YA 3K8KA 1QW8A 3IIVA 3O05A 3W2MA 3W1RA 3W88A 2WSKA 4KWVA 5LNRA 1UD4A 1DV7A 5CGQA 3SI9A 4XUGA 3U8GA 3G1VA 1BWLA 4R34A 2NXIA 2Y85A 3VKJA 1XH2A 4JYEA 4UQEA 3L4TA 3IIXA 3CC1A 2PWDA 1FCVA 3O07A 1JDDA 1H60A 4DO4A 2ABBA 5HUOA 2RDWA 2YIHA 3TFCA 2BHZA 1HL2A 4N2YA 4H2CA 1VS1A 4UZUA 3II1A 1LRNA 4HOWA 1SW7A 1UJPA 3C52A 3BSGA 1TSIA 4K36A 5FEXA 3HG3A 3UXDA 4JICA 1AMYA 1A50A 4MJMA 3EDDA 5F1VA 3A24A 5K4XA 1QOPA 4WF7A 1JG9A 1TO3A 3M41A 1QI4A 1BVZA 1TTQA 3MMTA 1WE5A 5F2GA 3IIOA 2ZX6A 1VH7A 3NEVA 3VNYA 5LNVA 3IGSA 3R2GA 2ZZ1A 3K8LA 3ABQA 3GAYA 3BAWA 4JN6A 1JQVA 3CIXA 2WCSA 4LV9A 2HTMA 3B0PA 1JR1A 3TJXA 2E6AA 4O15A 4UNLA 1SMAA 1AL7A 2ALDA 3LBCA 3C2VA 3H53A 2A7NA 4YCOA 1G4SA 3T40A 3QSRA 4UZSA 1OABA 2PCQA 5AHFA 3STEA 4PCSA 4WZHA 3UEQA 3KAOA 4H4IA 4HP5A 1W5QA 1UCWA 3CZSA 4GWEA 1K7FA 3IIPA 1MZHA 2FHCA 1RP9A 2YGYA 4LC8A 3EX4A 2QLYA 1R2RA 3IVUA 1GVSA 1I8JA 3L5LA 1EWDA 4O0ZA 4GNJA 2ALWA 2B4GA 3S8HA 4ZQPA 3TONA 4JY9A 1VB9A 3KLLA 4LNYA 3UNDA 1WQ5A 1EWEA 2VFDA 1S5TA 5DXYA 3QMSA 3L9CA 3LTSA 1FWSA 5F2IA 3CTTA 1VYSX 2IQTA 5CZ0A 1DHPA 4WJEA 4CNOA 3LRKA 4P61A 2V82A 4GQRA 5G2WA 4S1FA 1CGWA 3PUEA 4KFPA 3W7RA 2CWNA 5G5IA 5DO8A 3MP3A 2A4AA 3WELA 3O6DA 3NGJA 3NM1A 3CLWA 2C3ZA 4JCMA 1XSIA 3VM5A 5I23A 4FLQA 3FJ6A 3IVSA 5DLCA 4U33A 2KZHA 3GXPA 5CLTA 3TCEA 4HOXA 5D33A 3W87A 4QAIA 3OBKA 4PSRA 3S5OA 4DBEA 2Y7EA 1ICQA 3ZSTA 4ICNA 5G1TA 2VFHA 5FI8A 3N3MA 1XBVA 4EF9A 3PBUA 1CLVA 3W86A 3Q37A 1WX0A 2ISSA 2EJ1A 1SW3A 3W2KA 2DIEA 3I65A 5F4WA 3DFSA 1NEYA 2FB2A 5EPDA 3LHZA 1Q6LA 1CDGA 1W54A 4O57A 4OV9A 4XWUA 4HNVA 1UUMA 2WNZA 1KWKA 4M7TA 3W7KA 4YL2A 3LI0A 4I9AA 3W2UA 1NAL1 1D3HA 3UG5A 4AYSA 1WPCA 1F74A 4N9CA 1JUEA 2ZUTA 5A6LA 1XI3A 3E9AA 2OZ0A 2E0PA 3O15A 3OG3A 3W70A 4NXKA 3RNDA 1MO0A 3PUOA 3RLVA 2CHNA 3ELFA 1X1ZA 1AVAA 2AMGA 4AMXA 1ZNNA 3VGBA 2WO5A 3BK0A 2CFFA 2V2HA 3FYOA 4UTTC 1I4NA 2A6NA 2VENA 2PRMA 5LGXA 1J0KA 5HULA 2WKGA 4E2OA 2V81A 2YPIA 2QF7A 4MZYA 4Z1BA 2V3DA 2F61A 1KCKA 4QAWA 4K6AA 4UC5A 3PR2A 2WPBA 4UFKA 5I3GA 1UB3A 3ZR4A 2Y88A 1YDNA 2VR5A 1J2WA 4UCGA 2ZX7A 2C13A 1L9WA 1JAEA 1H3GA 2E1DA 2V2DA 3M47A 3TC6A 1OX6A 1GVIA 4M5PA 4L4MA 2HSAA 1YTDA 1ZALA 3ZWSA 2YKKA 3H54A 5HR6A 4J9JA 3UPBA 1TTIA 2WJZA 5CXPA 3L0NA 1WO2A 4IPIA 2EAEA 1G4EA 1MXGA 3GKAA 1QW9A 3SGZA 4JIPA 1DJQA 3BUPA 5I24A 4NJJA 1R33A 1X8FA 4FX8A 3N9SA 4BR1A 3CZGA 1H1YA 3TE9A 5MHBA 2R91A 3LHVA 3IVTA 4U3CA 1IZJA 1VYPX 2WVUA 5CLWA 1QX1A 4AIEA 3GVGA 5D02A 4O1BA 1U5JA 3NR0A 1QWUA 3D51A 2ZUVA 3M9YA 4JY8A 3LLDA 4LVGA 1C8VA 1QWNA 4WSKA 4JXCA 4M6PA 3EJUA 2VNCA 2QAFA 2QCDB 3C8FA 1CGYA 1SSDA 1HO1A 4PCFA 3F03K 3FAWA 1KFBA 1R30A 3ZS4A 1ZAJA 2X2GA 3V1PA 2PC4A 4XB3A 3W3OA 2WVSA 4CQAA 2PWEA 5CSRA 4PA8A 4N9DA 3LB0A 2B7PA 2YA2A 2VFGA 2X2HA 1BLIA 1ODUA 2FFCA 3WN6A 3QGVA 1G94A 3CIWA 4O13A 3W7NA 1MW3A 4JYFA 1IXOA 3KE0A 1EP2A 1F76A 1QPOA 1B57A 5LNUA 3DFNA 1Y7VA 2DP3A 4JTTA 1VCVA 4GUJA 3GBEA 5LSMA 3WK2A 2FE0A 3G24A 2V30A 2Y7FA 3L68A 1R47A 3VNDA 1JD9A 2QPUA 1UKTA 4W9TA 4LUIA 1TTJA 3VGHA 3TSDA 4LS1A 1NSJA 2WSQA 2GVLA 3TQ0A 3PULA 3K30A 1M7PA 1PIIA 3HG2A 4UOZA 1F73A 2YW3A 1I75A 3BUIA 1EO5A 2NV2A 3STFA 3EEGA 1CXLA 3BVUA 3MBDA 4MAZA 5IBXA 1U30A 2Y4SA 2IGTA 1RQBA 3EX3A 1H63A 9CGTA 1PAMA 1GT8A 3PSVA 5D2YA 1H51A 2PE4A 5DCEA 2OT1A 1WDWA 1CXHA 4AH7A 3W85A 1OF8A 4IWWA 3WY3A 1RVGA 5G4EA 5KZMA 4MB1A 4OBTA 1KXTA 1C9DA 2UV8G 2TPSA 2ABAA 4JTKA 1G1YA 1F7BA 1OVDA 2C1HA 4LRTA 4Q33A 2Y61A 2XN0A 1R2TA 2WANA 3ZSSA 1KB3A 3EKLA 1GZGA 1AMKA 4UNIA 3PG8A 2QCFA 5D2TA 5A6MA 4GI9A 2OYKA 3LCFA 4FXRA 1W5NA 3Q2DA 3KLKA 4AYGA 3B8DA 2ZUUA 4OJYA 4JTJA 3QZEA 3GXFA 2GQ8A 5CPLA 2PWHA 5HPOA 1LP6A 1ML1A 4LTSA 4Z08A 2ZZ4A 3MBFA 4O19A 2CLKA 1BPLB 1KM1A 1PJ9A 3STGA 4YXGA 3M5XA 2YXGA 4UTWC 3PVFA 3HG4A 3GNNA 1HT6A 2BLEA 3W22A 1JCLA 2Y2WA 2DH2A 1RD5A 4J3UA 4DO6A 1AW1A 1CXFA 2F84A 4KFOA 2A0NA 5L6UA 2ISVA 2RDTA 1SZEA 3EXRA 4RX0A 2NXGA 1WA3A 3LTYA 3LXCA 4PH6A 1WV2A 3DGRA 4E38A 1Q3NA 2NUYA 1KW1A 5L9FA 2QJGA 1M6JA 1XUUA 3LPOA 4JX6A 1JVNA 2E4TA 4JNMA 1GVQA 2XVGA 3WNLA 3VE9A 4X3ZA 3NQ8A 4MLRA 4MYXA 1ZFJA 2OT0A 4GUIA 4CNPA 1CXIA 2WSYA 1QHOA 3I7QA 1VFOA 1OFDA 1L6SA 4JD4A 4XBKA 5HINA 1S3HA 4XKYA 4XBSA 2X2IA 5FF3A 3W75A 8TIMA 3BAXA 1G6CA 2NUXA 3W84A 2AAAA 4O52A 5DELA 3L5MA 3VU2A 4OV4A 3UY7A 4FB7A 4U31A 1HFBA 3HGJA 4BK9A 2BXYA 1OYBA 3W7MA 5I5RA 3L0GA 3WK3A 3B03A 4U2YA 1P4CA 5KSWA 1XV8A 4DXVA 5BRBA 4YCPA 1FDJA 3HBLA 1VC4A 2VRQA 1JCMP 2TRSA 2TSYA 1XDMA 3W72A 1GVRA 4QJ1A 1EPXA 5SWUA 4UR7A 2O7SA 3AMLA 3DDGA 3MHGA 4H8HA 2V5LA 3QYQA 3IJ7A 3G3MA 1CX9A 4GUFA 4LWWA 4IQLA 3MI2A 4O11A 3DAQA 3LLFA 2V2CA 3HPSA 3A22A 1SU5A 3NVTA 1S5VA 3NNTA 4UUIA 1OB0A 1O5XA 1Z41A 2FTPA 3L66A 3G0SA 4CQ8A 4DF0A 3TQVA 4EVZA 3JR2A 1PCWA 2YOCA 2BHYA 4O16A 3FLUA 3P61A 4RXFA 3RFAA 3NAVA 4BI6A 4ADSA 3W74A 2P0OA 1DVJA 4AEEA 3SFKA 1HG3A 2QUVA 3B0UX 1XBXA 1QWGA 5FF2A 3LRMA 2DU2A 2J27A 5K9DA 2ZBTA 4JR5A 1LRQA 5HWJA 2RH9A 2PWFA 4EOUA 4M7SA 3CWOX 2Y89A 1I2RA 2E6DA 4EWND 