3H54A

Crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 128
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h54A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h54A01
4UQ9A 2CLHA 1JI1A 1GG0A 1V3JA 2J27A 1TO3A 2BSLA 1N7KA 3ZSTA 1KLZA 2XIIA 4KFPA 1P0KA 4QISA 1SFLA 5FF7A 4GQQA 3TROA 5TQLA 2EJ1A 3GDLA 2I9EA 2QCDA 3UQNA 4K6AA 1CXLA 2ZCGA 3QSRA 4PEKA 2E5DA 5J5RA 4JTJA 5E0FA 4CKQA 4QAWA 3AJXA 3CIXA 1BVNP 1OF6A 4RXGA 4OKDA 2DP3A 1FCVA 2ZTKA 3C2VA 4RJEA 1XSKA 4UUIA 2ZX9A 2A5HA 3W72A 2BLEA 3EWUA 4OU1A 4PA8A 3ZT6A 1G7UA 1H7OA 1A5AA 3DKLA 3HZ3A 2ZUVA 2JK2A 3GK0A 1JRCA 3E0IA 4DPPA 1KTCA 3IGUA 3DFOA 1UKSA 4I7VA 3W1PA 2ZE0A 3W7JA 3WK2A 4OBTA 2YFNA 3A21A 1MZHA 3BG3A 1YDOA 5HJLA 5C2XA 5HDRA 4LS1A 3LHUA 3L21A 1OB0A 2X2JA 4H8HA 5AHNA 3A9IA 3H54A 3GLCA 5A2AA 3VX0A 4JFUA 4JTFA 2QJGA 1K03A 1XM3A 1D3CA 1KWKA 2E68A 3P67A 3D50A 3WFZA 3CU2A 5A6MA 2BY0A 3QRHA 4N4PA 5K9DA 2XVGA 2YW3A 3LPPA 4DF0A 3PC0A 1H1YA 2VC6A 1JGIA 1QPRA 3W1RA 3G3MA 2ABBA 4Y6GA 2WV8A 1EH9A 3HJZA 2QLYA 3S6DA 3UY7A 1H7XA 3LCHA 3O06A 3GTNA 5G4EA 4BI7A 1U2YA 1NAL1 1R2RA 1XBVA 2CZ5A 2ZZ2A 3NPXA 3G0XA 1WP6A 2I1OA 1D7FA 4GO9A 3HQ1A 2VFEA 1TV8A 3DZ1A 4MPQA 3C56A 1UD2A 4X3ZA 2PE4A 1FCQA 3C4UA 3SY5A 1KXTA 3TTSA 3C8FA 2QCHA 1FUYA 1ME8A 2WJZA 1I2PA 4J7RA 1SO6A 2OX1A 3KVJA 3PWAA 1I4NA 1OX4B 5FEZA 3RMJA 1MW0A 4XB3A 2JKAA 1UD4A 4LS2A 3HF3A 1W5MA 3BW3A 1T0OA 3LBMA 4EOUA 2NUWA 4ZMGA 3WNMA 3WEOA 1EO5A 3CV5A 2NT1A 5I3FA 1SMDA 4CVWA 4LNYA 2B7PA 4AHOA 1W5QA 6CGTA 3FW6A 1P5BA 4ZQCA 3KRZA 1XDLA 4WJEA 3L4UA 1LRQA 3E12A 4JCMA 1XGZA 2WKJA 3L4YA 1GT8A 4AWSA 3T44A 3N34A 1QNVA 4WQ6A 4FNPA 1QWGA 1SZGA 3P61A 4LW7A 1VH7A 1PS9A 2A1YA 4OGZA 1KBIA 3RK8A 5E70A 1IZJA 5HUOA 5BRBA 4MKNA 4JTHA 4CCDA 4EF9A 2C15A 4MVAA 1XCWA 1K02A 1ZCOA 4HPJA 1DKWA 2CPUA 4B5NA 4W93A 5A2BA 3NL2A 2NWSA 1JJKA 3QPZA 1SUXA 1BLIA 3II1A 1VAHA 4GWEA 2Z1BA 2C16A 4IMFA 3W7GA 4PCSA 5D2XA 5D32A 1UD3A 2PURA 1VPXA 4O54A 3SGUA 2F7FA 3QMRA 4IQLA 1IGSA 3W76A 2CW6A 1K3UA 3BLPX 4PSRA 1QR7A 2CWNA 2C8NA 3W38A 1KFCA 3KLKA 3G18A 2TAAA 3O6CA 3ZS4A 3UY8A 1MW1A 3R5EA 4IWWA 2V0TA 3S1VA 2EAEA 3DFSA 3M5YA 5CLWA 4UTJA 3BUDA 3SJ3A 2WNQA 5D38A 4CQ9A 5CLTA 1GEQA 4YCPA 1CDGA 1F6KA 1LDCA 1LTDA 3TFXA 3A47A 1A53A 3BMVA 5HR6A 1KM1A 3LRKA 3T4CA 5AHFA 1FXQA 4HOWA 4AWUA 1NM9A 4HOXA 4NJGA 2NX3A 2ZX6A 1YADA 3BAKA 3FS2A 3LCGA 4J9JA 4AYGA 4KFOA 3C2RA 1KGWA 2WSPA 2QCCA 1B4EA 4UFKA 3G1FA 4POCA 3RF9A 3S5OA 4CNOA 3WDJA 1JXKA 3P80A 4O57A 4FLRA 2VEMA 3EJPA 1FQ0A 2YW4A 2VUYA 1O5XA 4QNEA 3DI1A 4O28A 2Z6JA 2XVLA 5HWJA 4OT7A 4GINA 9CGTA 1X1ZA 2VOMA 3GKAA 3EDFA 3NQ7A 3F4NA 4M6VA 2JKEA 4MZ1A 3KVMA 4Z1AA 1H3GA 1B3OA 4Z0SA 2YYTA 1GPWA 2JGYA 3W85A 3NL5A 3GXTA 2VXNA 5C54A 4J28A 3VMPA 4ZL1A 3PUOA 4H7VA 5U7SA 4JTLA 3TUUA 3L0GA 2CLKA 1W31A 1ZALA 1SU5A 1LRTA 1NSJA 2TPSA 3PSWA 3UNDA 1NF0A 1G69A 4TMBA 5DO8A 1MXSA 4O4VA 4ZQPA 4FLOA 2D0FA 3TSBA 3QQ0A 1QAPA 1GVRA 4NJKA 2XN2A 3P60A 3W7RA 3GR8A 4NJHA 3VSTA 3ZSSA 1RQHA 2TYSA 2WC7A 1LP6A 3NAVA 4GE8A 1VS1A 4C1LA 3W22A 2OT1A 2Y7DA 3U6WA 4XQ6A 4E2OA 2CZDA 4M6PA 5CPNA 3W2JA 1MXGA 4Z1DA 3TW7A 3L9CA 2R94A 3GDMA 2DJLA 3LI1A 3W7CA 2D0GA 2A7NA 5K4XA 2W6RA 1AVAA 3HGRA 1UH3A 4MZ8A 2VRQA 4HNVA 3USBA 1ML1A 3WELA 1EIXA 1CYGA 4AH7A 3UXAA 1VLWA 5FESA 1CX9A 1KBBA 2WCSA 1L0PA 3M43A 7TAAA 1H7NA 4GI9A 2Y63A 1P0NA 3HOJA 5DY3A 3B03A 1JL8A 4AEEA 1EWDA 5LNUA 1WX0A 3NXFA 2FQIA 2Z0IA 4OHQA 1VHCA 3EXSA 3MP5A 1PJ9A 1HVXA 4UR8A 1KBKA 1HL8A 1C8QA 5DXYA 2A6LA 3IIOA 4JDBA 3S42A 3KE0A 4Z1BA 1KM2A 1QHPA 4RZ4A 1QI4A 1QMLA 2XFWA 2EAWA 5C55A 3W07A 3WY4A 4MYAA 2XWEA 2BY2A 4FXSA 3NQMA 4JTGA 1MFVA 3LHWA 1CGXA 1H7PA 3Q94A 1BEUA 5FEPA 4GUGA 2B7OA 4YL2A 3MYPA 3ZWSA 5LNWA 2FB3A 3P81A 4LRSA 3EDJA 4H4IA 1OK4A 4WLCA 2OZ0A 4Q4KA 1QO5A 4U3CA 5EBUA 4UQDA 1XCXA 1KM4A 1TV7A 3UWYA 1AW1A 1J0HA 4LS0A 3LTYA 3W1QA 2BHYA 3WK1A 4I7WA 3OLDA 1U33A 2OSYA 1ZFJA 2GQAA 2G3MA 1QPQA 1MEWA 3UPBA 3W7DA 1BTMA 1DJQA 2ZXDA 1HXKA 3VM5A 4FNSA 1WYIA 4BWLA 1Q6QA 2V2CA 3G8EA 4LC6A 4PH6A 3WJYA 3HG3A 2YYUA 4JN6A 3W71A 3HGOA 1PCKA 4JGDA 3ZR4A 1Q4NX 4UXDA 1QWNA 5E0KA 5G4WA 4FMVA 3MHGA 3N9RA 1EO7A 3SGZA 2FGZA 1I45A 1SO4A 2X2GA 2WO5A 4AW7A 3K30A 3M44A 3W83A 4M56A 3BGJA 3L0KA 1EA0A 2GJRA 3KHJA 3UXDA 4XWUA 1XBZA 1P4CA 3UEQA 3LCIA 4ICNA 1QPOA 1H50A 2Q8ZA 1KWGA 4K8HA 4PEEA 1FWWA 1R75A 4U33A 1ZJAA 2F84A 3QGVA 4UTTA 3PB2A 3VE7A 1PS3A 3O6DA 3UWQA 3BAJA 1PIGA 2QCFA 5E6YA 5AYXA 1KV5A 3CLWA 3C0JA 4IX0A 3TKFA 3B04A 3GR7A 5DBTA 5DBUA 2X30A 4BF9A 1S5TA 1W8SA 2J25A 1TPC1 5DCDA 4CNPA 3BAWA 2ZWZA 1ZAHA 3VNYA 1KFKA 1YYAA 3W1NA 1ZY9A 3KLLA 1JQVA 3M5ZA 4EIVA 4UTKA 3NA8A 2Y89A 4RV8A 2BXYA 5AHEA 1FY6A 4R7JA 1ZENA 2PRHA 3ABRA 2E4TA 2H3BA 3O8AA 4S2CA 4JTUA 2FYVA 1YPIA 2B7QA 4K37A 2YR1A 4H2CA 5SWUA 3FA5A 3NEVA 4AIOA 4M8UA 3U2OA 3LXBA 2GUYA 3R12A 5F4WA 3W2LA 2X2HA 1W5PA 4ADTA 4LUJA 1G4EA 4UFIA 4GQRA 3PR2A 3O1NA 5AC7A 3UCQA 1KB3A 4TVUA 3OEXA 4N4QA 3GZ3A 3DAQA 3AJ7A 3TMLA 3UZ5A 1UKTA 4QSHA 3YPIA 4UC5A 1F74A 5D37A 2E5CA 3KX6A 3WNLA 1C29A 1TREA 2DIJA 4K36A 3S0CA 2WVVA 3W7QA 4BI6A 3C6CA 3IK2A 1O5KA 1T99A 3M6YA 5AHLA 1SZFA 2NX9A 3FJ6A 2F1BA 1ONRA 2WCGA 3A5FA 2Y85A 3VE9A 2NX1A 1RV8A 3KFTA 5F4SA 1UD5A 1GVFA 2H90A 4QM1A 4FNRA 2YGYA 4PL2A 4O1BA 1K8ZA 4IMDA 5LGZA 1TPEA 1IIGA 1UOKA 1X6UA 1V3MA 3MWAA 1QOPA 3G22A 1PAMA 4N9EA 3Q2DA 4WY0B 3TFCA 2NUYA 3TSMA 4RZ6A 5CPMA 3R8RA 5E9AA 3O63A 4UFHA 3Q37A 3IJ7A 5EYWA 3NQFA 1LOLA 2AAMA 4BA0A 3L65A 3VKJA 1F5ZA 3NL6A 1DEDA 5F2LA 1F05A 1SW7A 2EGZA 2X1SA 5AB3A 2ZRVA 4XTIA 1DL3A 1HO1A 1TQXA 2B0MA 3PM6A 3LGEA 5EPDA 5CGTA 2NXHA 3DFTA 2GQ9A 1OT1A 2ZXQA 4EF8A 4JXCA 1I75A 1L6SA 3DHUA 1SR9A 3NPUA 1R33A 1B57A 2W79A 3T78A 1V5XA 5CXPA 1WZAA 2QPSA 3NQ6A 1MEHA 3N3MA 4AF0B 1JI2A 4BR1A 1OX4A 3L5AA 3CZLA 2VEKA 1T8XA 1OFDA 1PIIA 2Y4SA 4YLWA 3W1AA 2XWDA 1W5NA 1JQXA 2PRLA 1DOSA 4KWUA 2ZBTA 1LWJA 2E0PA 1JULA 3BCFA 1HNYA 2QAPA 3NGJA 3L5LA 3G1AA 5U4NA 2KZHA 1H5YA 2EF9A 5C6MA 5DY2A 3R2GA 1H63A 1L9WA 3RU6A 3I6RA 1ZJIA 1WV2A 2PWDA 3LCLA 4DEFA 3WN6A 1QI5A 2Y7GA 1RQBA 2EHHA 3BVJA 3ZT5A 3I68A 2BHZA 2E6YA 5D04C 3L67A 4ORMA 1NF7A 1BPLB 5T26A 4ZQOA 2OSWA 4JFTA 1TPH1 4NZFA 3S5NA 1PPIA 3NQ8A 2GVJA 4WOZA 4BZYA 2NV2A 2WNNA 2WSQA 4JTKA 1AQMA 5F2IA 1Z32X 2QCEA 4LUIA 2WVUA 3TMQA 3BPWA 4FNQA 1LM1A 1GWJA 1JDAA 3EWZA 3QPYA 2D0HA 3W84A 5AC6A 3OLEA 4O0KA 5CZTA 2QJIA 2QEZA 2QUUA 4U31A 1N55A 4KWVA 1W56A 2A7RA 2ATMA 2R8WA 4O53A 3O05A 5D2YA 2YDAA 4FEZA 3S1XA 1JRBA 4Y8FA 3NL3A 1TMQA 2RDUA 3EJTA 4PFMA 1OX5A 2ZWYA 4FNUA 1IF2A 5AFDA 3DHDA 4HP5A 1FWRA 1E43A 3VGBA 2CXGA 2NLIA 2FHBA 5I0DA 3LV6A 3MP3A 7CGTA 1JCYA 1TQJA 1FBAA 3P62A 1R30A 4O0ZA 1UJPA 1HX0A 1JCXA 1FDYA 1XI3A 2YA2A 2E6DA 2QDGA 2CLOA 3GDTA 2NXIA 1XH1A 3IGSA 4DF1A 1Z41A 2P0OA 3TC7A 3G24A 2YXGA 2HS6A 1LROA 1JIBA 3EX2A 5K9CA 3GYEA 3LDVA 3W7OA 1HG3A 4BFAA 1VIWA 2HSAA 4B9YA 3TDFA 1CXIA 2ZICA 3NQAA 2A6NA 4PCFA 3TX9A 2D3NA 2ZZ6A 1LORA 1EA9C 1WE5A 1K7EA 2V5LA 1KGXA 2UV8G 3W7IA 2BX7A 3PSVA 2H3DA 1Y7VA 5EMUA 1VYSX 1XD0A 4WSJA 1KM6A 3MJYA 4NI3A 4UNLA 2J9ZA 2GQ8A 4DF2A 4Y9AA 3QQ1A 1KTBA 1VYPX 2ZRWA 3MW7A 5LKYA 3EJRA 4NUWA 3PBUA 3ELFA 1A50A 1CI1A 2YFOA 4JYFA 4H3DA 6TIMA 3BCDA 2DZWA 8CGTA 2Y62A 4HHPA 3W7MA 4GI8A 1UKQA 2C3ZA 1EB3A 3ZO9A 3ZR5A 2DZXA 3F4WA 3N9SA 3RLUA 1Z48A 1TPWA 4OQVA 4CGTA 2YOCA 1VCGA 4IUOA 4FB7A 8TIMA 1TJRA 3JR2A 3WK3A 4E38A 4FX7A 2Y24A 1S5WA 3W1UA 1KLYA 3KRSA 1LBMA 2XIBA 1Q6OA 3DGRA 3MHFA 4UNKA 1J0IA 1IZKA 5BOOA 1OX6A 4PC8A 1JFHA 4HSNA 4FHAA 4JFSA 2C7FA 1I2OA 4U4MA 5EL1A 1O60A 3BVUA 1TQSA 3BLIA 5CG7A 2QUTA 2EO7A 1QPNA 3B06A 3LTSA 1G94A 1G7VA 4N6FA 5G1YA 1TRIA 1OFEA 1MFUA 2CFFA 3CWNA 1OHLA 3L2MA 3C3NA 1V7YA 4A2RA 1G9HA 3L66A 4ZVJA 4UQEA 1HUVA 3M41A 2X1UA 3OIXA 3TQVA 3I7SA 1TSIA 2GVYA 3RFAA 2ZQ0A 2ZUSA 4CQAA 4E2BA 4PSPA 2P10A 4LU0A 2XN1A 1SZNA 1XCFA 3DX4A 2J9YA 2Y88A 4IJBA 4K39A 3U8GA 1MW2A 2WSKA 1WA3A 2GPTA 3QJAA 3EB2A 4ADSA 3RNDA 3VU2A 4ATWA 2VFFA 3GXIA 1YTKA 3NYZA 3M16A 1ZAJA 4IOTA 3BSHA 4NNAA 5IBXA 5D03A 3W7EA 1KCKA 3GB6A 1Z42A 2QCGA 3THAA 1QCWA 4ML9A 4WSKA 3P8IA 1TQTA 1CGVA 1AL8A 1XSJA 2CZEA 3IGXA 3W6YA 3NPWA 1G1YA 4AAJA 1KW1A 3EXTA 3HG2A 6TAAA 4M19A 3SR7A 3TQ0A 2X1RA 1JVNA 3O07A 2GUUA 2V9DA 4OE7A 4N9BA 4L4LA 3UPWA 3VSVA 2Z1KA 1ZS2A 1J5TA 1J0JA 2OMAA 4UTWA 4A21A 1XL9A 5DELA 3TR2A 4FX8A 4UTHA 4JCLA 1BAGA 1NOFA 1OFBA 3CPUA 1IXNA 2NUXA 2D2OA 1UASA 3PAJA 4DBDA 1K7XA 3G1XA 5K3VA 3LM7A 3UYCA 3PBVA 3OLGA 4G1KA 2ZZ1A 3VX1A 3HMJG 1AL7A 3CTTA 3WJWA 3FAXA 4H8UA 3W7NA 1YTEA 4O4WA 2J6XA 4O1DA 1XH2A 1OFOA 1S46A 1QW9A 1AG1O 4ZQNA 3M47A 4QQ3A 2ZUUA 3CLMA 3HPSA 2DH2A 4GNJA 4A3UA 3C2OA 1DQWA 4W9TA 1V3LA 3GAYA 3THQA 1TQVA 5HMSA 1YDVA 4X9SA 2VFIA 2J88A 3ZWTA 5FF3A 1JDDA 1TCDA 4U28A 4FLSA 1KFEA 3C61A 2YKKA 4AMXA 4UMAA 3FLUA 2FE0A 3BVWA 3ATZA 4OV9A 2JGQA 5CZ0A 1JDCA 3MI6A 5KMYA 2QAFA 3M07A 3MP4A 1THFD 1IXOA 2OSXA 3IRDA 3SI9A 2HS8A 4JS3A 2WKLA 3HBLA 1Q3NA 4GC4A 3FOKA 4AB4A 5K7JA 4HOZA 1S3HA 3FFSA 2WPGA 4AMWA 1IIHA 2E77A 1I2NA 1R46A 4HNTA 1AMKA 3EDEA 5D30A 1A5BA 2BXZA 5FI8A 2QCNA 4JX5A 5AHMA 4CCEA 2ATSA 4GKLA 3N73A 1VYRA 2TMDA 3BW2A 3ECQA 1JD7A 3SIZA 3LRLA 1JG9A 2QMKA 1QW8A 1P1XA 1O94A 3B8DA 4NJJA 5LNVA 3BH4A 1MW3A 3W2KA 4FF7A 4GXMA 3WJZA 3FYPA 1WZMA 3V75A 4UZUA 2CLLA 2FTPA 3W75A 2Q3RA 5D09A 2RH9A 2EEXA 3TW6A 2XN0A 1LZOA 2AGKA 4GUFA 2V2HA 2DH3A 3TOPA 1C8VA 3PUDA 4LVAA 1X1OA 4LOCA 2Y5EA 4O11A 3FKKA 2B7NA 1QX1A 1RP9A 5BRPA 1XUZA 4JIPA 3P8JA 1NFBA 2VR5A 1BVZA 2ZRYA 4WY0A 5F2MA 5MHBA 4N9DA 7TIMA 1OFQA 3MUXA 4X22A 1UUMA 3EX4A 3UWZA 1CXHA 1BG9A 2ISVA 3WY2A 1ICSA 2E9BA 3MBFA 4BK9A 1VQTA 1R47A 1R2SA 2FB2A 1DJNA 3BUBA 3S2CA 5AOUA 3V1PA 2CHNA 2Q3OA 4JTIA 4RKAA 1W3TA 1RPKA 4NXSA 5G2IA 2FDSA 5LSMA 2P1FA 3SECA 3CIWA 4UCGA 3ZQ9A 4JY9A 4NT0A 4IMGA 3OBKA 1QO2A 5LNRA 2X2IA 1VJSA 5AYZA 5AYYA 4GUIA 3E49A 4UTIA 2DORA 1TQWA 3C2FA 1TB3A 5G5IA 1M7OA 1W9XA 1M7XA 2A7PA 1OYBA 5D33A 1E3ZA 3HB9A 4XKYB 3CQ0A 4O52A 4QJ1A 1JUKA 1TPFA 3LHYA 2ALDA 1ICQA 5LHFA 4A22A 1TTQA 5K4ZA 2Z6IA 2V30A 3WFAA 3B4UA 1GQNA 2ZA3A 1O7DC 4HIBA 1QFEA 2QMJA 3CZEA 3LBCA 2A0NA 2ZZ5A 3G1DA 3TA6A 4OWGA 2QV4A 3L4WA 4MZYA 2AAAA 3CM4A 3NOEA 2QCMA 2VFHA 2WVSA 3NQ2A 4J3UA 3S5YA 1YTDA 3LLDA 1V3KA 4PCTA 2QPUA 4K8EA 1SSDA 3D4ZA 