3OLEA 2V3EA 2NT1A 1K8ZA 3S1UA 3LM7A 4GKLA 3O1NA 2GOUA 3KHJA 3UY8A 3AO0A 4UMBA 1GVOA 2F18A 3B04A 4ONVA 3HIJA 3CZEA 4O8RA 5T26A 2H3DA 2X1TA 4HIBA 3S1VA 1FDZA 3VGDA 3SSJA 2YSWA 4JFWA 1XCWA 1Z32X 1LCOA 4CCDA 1KFJA 3PB2A 3LBMA 2ZWZA 3CLMA 4PTNA 2FH8A 1XL9A 2FPTA 3GB6A 4JTSA 1DKWA 3DFTA 2YW4A 3GR8A 3W73A 4MY8A 5AFDA 7TIMA 4GE8A 1JQXA 4JS3A 4LU0A 4CNNA 3WNNA 1FXQA 3EX1A 3O06A 1LROA 4Y96A 1FX6A 3G1SA 6CGTA 1LDCA 2NWSA 3QRHA 2WVTA 1UH3A 3A4AA 2QV4A 2NX9A 4Z0SA 1R34A 1CGTA 2CZEA 1KM4A 2OYLA 1IXNA 1SO4A 4KFNA 1JULA 1VHCA 1L0PA 1QPKA 4AF0B 5CZTA 3NQGA 5DN1A 1GOXA 5AYZA 3G1HA 4BF9A 4JTIA 1A47A 1WZLA 3P74A 3GDLA 2XIIA 4NI3A 3W1MA 1T0OA 4AHQA 4NJGA 5K2ZA 3BH4A 4XTDA 2C8NA 4WLCA 1A5CA 1F5ZA 1BF2A 3O16A 4ADUA 3QEZA 3EDKA 1QR7A 4GFSA 3TR2A 1JFHA 1QO2A 3MWAA 2NLIA 4HNUA 4GC4A 5TIMA 3EX6A 4ZZ9A 3NPXA 4DQWA 4E2BA 1B2YA 3L4XA 3UWYA 2A2IA 2ZA2A 3GTNA 5GVJA 1JGIA 3R5EA 1ZJBA 4ZQMA 5TQLA 3T44A 2XN1A 3OHIA 3NL6A 1GCYA 3KRUA 8CGTA 1KBKA 1TQXA 3KXQA 4QNEA 3BLKA 2CLFA 3G8EA 1NF7A 3I68A 1L6YA 4MYAA 2NSXA 5DY3A 3DXIA 4O10A 1W37A 4J3XA 2Q8ZA 1JCNA 3IV3A 3C61A 3O6YX 4IPJA 1WBJA 4FIRA 3W2NA 1MXDA 3UWQA 3P80A 3BVJA 1TCDA 1FDYA 3EXSA 2VRKA 1N55A 1YADA 5LHEA 1ZS2A 2H8XA 4X2RA 3LV5A 3TJLA 2R14A 3TSMA 4UTUA 2JGYA 3W83A 3VGGA 2DZWA 4RLIA 1XM3A 4QNWA 5AB3A 4KKXA 3NL5A 5AN7A 4IXXA 3UERA 3U6WA 4LQ1A 2FQIA 1VFUA 2G5WA 3W7EA 3A21A 2FPVA 1W1ZA 2XWEA 3NPWA 5D30A 3BC9A 1R2SA 1H5YA 1R75A 2QDHA 3OLIA 3PSWA 1D3GA 3P60A 3TMQA 3QPYA 4MKNA 2VEMA 4W93A 1GPWA 4UTLA 3BGJA 1BG9A 1ME9A 4K38A 4GINA 2P10A 3B06A 3BG5A 1OX5A 3QM3A 3R89A 5CZSA 2OSXA 1UD2A 2ZE0A 3VGEA 1IGSA 1C8QA 4PC8A 3VCRA 1EH9A 1KM0A 2QAPA 1G4PA 3F4WA 1VCGA 4PODA 2B0MA 2EHHA 4NVTA 4OWGA 5FF7A 4FNRA 2YYUA 4ORMA 4TIMA 3VMOA 4O50A 3Q94A 5A8GA 3TV8A 2ZZ3A 2X16A 2PWGA 1CYGA 3EWYA 1XC4A 3GYEA 1WAUA 2J88A 3NL2A 1ADOA 4AIOA 1E3XA 1OYAA 4Z1CA 3QW4B 2WQPA 3MW7A 1K3UA 1MW2A 2FGZA 2EF9A 3DFPA 5AC8A 2G97A 3OVRA 2WC7A 4GUHA 4J27A 2VEIA 1FWWA 5EKYA 3FJLA 1GQNA 3RIKA 4A2SA 1QFEA 1L6WA 3TFXA 3TNOA 4JFUA 1KA9F 3GR7A 1LWJA 2G95A 3TC7A 3DX2A 5BOOA 7CGTA 5BRPA 1PS9A 3TKFA 3L2IA 1H61A 4UQCA 1O7DC 3L2LA 5CPMA 4Q32A 2F2HA 1I2OA 1XCXA 1FBAA 1SFJA 3W7CA 1YDOA 4CN1A 2CLEA 4TX9A 5D2WA 1HTIA 2A5HA 1BAGA 2G3NA 1W3IA 1GG0A 4JTHA 1TMHA 4NU7A 1MFVA 3TTYA 3BARA 1KCLA 2CLIA 1U83A 1UD6A 4IGHA 2ZRWA 3T78A 1E51A 3WY4A 1EO7A 1B3OA 2VT0A 1H7PA 4RXGA 1PE1A 4UTWA 3C2OA 4BWLA 2OX1A 2E5BA 3BG9A 4LPCA 3EJRA 3O6CA 3NA8A 2C18A 1JRBA 4C1LA 4A2RA 2GJLA 3D0CA 2D3LA 6ALDA 1TPVA 2NUWA 1N8FA 2J24A 1YTEA 4H7VA 1J4EA 2YA0A 3W9ZA 3ANYA 4PL2A 1TPUA 1OT2A 1P1XA 2BY1A 1OFOA 1H1ZA 2BTMA 4GQQA 5BRQA 4K37A 5D32A 5LGZA 1HL9A 5CZJA 4YWIA 5IM51 4UFIA 2G3MA 1V5XA 3R12A 1XGZA 4HHPA 5KINA 1KFEA 2VELA 3PF3A 4AHPA 4MPQA 1TQJA 2DZSA 4PL1A 3JRKA 4POCA 4RCXA 1JD7A 1FWNA 3NL3A 3A5FA 1PHQA 5I3KA 1DTUA 2QCGA 3HOJA 4M6QA 3VM7A 5K7JA 4DPPA 4MLJA 4U28A 4N6FA 5E1QA 2W0UA 1W8SA 2E9BA 3LCWA 3M43A 1FWRA 3BUQA 2BWGA 3CPUA 1LTDA 2C7FA 4QISA 5F4XA 1QI5A 1KWGA 1KBJA 3INPA 1TQVA 2WNNA 1A5AA 1BTMA 1FUYA 3L4UA 1WXJA 1QMLA 1B4EA 1HTYA 3TMLA 1GYNA 2F1AA 1X6UA 3I6RA 2YYTA 3QW3A 4J3VA 1RP8A 1SFLA 4JIQA 4Y9AA 2AAMA 4ZQCA 3W71A 4CN6A 4IMGA 4AAJA 3QSTA 5J5RA 1GYLA 4N9EA 4ORIA 1JCJA 1OF6A 3K8MA 3O63A 1A53A 4LT9A 4JEQA 5D03A 2NX3A 1VPXA 3SW6A 3NDOA 1XCFA 3B05A 3FYPA 3OVPA 4C1KA 2ZXQA 1JUBA 2QCNA 1OK4A 3NZ1A 4GI6A 4FNTA 1AL8A 1AQHA 2X1UA 3NPVA 5BMXA 3L4VA 4HNNA 1DHKA 4O12A 4OIFA 2QJIA 5HR7A 2ZUWA 1Z48A 3E49A 3KOFA 3QH2A 3E96A 5A2AA 3NQDA 1JDAA 4IMCA 2WCGA 3IGXA 1TPH1 4LS0A 2WNQA 3LHYA 1LORA 2CZDA 3VMNA 2GVYA 1PL9A 2ZTKA 3P8JA 4CN4A 4K39A 1LZOA 3R13A 2ZRZA 2NT0A 2E68A 3QQ0A 4A3UA 1A5SA 3KVLA 2BY3A 5AHEA 2YJQA 3WNKA 3BCDA 3L67A 3FOKA 3TAOA 4HA1A 5G1YA 2D3NA 4MIMA 1P6WA 3UYCA 1XBZA 2OYMA 3NQEA 3W7PA 1OFRA 1CIUA 2RFGA 4RZ4A 3BMVA 1VHNA 2XVLA 2CLLA 2FLIA 3BG3A 3KRZA 3MI3A 1RQHA 4NJIA 2P1FA 3NOEA 3M07A 4GI8A 1K03A 3G1XA 1KTBA 1ZJAA 3W23A 1J5TA 2DH3A 3WY2A 3UXAA 4OQVA 3SJ3A 1PIGA 2ZX5A 4N6EA 3RF9A 3N73A 4JYDA 3D4ZA 2V8ZA 1BWKA 2F1BA 4BI7A 4BA0A 1TYGA 4Y90A 5K9CA 2Q8LA 5FEPA 3AJXA 4IMFA 1HX0A 4JTGA 1E43A 1RQEA 1HNYA 3W1PA 3BAKA 5J5DA 3EWBX 4I7VA 3KFTA 5I3HA 3CGTA 1I45A 2Z2UA 3W7HA 1XH0A 2CLHA 3M5ZA 4TMBA 5AHIA 2FB3A 4WQ6A 3WEMA 3CM4A 4Z1DA 2GQ9A 3MI6A 1TQTA 2X1RA 2DZUA 1SZFA 3QF0A 1SUXA 3F1QA 1ZENA 4LVBA 3STCA 1NF0A 2JKPA 3N19B 4AMWA 1LBLA 3DKJA 1AQMA 4FNPA 4Z1AA 3KVKA 1G69A 1AW2A 1JIBA 1XD0A 4FMVA 3BVXA 1VCFA 2V9DA 2RDUA 4TR9A 4K7VA 1XFBA 3CZLA 3TX9A 2QMJA 2FDSA 2ZRYA 1RR2A 4UMAA 3DBPA 2JKEA 2B7NA 2X30A 1CGVA 1KM3A 1W5MA 1ZAIA 1JXJA 3C2FA 2D2OA 2Y63A 1WOAA 2G96A 5F4SA 2DZTA 4HPXA 4O53A 5K4ZA 3VMPA 3C4UA 3THQA 2BSLA 1FY6A 3FFSA 4N02A 1UH2A 3W1LA 1TMQA 3IGUA 3ZT5A 3MO7A 4JDYA 3PM6A 2V0TA 3TK7A 1I2PA 1XSJA 3BLBA 2YZRA 3CHVA 5DBTA 3SZ8A 2PRHA 5D2VA 1LWHA 2ZWYA 1RZMA 3NQ6A 3N34A 3W07A 3P5YA 1QHPA 3HMJG 4RJEA 1K7XA 3WJWA 3W1AA 1TRDA 1TQWA 2XIBA 3VSUA 3QC3A 