3P84A 3CZSA 4P61A 1XBXA 5F1UA 3LHZA 1XKYA 1BF2A 4HPXA 2Q8LA 3FYOA 1R2TA 1CIUA 1L6WA 3FAWA 2XVKA 2WPBA 1BKSA 1ICPA 3GVGA 1IV8A 4WF7A 1M6JA 1FWSA 1O4UA 4JX6A 3VGFA 4MFEA 2Y7FA 5ABTA 3DKJA 1KA9F 1KCLA 4NQ1A 3S9YA 1DV7A 4TR9A 1UUOA 5HXMA 1AW5A 3GKFA 1UB3A 5C5YA 1KFJA 1YXYA 1KGUA 3P74A 1KTNA 3PB0A 2IQTA 5H2ZA 3W88A 2OW7A 3VGHA 3FJLA 3ATYA 5G1TA 2F1AA 3ZFHA 1A5CA 2FPTA 5A6LA 3CTLA 3N14A 4WXZA 1TMHA 2BTMA 5FF0A 4LVDA 5HINA 2H8XA 3NDOA 4LC8A 2WNZA 5CZSA 3W37A 4JFWA 2W0UA 4J3XA 3K1DA 1ZHAA 1K7FA 1ME9A 3HG4A 3QFEA 1PHQA 3OLIA 3NQCA 1CPUA 3BK0A 4WXYA 3BLEA 4CLMA 4S1FA 3NO5A 5KEZA 2CLIA 3DU0A 4UTUA 3D51A 4RCXA 3PUEA 4LPCA 4A29A 5I24A 5AC8A 3IVTA 4K7VA 2PWFA 5D05A 3HPZA 1PE1A 3BVXA 5TIMA 2DZVA 4CN6A 3BO9A 1PL9A 3UG5A 3BUQA 4MJMA 4FNTA 1LWHA 2OT0A 2DZSA 2JBMA 3WEMA 1LRNA 3GXMA 3T40A 3EWXA 1EP1A 5DCEA 2VENA 2ALWA 4HPHA 2TSYA 2E09A 3IIVA 2RHGA 3E02A 4GRSA 3KRUA 3L2IA 3STEA 1G67A 3DHPA 1CGTA 5KZEA 5HUPA 2ISWA 2H8ZA 1KM3A 4MJZA 3HPXA 4GBUA 4Z0JA 1WO2A 1VCVA 3HGSA 1KXHA 4O19A 2OYLA 1F7BA 4J3TA 1YDNA 1T96A 1EPXA 4IXHA 1VHNA 3C52A 3BW4A 3CB8A 1PEZA 2BWGA 1FDJA 1RD5A 1RZMA 1TIMA 1WXJA 2ZZ4A 4IGHA 4P2VA 3S8HA 3BMWA 2RFGA 3TAKA 1VFUA 3D52A 4LXFA 3IVSA 2QDHA 4AXKA 3TTYA 1LOSA 5FF4A 1FCBA 2BZNA 1XH0A 3WENA 3N19B 3S1UA 4JY8A 1KV8A 3EJUA 1XV8A 4AEFA 1OGSA 3SFKA 3G1HA 4M6QA 2FPYA 2VRKA 2ZA2A 3G3DA 3L4TA 3TSDA 3HJEA 4LVGA 1HWWA 1A5SA 2FH8A 3I65A 1TV5A 3RILA 4MLJA 4JYDA 4X9YA 4UFMA 3NZ1A 1XBYA 5K9XA 4NNCA 3DBPA 5DXXA 3TU9A 1RR2A 2H6RA 3BLKA 1TJPA 4Z08A 4KFNA 2E8ZA 2NSXA 1JXJA 1MEIA 3R13A 4UFLA 1W5OA 1G4TA 2VT0A 3K8LA 2CLMA 1DHKA 3GAKA 1XSIA 1SQ7A 4LRTA 3PF3A 4O1CA 3DFQA 1CGUA 2ZFAA 3G1VA 3AXIA 4QIUA 3S1WA 4O12A 3TONA 2G3NA 4DO4A 3CZNA 1DQXA 3R89A 1VZWA 5HWNA 4LWWA 4O1AA 3NQEA 3NNTA 4YMZA 1FXPA 3G1SA 4LV4A 1VGAA 1JUEA 1JF5A 3WK0A 1LLZA 3W9ZA 3DENA 3EDDA 1F76A 4JNMA 3IV3A 4K38A 1TPVA 2QJHA 3Q58A 4CQ8A 2RKXA 5G2HA 2QUVA 4UOZA 5AHIA 3M9YA 2TRSA 4DO5A 3NQVA 1DORA 3W86A 3PVFA 3LOTA 5KITA 2Y7EA 1U5JA 2FIQA 2WOQA 5D2WA 1JCNA 3VM7A 3BUPA 4GI6A 3IIXA 4JX4A 4EVZA 1W1ZA 3RLVA 2JKPA 3DDFA 3W3OA 1M5WA 2VEIA 1PHWA 4BI5A 2QF7A 1C9DA 4BWLC 3EJSA 5DFAA 4GFSA 4GIAA 3EX6A 1GJWA 4B9ZA 4IX2A 2WVVB 3EJQA 5GVJA 1YXDA 2AQWA 1OF8A 1Y0EA 1HL9A 1AMYA 1JR1A 3VGGA 2ZYFA 2GVLA 3B05A 3UWVA 3W23A 3LPOA 3ZR6A 2HTMA 1W3NA 3L2LA 3LXCA 4R33A 4XUGA 3OHIA 1A47A 1ME7A 1LLWA 4YCOA 1ZNNA 1GYLA 4UMBA 1VC4A 2CLFA 4CCCA 3RIKA 1MVYA 2ZXAA 4JR5A 4U2ZA 3FKRA 3OVQA 3K8MA 1OG0A 1HTYA 2CZFA 3WNOA 4JYEA 1QPKA 4UTTC 1TCMA 2B4GA 3KEHA 2DZUA 2QKFA 1WZLA 5TBOA 4GJ1A 3DX1A 1OFRA 1WPCA 4JFVA 3MYOA 4Y96A 5I23A 3W1TA 3IJ9A 1KM5A 5CPLA 5I3JA 1M53A 2FHFA 3L4XA 1H1ZA 3NG3A 1J0KA 1TTPA 2FPVA 4UTMA 1F2JA 1LBLA 3W87A 2E5BA 2VELA 1WDWA 2VEPA 3WMSA 3TJXA 2G5WA 1UH4A 3EX3A 3W1MA 4QITA 4I9AA 1EX5A 3UZJA 1ALDA 4NX0A 3M1ZA 3LV5A 4E2DA 1CGWA 5FF2A 3LCFA 3LCXA 4OIFA 3JRKA 1B0IA 1JCJA 1QI3A 1DBTA 4EWND 4J3SA 3LLFA 3QYQA 5BNKA 2LLEA 3CZKA 4M7TA 3QMSA 4PL1A 4LVBA 4O15A 1MSSA 4CN4A 3BC9A 1XDMA 3BVTA 2Y61A 2E1DA 2RDTA 2ZZ3A 3DI0A 1I8JA 3W1LA 4HT3A 4NX5A 4UQBA 1IXPA 1GG1A 5HPOA 1LCOA 1FCUA 3TQKA 3K8KA 2R14A 3UWWA 1TPDA 4NNBA 1OYCA 1E40A 3MO7A 5LHEA 1TPB1 1PVNA 4M7SA 3M5XA 1AW2A 4XTDA 3WJXA 3LX9A 3FEMA 4UNIA 3KL0A 3D0CA 1W0MA 3BUIA 1H61A 1TPUA 2ZRXA 1SSGA 3CWOX 2WSRA 1HL2A 3B0PA 4S2BA 2PWGA 2WKGA 3LRMA 4R53A 4UTLA 1JCLA 1GVQA 2ZUWA 3QC3A 2ZXBA 3TIMA 2C1HA 4DQWA 1SMAA 3LTPA 5FEWA 3KL3A 2FLIA 2OCZA 2R91A 4TO8A 4RX0A 4JIQA 1K8YA 1H62A 3N2MA 3PG8A 4X2RA 1UD8A 2WVTA 2QCDB 1E51A 1K8XA 4NJIA 1OSEA 4MIMA 3ZOAA 3A24A 3CHVA 4J27A 3NPVA 2I14A 1NVMA 4RR4A 2ZDRA 1GJUA 2OYKA 4O14A 3WJSA 4N2YA 4AHQA 5HWMA 5E6ZA 3CPRA 1CW2A 3TH6A 4PODA 4FLQA 3FIGA 1TTIA 1WBJA 2YSWA 2YZRA 3SSJA 2V81A 4ONVA 3D4YA 4ALDA 4UCFA 2ZA1A 2WSYA 3QMTA 1B4KA 3T55A 4WX2A 1B2YA 4UFJA 4O8RA 1HT6A 3DX3A 1VB9A 1QOQA 1MO0A 3BLFA 2EQDA 5G2WA 4KWWA 2YA0A 3GNDA 4FIQA 3IIZA 1EWEA 3P82A 3A22A 2Y70A 1FX6A 1CLVA 2F2HA 2EABA 1ADOA 2WQPA 3MBDA 3NM3A 1FDZA 1Q45A 1BWLA 1J2WA 4IMEA 1SO5A 5J5DA 2ZUTA 3L0NA 2CLEA 4IXXA 1KFLA 1GZGA 1GTHA 4N02A 2WNWA 3AXHA 2O7SA 1HTIA 4IMCA 2X1TA 1H51A 1PCWA 2VKZG 1IXQA 1UCWA 2C13A 3AO0A 4MB1A 3BARA 1LBFA 1G4PA 1BWKA 4UIOA 3W7LA 4XKYA 2E8YA 5CKSA 1RQEA 4NU7A 1QHOA 5EY5A 3M0ZA 2O7QA 4Q32A 3G0UA 2F18A 1ZJBA 3HG5A 1LOQA 1MWOA 3P7YA 3STGA 3TXZA 5IM51 1PZ2A 2OW6A 3TJLA 5F2GA 3GNNA 5HQEA 3BVVA 2V5BA 4UOQA 1EHAA 1GCYA 5F7UA 4LT9A 5E1QA 4L4MA 1FWTA 3DXIA 5E93A 4CNNA 4ZZ9A 2V82A 5HULA 4H8VA 3WNKA 1DVJA 5I3IA 2BXVA 4R34A 2NXGA 4PTNA 1JCMP 2PWHA 3TNOA 3GIYA 5I3HA 3NR0A 3M7WA 3BAIA 3EKLA 3GDKA 1DHPA 3QF0A 2F7PA 1VR6A 3EEGA 1YLVA 3IVUA 4N9CA 3H53A 2C6QA 1L2UA 3WDIA 3VI2A 4JD4A 1VFOA 2OJPA 4GUHA 4K7YA 4UQCA 3CEUA 2YA1A 1I2QA 1OVDA 3DHFA 5D2TA 4DPQA 2YX0A 4TMCA 3IIPA 1S5VA 3CC1A 1FWNA 2F7OA 4MLRA 3DX0A 3NM1A 3KAOA 3F03K 4A2SA 1JAEA 1GTEA 3BAXA 3NQGA 3B0UX 2ZZ7A 2IGTA 3DH7A 3NZRA 4GUJA 2ZRZA 4WUIA 2VNCA 4O10A 5DLCA 3W7HA 3HGJA 1TTJA 3GDRA 4X0NA 3OG3A 3TE9A 3PULA 4AHPA 2G97A 4WD0A 1PV8A 4NXKA 4AYSA 1CXKA 1GYNA 3GXFA 3L5MA 2RDWA 4O50A 3BSGA 3DFPA 3G0SA 2PWEA 5LZLA 1W37A 1F73A 3KVKA 1EP2A 4DO6A 3QEZA 1G6CA 3G8RA 4MY9A 4O17A 2GVGA 2V3EA 4DBEA 3L4VA 1G4SA 3QM3A 5I3KA 3WY3A 2PC4A 4J3WA 3W74A 1J4EA 4ORIA 3UERA 1W54A 1X8FA 4E0CA 5F4XA 4IPJA 2OYMA 3SW6A 1LYXA 5KSWA 4LVFA 4NZJA 1QWUA 3A6OA 1GVOA 5BMWA 3INPA 4WOQA 3LB0A 4NVTA 3VMNA 4MFDA 4MY1A 3LHTA 3B0VC 1XD1A 1JD9A 1O95A 2Y6ZA 3T7VA 5CSRA 2DIEA 1JUBA 5DN1A 3AMLA 3EWYA 2F61A 1KXQA 5FEXA 2FJKA 4MUZA 3KL5A 3H55A 1VCFA 4OV4A 3DDGA 3W2NA 1UA3A 3VNZA 3IEBA 3WNNA 5BMXA 3VSUA 1GVIA 3IJ8A 2G96A 3CEPA 4O16A 4AMAA 4UR7A 1G5AA 3WDHA 1WQ5A 2A4AA 3MI2A 1SZEA 1U83A 4HNUA 2EKCA 1XC4A 3EDKA 1GJPA 5KINA 4J3VA 4AF0A 1P6WA 1OYAA 3LXAA 4LV9A 2FH6A 2E6AA 2GJLA 4U2YA 4N6EA 3BLBA 3VGDA 1D3HA 3F1QA 4O18A 3W73A 3LHVA 5HR7A 3ZT7A 4FXRA 3N2XA 3QW4B 1W3IA 2QCLA 3EXRA 4TU1A 3VMOA 3UD6A 4KMQA 3KOFA 4FIRA 2A85A 3P5YA 2FFCA 1L6YA 4UMCA 3KVLA 4JTSA 5LNSA 2DU2A 2HMCA 2C19A 1TQUA 2ZX8A 2BHUA 3TV8A 4TX9A 3GXPA 3TC6A 4JICA 1XXXA 5K2ZA 2VFDA 4JL1A 1H7WA 3ANYA 4FO4A 3AMKA 1X7FA 2DZTA 4AWTA 3NVTA 1MXDA 3OVRA 2AMGA 3ABSA 5KZMA 4ADUA 2ZIDA 1Q6RA 3O15A 4AVFA 1OFAA 2YIHA 4WZHA 3W2UA 1RPXA 1GVSA 4LY8A 1CXEA 1DTUA 5DCBA 1E3XA 5H91A 1KBJA 3O6YX 1PZ3A 2DZPA 4ZQMA 5L9FA 4OJYA 1D3GA 5BW6A 3EWWA 5CGQA 1OK6A 3I7QA 1CGYA 1EEPA 1OFPA 3CT7A 3MMTA 4Z1CA 2E6FA 1SPQA 1GOXA 3BV4A 3GX9A 2F7QA 3G1YA 2GJNA 5AN7A 4JEQA 3QZEA 1CXFA 4C1KA 1ZAIA 2BY3A 2X16A 3LERA 4HNNA 5LGXA 5CZJA 3TCEA 4Q33A 3VGEA 1WOAA 3TAOA 1R34A 4IPIA 3BG9A 2ZX7A 2ZX5A 2GOUA 3HIJA 3KWXA 1HFBA 2YCEA 1YXCA 5IBXC 2CU0A 3L68A 4Y90A 3W70A 2C0AA 1Z44A 3EWBX 3SZ8A 5D02A 3GXNA 3LI0A 3ABQA 1Q6LA 3OA3A 1H60A 3A4AA 2V3FA 3LCWA 5CPOA 2NV1A 1BSIA 1OABA 5F1VA 3PBYA 2ISSA 1EUNA 3CZGA 2QR6A 3EX1A 3KXQA 3MI3A 2D3LA 5CGMA 1QDSA 1EUAA 3W1XA 2DJXA 4D2JA 1PIFA 2NZLA 4JTEA 4UTWC 2NWRA 4MYXA 4HA1A 2F7RA 1JF6A 4UQAA 1UD6A 4XBSA 3QSTA 1KFBA 3UWUA 2BY1A 1SFJA 3BGGA 3VFLA 1U30A 4MY8A 4JDYA 1SW0A 4RXFA 3VCRA 3WNPA 1B9BA 3E9AA 2WANA 1TYGA 5A8GA 3VO0A 2ZRUA 2FHCA 4UZSA 1F6PA 3TK7A 3W2MA 3OVPA 4QAIA 1OT2A 1SO3A 2Y2WA 1XUUA 3BG5A 2NT0A 5A5WA 5EA9A 1H7RA 5D2VA 5TD4A 1WAUA 3CGTA 1D9EA 4QNWA 4DELA 3W7PA 2Z2UA 1RP8A 3STFA 2GJPA 5I3GA 2C14A 3TXVA 4CN1A 2A2IA 3C2EA 3GBDA 3BAYA 2J9XA 1KM0A 4LQ1A 1TRDA 5L6UA 1KXVA 1VFMA 3S5ZA 3MHUA 2D73A 4AEOA 4JTTA 4LTSA 4GO8A 1YPFA 1I2RA 1UBSA 3PG9A 5HNRA 2YPIA 1M7PA 4HSOA 4AIEA 2V3DA 1EP3A 3PY2A 1UH2A 2EADA 3JS3A 1VRDA 1ODUA 2EPHA 2G95A 4O13A 4RZ5A 5EKYA 3E96A 3GXDA 4RLIA 4FX6M 4ZQRA 4RK8A 3DC0A 3NQDA 5KTLA 1OJXA 4I7UA 1RVGA 3O16A 3GBEA 3UG3A 1UA7A 5CSSA 3WY1A 1VJIA 2ZTJA 1WZKA 4HKPA 5I5RA 2J24A 3DX2A 3QW3A 4KKXA 2V8ZA 2C18A 4MOZA 4DXVA 4WY0F 1XFBA 1SW3A 5EMYA 1VLIA 4TIMA 1WBHA 1WOBA 3UG4A 3DFNA 3STCA 1AQHA 3I7RA 1HO4A 2EACA 4MAZA 3EKZA 4HN4A 4YWIA 3M5VA 3VNDA 5BRQA 3QH2A 3PBWA 5KZDA 1NEYA 3L4ZA 3A5VA 3HO8A 2V2DA 4XBKA 4XZ9A 2ABAA 2PRMA 1N8FA 1AK5A 3P5ZA 3A23A 4YXGA 6ALDA 4H6KA 3ABOA 2PCQA 2YJQA 2VFGA 4JL2A 5A2CA 2A21A 4M5PA 3PS7A 3W7KA
chains in the Genus database with same CATH superfamily
7ENLA 2Q86B 1ANUA 4N2HA 3AZRA 1SFLA 5FF7A 3REWB 2DW6A 2EJ1A 3UQNA 1S7TA 4XH2A 2E5DA 1MSPA 3GHPA 4JTJA 3CIXA 1U3JA 3LENA 1UWGH 4CBZA 4MDIB 1EXGA 4M5YL 5EU7C 2B59A 3I6KA 3DI2B 5GS1B 1ZANH 4ZX4A 4KUCF 2O9PA 3KBEA 1EHNA 2H3XC 3AREA 2XXMB 5HDLA 5GJTH 2XWBA 1XEDA 3DG7A 2VWEE 4OBTA 1CFNA 4D0BA 1W2VA 4KWOA 1R5IA 1LO2L 2X87A 2VN4A 4N90E 3H54A 4C6NA 2H0PA 2QJGA 5F9OH 4ENED 1B3JA 1TLKA 4JG9A 3NYKA 3WFZA 2YCKX 3H7BA 2YW3A 4LCCB 1JGIA 4XZBA 2BJMH 4FALA 2X6VA 5DRWA 3GTNA 3ZHFA 3U0WL 3M0JA 4X3ZA 3IT8D 5DJZA 1UZGA 1ISXA 4F1ZA 4FMKA 3UNTA 5L7XL 3PWLA 4IGBC 4AC2A 3RMJA 1RHHB 3T8LA 3V6FA 4PRNA 3JZEA 1ET5A 1MCPL 2NUWA 4I1NB 1NMCB 4QFUA 2NTSP 2LU4A 4FXJA 5DJ2A 3RZWA 1N0LB 3E12A 3KCPA 2F54D 2X0HA 4KAQH 4FYQA 4KRPC 5T3ZE 3H2WA 4DVRL 3MFGB 1GOHA 2HT2C 1UGNA 2RB8A 4AGOA 1TVHB 1CYXA 3T77A 3K6IA 4QUOA 4LCWB 1OAXH 5LG6A 4GWEA 1IGTB 3UZVB 3K1GA 1XG4A 3C75A 4MFHA 1K3UA 3ULVL 5H94B 4Q8UA 1XCQA 4HCRA 2C1OB 3BUDA 4Y4KB 4H8WL 3ZDWA 2OMBA 1CF1A 3T4CA 3ZZ1A 2WIIA 3LBOA 3E0VA 4YWGH 4R7WA 4AYGA 1U8KA 1CTMA 1OIMA 2P8LB 1BLNA 4HWBA 3UYIA 3S6OA 4IQHA 3HNVH 2VEMA 4QLKA 2VXVL 4DBWA 4OF5A 4O28A 5CCHE 2YAOA 4OT7A 5D70H 4M6VA 3L95A 1UUQA 3FNDA 2V2XA 3K74B 4F15C 4ZI8A 4Q4MA 3B7SA 3ZJ6A 4GKNA 3J7HA 5LXGH 3VDBA 3D6NA 3D33A 3C6LB 2IOOA 5HYJE 3JT2A 3K81A 3HHSA 2Y7DA 3OAZH 1XGPB 4M6PA 5HVWA 3KP0A 3OW1A 4OJAA 2W6RA 2C26A 5HHOE 1CICD 4I4WB 4UILL 4TNEA 1MI3A 4AG4H 1KBBA 3T65B 1T0NA 3GHEH 3MRLA 3MUHL 4HIHA 1JL8A 4CD5A 1HL8A 5DXYA 4RGOL 2ADYA 5I1KH 5EWIL 4Y9BA 4ELMA 5DJDA 2K6ZA 3JWNG 1XGTA 1A1OB 2YQ3A 4JTGA 1S7VB 2ZYSA 4QNPE 3TO4C 5D2LA 4B0MM 4KY2A 2OGJA 4OF3A 3EYQD 4ZTPL 4G6CA 2VDOB 4X6FA 1SJCA 1UC6A 2FJFA 1A6PA 4Y5VB 1B90A 3F12A 2KMWA 3F7PC 3MHGA 1AGEB 3NCXA 4KJWD 3VXNA 4CW1A 4AW7A 3K30A 4XWUA 3LEYH 1F1AA 2HK1A 3F7YB 5DHYB 4N8VB 2DQIH 4DGYL 3OJDA 5F7DB 2QHLA 3NIFF 4HU2A 3HN5A 1EJOH 2PR9A 3QQ9C 1IEXA 1MJ8H 2NY2C 3S6TA 2UZPA 1NTDA 1MPAL 1F8IA 3TYGL 4G8TA 3CFEA 2H3BA 1CB2A 3W56A 1KTDB 3BXNA 3R7QA 3HVDA 1KGCE 5A6JA 4L37A 3ZW3A 2DSWA 