3MJYA 1YTKA 4XQ6A 3UWWA 1TB3A 4QSHA 5I3IA 1Q6RA 1ZY9A 4GBUA 1YXYA 4FX7A 5HDRA 5G4WA 4HSOA 6TIMA 4DPQA 1U33A 3FAXA 3HPXA 3ZR5A 1J0JA 1HO4A 4O0KA 5K9XA 4Y6GA 1DOSA 2VC6A 4KWWA 5TBOA 4BI5A 3TW6A 5HWMA 4X9YA 2QPSA 3BAYA 1LOQA 2F7FA 4N9BA 3VSTA 4M8UA 4R7JA 3WJSA 1Z42A 3NQMA 1LBMA 2WKJA 2Y70A 2GPTA 3W76A 2A85A 2Z1KA 4X22A 4UFLA 3DFOA 4ZQOA 4IMEA 3UZ5A 5C2XA 2XWDA 3HG5A 4DF2A 1U2YA 3AXHA 2ZZ7A 3BV4A 3HO8A 1VJSA 1FQ0A 1X1OA 4O17A 1A5BA 3C56A 3NZRA 3YPIA 1OFQA 2W6RA 3RLUA 1JRCA 2H90A 3WDJA 2ZFAA 3GXTA 3MHFA 4UMCA 1UD5A 4BZYA 1B4KA 2YCEA 3FIGA 1DBTA 3ATYA 4WXYA 1UKSA 3UWVA 3UZJA 1VLIA 1F2JA 1XXXA 1GEQA 3WJZA 1ZCOA 4N4PA 4M19A 4JCLA 1TPB1 1FCQA 2OSWA 3C2RA 1WZAA 3D4YA 2QR6A 4QQ3A 3KEHA 4JTEA 1ICPA 2ZYFA 5CPNA 1LLWA 4NZFA 2EKCA 4OT7A 5F2MA 1LOSA 3DFQA 4CLMA 3EJSA 2VXNA 3KWXA 3ZO9A 1YPIA 2ZA1A 3NG3A 1R46A 3TQKA 1FCBA 2FH6A 3HQ1A 1OX4B 1OGSA 2OW7A 3G22A 4IX2A 3TW7A 4QITA 1OK6A 3L5AA 6TAAA 4JL1A 1SO5A 3P81A 3WDHA 2GUYA 1MWOA 2D0GA 1M7OA 3PBYA 3VSVA 1KM6A 4O54A 1D3CA 1UKQA 4IX0A 1TIMA 4NNCA 2YFOA 5CGMA 3ABSA 3S5NA 2OSYA 5DXXA 2ZCGA 4AVFA 4FHAA 1W5PA 1G5AA 1OFBA 2ZX8A 1OFPA 4J28A 4S2CA 5BMWA 2WVVB 1UH4A 3BSHA 1VR6A 5AHMA 3G1YA 4UTTA 2I9EA 1TV7A 2DZVA 2Y5EA 3ZT7A 4AWTA 1UBSA 4LVFA 3TUUA 1YXCA 3G0XA 5FEZA 2ZZ2A 3GDMA 1MXSA 2R8WA 2J9ZA 3P5ZA 4LV4A 3O8AA 1KLYA 3W7DA 1VLWA 4FNUA 2V3FA 2H6RA 5H2ZA 1TPFA 5I3FA 3S9YA 2H8ZA 4R33A 2BX7A 2WSPA 3DHPA 3FA5A 1HUVA 4UR8A 4ADTA 2A6LA 4IXHA 2E6YA 3T55A 3BVVA 1M5WA 5D05A 1X7FA 3ABOA 2A1YA 1TQUA 4WY0B 3S1XA 4RKAA 4NNAA 3A9IA 1Q6OA 4YMZA 4CQ9A 1XSKA 1MSSA 2F7QA 1OX4A 4UTKA 3WFAA 1SSGA 4NXSA 4O4VA 5EMUA 4K8EA 4E2DA 4DBDA 4UOQA 1PCKA 3W1QA 1IXPA 4O1CA 5IBXC 3HB9A 1O4UA 4RV8A 3WJXA 1ZAHA 1YLVA 2FIQA 3T4CA 5C5YA 2XN2A 3EJTA 4J3WA 1TJPA 3HGRA 2D0HA 2EABA 3L4WA 4UTMA 3W7QA 2RHGA 3EWUA 5D2XA 3SIZA 2NXHA 1IF2A 2V5BA 1G4TA 1IIGA 1TV8A 3W37A 1TPEA 3V75A 1THFD 2R94A 1V7YA 3LCLA 1JF6A 1XDLA 1MW0A 4ML9A 3TH6A 3GXDA 1YYAA 1KFLA 4JL2A 4OKDA 2ZXBA 1H7NA 4LW7A 2E5CA 4GIAA 1UA7A 3EDJA 4FX6M 3N9RA 3Q58A 3IIZA 1GTEA 5K3VA 4EIVA 4HKPA 3LV6A 4R53A 5DCDA 3N2XA 1P0NA 3VE7A 1DORA 1IV8A 1WBHA 1M7XA 4ZQRA 3CB8A 3EWWA 4FXSA 2J6XA 3BW3A 1CW2A 1GWJA 4UFJA 2ZZ5A 3G1AA 3LHUA 3HJEA 4CKQA 3M1ZA 2HS8A 1S46A 2VUYA 3RMJA 3IRDA 3VFLA 4JFVA 3OVQA 2YFNA 3CEPA 2QCLA 2BXZA 3F4NA 1DQWA 1Q4NX 4NX0A 1Y0EA 3L0KA 2HS6A 3KL0A 1XBYA 2C14A 3HJZA 4MZ1A 1EA0A 1KGXA 2C16A 3RK8A 1OYCA 1KFKA 3CTLA 4MFDA 3MYPA 4FNQA 2CXGA 3ATZA 1HVXA 3BGGA 2BY0A 5A2BA 3I7SA 4LRSA 1GTHA 3BAJA 2GVJA 2BZNA 4A22A 1JJKA 5DFAA 3G1FA 2QJHA 3TDFA 1L2UA 2WKLA 3A23A 4OU1A 2DZPA 2X2JA 1VYRA 2VEPA 4WUIA 3MYOA 4HNTA 1EX5A 1HWWA 3A5VA 3GDTA 1TQSA 3W7IA 3WK0A 3UQNA 3CZKA 1PIFA 4PEEA 2NX1A 3PBWA 5E0FA 1V3KA 2Y24A 1V3MA 3WNOA 2Z1BA 4WX2A 3S0CA 4KWUA 5F2LA 1BEUA 4X0NA 1WZMA 2DZXA 2CLMA 3NQVA 3GXIA 5E0KA 3A6OA 1SW0A 4GJ1A 3BLEA 3P67A 3LCIA 1W5OA 1F6KA 2ZXDA 2QUUA 2ZIDA 5E6ZA 2Z0IA 2VEKA 3QMTA 3BO9A 1IXQA 2Z6IA 3NQ2A 4K8HA 3LOTA 4LUJA 4NJKA 1MW1A 3C6CA 3M16A 4B5NA 4GUGA 3DHDA 4B9ZA 3SECA 1CGUA 3PWAA 1CI1A 1HXKA 4JX4A 3MHUA 3DU0A 5TD4A 1QO5A 3EJPA 2J9XA 2GJNA 5C6MA 1B9BA 1C29A 3G0UA 1W9XA 2VFIA 4PFMA 1CPUA 1CGXA 5DY2A 1JCXA 2E5DA 1WZKA 1QDSA 5EYWA 1G7VA 2NZLA 1ONRA 4J3TA 3HZ3A 4LXFA 3S5ZA 4LS2A 1PS3A 2QCMA 1JF5A 5KZEA 2JKAA 3BAIA 3EDFA 2CZ5A 3UWZA 3H55A 7TAAA 1UOKA 3DX0A 3TU9A 3QJAA 1D9EA 3CPRA 3NXFA 4GO9A 3E12A 3EB2A 4WY0F 4H6KA 3G1DA 4NJHA 4RK8A 4M6VA 4HPHA 1F05A 2QCEA 3L21A 4L4LA 1D7FA 1MEWA 3NQCA 5F7UA 2WV8A 3I7RA 3PB0A 3MP4A 1F6PA 5E6YA 3TOPA 3OLDA 5EY5A 5KITA 1TV5A 2EO7A 5I0DA 1K02A 4UQBA 3GAKA 3LHWA 5HWNA 1JI1A 5HQEA 1FCUA 2XFWA 2O7QA 3DX4A 3N2MA 1W31A 3P82A 4HPJA 5AOUA 3GX9A 2CZFA 1ME8A 4TU1A 2F7OA 1RPXA 3KL3A 3RU6A 4ALDA 1V3LA 1H7OA 4O1DA 3LDVA 1OHLA 5A5WA 3CEUA 4PSPA 3E0IA 2PURA 1PZ3A 4WD0A 1N7KA 1DQXA 2DORA 2ZZ6A 3PC0A 3IEBA 5FF0A 3BCFA 1KGUA 3P84A 4A29A 1Q6QA 1PHWA 3LCHA 5KTLA 5AYYA 2A7RA 1G9HA 3USBA 1Q45A 4OE7A 1KLZA 1ME7A 2DJLA 2NV1A 3JS3A 3S2CA 3SR7A 4HOZA 2QDGA 4O18A 2F7PA 2OMAA 3PBVA 2GUUA 4CCEA 1QAPA 3ABRA 3GZ3A 4ATWA 2CW6A 3M5YA 1H7XA 1PZ2A 3WNPA 2QEZA 1P0KA 4U2ZA 3KRSA 2Y7GA 3PUDA 3HGSA 3UPWA 3PG9A 1JL8A 4FEZA 3UWUA 3EKZA 3KX6A 4K7YA 4H3DA 4O1AA 4ZL1A 3VO0A 3R8RA 3W1UA 1I2NA 1QOQA 1M53A 5HNRA 2A21A 2EAWA 3LTPA 3QMRA 3LCXA 1KTNA 3TTSA 3OA3A 2EQDA 1LLZA 3U2OA 1KXQA 4JGDA 4YLWA 3C2EA 5C55A 3N14A 5CGTA 1E40A 1VGAA 2Q3OA 1VFMA 1QPRA 3MP5A 3K1DA 2QUTA 2B7OA 3A47A 4N4QA 3W2JA 4UQ9A 3GDRA 4Y8FA 2ZX9A 5A2CA 4BWLC 1W3TA 3FKRA 3W2LA 1GJUA 3DHUA 1KV8A 3BVWA 3NQAA 3CU2A 1XH1A 2FHBA 1BKSA 1LBFA 1QNVA 3CQ0A 1SR9A 4UXDA 1MEHA 4PEKA 1GVFA 3GLCA 1G7UA 5CG7A 3WEOA 4Q4KA 3GBDA 1TPC1 3D50A 3FKKA 3CT7A 3ZFHA 3SY5A 2W79A 3P62A 2FPYA 4H8UA 3C3NA 4FF7A 4MOZA 4O4WA 5I3JA 2FJKA 3EX2A 4AF0A 3DHFA 2ATSA 1TRIA 1PVNA 4DO5A 1AK5A 2C0AA 1IZKA 3VGFA 3GKFA 3GDKA 4GXMA 2BHUA 3GK0A 1KM5A 5EMYA 2Y6ZA 3ZT6A 1JXKA 1TPDA 4MZ8A 1IIHA 1HL8A 3D52A 1K7EA 3UCQA 3DENA 3VX0A 5EL1A 3S6DA 2F7RA 2QKFA 1H50A 3BPWA 2ATMA 4AXKA 3EWXA 1UUOA 4MFEA 4O14A 5U7SA 4P2VA 1J0HA 4HN4A 1OJXA 2QCHA 3W38A 1EUNA 4JTUA 4JFTA 1ALDA 2E77A 3NQ7A 1FWTA 1JI2A 2Y62A 4DEFA 3DX1A 3VNZA 2OJPA 4I7UA 2ZXAA 5DCBA 5D37A 1KM2A 2TAAA 2ISWA 1LYXA 3GIYA 5U4NA 4BFAA 2JBMA 4IMDA 4NX5A 2C19A 2OCZA 5KEZA 3BLIA 5FEWA 5C54A 3ECQA 3M0ZA 4NZJA 1SPQA 3W1NA 1GJWA 3THAA 3WK1A 4GO8A 1EIXA 5FF4A 2WPGA 4IOTA 2EEXA 1SO6A 3HGOA 5E70A 4NT0A 3EDEA 3DH7A 2GJPA 2ZICA 1MFUA 3BLPX 1KTCA 2VOMA 3NO5A 2E8YA 3L4ZA 4JDBA 2VFFA 4I7WA 1LRTA 3G18A 1BSIA 1WP6A 4ZQNA 1OSEA 4O28A 4Z0JA 2ZRVA 2GJRA 2ZUSA 4FLRA 1EEPA 2YA1A 5AHNA 1SO3A 1WOBA 5AC6A 1P5BA 3M6YA 4HSNA 5H91A 2Z6JA 5HUPA 2E6FA 1O60A 2WSRA 1UD8A 1O95A 2QCCA 4UTIA 1SMDA 4OGZA 2X1SA 3EXTA 4HT3A 1EB3A 4AB4A 3LI1A 1XKYA 1AG1O 1NM9A 4UIOA 1LOLA 4S2BA 3TXVA 3KVJA 3WFZA 2QMKA 3ZR6A 2D73A 2E8ZA 5BW6A 2PRLA 5HJLA 1JCYA 3L65A 5CKSA 3C0JA 1EA9C 3LPPA 1TREA 3QQ1A 1GG1A 1OFAA 3DC0A 3AMKA 1QCWA 3LXBA 2JK2A 3ZQ9A 3HF3A 3EJQA 4WSJA 3B0VC 4PCTA 3SGUA 3NQFA 1E3ZA 4DELA 1UASA 2EACA 2YDAA 4NUWA 3BW4A 2JGQA 2XVKA 5EA9A 1WYIA 2E09A 2VKZG 2CPUA 4FNSA 1LM1A 5D04C 3M5VA 1SZGA 3LRLA 1QPQA 3W7GA 4FLOA 4AMAA 3M7WA 5KMYA 1RV8A 2BXVA 4LY8A 5LHFA 5D09A 1AW5A 3QFEA 4H8VA 3IK2A 5HXMA 3BVTA 3E02A 1MEIA 3VI2A 3AXIA 1EP3A 2CLOA 2BY2A 3P7YA 3L2MA 1T99A 2YX0A 3LGEA 1VAHA 3PS7A 4CGTA 4JFSA 3WNMA 3FW6A 4JX5A 1DJNA 2J25A 1GJPA 2D0FA 2AQWA 1G67A 2I1OA 4MY9A 1B0IA 5HMSA 2AGKA 1H7WA 3WENA 4XKYB 1KGWA 4XTIA 4AEOA 3CV5A 3DZ1A 2J9YA 3B4UA 1NFBA 1FXPA 2ZRUA 3ZWTA 2EADA 2ZDRA 3NM3A 1EHAA 5ABTA 4FLSA 1QPNA 4TVUA 3BUDA 1O5KA 2A7PA 4UCFA 2B7QA 3W7LA 4WOQA 4UNKA 4TMCA 5G2HA 5D38A 1NVMA 1EP1A 3FS2A 3GNDA 1KBIA 3LX9A 4D2JA 1XUZA 2ZTJA 3EWZA 3L4YA 1NOFA 3LERA 1MVYA 3LXAA 3W6YA 4AWSA 4E0CA 1KXHA 2EPHA 3DDFA 4UFHA 3NPUA 5E9AA 4J3SA 2DJXA 2LLEA 4KMQA 1JUKA 4ZMGA 1J0IA 4RZ5A 1ICSA 1TTPA 1VZWA 3T7VA 2TYSA 3BLFA 2Y7DA 3P8IA 1KV5A 2WNWA 2WOQA 4U4MA 1DEDA 2OW6A 4JTFA 1TCMA 4X9SA 3OLGA 1KBBA 1OFEA 2WVVA 3S5YA 4LVAA 4AW7A 5AHLA 1SQ7A 1KXVA 3G8RA 5EBUA 1YDVA 3TXZA 1Z44A 4XZ9A 1YPFA 1BVNP 3DX3A 3W7JA 4EF8A 3TSBA 3LHTA 4NNBA 3BMWA 1K8XA 1TPWA 1VQTA 3TIMA 5LKYA 4FIQA 3TAKA 1TJRA 2C6QA 5G2IA 1W3NA 4G1KA 3WY1A 3BUBA 3DI1A 4LOCA 3TROA 4AHOA 1PEZA 1EUAA 3VX1A 2ZRXA 1T8XA 3GXMA
chains in the Genus database with same CATH superfamily
5HBBA 1W0MA 3U1PA 4MUPA 3LDBC 4H40A 4W85A 4I18C 4FA6A 3CN1A 4EPEC 3BRFA 4WDTA 3WAJA 1HSBB 1XYFA 3HNVL 4P59L 3Q5TA 4CCCA 3SBWA 3UG3A 3EOUA 5KTEL 4PJCE 3NO1A 2BSRA 4HMNA 5MF5A 2IAMD 1LL4A 3E0FA 5ABDE 2H3BA 4Z2IA 3FJNA 4MJZA 2JTYA 3TO4C 5IROC 2A38A 5IFJA 1WCGA 1B88A 3BDYL 1XLKA 4F9PA 1M6OA 4B9JA 4R97B 5CHNA 2JB6B 3W1TA 3IJ8A 1PV8A 3GIQA 1GVEA 1MFEH 1YEDA 2EECA 4N0FA 4ADJA 4E5XG 5KS9A 3GHBH 4OHQA 3AS3A 4LCYA 4X99A 1B3VA 3U0WH 4P4KC 1VRDA 3QFWA 1IQDA 1FO0L 5CZVH 4PP1C 4AX3A 2ZUNA 1BBDH 1UGNA 5GSRA 3ZE1B 3GGWB 3PIQB 5BNKA 4RGNB 3FT3B 3QO0B 4XO5A 5IMLA 1HCVA 3IJ9A 5DK0A 3BZEB 1YXDA 3CWNA 3ELQA 4Y4FA 1ZHAA 5EU6D 1PG7W 3BKJH 4OM1H 1NWSA 4FZ8L 3C5QA 2V9TA 5AVYB 1S2VA 3PPFA 4N42A 5DJZB 4IJBA 1ONWA 2WNGA 1FPTL 1W8EA 5C2CA 3S3SA 1HDMA 1AP2B 4HCGA 4HHAA 1B4JL 4LSPL 4TQEL 1H62A 5FD0A 4DWSA 1SPDA 2NX5E 5FW6A 4GP8B 2RH0A 5LNWA 2DQFA 4LQFL 3TCLB 1IGFH 3ZDYE 1SZNA 4XZ4A 3PY2A 1OARH 2J4WL 3CZNA 4AVIA 3AHXA 1P9MC 3UGRA 1BAWA 1KV7A 1XF3B 2DBLL 8A3HA 1UA3A 1KZQA 1QI3A 1FYHB 1VJIA 3AWNA 1CCZA 2HMCA 3LCGA 3SN1A 2RKXA 5HHME 1UWIA 3VIOA 4PBVC 4U05A 3WFHA 1TSRA 3SGGA 2VFEA 3UAJD 1WSST 5G2NA 1MQKL 1X5MA 4N6RB 3EOSA 5JH2A 2QDEA 1PLGH 3VG9C 3G3DA 1L3WA 3WMSA 1CC3A 4WY0A 3W6LA 1QRNE 1ROCA 4MGXA 8XIMA 5DJAB 3V0DA 3KD4A 1UM4H 2EPLX 3GTHA 4ZVJA 2O5YL 4MM1A 2X7LA 1OCJA 4WW2A 1OT1A 2NY5C 3CFBB 5I1IH 4XIMA 3UDWA 4AX6A 2DIKA 4U1JB 4QO1B 3MUGB 4N8UA 3KPSD 3QPKA 4LC6A 1AD9A 5E93A 5JOFA 3RE0A 4B9YA 1H5VA 2DQEL 3K8KA 4W84A 1QW8A 3LKOA 3UTSA 1QZ1A 4NO3A 4RDYA 3VYLA 3MVSA 2Z1SA 2WSKA 4HQVA 5LNRA 1O9WA 1AFSA 2EE3A 1P1ZA 1ETA1 2F54B 4M02A 4XGZB 2R7EA 3O4LE 5IB5A 1F6AB 4XUGA 1BWWA 5D4YA 5MEQB 2R1NA 2VDNH 2VSCA 1GS8A 4GIOA 3FEQA 1HC1A 1XGYL 2G5UA 3IGFA 5DX7A 4HJWA 5AUMA 1NAKH 4J12A 2NXIA 2J6WA 3LQZB 1ORQA 1E9PB 4FTVD 2XH4A 3HURA 4W6WB 4LAOA 2IFFL 3HA0A 1QUMA 1F8TL 2FO4A 3ARPA 1Z6JT 4IMLB 4P5KA 5E6ID 4K1GA 4UQEA 4AEIH 1WWAX 2BVYA 1K2DA 5FB8B 2DT3A 3IIXA 5FJRA 1BJ1H 2WBJA 2Z1WA 2JJTC 1JSYA 4Y5YA 3R10A 1W6TA 1M7DA 2YD9A 5DYFA 2ABBA 3CUPB 5HUOA 4WHTB 2RDWA 5LNGA 1F18A 4FFWC 3QDMA 2WOYA 3CFEB 4L23A 1C5DA 4FJZA 1VS1A 1WYJA 1JNNL 1J7VR 1J2BA 1RURL 2Q8BH 3VXQA 1FFPA 5L8LB 4QBXA 1OSPH 3PL6B 3EO0B 3GPEA 5F6HI 3JXAA 5IB1B 2BP0B 4D3CL 2VX6A 3SN4A 3SUUA 5HYFA 1KT2B 3KOZA 1MKFA 1OAKH 3IWVA 3CMFA 4EVNA 4P5TA 1PDKB 3FVMA 3WD4A 4N90E 2X09A 4HAGA 3X3GH 4EZJA 1OQOA 3GVQA 5FOOA 3B3DA 1T1WA 1RMFL 1AMYA 4E36A 5IUCA 5E5MA 3BP4A 4MJMA 5A6IA 3A24A 5K4XA 4RDQF 2D24A 2REQA 1FZOA 3RM4A 2W63A 3BSZL 1OGAB 3MLXH 2V3GA 2DRUA 2XH0A 3D69A 3H42H 2ZX6A 