4AIOA 3UGEA 4LUJA 1G4EA 4TVUA 1RIVL 4N4QA 3CBWA 2NY6C 4JFZL 3BQVA 4JHUA 4CMMA 3VWKC 1HE8A 1O5KA 3KOZA 1CFBA 2CKBL 3KEDA 1IM3A 3ZDXF 3RWFA 2KPNA 5C08E 4WRHA 1KC5H 3R4RA 1MWAA 2IDTA 2DWEB 1A22B 2OWCA 5LAPA 3CL8A 5KBNC 4QDWA 3NABH 1OALA 1DEDA 4R3UA 5M03A 3H7LA 2LAAA 3L5WB 2AXJA 3VI4A 1I7RB 1R33A 2YPLE 3HFFA 3KCWA 5BV7L 1H5VA 4PV9A 3AQDA 3MS8A 2NLJA 2DLFL 1M3JA 3ESMA 5F1IB 2WLMA 2FTWA 3V0JA 2NXYB 3JWOC 1CE1L 4OVVA 3QEQD 3RB7A 5HQLA 1NCIA 4BFNA 1E6SM 3L5LA 1BAWA 2IANB 4TNFA 3ZL2A 2Y7GA 1N7ML 4WGKA 3B0YA 4PGEA 5D04C 3EH1A 1BPLB 2V5MA 3CUPA 5FF6B 4DUOA 3IFOA 5EO1B 3UAAA 3RG6A 3NUKA 4UV4H 2R8WA 4WV1C 4FKKA 5E8OB 4X7FC 2RDUA 3B9VA 3W6LA 3B9KC 5AFDA 3GNXA 3A4EA 1S7QA 4HAKA 1T7XA 4I3GA 3V5KB 1A2YA 1E43A 2CXGA 4EPEC 1BW8A 1GGOA 3BL3A 1GW1A 1UJPA 4YFDB 3TO4A 5FECA 2E6DA 3GUFA 1XH1A 3S3DB 2VW7A 3G24A 5EPMB 3GYEA 4OJFL 3LQZA 2BASA 1FG2B 3SIKA 5F7FA 1WAEA 2BNUB 1HE7A 3QUXD 1QU4A 5L2KD 4FK9A 4QE1A 1F11B 1ZZMA 3SO7A 2X89D 2YFOA 4ZK8A 4I9WD 1OPGL 3OKOB 3U48A 4KHTH 2DZXA 3DRTB 3VI3A 4O02B 3FQXB 2Y6TE 4A7VA 1UFUA 4M5ZH 3L13A 2JXMB 4AUYA 3SDYL 3RM4A 2CHZA 4MJ2A 2WLHA 1LBMA 3RPIB 1W1B1 3BZDA 5BO1L 2OR2A 3VRJA 5BZWB 4WJG3 2EO7A 3E0FA 4WTZA 2HUHA 2A77L 1G9HA 5F1NB 2OMWA 1HUVA 2W95A 5IMKB 3DX4A 2VRAA 3BWAB 3P4OB 4UMSA 3SGEH 4Q4EA 1QSED 2Y5TB 1YTKA 3SAZA 5IBXA 2CBQA 3W7EA 3Q1EA 5DGQA 1O5PA 3T0WA 1MJJA 1AL8A 4G8GD 4IU2B 1G1YA 3RWHB 5EZOL 1J9RA 3QK0A 1YJDH 5CHNB 1KXVC 4Q0XH 2ZC8A 1DO6A 3QNXB 3IGAB 1QFUH 2W9LA 4DBDA 2YB4A 4KK6C 4KKCD 4ZSOA 3MO1A 3KPNA 1HQRA 2WYHA 3EPOA 2YLHA 1AG1O 4QQ3A 4RWYL 4LCIH 2CKBB 3NIGB 2IBZX 1MAJA 1DQJB 3SQOL 3TPKA 1EEUA 1TJ0A 3X3GL 1DWGM 3R1GL 1JDDA 4XXWC 1KBPA 2DTML 4PTTA 4YHOL 1JYXA 1NCOA 4KI5D 1KTKE 1AXSA 1N68A 1JGVL 1BZ8A 2XSXA 3GMOA 2DUXA 1VBJA 1E1EA 3DRQA 4YDIL 5I1GH 4HXBL 3M17B 4LNRA 1RVFL 1JG9A 1UXMA 5BV7B 3M8OL 1ITQA 5LNVA 4B97A 1KOAA 1E1FA 5D2LE 2YBUA 2ZF9A 1NUFA 5SX4I 2V33A 1J9CT 5E2TL 5IQ7H 4O11A 1AH4A 3P8JA 1NEZB 3CUJA 3MUCA 2HZHA 5GGRY 1J12A 3P14A 4N9DA 7TIMA 3VWKB 5EU7E 1UUMA 4WV1A 2EEAA 4Q4PA 4DHLA 1B2WH 2BVQB 2JKRM 3U4KA 4UTAA 2VUKA 4F7EB 5EEYA 2VSCA 4NZTH 5AB1A 4ZOBA 1TQWA 1W9XA 1XZ0B 3L5JA 4NAMA 1TTQA 5C6PB 2QSCL 1E3FA 1IKFL 3AROA 4PD4K 3G1DA 4JN2A 4HF5H 5J56B 3FYYA 3NOEA 2UY2A 3NQ2A 4C6KA 1NJJA 3GG8A 2D03H 1HQ4B 2DT1A 4EZKA 3B2XA 3SUTA 3FDGA 4S3KA 4XOBA 2IH3A 3HE7A 2F8QA 4QRQA 4E9WA 1UWAA 1BKSA 1ICPA 4XNQA 3GVGA 1IV8A 2PTUA 3S9YA 1UUOA 1QWHA 3ZTCC 1KFJA 3UXFA 1JGUH 1KGUA 3H1ZA 1KTNA 1G7IB 3FJLA 4MZ2A 3NJVA 2IFFL 4K5PA 3S2LA 5HINA 1HSBB 4N3TA 4TNWF 5AZ2H 1UW9A 2VDPH 4L8SA 3GNOA 2P5ED 4DZHA 5FOBA 4X5LA 5F7MC 3BPOB 4FFVC 3F3HA 1JNNL 4U1HB 1NC2D 3BUQA 1JAKA 4L3EB 4FZEL 3FT4B 3MBEB 3VXQA 1JFXA 5TE7H 2X10A 4K7PL 4AD0A 1FHNA 1E9QA 2CHOA 3STEA 3X2QB 1LMIA 5FYKU 4MJZA 3SPCA 2OYLA 2P80A 4XBEL 4WK9A 3OXSA 4RISL 1D5BB 1RZGA 4KEVA 5DD5H 2PDYA 4E4PA 4JHAH 5HJ3A 4O1FA 4X6BA 3V0VB 2UYLA 4JY8A 2PDNA 2GCYB 3W81A 4FAAB 2ZA2A 1GC1L 2Z92A 3TSDA 3CFKB 4RMTA 1A5SA 1IC7L 3NZ1A 4AZIA 4WEBL 3NIDE 4AXWA 2H6RA 4KFNA 3QCUL 1W5OA 2QUNA 4RFEA 3APTA 3HI5H 3PF3A 1NL0H 2ZFAA 3D7PA 4YZFE 2W63A 5AOMA 3WSQL 4INFA 2H26A 1XR2A 2YRZA 2AOSA 2F8VA 3VXGA 3WJMB 4G7YL 3WK0A 2JJVA 1KB9K 1C5CL 3KM8A 5EMKA 3QQ4A 3V5DA 5AHIA 1P6AB 1NIFA 5CEYA 1OAYL 2J7BA 3EHBD 1URIA 4YE4L 1GGTA 4WDXA 4PMZA 1MLBB 2FECL 4UAHA 3EX6A 2M2DA 1RZJH 1T21A 1TQBC 1E1CB 1O6SB 5I1EL 1AMYA 5FYLE 3OZ9L 1QWKA 4ZZFA 1P48A 5DK2A 4F8TA 4HCHA 3MTWA 5F6IC 3RJYA 4EI6B 1WISA 2YQBA 2CETA 1ME7A 1LLWA 1A6ZB 4HYWA 3CXDH 1FA4A 1NIDA 3URQA 3HR5A 4N0FA 4JNZA 1DPMA 1CFVH 3NCJH 1FZOA 2Z31C 4GYPC 3NG3A 4NGHL 4YZWA 4NERA 1ZSDB 4OCLC 1DIEA 4MDPA 1EC9A 3QEGH 2W07B 3UZJA 4YTUA 4H20L 4NX0A 3M1ZA 5AVZB 3EOTH 4PL1A 3VTTA 3W1LA 2V6AA 1IXPA 3EYFB 1A6AA 4ZFMA 3H9SB 3NESA 4NNBA 5LHEA 3CHDA 1CFTB 1UWIA 4UNIA 5ABZA 1K9TA 1H61A 1JMZA 3W01A 4R85A 4IFOA 3B0PA 1UR9A 4GW4B 3IWVA 1LE5B 3T6CA 3VNJA 2J7LA 4QKXB 1JTTA 3IDMB 3WLNA 5GS2D 4BSWB 1K8YA 3PG8A 4MIMA 3E38A 4W8BA 3A24A 5L88L 5HY9B 2WZPD 2FJSA 4JVPA 2XNAA 4PJGA 1YJDC 1C8PA 4X4YA 2A9MH 1CCWB 3QMTA 4K3ZA 3T55A 1B2YA 3BJTA 4UFJA 5E9DD 4BF5A 2YA0A 2FRGP 2ADJA 4XHQA 1FDZA 4GAYA 3VXRD 1QMUA 1FAIH 1FIGH 4MB1A 3GLEA 5DD3H 5C7XH 1QHOA 1C7TA 4ZSOE 2VB5A 2OL3A 1A6VL 3BJFA 3P7YA 3T2QA 4Z9KB 4EXAA 4UOQA 4L64A 1OAUH 2AQPA 5TGBA 3D39A 2AJUH 2J8UA 1IQDB 1RCOB 1TZHA 5I3HA 1BQSA 3OKEB 3HQPA 3M7SA 4NRZB 3ROOB 4DVOA 3H53A 5EN3A 5I5IA 1KENH 1FDLL 4GUHA 2A74B 2D7QA 5KBKA 3DHFA 4TMCA 5T3XH 3PXJA 3U4BL 1NGZA 1FWNA 1TTAA 3QI9B 1TZAA 2D22A 4G5DA 1Q0YL 3CSFA 5IFJB 5H37H 3W0WA 5GQBA 4E9LA 1CE6A 3WG6A 2DD8L 1NJ9A 1JZ3A 5T33L 1QPPA 2FFIA 5A6TC 3M0HA 1F8TL 2GVGA 5AZUA 4ZX3A 1IT0A 1T1XA 1PD0A 3TWBA 1Y0LB 2X44D 2Q7NA 1QKZH 4NZJA 2WOBA 1H8OA 1PDZA 2H32A 2R4RH 2PCFA 1UBPC 4HBCL 2A3AA 2WXQA 3ML9A 4BKLA 1C08A 4TTUA 1VCFA 3DDGA 2VDMH 5IB3A 1EHKB 3WNNA 1QSFD 2EYRA 5BMXA 5E0QA 1X5AA 2A79A 1F42A 5BXFA 4XISA 2EKCA 5AYUL 4J3VA 4PMQA 4BZ1L 3LXAA 4Q7IA 4N6EA 1ORSB 3EXRA 4L8CA 1VCBC 2VC2L 5D4HA 3DG6A 4OBRA 1YMHB 3VXUD 2HMCA 2BHUA 3L9RA 5FM5O 4F7KA 3CFTA 4FO4A 1PO9A 1A3RH 