4XZUA 3KYNB 5LNVA 3IGSA 2DQXA 2QULA 3R2GA 1NGXA 4IQJA 3GAYA 2P8CA 2J7CA 3GC2A 3S47A 3H2PA 3CIXA 4ZXBA 4DGIL 5E08L 3MOBH 3EO9H 3NZ8B 5DD0L 2HTMA 5E09A 3RWFB 1CYXA 1OY0A 1EZSA 4ZS7H 4AQ1A 4P2RD 4O15A 1ZBWA 2ALDA 3TN5A 1ACYL 4G8IB 5BPPA 4LB8A 4HT1L 3VACA 3SADA 1SBSL 3T0DA 5LA1A 3QUMH 4Q8TA 1CZ8H 1HL4A 3UZXA 1VGKB 1UP0A 4LALA 2CA3A 3UR7A 3QR0A 1W5QA 3VD4A 2EEFA 5E0CA 1I8AA 3KW8A 1BMWA 2O9TA 1JWUA 2NV9A 4R85A 3QFJE 4ZUSB 4E9VA 1E0UA 2JH2A 4NJGA 5MEQA 3TVMA 3VFOB 1YEKH 3TC9A 3T05A 5F70A 3RO8A 5L0QC 4KPHL 3ULUH 2DT0A 1UCBL 4NNPL 2YARA 2PB1A 4O0ZA 4B90A 1X9LA 1CT5A 4LLUB 2WP3O 4KO6A 1A3LL 5EO9B 3VFWB 1FZJA 2CO7A 4JY9A 1FZMB 4MNQA 3O9WD 4W70A 1C92A 4LUTA 2DQJL 2A0LC 1TR7A 4AY1A 3KWTA 2KDYA 1GOMA 1RCOB 1EWEA 3HZKB 2X7LB 2X4NA 3I6LD 3FT9A 1BECA 1NAKL 1XF4A 5LAXB 3QMSA 1WA0X 5DXYA 3U30B 4F2FA 4QHLA 4OQTL 1VKXA 3EYVA 1JZGA 5F2IA 5CEZD 2VC2L 1Z5LB 5L88L 2BV9A 1VYSX 3IPFA 2R1LA 5C0BA 4A8RA 9XIAA 4NYLA 1Q5MA 4WJEA 3IDIA 1DN0B 4HZ8A 5G2WA 3VQ1C 1S5IL 1CGWA 2AJYL 4KFPA 3FCUB 1RAMA 1UYWL 3FSWA 3GDCA 1T7LA 1A4BA 5G5IA 3P4NA 4ZOCA 5DO8A 5C08E 5MERB 1N67A 4B3EA 5I0WA 3CT2A 3O6DA 4WK9A 4KH2A 5EFIA 3NGJA 1Q2RA 1C16B 4YE4L 1ITBB 3NEOA 2DQGL 4S39A 1E5YA 2JJVA 1WBYA 3MROB 4D0DA 4JCMA 3EA3A 1MEXL 4FLQA 4UV7L 1F02I 2TSAA 3PABA 3BCJA 3FB8A 4U33A 4P06A 4V11A 2YUZA 5B3JE 1G1OA 3GRIA 2D9QB 2HFGL 1T0MB 3MRKB 1REQA 4G6AC 5EFDA 2CLRA 2Y7EA 1ICQA 1HHJB 3Q01A 5CS7A 4LLYB 5FK9A 2A9BA 3R8GA 1RLDA 4FD0A 3INUL 4EF9A 4N9OB 4MASA 2FIKA 1EXGA 2UYLA 3IDXL 3PBUA 1HQRA 1QBLH 1CLVA 2HVKB 4EI0A 5DJZA 3W86A 4HUXB 5BUAA 4I0PC 3W2KA 1ZT4A 3D5HA 3I65A 3GNRA 4AMCA 1X7TA 3UYPA 3UBXB 3LHZA 5BXRA 2NR6C 2QFRA 4FQPA 4OV9A 2PDWA 3WUGA 4M24A 2QGCA 4M7TA 3W7KA 1EFXA 4C4UA 4YL2A 1TVHA 3NO3A 3GS6A 2F8IA 3EZ8A 4UTBA 3TPKA 3V0HA 1TWZA 4EDXA 4Q6IC 4QRAA 2W60B 2KDGA 1J10A 3PZIA 1ILUA 2UXFA 3HPJA 3QUYA 5IHUL 1J5IA 1MFCH 3KPRB 3E1ZA 3OZ9L 1NCAH 3SKOA 1E2VA 4AGOA 4DQOH 5A6LA 2PMQA 2VLKE 3AS0A 2OZ0A 3OG3A 3W70A 4B15A 1J96A 5CU5A 5FJIA 3BZFA 1HSAA 4XP4L 3T77B 4U7MA 3ZTCC 1JYVA 4AUJA 1E5ZA 4EUPG 2AMGA 1X1ZA 2WO5A 4KRPD 2Q01A 4HJFA 2CFFA 4KK6D 2XKNA 1W1B1 2MANA 3QQ9C 3RL2B 1EHNA 1FNEB 2P8PA 4DP9X 1E6OL 1UROA 2ADYA 2VENA 1JHTA 1KJ3H 3LPGA 1DQKA 2BH0A 5HULA 1H11A 5IW1A 3LB6C 2V81A 4QKTA 5GS0H 2AS5M 2QFPA 3IE9A 2YPIA 4M5ZL 1E90A 2V3DA 2VLJE 1UWAA 1KCKA 2YBRB 3D39D 4D8AA 4OLYH 2H1XA 5E8OA 3VH8A 3A6CL 2G3XA 4QAWA 3CXHJ 5F7DB 4N3UA 1E6ZA 5A95A 4NI6A 1J2WA 4IOFD 4S38A 3QR2A 1AGDA 4LAQL 4V1DE 3CIVA 4QHRA 2ZKHL 2E1DA 3BZ4A 4MLSA 1E0OB 3G5VA 3B0XA 4DWSC 1J8HD 1Y65A 2OR7A 3KPMA 4AXWA 4XODA 4L4MA 2WY3B 4B5SA 2NQJA 2HSAA 1YTDA 3B3BA 1FJ1A 1NLDH 5I18L 5HR6A 1CL7H 5EULV 2X4PB 3T65B 3A6BH 5FGCE 1MLCA 1TZAA 2IALA 2YN3A 4N22A 3FCPA 2WQUA 2FBRA 1MXGA 5KANG 3U48A 3UJSA 4L61A 2QSTA 4XPTL 1W72L 4DUOA 5HYQB 3VKDA 2GCYB 4MCYB 1OBAA 4UAOB 3H0TA 1GOKA 2VERA 4OLZL 3GUWA 3NIFB 5GRUL 2BNUA 2DW5A 2F5BL 3SDXA 2PWVA 4KI5C 9PCYA 2ICWA 5CIPH 2OJZL 3QZWG 3U30C 3WHXB 2YUVA 5A6SA 1T0NA 4QLRA 1M01A 1NDVA 1AYOA 1ACYH 2GFTA 1DVFC 5GSVA 1S3TC 4LX4A 3NACH 2WVUA 4KVPA 1VYPX 1QX1A 5FFOA 3GVGA 4UQIM 3QXWA 2NZ1A 1TE1A 4O1BA 2W07A 4IIEA 3ALFA 3NTCH 1N82A 2EC8A 5C0GA 2H3NB 4M93B 3VRLE 1FA4A 4X5RA 1BYDA 3F5WA 2EDBA 4QTGA 1EZLA 1ZSHA 2K8MA 4DGWC 5GS2D 2HKHH 1C8VA 1DYZA 3LZLA 4FQQA 1EJ7L 1V6UA 3BWSA 2HKHL 4NJ9H 4WSKA 2EVFA 2DW7A 3EJUA 3X11B 5J8OA 3FBKA 4PV8A 2QCDB 2H2PC 2X28A 3BEVA 4EI5A 5LNDA 5HGAA 3GTFA 3MNZA 3X2QB 2WCAA 1BZ7B 4YJ5A 3A4WA 1G6RA 1R1CA 1ZIBA 3ETSA 3F2CA 5AAWC 2D7TL 5TE6L 5IR1A 6FABL 4WU7A 3FJTA 5H2BB 1MLBA 2PC4A 3MTWA 3SCNA 1F5WA 4J5VA 2WVSA 2RTTA 2NUTB 2CH8A 4CL7A 2PTTA 3GSWB 5LXGL 3GY1A 2VFGA 3MJ9H 1AS6A 1OEZW 5JDSA 3RQ3A 1BD0A 1G94A 4QRTB 3W0WB 1UZ4A 1GW6A 1CGSL 1GYWA 4G42A 4YNYA 4A3HA 3LD8C 1WTLA 3HUJF 1IXOA 4JPWL 3WF4A 1ONEA 4HS6A 1FRGH 4US5A 5KYNA 3DFNA 4H6RA 3LG3A 3IE4A 4JRYB 3II3A 1VCVA 4GUJA 4TS6A 3GBEA 4F9LA 4DKDC 2EIZB 5LSMA 1DR9A 4M3PA 5JQHC 1KPUA 5M17A 4BQ3A 1JYWA 5B8CC 2VRAA 2QPUA 2XXCB 3SE3C 2QJJA 2GITB 4LUIA 4AQAA 4JKPH 3VGHA 2X0HA 4KNSA 2DS4A 2FYMA 3QHNA 1AGFA 5HI5D 4BQ9A 3PULA 3U6RA 2H6PA 1M7PA 1OKEA 4G6JH 5TDOB 2XPGB 5F3HB 5IY5B 3MLSL 1QSED 1I75A 3N6QA 1TYEB 1FL5A 5AZ2H 1EO5A 2NV2A 1A7QH 5FKYA 3G6DL 3ARUA 4FOKA 4EAEA 1U30A 2ENPA 5EH1A 1E72M 3VNIA 2XKUA 2IGTA 2GSIB 2VDKB 1LUCA 4UR9A 1RQBA 4LUSA 4YPGB 1A7NL 3T07A 2PBGA 1H63A 3GSOB 4R7VA 2VMEA 2P5PA 4KKPA 2JMRA 3PZGA 3QYNA 3OZPA 2QGYA 3WLBA 1JERA 2XWZA 4X4YA 3RVVD 2VR2A 2FD6H 2HLAA 1EGMA 4GMSH 2JF6A 1DFXA 4OD1H 4RW3A 5DCEA 1IR1A 4HUWA 4X80L 4RISH 2RALA 3RY5A 1E5CA 4AH7A 3DBNA 1OF8A 4IMKC 2X1PA 1M7IA 4MB1A 3R8BB 1BJ1J 1E1FA 4OBTA 5DQJA 1WFUA 5C9XA 1C9DA 4C56A 4WEMB 2AQQA 2WLYA 4NDMB 1K4DB 3OZKA 3WF2A 4FXGB 4X9GA 3TNNB 3P30H 1TLMA 4FQXB 4YHOL 4L8SC 3PWPA 1EVUA 3D2UD 4LRTA 1XZWA 4PJHE 1IM9A 2Q8AH 4Q33A 1XF0A 3DUSA 2YRZA 3SKJL 1ECZA 4FQJH 5D2NA 3TFKD 4F0LA 1F6FB 3L9BA 4OZHE 5I66B 1IL1B 1BFVL 2IWKA 