1MXDA 3RVVD 2YB1A 4BQ5A 4DWHA 1NH6A 2YCLB 3OMNB 2FWOA 1NMAH 3W2UA 3OG2A 5TF1H 2R83A 4HZAA 2DZPA 2J8OA 4PS4L 4KU1A 5IEHA 1ETJA 1RK7A 1J6OA 3NZ8A 3QG6B 1SFHA 3TCEA 3EOAB 4WO0A 1ILSA 2ZX7A 3IJYB 4LKXB 2GOUA 3KWXA 2QKIC 5JQ6H 4JTRA 2ZP8A 2C0AA 1S7SA 3E0WA 3SZ8A 3GXNA 1Q6LA 1DO5A 2GSMB 3T2NL 2V3FA 1TO5A 4HKXA 4HH9A 3S97C 2GJ6D 3VFUA 5IHUL 2VZUA 3WMPA 1MREH 4HA1A 3BH9A 2EPOA 3BGGA 2R51A 4RAUB 1IBGH 1RJYA 1XUUA 1UB6B 2ZCLH 4XVOA 1TQBB 2A2IA 3NZUA 4WCJA 2NUPB 3KW8A 3D0LA 4PJ9D 2WQXA 1E4HA 4JTTA 3HE6C 5F6IB 3KPSD 4HSOA 3BKCH 1UH2A 2NY3D 1K5NB 4LHUD 3K6FA 1BYPA 1AA1B 4ZQRA 4HX1A 3KYKH 1VJIA 5ICUA 5IVZB 3AT9A 3GMMB 4X8GA 1BWWA 2XUCA 3DX6A 1NKGA 3UPAA 2PPCA 1LO5A 2W9EH 1U8JA 2D31A 2P5NA 2AXFB 2ZOOA 2CCRA 1XR9B 1FFTB 4YQXL 1N8FA 1AK5A 3MRRA 5A2CA 3PS7A 4NKOB 4TOYH 3D30A 1KT2A 3CH0A 1JS4A 3WD3A 3MY9A 1JXDA 2AQQA 3WQDA 5TQLA 3GH4A 4AENB 4M48H 4JTQA 4R9OA 2EC9U 2X6CA 5C07A 1RZJC 1CCZA 3ULVF 3AJXA 1W8NA 1N59A 1YNLL 4ZG1A 3MRNA 1XX9C 4OU1A 3KCLA 1GGBL 4MF4A 4M1BA 4HU0A 1OW0C 3VRIB 3RNQB 2WWNA 3ZTJH 4ZW5A 3VOHA 1AR2A 4JTFA 1W1A1 2E68A 2Y0SA 5IHZA 4X7SH 3RR4A 3RL2A 5DU7A 3OGVA 1NC4A 2VC6A 2AV1B 1BFVL 4JR9H 1H7XA 3VIMA 3H12A 5E99H 3GWQA 1EBPA 2ED8A 1B3ZA 4NNXA 4AKPA 1Q7QA 2Y8VA 3VXTA 3CMFA 1I4NA 3ZKQD 4LS2A 2ZSWB 4W4NA 1TEFA 4ZXBA 3BPNC 4AHOA 4AM0A 2XU9A 2DOCA 1P5BA 3D12B 3G6DH 3DHJA 3MLRH 1A1MB 2VAJA 2HBVA 4H41A 3CH1A 1QYGL 1IZJA 3DJRA 5HI5D 4DZAA 4CCDA 3J27A 1ZCOA 3T71A 1CENA 2ZOUA 3G6JE 1SUXA 4XPBL 4QGYA 2WXJA 4K3JH 1C8XA 4PE8A 4M62L 3WZ0E 4ZR8A 3S48A 4GRMB 3SUUA 4JFPA 3FUKA 4X8JA 3CXFA 1G9NL 3S1VA 2BP0B 1ZS8B 5CLTA 3E1F1 1I9JH 3FA4A 3ARBC 1LDCA 3S96B 5AHFA 1AGFA 2AKRB 1WT5A 2NX3A 5AVHA 1I7UA 4KFOA 5FGCB 1N8WA 1XT5A 4A2HA 1OQOA 4ZDHA 4A3RA 1T0MA 4NM8L 5LGYA 1X1ZA 3N43B 3VUSA 3MUUA 3WQFA 5IJKA 3PGFL 1VBGA 4CSSA 4ERAA 3QRLA 1SU5A 2J8UE 3IKCB 4TQHA 5CCKL 4S1RL 3S2AA 1TCRA 1EFXB 5K9JH 1QAPA 1DVQA 2PXYD 4AVJA 5CP3H 2E6JA 4V15A 3CN2A 1A7BA 3MOAH 5A16B 3KNBA 2C1PB 2YEZB 1AODA 4GP5B 3H2FA 1P0EA 1WITA 3LI1A 4JKPL 1PTDA 3VTMA 2VRQA 1FBIH 4K3HA 4DGVH 3Q43A 4QRRE 4XBPB 1ZHBB 7TAAA 4GI9A 3H2EA 1YMMA 3UZQB 4TUKL 3MCKA 1ETZB 4XBGB 2QHRH 1IBYA 3NIGF 2PCPA 4KMLB 3C2AL 1UENA 4W4QA 4JEGB 3GHBL 4KJYB 4Z7WA 5LNWA 3MV9D 3F5JA 5T5FL 2YMXH 3TN3A 5CBIA 3TYDA 3I02B 3Q1SH 4OM1L 2RBLA 1MEWA 1DJQA 3L81A 3MRGA 4A3HA 4K3EL 4IBWA 4NM4L 1OW0A 5J13C 2VJ0A 4XE0A 1I45A 3WO3B 2CO7B 1EJSC 2GSJA 2BSTA 1A7NL 3VRLF 3FN0L 4YAQB 4R7XA 3CPLB 1HINH 4UTTA 3DG3A 3QNYA 4TQEH 5E6YA 1X5MA 2D69A 3C0JA 3HE6B 4OI7A 1W8SA 4LOFA 1HEJC 1YYAA 2F53D 1U3HC 2R1NA 4ZUUA 2ROYA 4FQ2H 3B2MA 3M46A 1XHGA 2MFNA 4OD3H 1A4CA 3WLIA 4GD0A 4KTEL 4P5KB 4HIIA 3WL1A 5F9JB 4XO7A 1V27A 3RJDA 2J3SA 1E4KA 2X2HA 2Q87A 3TW9A 4LFHG 3O1NA 2ID5A 3V5HA 3OEXA 3IRSA 1NKRA 3CVCA 4O4YH 4OCXL 2WP3O 4S3EA 3TNBA 1B0GA 4H6QA 4K36A 3W7QA 5DRXB 3KPQB 3P4NB 2F1BA 3TN0A 1QLRB 3AUOA 2Y85A 2Z7WA 4R4FL 3VCNA 1ZT1A 3OB0H 5LGZA 4HCRH 5LIKX 4NPYB 4AD1A 2J75A 4BK5A 2FLRT 4RZ6A 3BP5B 4FFYL 3T3PB 3OMIB 3M0IA 2C1IA 3PNZA 5BMFH 4K8RL 4HWBH 2H9AB 2AF2A 3DGDA 2DKUA 5IHBA 3ARBA 2FO1A 2W9MA 4DEPC 3CHSA 4U1SA 3DHUA 1VRSA 1B57A 1MI5D 3H4GA 1LEKA 1FP5A 4HAFA 3SY1A 1YEDA 1QW7A 1OX4A 4AVKA 1ECQA 3ZZLA 3GKWL 5C6WH 1KBVA 3AS0A 3WLOA 1YN6A 4RDYA 3TOYA 1R3HA 3WX7A 3NIYA 3LGDA 5E2WL 5KSAD 1US0A 1FGNH 4L9DA 4AC7C 4MCMA 3WJLA 2XSBA 4NZFA 2X4QA 4HUUA 3BPNB 1E27A 3TBVB 2JF6A 5LN8A 2WWMD 2G75A 2PW2B 2XTLA 1MFNA 4OUUA 4ZQTA 1CIDA 2NV9A 4GYJA 4IBUA 3ABZA 4MASA 5DJ6B 4E9QA 4FNUA 4F7CA 3PTMA 1Z6JT 1EMTH 1LXMA 3TYCA 2HG0A 4X99A 3P62A 1OSYA 3K6OA 3SE4A 2J78A 4WI3A 3GDTA 2IPUG 3ZJ7A 5DTFB 2BS8A 1JPKA 4P2RD 4PRIA 3LDVA 1V6YA 4KMTH 3OGSA 4JJ5A 1NDMB 2A6NA 1UUSA 3OO2A 4FQLH 2N7BA 4RFOL 1J8HD 3ISWA 3ME0A 3PJXA 4MMZA 2FEDD 1GQJA 3EJRA 5BRZD 3PBUA 3ITLA 4EF3A 2W92A 2MH4A 4ZD3L 4CDHA 4N8UA 1XIGA 4DSYA 1CLYH 1L6GA 1EO8L 2HFGH 3WK3A 1PW3A 1YE4A 2XN9B 2EIMB 3MHFA 1JHLH 5AYTA 1IZKA 3R8QA 4BFIA 3RRQA 5D4QA 1S9YA 4W88A 4NZCA 4NNPL 1O60A 1I8IB 1NBCA 3VFNB 2DL9A 1TJXA 3SE3C 4POZC 5MEOA 4QTHA 4UQEA 1EXUB 2ZUSA 2P10A 4DESA 1MW2A 5BOEA 3LPGA 5JW4M 3GXIA 5KVGH 1FA2A 4R7DB 4V1YA 5CZVH 3GO1L 5M2FX 5FKAA 4N87A 1TQTA 2CZEA 3AXXA 5B8CB 1MWAH 4LP4A 4RMBA 3KPRA 1FP9A 3VSVA 3KBMA 4JFHD 4DWSD 1LNUA 3KPLA 5DQDL 4WGWB 3B1UA 1DXIA 2V5YA 1OFBA 3QR2A 4H6EA 4B9IA 3QHNA 2XSKA 2VMJA 1SEQH 4O4WA 4IHOA 1E5BA 5TH2A 5I28A 4M4RB 1FNHA 3ESUF 4ONFH 5JNYB 1DQWA 1V3LA 5D7KD 2CKRA 5D72L 1CZ8H 1IGCH 2P8MA 1ASPA 4XPGH 4W85A 1CECA 4HJWA 4YIQA 1MDLA 3GDBA 4Z3JA 5A40E 2GGGA 4LFYA 3QIWA 4JS3A 3GK8L 4Y16C 5DD6B 4AMWA 1QR1A 5E9XA 4FKHA 1U3HB 1YMME 1G7HB 3K7UA 1WF5A 4AM0Q 2TMDA 1JK8B 1MH5A 5DJ0B 3Q8FA 2QMKA 5GS0L 3FU7A 1O94A 3CVDA 2A3CA 3M4HA 3AREC 3ZVHA 2PDLA 2R0KH 4I6KA 4AG0A 2CLLA 2FTPA 1LZOA 4Z7WE 1AJ7L 2WK2A 1RP9A 2ATAA 3EOUA 1HYSC 1ZA6B 5E1IA 4EN3A 2O5NA 4MS8C 5FYLH 2H1PH 2EDTA 1BG9A 3FHEA 4I3RL 1WS7A 4TPRL 4JUTA 3IU3A 2VO5A 2DWXA 3HB3B 3LZ5A 4JY9A 5C0DA 1XYMA 2L7EA 4ZFFB 1Z8AA 2XZAL 5IFPA 1DEEB 2ALDA 3HN3A 2P24B 5K4ZA 2O6DA 4QE5A 2Q02A 4F8OA 1O12A 2E6QA 3LBCA 5EO9B 2WXOA 