2DLFL 1GZPA 2P5WD 4ODVL 3QZPA 1KB3A 1KIUA 1ZT1B 4P3CL 3WS6A 1GZGA 5D2TA 2B59A 3JV0A 4GAYA 4QIRA 2WLMA 1ANUA 5CSGA 3FSZA 3Q65A 2OYKA 1AZVA 3MJMA 1U8NB 3IANA 1KXTB 3QJOA 3LMZA 5MP6H 4I0PA 3NH7H 3KLKA 3B8DA 4OFDA 2VUKA 3LKPA 1R0MA 1O5DT 5C6TH 2PP3A 2NYYC 1JZJA 1L2QA 3DPDA 4OJYA 5CKAA 3BQUA 3U9IA 2GQ8A 4ELDA 2H41A 3QEQA 5CNHA 4HQQH 4GBXC 1LP6A 1AIZA 4BZ2H 2LVCA 1ML1A 3QNYB 1P43A 2MNJB 2UY2A 4UWMA 3QUZD 2XSAA 1XIWC 4RZCB 3P0XA 4O19A 7REQB 4QDWA 1Q72H 1YQ2A 5IHRA 4F7KA 1XGDA 3QG6B 3SKUD 4ELKB 3CDZB 2VXSL 3FN9A 3IRZA 3RFZB 1QBAA 4K3JH 3UEZA 5JLZB 3MJ8A 5MHSE 3STGA 4YXGA 1DSFL 1NOLA 1K72A 3BYTA 1IILE 1F4YH 4ICXA 5TK2A 5IB4B 1WA2X 4JPKL 1VDGA 5EUOF 3GNNA 4RDWA 4YE0A 4XWGH 4JNZA 5MENB 3W22A 1EDHA 3DVNB 2CEQA 2YPLB 3BT2H 1RD5A 2DBJA 4D6CA 2FKPA 4C47A 4DO6A 1CXFA 4U7SA 1BJMA 4I4WB 1B6UA 4OGYH 5K1JA 2ISVA 4RX0A 4IRSB 1EEYB 4DF9A 2WGXA 3UWEA 3LXCA 4BRJA 2XXMB 1WV2A 3DGRA 2Z91B 4LDEB 4WW1B 2XZZA 2OSLB 2A79A 2AEQL 3IDUA 4OUEA 3V16A 3V5FA 1GOGA 4O1EA 1J93A 2Y3AA 2FO1A 3KOXA 4IU2A 1HHGA 4KZCA 4QRUA 3KM2A 5ICYA 5I7GA 1NEZG 4DRSA 1NANI 5I6MA 1XLIA 1QNOA 4C6PA 2VAAB 3FC8A 2E4TA 4JNMA 4G5ZL 1FFNB 1GYCA 2D03H 1IQ8A 4GP4B 2FT7A 3MRDB 3DYOA 3LMJL 1IEAA 1QEWA 2CK2A 1OB1B 3RAJL 5KYYB 1UWQA 2Z3FA 2I17A 5IQ7H 1K70A 1ZFJA 4FFYA 2J8TA 3DVGA 2OT0A 3I7QA 4GKZB 4U1IB 5FUCE 1J8KA 2YWZA 4Q9RH 4GX9A 3KPPA 2FJFB 3SRDA 4FXGC 2JSFA 3W75A 2X2IA 8TIMA 2NQCA 1A3RH 3KPNA 1BVKB 4UTBH 4AZUA 4N20A 1F61A 3DCPA 4FR6A 1WC7A 3VA8A 2NQ3A 1S9YA 1E1CA 3QOKA 4QY8A 4PI2A 1ITCA 3NQKA 1CURA 3Q1SH 2Y5JA 2J5WA 4GYKA 1BX2B 4OV4A 4J4KA 4C6OA 1OHZA 3UY7A 3O3EB 5KBDA 1DQMH 4U31A 4BWUA 1UWXK 3EH4B 2W9MA 1G4RA 2CJUL 1YUKB 1TUXA 4QF1B 5AZEH 3HGJA 3VD1A 5FECA 5BOFA 3DX6B 1N8OE 1OYBA 3MLRH 4ZSOA 1P7BA 2WXOA 5I5RA 1TJMA 3MXVH 2BWIA 4DESA 5T9CE 2F6AA 1XV8A 4YIQB 2BJMH 3HI6H 3I2CL 3T3MB 3HBLA 3JWOC 1F3JB 2UZYA 2VRQA 5J6HA 4G8EA 1QVOB 5E6IB 3GH5A 4XP1H 3VOFA 1NMCB 5ETUB 3GMRA 4NZUL 2V67A 4L8DA 3MV7D 1VBUA 1I3RA 3W72A 2FX9L 4L3EE 4PJ8A 2DD8L 5KBLA 4MWFA 4FQCL 1TETL 2H8PB 4C4KT 1P7QA 1JCTA 1XT5A 4UR7A 5FYKL 3MHGA 4FEIA 4PRDB 2V5LA 3E2HB 4J1OA 4DHLA 2ZCLH 3IJ7A 2DTML 5SX5H 3T0VA 1WAAE 3L2NA 2E7BA 1K6AA 2AMUA 2V2CA 3A22A 4OGAC 2A77H 1V3HA 3TA3C 3PZQA 1Z1WA 3FFCA 1S5VA 1OB0A 2Z4QA 4Z7WA 1U8CB 5E4AA 4NQDB 4ZZFA 2FTPA 3G0SA 5HQMA 1NOAA 1J5HA 2QQKL 5C0CA 3NZQA 2F53B 1FL6B 3L3IA 3BH9B 2FZ9A 3DI3B 1K8CA 2VDIA 3ABMB 1LO2L 5JIHA 3EMZA 3JR2A 4O16A 1KEML 1E4XI 3L3HA 2BFVL 4KVNH 1DO5A 3L6FB 3PGCA 5A3IC 4ADSA 2VWEC 4HPNA 4UAHA 3RCNA 1MCKA 1C08A 1Q9OB 1DVJA 1YE4A 3S3DB 4AEEA 4BZ1H 3SFKA 1HG3A 3Q9QA 2XWJB 3DK0A 3DRTB 3EIFA 4IU3B 4JFPA 3HQOA 2DU2A 2J27A 4GVGA 1ET8A 4JFEB 3C5XA 2PN5A 3FO1B 2NLYA 5K9DA 3BPOC 4LP5A 3RVTD 1UMLA 4PV9B 2ZBTA 4TOYL 3RPBA 1LRQA 2DQUH 4IJCA 2AKMA 4F7TB 3I6KA 1EKOA 4MWAB 4WIWA 4G82A 4JEJA 1A65A 4MYPA 3TU6A 2Y89A 1ONQA 4H25A 1KLUB 4ENLA 4WJKB 2V3EA 3K2IA 1TU2B 3U2EA 1IWAA 3ARFC 4NRRA 1NA8A 1NMAH 2OTPA 1J1OH 5J12B 3LM7A 3SDDB 1ED3A 1JNLL 1S9WA 4U6XB 1IFGA 3ILQC 1Q6EA 5BOZG 5CP3H 5FDWA 1J0YA 3V5KA 1PUDA 2G2PA 3OGVA 4N2EA 3B7YA 2OK0L 5FKAB 3HIJA 4KEVA 1MUMA 1BEXA 3WQFA 2WHKA 2VQ1A 1EDGA 3WS3A 4JQ1A 4ISVA 4BKSC 3GPSA 2FGLA 1O1HA 2UZ9A 2V5TA 3CZJA 2HJKB 5EU6B 3SD2A 5BV7L 1S39A 2OX4A 4HIBA 4AZ8A 2XSKA 4X60A 3AUWB 4ZW6A 3RJQB 4QLWA 4L3AA 4JFWA 4PJAA 2AABL 3ARGC 1OQFA 1YW1A 2YSWA 1CDIA 4CCDA 1KFJA 3QGAC 1NCJA 4X6EB 5IHZB 1M7UA 3H3PH 4TNGA 4B95C 4LSPH 4TQEH 1JN6B 3AM8C 5BNXD 2VLJA 1CFVL 1JUFB 1WCQA 3HIZA 4WEBH 1IAOB 4O00A 2H32H 5T5NF 3ROLB 4HC1H 1Y6NR 4LE8A 1M9HA 2Z25A 2W62A 3P11L 3ZLFA 4J23A 2YZ8A 4Q2ZB 5JOPE 1QZNA 4J4PC 3RPIA 4NKOB 4D0BA 3O6AA 3GI8L 2FPTA 3HTLX 3B9NA 3QAQA 1JNHB 3GMOA 4JTSA 1V7NH 1AGCB 1BZ8A 1F2QA 2AP2A 1M05A 3HRZA 4L5FL 4DW2H 4KQ0A 3PWPE 7TIMA 1VZIA 1RJLA 2H32B 4JS3A 4CNNA 2XTSA 2QDWA 1N10A 1FXQA 1RUQL 4YWGL 4Y96A 5H8UA 2GW5A 4W9HC 5FYLL 6CGTA 2FX9H 3IXAB 2FJGB 3OGCB 3SOTA 1Q1JH 5LQBH 1K1DA 5FJJA 4WR3A 3MRCA 2QV4A 2NX9A 4K4KA 3SPVA 3VFPA 1IGIL 2FL5B 5DHVB 3AIBA 4S1QH 3NCYS 1THCA 2E46A 3KPQB 3L5IA 5FA4B 2EPKX 3U0TB 4AZ5A 2NQHA 4IJTA 4OZIF 4WUUE 2FQEA 2LLLA 4D9RE 1DQIA 1UEYA 3RRQA 4F7CA 2WXIA 5F89A 1VHCA 2BBFA 3GBNH 3HOGA 2L4OA 3MLZL 4LKXA 3T6ZA 3NQGA 2QHLA 2LFEA 1OINA 5AYZA 3IPEA 4NY2A 5DD3H 3V0EA 1PLCA 1DTNA 4AXNA 4BF5A 3P74A 5I79A 5LIUX 2VX5A 4QWWC 5DZLA 3DX8B 3HI1A 3Q6FB 2PPGA 1E8ZA 4JFQB 5ESQB 4IGBC 4IOIA 5DRZB 1F58L 3T2QA 1DVYA 3BE1H 4L1GA 3TLLA 1DQVA 3BH4A 3JWNG 4L8SA 2W94A 25C8H 4E9XA 2ENJA 1BD2A 4XTDA 5B38G 1A5CA 1GYVA 1VFBA 4JM0A 3GSRB 1GTFA 4B2DD 2VSKB 2BIPA 4BFFA 1QR7A 4O02H 2AHIA 4UV4L 2KT6A 4HZAA 4NN5C 4DVRL 1QO2A 3MWAA 4IFKA 1J5OL 4NQXA 5GS1A 1QR1A 3QW9A 5ESAB 3E0GA 1KCWA 4X6DE 3WJJA 2BB0A 1B4RA 2Z7GA 3BDXA 3NPXA 5HHOD 1BXAA 1N6VA 5INCA 2Y25A 1E5BA 1BQLL 1NDTA 1R5WA 3VNMA 2PDMA 2XZQH 4XO8A 3TH4T 5LWYH 3O8XD 1HJQA 4PJXA 5GVJA 2PKDA 4PR5A 1ZJBA 1EBAA 1GOWA 2OMXB 4HJTA 2XN1A 3EPOA 5CMAA 4B91A 3R4RA 1TZHB 