4OWGA 3L3OB 1INQB 5E5MA 2QJJA 3EW3B 1MCRA 3TEUA 1YTDA 1V3KA 1HIMH 1CK0L 1UWQA 4K8EA 1DQML 1WJ3A 1WB0A 3Q67A 3I9GL 5HYJB 2Z25A 4HPXA 2ZCKH 4WWNA 1L6WA 3BQUA 4FYTA 4XE5B 2FBJL 4FQHB 3MUY1 2DDQL 5HHOB 4TR9A 1VFSA 4PJAA 1DBJL 1UB3A 3X17A 1T7VA 2QDVA 4HGWA 2AABL 3UH8A 5JW5B 3ARPA 2FPTA 2MANA 3V35A 5FACA 1P4UA 3HG4A 1QBMH 3BK0A 1XGDA 4CLMA 2CR6A 3CMOH 4S1FA 3BO8A 3D51A 4LYKA 3PUEA 2UXGA 3VILA 4JS7A 5ECGA 4Q89A 2YWZA 1GW6A 2VJXA 4OAWB 3SJVA 2VDKH 5KANG 3TR9A 2GSIB 3T40A 4YVUA 1F58H 1FE8L 4LANA 4HPHA 2CK0L 2E09A 1PQZA 2VLME 1TDQA 3KRUA 3OD3A 5IV2A 1QEWA 1I4FB 3OBAA 2DYPB 2ISWA 1GW9A 1XP3A 3W57A 2UXFA 3BW4A 3GH5A 1RZIA 2ZF8A 2VSKB 1KUMA 1WXJA 4PCPA 4L5ZA 1FZKB 3V6OA 4OCNC 1QTYT 4F20A 1WYJA 5CLZA 2G9HA 1KV8A 4DERA 4JO1H 5ENWB 1V10A 2L0DA 4XC3L 5E95B 2X4NA 4Y5YB 3FTXA 1HWWA 1TV5A 4GAJL 1H15B 3T1FA 1SJEA 5AWNH 2UWFA 3LIZA 1YSOA 3UTPD 1G4TA 2VT0A 3FOMB 4QHKI 3SDDD 5IQ9B 1YEIH 2EDNA 4MAUH 2P43B 1HAUA 4JPKL 3TONA 1X5IA 3G5ZA 2VDOL 5T3XE 1NCCH 9XIAA 3CIQA 5HHXL 1L9SA 3EH3B 3KM2A 5HNTA 5BQ7A 5DSCB 5GISH 3AT8A 1JPTH 4N2FA 1PYFA 4Y16A 2Y7EA 3QG7H 4UNVA 4QY8A 3DDFA 3V8OA 1N4XL 2PUQT 4L3FA 1A9EB 2MHAA 1AY1L 3AYTA 4ODHH 4E41D 1OCQA 4B5VA 3CUGA 2FX8L 1IU1A 2BPBA 3FQNB 2OLHA 5F7BA 1DWHM 4Y9NA 2C4FT 2FZ9A 3O0FA 4LSPH 2COVD 5C08B 4GUPA 2R0ZL 2FO4A 4EXPX 1S2CA 3HPLA 1S2UA 4UTAH 2I32A 4PRIE 3K72B 5K1NA 4FG6D 4AVIA 3N4FA 5T1JA 5LHDA 4AX6A 2HKHH 1OFRA 4Y96A 1BYNA 5JW3L 3IJ9A 3W87A 1A3WA 2N59A 1WDWA 2EE0A 3W1MA 1J1OH 3S88H 3UETA 4OIFA 4ICCX 5EC1B 1F2XK 1RU9L 5F70A 4XWOC 1MSSA 3GI8H 4W6WB 1D5XA 4ALAH 4L3AA 1FCUA 5D1QA 3SPGA 1I1AA 4DZ8A 1AW2A 3BUIA 1E0OB 3GBML 1I3VA 1MCLA 4OF0A 3IJQA 3H2PA 4R53A 4UTLA 1CT8A 4TSAL 4OFPA 1E6JH 3TYFA 2R91A 1S7TB 4Y9CA 4XH2B 3DTUB 2WWKO 5D7JD 1HSAA 3NTYA 4NZ8A 5DYOA 2WMPA 3AQXA 4ZZKA 2B59B 3I6KB 4HIQA 5AW8B 2V81A 2FX7H 4D0CB 2QQLH 4D6HA 4G3YL 4WX2A 3HFMH 4M1CC 5TFSL 1O5RA 1KNOA 4KWWA 3GNDA 1XH3B 3IIZA 1RMFL 1DANT 4D0BB 1RUQL 4HZ6A 3ZBMA 1R5IB 4FQXA 3KPRE 4E36A 1MJ7H 4N02A 1HCZA 1ACYH 2R0LL 4G5ZH 3FU8A 2VKZG 3KBPA 3WDQA 4NU7A 4G1EA 1CD9B 3EXLA 3H7BB 3PTDA 1H0GA 2O7QA 2FX9L 4Z0BL 3ZLGA 1LOQA 3V4UH 4DN1A 5GPRA 4JFOA 3QXDA 1G0CA 1YECL 1YEEL 5DRWB 4GP8B 5JIWA 2C9XA 4N2EA 4ZZ9A 4LEFA 2GAZB 5DJZB 3VDHA 1BBDL 4R34A 4F4RA 3W5NA 1WZ1H 1JZ4A 3WSUA 3TNOA 3PWLB 3MJ9H 1A5UA 2Q8AL 1DHPA 4WUUD 3V6FB 4PRNB 2FYMA 3GJFK 4N9CA 3CEUA 4XNUL 1MY7A 3TA3A 4DPQA 3MCYA 3IIPA 2LFGA 4BH8B 3HMXL 1Q72H 1EUUA 4WI0A 1GTEA 3KCPB 4WTQA 3N43F 3IMWA 2AQSA 4MD0A 4O10A 4Q2ZA 2IALA 5BWAA 2HAZA 3DFPA 3QIUB 1CDYA 3GS7A 1X9RA 5EOTA 3VB8A 3WQ5A 3QEZA 4NJAH 4X2PA 1CU4H 2PC4A 1IILE 3X3FH 5F4XA 1BDYA 3R7MA 4P5UA 1GVOA 3QVAA 1XCQB 4L1BA 5E6IA 1NBVH 3EG9B 3OZKA 1NGWB 2Y6ZA 2TRYA 1SJMA 1YYMH 4O02L 1IC4H 2WIIB 4HV8A 3H3PL 1KXQE 4OT1L 2QEJA 4IKJA 1MF2L 1U8KB 1N82A 3PUCA 2EINB 3ZIZA 1BLNB 1G5AA 1N8ZB 1WQ5A 3WXVH 1SM3H 3LNHA 2WKOA 3OC5A 5HR7A 4YDVA 2V2XB 2MUCA 2VD9A 3HPAA 1R5VA 3NDYA 3TV8A 4GKNB 5DI8A 4XN4A 3HC0B 3ISRA 5I6KA 3QUZD 3DVGA 5DCBA 1KBJA 1PZ3A 1E0XA 4UI2A 1DQUA 4PJAE 2R15A 4OIBA 1BIHA 1EANA 2X05A 1T0NB 4HIHB 3MRLB 2IPWA 1RJZB 3VGEA 2QTEA 4HG4J 4IK7A 2DSUA 3HIJA 2YCEA 5B21A 5IBXC 3GHTA 2HPMA 3FTYA 3LI0A 3OKMB 4HK7A 4BFRA 5JH2A 1WDRA 4L23A 2VL4A 4LEXH 2CIKA 3PBYA 3GU2A 2ISSA 1WHPA 3SJVE 4M1RA 4PGCA 3UBXG 5E4AA 4TSBH 4JDYA 3MRFA 1MZZA 3MRCB 2WXFA 1S6NA 5IY5B 1QFHA 5HNUA 3BG5A 2FJFB 2A7BA 1D9EA 4UT9A 3STFA 4FQ1H 3RIAK 5I3GA 3TXVA 1GKPA 5C09A 1T8QA 5FOOA 3F12B 4P4KD 3BT2L 3VXNB 2OL3H 2BSSA 4GO8A 1I2RA 2YPIA 2N3JA 4PJBA 1AS8A 3UJJL 1KIUA 5ESVA 1CDIA 3WUWA 4L0ZA 3QXWA 1GGCL 3ZJ8A 3SFWA 2ZTJA 3GMRB 3OJDB 4GVIA 4WK2B 3PWGA 2V8ZA 2IPUK 1ES0B 1HO4A 3T3PF 4YWIA 2BSRA 2AQTA 5T8GA 1N3NA 3CFEB 6ALDA 2A21A 4B27A 4IGBB 3R0NA 1KLZA 1I3RA 4D9RE 1GOWA 3GSRA 2DMHA 1EHLL 3O45A 2XM2A 5CGYD 4LVEA 5D7LD 3MTRA 2VDLL 2DP3A 4PJ8D 1JRHI 2GBVA 1SQMA 4R7VA 4KRPB 2VOTA 3GINA 5FB8B 3CLFH 1FZMA 4NZUL 3OX8A 3DFOA 1UKSA 4I85A 4XVJH 2J66A 1IM3B 2H32H 3BW9A 2P45B 3LHUA 2FL5B 1OB0A 4UANA 2Y7NA 1UHVA 3LKPA 1MWAB 5E94A 1OWRM 1SOQA 4D8PA 1OSPH 1YQ2A 1M65A 2XVGA 5GRUH 1Z9OA 2K9UA 1PZCA 1IIKA 4MA8H 8A3HA 5CJ5A 3JWOL 2G4FA 4DZ5A 5D9PA 3S9DB 3HI6L 1S5NA 1L9TA 1U8MA 4AFYA 1UD2A 1T40A 2IQ0A 3SY5A 4PV9B 1M6OB 2WJZA 2X4PA 4ALAC 2OX1A 3HE7C 5J6GB 4J4PA 4EOUA 1U0QA 3WL0A 4PULA 4GMSH 1XIIA 5EMMA 1ZANL 2O6PA 3NIDB 4CVWA 4LNYA 4QRFA 4F15B 4NLHA 3KRZA 4WJEA 1XGZA 5D1QE 2YKLH 4O9HH 2KPWA 5GJTL 3ORWA 2BP3A 3M7FB 5J1AA 3HHRB 5GRXG 3WH7A 4L8SC 2HPOA 4XAKE 3OJGA 4RZKA 2Y8UA 4NUGH 1A3QA 5IR1B 4F37K 3QPZA 2WTRA 5CD5C 5D2XA 1KDJA 1MG3C 1J6PA 3C8HA 4U0QB 2EIJB 3O6CA 5JHDB 3B8IA 3ITGA 4JGNA 2WNQA 1A2YB 3BWSA 1A4BA 3TO4B 1PBGA 3SYPA 2VVNA 1L6XA 3LQZB 1A66A 4LSTH 9CGTA 2PGFA 2CGRH 1JP5A 3G6AA 3LH2L 1B3OA 4W87A 5DQJA 3P4LA 4L3CB 1QBLH 4XAYA 3UX9B 3QUMA 3A67H 2D0FA 3SYOA 4RMUA 2LE9A 3WMCA 4RPPA 4ONGL 3W22A 2Z29A 4E2OA 2Z65C 3WYRA 3TTQA 1LWRA 3SGDH 1L9RA 4GOSA 4HCFA 4GG8A 5T1DH 1ZCCA 2EYSA 1X96A 2E7BA 2CKNA 3HPJA 3V36A 4JO8A 2NY2B 2WB5A 1V0NA 1R3JA 4EI0A 1QI4A 3CHEA 2IDFA 2OMWB 4ELME 4MYAA 