4PJ5A 2B4CC 2BLFA 1GGCH 1E5AA 3RX7A 1EF3A 4F3FB 5EF2A 3NL6A 1GCYA 2B31A 4LYPA 3PV7A 1PKNA 2Z2BA 3LH2L 1KBKA 4ISVB 1UOZA 2QUNA 3KXQA 1MUJA 3WFDL 4QNEA 3RCYA 3WD5H 1TQBB 1DDHB 2BVEA 3HMWL 4LNCA 3NQIA 3W3BA 4O10A 4J3XA 4YDMA 3IV3A 4N26A 2QHRL 3CLEL 4US6A 3VWKA 1WT5C 4MMXA 1UCBH 4GG6A 5I6KA 1M1SA 1RHHB 3QFJD 4DAGL 1DE5A 5I16B 2B1OA 5BJTA 4ZFOL 1SDAB 1ZS2A 1E4WL 3ZMEA 5F3BB 2H8XA 3TJLA 3CNKA 3TSMA 3S8FB 4UTUA 4GVHA 3FHAA 3ULVL 2G5BB 3MRIB 3C6SA 3GMMB 3VD5A 2BZDA 2FATL 3VGGA 3Q9PA 5DEZA 4PV9A 2ISDA 3RWCA 4ZAKA 4LAJH 1XM3A 4KNTA 3FO1A 1USZA 4HLZG 4J3OH 1NFPA 4GG9A 2IPTH 4Q4QA 3BW9B 3E2SA 4I9JA 3JUZA 4M62L 2WOBA 1V6YA 3RL1B 1XG3A 1JV5B 2VLRE 2OQYA 2H6OA 3H1ZA 1HJUA 4NO0A 4P9HH 3K71A 1GORA 2OMTB 1QNQA 5I1CH 5DA4A 2WJ5A 5D30A 4U1SB 5D1QA 2WN2A 1R2SA 4HTYA 2ZADA 2R9HD 1H5YA 1R75A 4DZ8B 4DEPB 3P60A 2EG6A 4GA8A 3E3QE 1AE6L 3PWJA 2J78A 1BQ5A 5F72S 5F71A 4XCYB 5T1KB 1P9MA 3T0BA 1DJGA 4EKJA 3KHQA 2ADIB 2GOKA 4LHJB 2AKRB 3HI5H 4HV8B 5D7SL 4K7PL 3HNTH 1NUNB 1RZJC 1W0VA 3GHPA 5T5NG 2B2XL 2ACSA 4Y5XA 1GTNA 1B0WA 4C1NA 5D4HA 3REVB 4KDTA 1BW8A 4Q8OA 3APCA 4N1HB 3R89A 3KPLA 2VO5A 3T1FB 5CZSA 1CZ1A 4P46C 3H2QA 2AK4D 1MWAB 5FOBA 3QQDB 5E8PB 4Z7NB 3VGEA 4PJ8B 3IJHB 4TUUA 3L1FA 2BCMA 5F0JB 4WK2B 3V0WH 1VCGA 2B0MA 2EHHA 4ZBCA 3AY4C 3AUOA 4GLEA 1IBHA 1VFFA 3VMOA 1JPKA 1ZV5A 3Q94A 3TV8A 4O50A 5A8GA 5H37H 1SEQH 3A4FA 3C6LD 3K72A 4G1EB 4P4KB 3EHBC 1ZLSH 3UBFA 1KCZA 3QQ9D 3EGDA 1TZIB 1SJCA 3ULUL 1W2PA 3GYEA 5I19L 2CIIB 4LVOB 3V6FA 1YHTA 3L5WB 1WAUA 4YSSA 2GZXA 3AIEA 2NQ5A 3GHRA 3CC5B 4AIOA 1U8LB 1R38A 1E3XA 1FO0A 5TDNB 1S5IH 1ZLWH 1A1MA 1FNHA 2IG2L 5D7IA 1DBKH 3TT1L 3MW7A 4BBWA 3DDMA 3E6EA 1QO3A 1KLFB 3DFPA 2VR6A 2I5GA 2G97A 1OP9A 2WC7A 3D87B 4KAQL 4OQTH 4U7KA 4QNPF 5I0XA 1EHLH 3KWWB 3GC5A 1EK3A 5HQLA 1RZ7H 4P0DA 4R90L 3O4LD 3PANA 4IPNB 1ITXA 4Q4SA 1YEIL 3NFNA 4KKLC 2I27N 2BGSA 3GO2A 3TFXA 1KA9F 4PRIE 3T09A 1NCWH 1KZYA 4NZCA 3NIDF 3IVKB 2ZDSA 2F74A 4M0XA 1K8DA 1P0DA 3TN0B 2BWQA 2DJ4A 3GMQB 3TKFA 1AQDA 1H15A 4XNUH 1BREA 4LF3A 3L2IA 3OBEA 2IWGA 3JV6B 2YGNA 4GAAA 1O7DC 3L2LA 4WSGA 4DZBB 3F6LA 5CPMA 1XFCA 3LENA 4MCZB 1I2OA 1Z3NA 2BNQA 3N85L 2DMBA 4XO6A 4HEPA 5D2WA 4G3YL 2PF0A 3D6GA 1ADQL 3RR4A 2A5HA 1W3IA 4EMZA 2PI6A 2EJAA 2QNEA 4C91A 2WZPA 2PC8A 4JTHA 1TMHA 4XXCC 1MFVA 4IRJB 3W1ZA 4O2FA 3MA7B 3BARA 3HC4L 2CG9X 3SGEI 3E0VA 1FNSL 2ZCLL 2CLIA 2OB3A 2KERA 4OCYH 3WY4A 4P2OA 2O6FA 5D6CB 3FCTB 3M7OA 4AG4H 4G72B 3CC5A 3MV8B 4M48L 4RXGA 4S2SB 1PE1A 4FFVC 4BWLA 2OX1A 3IF1B 2PYFA 3LEVH 3ZKND 3N18A 4ICMA 2VDPB 1UWEL 3EJRA 3I3EA 4I77H 4QRRA 2ADGB 4IRZH 3IU4L 4CC0A 3NA8A 3OHXB 3AS1A 3FOLA 3MJ8B 1FORH 3RZCD 1JPSH 4HPYH 1JRBA 4BGLA 4A2RA 3AT8A 3I9PA 4MJJA 2GJLA 2RGSA 2L3BA 4RX4D 4ZTPL 4IHCA 1JGEB 1TPVA 4I2XA 4AGNA 2NUWA 1CI3M 3RNKB 1JK8A 3PS6A 5B1JA 3R8QA 2J24A 1YTEA 3DXAD 1TV3A 3JV4B 1D2PA 2VGIA 1AZ2A 5CBAB 4KESA 4PL2A 2WBWB 4Y5XB 4UDTA 1D5MA 1H1ZA 5BRQA 3O0FA 1HL9A 1YYCA 2Q0ZX 4QQUA 5E1AA 2Z27A 3D0LB 4YWIA 1XP3A 4EDWL 5I73B 3TZVA 5DSCB 3NQBA 4NQCB 3O3DB 2HK0A 1KKRA 1AJ7H 3R12A 2DQWA 1XGZA 4GQGA 3FCSB 3UA3A 2FJSA 2K45A 1SBBA 2VZ1A 3HRZC 1UT1A 2XINA 5KINA 3O4OB 4QYAA 2MCPH 4IBLT 3KPRE 3ORWA 3S36X 4PL1A 4V1YA 1Y18A 1T21B 7ENLA 1I8MA 1UFGA 1JD7A 4IKNA 4P23A 4AZIA 1YYLH 5LB1A 2B4CH 1GL4B 2WXKA 1FFOA 5DYOB 1AFVL 3RTQC 3BANA 4OJDH 2QCGA 3HOJA 3VM7A 5CF3A 1J8HB 2X9WA 4HIXH 2H9GA 4TQTA 3SDOA 5K7JA 4P04A 3NP3A 4LVNC 4YHKL 2X3BA 1W8SA 1L0YA 3F84A 3M43A 4L4VE 1T89C 4X7DC 1H0DA 4LRNL 1LTDA 1W0YT 2MRYA 2XETA 3VG9B 1Z66A 4WV1C 5EU4B 1V05A 2UX6A 3E6FA 2WMKA 3AQYA 3QIWC 3QJRB 5TPWL 1TQVA 1RJYA 1BTMA 1CEOA 1FUYA 2VKXA 3S3JA 1W9UA 3OKNA 1IC0A 2VMDA 1D5ZA 4DERA 1HTYA 4GKSB 4H0HB 4J1UA 1RHHA 1NDMB 1GC1H 3PHQB 2ZOUA 3BN9D 4MMXB 2ZZ4A 1BVLB 1WXYA 4LYQA 3OP2A 3VXRE 2WNKA 1WFIA 3I3DA 4J3OC 4ZMZA 3F3HA 5E0QA 4J3VA 3AREC 4JKPL 5DQ9B 1KRAC 3OF6D 1SFLA 2OI9C 4WHCA 1IX2A 2ORBL 5CIPA 1NCBH 1V55B 4JRXE 5EPMA 5TQ0L 4M8QA 4X80H 2AAMA 4CN6A 4UNUA 1HXYA 1O0VA 4P5MA 2I7SA 4PB4A 2HJLA 2B5IB 3UMTA 1GYLA 1GZHC 5JHMA 1US0A 4ORIA 4Z7OB 1E0VA 4JJ5B 4JQAA 4QDPA 5IIEA 3DRQA 4B5WA 4R27A 4LT9A 4UTAL 4Y4HA 3ZY7A 3SW6A 2NX3A 4OBRA 5C09A 1XCFA 3DVIA 1XZ0A 4AVKA 3OVPA 3THDA 4C83A 1HW6A 5IHUH 1VF8A 2VR4A 3ICJA 1WJ3A 3IMVA 3L08A 2LV4A 1A66A 1EL3A 3V4BA 1ET5A 4GI6A 4ODXB 3HMXA 4FNTA 3BIKA 2UWEB 2X1UA 4AISA 3HNSH 4D2NA 2YMTA 3L4VA 4OIFA 2F2KA 2X5PA 2B8OT 1TG7A 1YBQA 1U42A 3DARA 4OFYD 4S1RL 4TL5A 3DV6B 3G3LA 2L04A 3WN5A 4IMCA 3IGXA 3VOGA 2Z31A 3LV3A 1DN2A 3HFMH 4IFRA 1OE1A 1CFNA 3GC3A 4JFOB 1GSMA 5KBNC 1PL9A 3UJTH 4I6KA 1MCNA 1P1VA 4W9LC 3N40P 2WXGA 3IN2A 1RURH 2Q8BL 2J20A 3K91A 4OQTA 4V2BA 4ZX5A 5IQMA 1CDHA 1BYNA 2E3ZA 8RUCA 2R2HB 3WH6A 1BZ7A 5AG9A 5IG7B 3AU0A 4EI5B 3KGSA 1E5UI 1B5TA 3FOKA 1T2QL 2WLLB 1FYTE 2K9FB 3K6SA 4W9FC 5G1YA 4XVOA 3KPQA 4MIMA 3KG5A 1Y07A 3PUUA 5FYKH 3Q1EA 5CJQL 4Q89A 3NQEA 3CDGB 5DZAA 2X41A 3DFYA 2RFGA 4F0KA 4WWPA 3BMVA 4IM8A 3SO3C 