4ZO9A 5EHFA 4UM8A 5JUEL 2MOGA 4DP1X 2J1XA 3OG4B 5EBUA 2R1XA 4RAVB 2NY6B 3OLDA 2VLJA 2V9QA 2UY3A 3UCDA 4FFWD 4JX0A 1GEHA 1FYTA 2B1AH 1MJJB 3BZJA 5JDJA 1MUMA 4QROA 3KYMA 3RA7H 3URAA 3PZOA 3DROB 1S5IH 4AC4A 4OUEA 4EO5A 3PK7A 3Q5TA 4MYPA 3V8CA 3GT6A 2HX8A 4AW4A 3PHSA 4ZSOB 2Z00A 2VDLB 4AG4L 3KPNB 1M7JA 4UAOC 1X6NA 1HQRB 3GHEL 4TOQA 4GI4A 1PTAA 4Y2DD 3PB2A 2V67A 3O6DA 1LEIA 2JELL 5I1KL 4KF1A 4CMHC 3H56A 3BDBA 3NDYE 2E7HA 1ETA1 3MUJA 5DBUA 2VR8A 2EPKX 3SSGA 4C6JA 2XXCB 4OLEA 4KK5C 5F7NC 3R1ZA 2R29A 4ZNCD 3NA8A 3CFDB 1GMEA 3BUYB 5ECJE 4LYRA 4OKVA 3GS6A 3A64A 5F4WA 3I2CH 1KPVB 5C0EA 3JV0A 5FR3A 1WCQA 3DRQB 4QSHA 3NK4A 4PI0A 3PABB 5E2JA 3BMXA 3I6LD 3NTCH 4F7PA 4LFHD 3VJ6B 4EANA 4ABQA 5KVGE 1IKNA 1J2BA 3STZA 4FNRA 2YGYA 2L8AA 3MU3A 3LQAH 3G22A 4KROD 4WV1B 1MJ8L 5EYWA 1GOMA 5IB2A 3BOFA 4MJ6A 5CJ8A 3CV6A 3B9KB 3EA2A 2XICA 4TTDD 2B0MA 4AD5A 4A7GA 2GQ9A 4PJBE 5F8RC 5DS1A 4LUSA 3OM3B 3VI4E 4X4ZA 5FLVA 2PEVA 4S10A 3CNYA 4QNPF 3K0YA 1LEGA 4ZTEA 2PO6A 3PF2A 4HS6A 1AD1A 2XISA 3QC5X 1YC8A 1LWJA 3QJZA 2N0MA 1RJCA 1JULA 4ZMOA 3INUH 3MJ9A 5AW5B 2KZHA 3FMGH 2VCCA 1EVUA 2NZ9D 2IH3B 1OM0A 4QRQB 3A9BA 5I6XC 4KV5E 4JM4H 2A73B 1KC5L 5EULV 2NV2A 4KO9A 2PZNA 2PW1A 3QPYA 2JF1A 3MX0B 2QEZA 1N55A 3EBVA 3TZFA 3PJSA 2ZVIA 4I0CC 4OJCA 3PTQA 4J5NA 3ZGHA 1UUNA 4QT5B 1VGKA 4NBZB 4NO0D 3ATAA 2X0SA 3EJZD 4BKNA 1QT1A 5GRVL 4WFFD 3VXQB 1JCXA 2HKAA 4BQBA 1HKWA 1E9QB 3QJFA 1ZK5A 3CDGA 3ATBA 5IB4B 4BFAA 1E4XI 4PIRF 2AQOA 1VEOA 3RY4A 4HZMA 3OXSB 4KKAD 5KSVA 4K73A 1VYSX 4WSJA 4OZ4B 3MJYA 2QADD 3BN9C 4BZ2A 5HJ3B 1JZ6A 4X6BB 1GRWA 3GSWB 2UYLB 1MNZA 4KCTA 6TIMA 3E6HA 5JW4N 3H4FA 2PDMA 3ZR5A 4WEMB 5ISZA 1TJHL 4BF7A 4CGTA 4YXKL 3VI3E 5ABGA 1S9VA 2C9AA 5ELIA 1XSOA 4LUTA 4UNKA 1NCNA 4RFEB 1OX6A 2CITA 3BFWA 5SX4H 2C7FA 1I2OA 2EDXA 5CG7A 1TV2A 4L6DA 3RTQD 2H26B 1SDYA 5J5EA 4FFTA 3NAAH 1UB5B 4HK0B 3N15A 3AWGA 3QQ4B 3V5DB 4WFHE 2GK1A 2HWGA 4IF2A 1E73M 5CEYB 4ADSA 2ORBH 1T5WB 3MXWH 4ATWA 4UM9A 4M6OL 1M41A 2QCGA 5HMDA 4TSCL 1XSJA 1QR4A 5DK2B 3P3RA 2HJLA 2HJPA 5BVJA 1JGLH 4JCLA 1Q0EA 1QNPA 1BAGA 4M5ZL 1FNSL 1UASA 3F7QA 4KW2A 2YWYA 4CADB 2INZA 4DT2A 4YLBA 4IIHA 3O2DA 1KJVB 3TL5A 4O1DA 4RNRB 5D8JL 3EOSA 3M47A 2VCAA 2WLLA 3STPA 4GSQA 4R88A 1E70M 4I5XA 3PTKA 3X13A 1T22A 5E6RB 2I5YL 3FB6A 3C61A 2YKKA 4AMXA 3RNKA 1M57B 4HWUA 1R24A 3WLMA 4N1HB 3AWOA 4XP1H 3NXLA 4XMVA 3SBQA 3D85A 3ARGD 3HMCA 4K9EH 3UA4A 9RUBA 1YJDL 2YAPA 5D7IA 4Q0XL 5AHMA 3SIMA 2BNRD 4XNBA 1QFUL 2YAQA 5A3ID 3O3BB 5LQBH 3G6JB 1UM5H 3OMZA 1K2DA 2V17H 5TF0A 3BKJL 4DKAA 1KEML 5H8PA 2QIIA 1IUZA 4LCIL 4WY0A 2VLJE 3MUXA 2CK2A 3EX4A 1FYTE 3BHBB 2POTA 1GMIA 2DJUA 4Z95H 2J7FA 1RPKA 3U9UB 3SECA 1HKJA 2PLKA 2G37A 5JLZB 3B3DA 5I6LA 4YFLF 1U2CA 5AYZA 2ZKXA 4UTIA 1RURL 1E3ZA 3HB9A 1T6WA 3QXAA 1RZPA 2OL3B 3FO0H 5JHMA 3WFAA 1JVLA 4MAYA 5J57B 1QFEA 3DJ9A 3FUMA 5I1GL 2EDFA 4MZYA 4ZXBC 1NOAA 3EFDL 2VXQA 3PS6A 2WMJA 2R4SH 3O8XD 2J8UB 3CFIC 3ZTDC 5L4JA 5D7EA 2QPUA 1VIZA 3ECUA 4YVPA 2VD8A 3UZEA 1O7SA 3DYOA 1MRFL 1CIUA 2XVKA 1M6JA 3MRHA 3VD1A 4PGLA 1KCLA 4JPSA 4XPAH 3V4BA 2P5WD 3GKFA 1JPIA 2AK4A 4QRRB 3MJMA 4ZXOA 3WIFA 1CEOA 4NZTL 1TJIL 1K7FA 3LQAC 3EB4A 3ELQA 4L0PB 2XX1A 3RX4A 5DVPA 3MV8D 3SDAD 3IVTA 3SE8H 2PWFA 1WT5C 3BVXA 3CDZB 3AIRA 1OANA 3HIZA 4JRLA 2J62A 4HF5L 3NCEB 5DCEA 5I06A 2PCFB 1CGTA 2D03L 2C3VA 4BKLB 5IJKC 4JG0H 4EUPG 2W65A 4Q8TA 1ADQA 5IB3B 2UBPC 2EYRB 1Z5YD 3FC8A 2JIXA 1YDPA 1IGJB 2Z91A 3CBJB 2A4EA 2XJLA 3D3VD 1PZDA 2FJGB 3ZTNH 3TEWA 3AAZA 3KRBA 5DJCA 3GIVA 4Z76A 5AZ2L 3S1GA 3DTXA 1U8NB 5K9XA 2KLSA 2EDKA 43C9A 3SRDA 2Z31B 1O6IA 1S5HA 2CLMA 1R0AH 3QUYA 2WM0A 1XSIA 2A3BA 4N4YB 1I8LC 4NF7A 4O12A 4FZ8H 1MIEL 1DQXA 1BQ5A 3SJNA 4KO6A 3WIIL 2H6PB 1JUEA 3BJ91 3OKLB 1LLZA 5IEHB 4G9FD 3W9ZA 1JV5A 2F58H 3NZ8B 1TE6A 5D2WA 4D6EA 1JCNA 2ZUQC 3NQIA 5DD5L 3JW7A 1SDDB 1KCXA 4ACYA 5JTWA 4B5XA 3KTXA 4HKXB 5CP7B 2A9NL 3GIZL 3P9MA 2VC7A 4EPSA 1B6UA 1PTZA 6ENLA 3ZRCC 3AZUA 3BH9B 4LL1A 4V2CB 1MVYA 5I1JH 2VE6A 3PIQB 4MVBD 4UTTC 4X4MA 3L5HA 4HK6A 1M42A 4S1DC 1QD0A 3W1TA 2WUCH 4N8CL 3CQQA 5C0CD 4AYBA 3T2LA 1HHGA 4BQ3A 5CS7A 2YL9A 3CSTA 4HX1B 5I66A 1NINA 5ISZE 4MTMA 4F92B 1E6OH 2GFBB 1J5OH 1QG3A 2ZZ3A 2E1DA 1E4KC 1LO5B 2WJ7A 1U8JB 2D31B 1RZJL 1OYCA 1LO4L 3WJXA 2WZ5A 1XISA 3FEMA 2OFQA 4FQJH 3GM0A 5LBVA 1W0MA 2XFGB 3MRRB 3VZYA 1J1PL 3TIMA 1KT2B 3TN0C 4W7UA 3HAEG 3CXDL 3TT1H 8XIMA 4NJIA 1K8XA 1JPFA 1MJUH 1HXJA 1ITXA 1CFVL 1N59B 5IM7B 3TH6A 4BK5C 4UIKH 1WBJA 4MNGA 3N2JA 4PJGE 3NSDA 2ZA1A 1TZZA 3QEGL 3FCBA 3KTSA 4YZFF 1NDYA 3EOTL 3FONA 2ZTBA 1PCWA 3PP4H 1G4PA 3B9EA 5IHZB 1Q94B 1NMBH 2H5UA 3UTTD 1F3EA 3RL2B 1UZ1A 3U7WH 1W8OA 1NC4B 4I9XA 3BOXA 4F24A 5CZXD 4ZAKA 3W11D 4LYPA 1IARB 5FJTA 4QHMB 3BOLA 3D39E 2CG9X 1Y1UA 3ARDD 3WNKA 5I3IA 3KBJA 4NWUH 3VXTB 1JCMP 4AZBA 1S7XA 5CQ1A 5CSUA 1B0WA 1QO3A 2EP6A 3UXIA 4DP8X 4K9EC 3WJLC 3LIZH 4YTSA 3TS8A 1H6UA 2YA1A 4ZXBB 3WXWL 3C8DA 4AM0B 1SBBA 1R3RA 1M9WA 1KCSH 1S7UA 2CO1A 3VKBA 2J4WL 5D7IE 1X9LA 3CT2A 5H35A 5CUSH 4XR8C 3W0WE 1I8LA 3A13A 1XYCA 1A4KA 1RK0A 1FIGL 4BFEA 5DD3L 4QYAA 3TNNA 3VWJD