2XVLA 1V10A 4RZ4A 5AVZB 4Q8VA 5CZRA 1I1AA 2Q8XA 5ITBL 4UU9B 2OL3H 3HLKA 4D9LL 2P1FA 4YBLC 1T0NB 3U57A 1J1XH 4ILDA 5KVEH 1JXDA 3VC6A 4HKZA 5A40E 3W23A 3CXDH 3FRPA 4NM8L 2BODX 4PBEA 5AZ2L 2CO6A 2PBOA 2EG7A 1JNHA 3GMOB 5AFAA 3S9DB 4D0BB 4N6EA 1CJYA 3CSGA 3MBXL 1S9VA 1PLBA 4XVUD 4W68A 4BWTA 5HYQA 3FY1A 4Z2HA 1EPFA 4BSJA 2GL5A 2GVEA 4BFJA 4KCVA 4LESA 3S88L 4Y90A 3O6LL 5K9CA 3AJXA 1NCHA 4S3KA 5C0AD 3V0GA 3UPRB 2ZUQB 3HNVH 3GUTB 1ISYA 1F3XA 2PCPA 4IIQA 4PJHB 2OTUA 3CMOH 4YDVA 5DR5H 5ENWA 3F7VB 5DJ2A 5J5DA 5C9ZA 4G2DA 1UM5H 3E2HC 5DJCB 2XG5B 2HP4A 1SOQA 4QPEA 4AXWB 3CUHA 2AGJH 5CO1A 2CLHA 4TMBA 1AIFA 1HILB 2AERT 3G5VB 3RX9A 2BGQA 1LL7A 1IKNA 4UTBL 3N44B 1YN6B 4TSAL 2Y7NA 2K6ZA 4RBPH 4R4NC 3V4VL 4YQXH 1MY5A 3CM4A 3KYOB 3RCMA 4Z1DA 3SCWA 2OMNA 5T1JA 3MY9A 3HG1E 1G1KA 2X1RA 4HK3N 4HXBL 4DEPC 1SUXA 1JMZA 2WO3B 3VH8B 4A2DA 3RAJH 5BZDA 1TMLA 3K4ZA 2DKSA 2YBRA 4U0QB 1ZENA 4A7GA 4AY7A 4LVBA 4XMWA 1GOIA 4X7TB 5EIQA 1GAFH 3D4CA 2FEDD 3V6OA 4AMWA 1A4CA 1S1PA 5ADOH 2JKPA 2XPKA 4N2OA 1LBLA 1FUNA 4LBAA 5F7LB 4ZNEA 4HBCL 3RL2A 4FNPA 3AIWA 5L6YH 5JBDA 35C8L 2DZBA 4TVDA 4FMVA 1VCFA 3GTIA 2V9DA 1A6TB 3HW7A 2RDUA 1RK7A 5REQB 2BWDA 1YCSA 2ATPA 4MA1B 4BKTC 1DJZA 2WLIA 1IT0A 2QDDA 1E4KA 2ADFH 1LLOA 3GXUB 3JWDH 3ETBJ 4RSVA 5E9NA 1V79A 3TX9A 3CVIL 2H0FA 2ZRYA 4AEHH 4U0RC 4S1RH 1RR2A 1JPIA 2BDNH 3HPJB 5LIWX 4Q56A 5JW4Q 4A05A 2UY7B 2B7NA 5DS8A 3RUGA 1W15A 1KM3A 1W5MA 3NZHL 5C08B 2ZOOA 5LCVH 3CE1A 3UPAA 4EDXB 1ZAIA 3G04B 3QJFB 1FL6A 3L3IB 3MPGA 4PRWA 1KCSL 4ZB2A 4W81A 1LP9E 3IWUA 2R2BA 2D2OA 3EFDH 4RIRA 4QITA 2Y69B 4Z7WB 1MZYA 3PHQA 4K3GA 3DOPA 5GS3A 4HPXA 4GY1A 2RMNA 3KYKL 3NPSC 2GJXB 2HNEA 4PJIA 3QUMB 4GFIA 1WBZB 1AO7E 5K9OA 4C6JA 5ALBH 2AV7B 4TNWK 1FWIC 2NY1B 3QOMA 3ALGA 4JDYA 1T2QH 3AACA 4TVSa 2LABA 3NFSL 1EGVA 1XSJA 3JTBA 4RMRA 3BLBA 3A3HA 3R4DA 4ZFZA 3Q7JA 4W9CC 3RWHB 1R2TA 2PRHA 4MLIA 5MENE 1UFUA 1RZMA 1BP3B 4JLRB 3NQ6A 4PR4A 3E8UH 3N34A 5KOMC 3QCVH 4N0YH 4E9SA 1LP9B 2ORBH 1XIFA 1C7TA 2WWMD 4PRPA 2EE9A 1I7ZA 4G8EB 3NIFF 2DW6A 1HN1A 4RJEA 3VIIA 2V6AA 4PGEB 3IJSB 1N0XH 5GHWL 5K9QI 2I5IA 3W1AA 4I5BA 3VSUA 3LRGA 3VKCA 1BZEA 3QC3A 3MJYA 2QSCL 3HCVB 2H4EA 4QSHA 4NBYB 1P69B 1Q6RA 3UBPC 3IKCA 5GZOA 4MAVA 3JVAA 4I18A 4CADB 4QF1A 1KD0A 1EV2E 4AQ8A 1YXYA 4FX7A 5G4WA 3SPJA 3ZR5A 3KGRA 4M5ZH 3P3BA 4NYLB 4QUOA 1UTDA 2NZIA 1PKLA 2FNBA 5TBOA 4E4FA 3KP1A 3TW6A 4Y1TA 1G6RL 4IRJC 3R06B 4X9YA 1LOQA 4PRNB 1HZKA 5AYBA 4L4JA 3LN3A 2F5AL 4KY1H 5D55A 1JPMA 1CFQA 4PJXE 3VDCA 2IXQB 1SLUA 2F53D 2XTJE 3OJMB 4XRCA 1HQTA 1BXCA 4R7JA 4HNOA 3B9OA 4FQ2L 5EMKA 4OF0A 3VFMA 3LTVA 4K3HA 4D7PA 4MQXD 3U2ZA 4M6MH 4YDKH 4YHLL 5KJ7E 3NOIA 5F6HJ 4FX5A 3SDCA 3ELAT 5I6LA 2Z1KA 1EXUA 1MELA 3PQYA 3T0AA 1A25A 4UFLA 3UZ5A 4DJED 1KJ2A 1U2YA 3L45A 3FU9A 1ELSA 2QGEA 4XMXA 2V8MA 2ZZ7A 3FUKA 2BP8A 2UZPA 4MS8D 5E1IA 5HYJE 1FQ0A 1X1OA 1UACH 5TFSH 2PU0A 5A69A 1AGBA 2DM2A 3CFTA 4B3ZA 5HDBE 4HU2A 1X4XA 3E9TA 3VXNA 5A8QA 3WDJA 2PP7A 4PCNA 1SN0A 2WAGA 2VDHA 3FIGA 2DEWX 4G8GA 3ATYA 4IRJA 4KHXL 2CR3A 3QQ3B 5SX4I 2QVHA 1UKSA 1AZ1A 1RZFL 3UWVA 4F8PA 2X05A 5JBFA 1F2JA 1XXXA 1LVEA 1GEQA 3T2OA 2XJ7A 4M3JA 2PYED 4HWUA 1XFPA 4RMUA 4Z7AA 4M19A 3VXOA 4AEHL 1IC5H 4IK6A 4PHZA 3NURA 1RK0A 2OSWA 2GUOB 2IH3A 1BIIB 3BEWB 3NUKA 4RISL 4WUUA 5FUZH 4ZXLA 1VBRA 1CR9L 1I85A 5B80A 1T5WB 4R96A 5CC6A 3MLYH 2WXLA 3PU7A 1F97A 1R3QA 5LBSH 2EKCA 3LN4B 2O56A 4QCIB 4CLMA 5ERWB 1JVOA 3UAAA 5CZKA 2VWSA 3KWXA 1CZ8L 3CZ8A 3ZO9A 3STPA 3QEUB 4IKLA 4Z95L 4QSFA 1FCBA 1NFDE 1V0MA 4LSDA 2AEOA 1ETB1 3L95B 3FN3A 3BP5A 2Q3ZA 3VXMD 3M1OA 1UZ6E 3NFUA 1OTUC 2WUBL 2HLFC 3MJWA 4JDZB 1OOAA 3M86A 3KP0A 5I1GL 3L5AA 2HRHA 2HVMA 3L5XL 3V4UL 1MJ8L 2C4FT 3SE6A 3UC0L 5JNYA 3JYBA 1X9RA 3PZUA 4UV4H 4DVRH 2VHLA 5GGSB 1M7OA 1HNFA 1DL7H 1KIUB 4XP5H 5DURD 3VSVA 4HKBB 2BSTB 2MUCA 2NYKA 5BQDA 1FFPB 3BQVA 5BO1H 4C5YA 4H2HA 3WTXA 5CGMA 4AKQA 3S5NA 1AKJA 1KPVB 4FR1A 3ZDYF 1UB6B 5ID1B 3BE1L 4HJGB 4RGNE 4HA0A 4XNMB 4WEBL 5IFAH 3SAZA 1MCWW 5F7BA 3MKCA 2VM9A 1UG9A 3CFKB 5DK2A 2DVUA 4JG1H 3T8QA 4J28A 3EO1A 1RUPH 1W6WA 3V5DB 4XXCA 2WVVB 5IXEA 1UH4A 3BSHA 5I71B 2ODOA 1BQHA 1TV7A 4AWTA 2YPLD 1NBCA 2HMIC 3EPNA 1UBSA 2DMGA 1I9IL 3APMA 3H4FA 4JFDA 8PAZA 3TUUA 4IRSC 5IFPA 3KYMA 2E4FA 3P0GB 3TT1H 1C1EL 2ERJC 4N0RA 4BFOA 2AKRA 2YEZB 4HV8A 2R7EB 5IB5B 1Q1JL 4ZMYA 1B30A 1M7JA 4YPGA 1C9SA 2AJSL 4L3CB 5T1KA 3AREB 1E73M 5CILL 1KLYA 4UB9A 4D6HA 2WJ7A 4NO3B 3GBMH 5H2ZA 5I3FA 2JCCB 2H8ZA 4N0UA 1HGWA 3S9YA 2XN9B 4DW2L 2A5UA 5HDQH 1PX4A 2EH8L 1IC4L 2OMTA 3PAUA 4ADTA 4IJ3C 3DBXA 2XU2A 2E6YA 4IXHA 3T55A 4YTSA 1GPOL 4DM2A 2BVOA 2YMXL 4WFHD 1DUYA 5ECJE 3RL1A 3HMCA 2DDXA 4JANB 4WY0B 4YHIA 3A9IA 2HXTA 5DEGB 4FF5A 3VI3A 1A3WA 1XSKA 3WFHB 1SXBA 1NY1A 3VXSB 3GS0A 3MT1A 3SJVA 3W39B 3HN5A 4UB0L 3ARFA 4MADA 1OV8A 3NCJL 4RDQG 2ALRA 1HYSD 2CLZA 4K8EA 2DWYA 2PPFA 3ZKQD 1U8QA 3AICA 1P6AB 3QIBC 2EO1A 4JHWL 4KK8D 4KEUA 2XFGB 5CJQH 4HG4K 4TUKH 4F8NA 4HJJL