3H56A

Met150leu/phe312cys variant of nitrite reductase from alcaligenes faecalis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
335
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGLNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Directed evolution of copper nitrite reductase to a chromogenic reductant.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 90
structure length 335
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h56A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h56A02
2CUAA 4HCIA 3BQVA 2HLEB 4YSDA 3QPKA 4G72B 4G7RB 2FT6A 4E9YA 2R7EB 1L9SA 4MFHA 2AZAA 2B08A 1GYCA 5B3SB 3MX0B 1PZCA 1OE2A 7PCYA 1AG6A 2YAFA 4N8UA 1EHKB 8PAZA 1MG2C 1SJMA 2XXFA 2BWDA 3PAUA 2TSAA 3D12B 1W6WA 2IH9A 4F2FA 2GSMB 3AZUA 3PAVA 1R1CA 1KBWA 1SFDA 2XX1A 5I5JA 2IWKA 3T71A 1BXAA 1PLCA 4DP2X 3NSDA 2QPDB 2PLTA 3EF4A 2GIMA 3OMNB 1VLXA 2UX6A 2R7EA 2X87A 2IDUA 3S8FB 4DP0X 4DPAX 1GS7A 4P5SA 1KYAA 1GSKA 2VM4A 3NP4A 4AKQA 5B7MA 4HZ1A 2AZUA 3AG2B 2E86A 1QHQA 2I85A 4YSAA 5I6MA 2UX7A 3C75A 3IE9A 2IDTA 3S3CB 2HX7A 4YSUA 4A67A 2YAPA 1IC0A 2FQFA 2HX8A 2P80D 3T6XA 1WS7A 1AS6A 2WSDA 2PPEA 4AX3A 2JFCA 1SNRA 1KDIA 1GY2A 3QQXA 4Q89A 4HCGA 1PLBA 2GC4C 4HHWA 1OV8A 1BQKA 2FQDA 3TBCA 2ZOOA 3KW8A 2FTAA 3WKQA 1ZV2A 1WA0X 2AANA 3OM3B 3PAZA 3FPXA 3IEAA 3NJMA 4E9VA 3IN0A 3SBRA 5AFAA 4YSEA 3ZX1A 1KCWA 1AIZA 2GHZA 4ZK8A 4G7SB 4HHGA 2RACA 3NYKA 5A7EA 2EIJB 3GDCA 3KW7A 1KV7A 3PPSA 1MZZA 2BWIA 4KO9A 3EH5B 2XWZA 3IBOA 4DP7X 2PP8A 4UANA 4E9WA 1L9QA 4UF7C 1AACA 4A2HA 3T6ZA 2BZCA 1CYWA 2Q5BA 1DYZA 4DP6X 2XUWA 1V10A 2BZ7A 4YSPA 4DP1X 1AAJA 1ASPA 2UXVA 5EHFA 2CJ3A 1IUZA 4F2EA 5TK4A 3X2QB 4HCFA 1NZRA 5B1JA 1MZYA 1IKOP 1BQ5A 1EZLA 1RZPA 2IDSA 3N2JA 2PPFA 4RH4A 4PCYA 1KDJA 2DYRB 4FA7B 4WTQA 4A66A 2BW4A 3NT0A 5D4IA 3BVDB 5B1AB 4GYBA 2PP9A 1X9RA 3NJKA 2YXWA 3H4FA 2DV6A 3FU8A 4DPBX 1RCYA 3SBQA 2BP8B 4HIPA 1JXGA 2HZHA 4KO5A 3WG7B 2YARA 1SHXA 3CDZB 3WNIA 1NWPA 2AFNA 2IAAC 4QKTA 2X88A 3NSFA 3T9WA 2VSMB 3X1BA 1JVOA 2W88A 4BWTA 5IY5B 2W8CA 2H3XC 2PP7A 2YAMA 1CYXA 1GW0A 2CAKA 3T6WA 2XLLA 1XB3A 2VW6A 3ABMB 2BP8A 4K9JA 3RYMA 4A2DA 5F7BA 1WS8A 2DY2A 2XU9A 2YQBA 4YSOA 1OCRB 5E9NA 1JERA 3NJNA 3CDZA 3NSYA 1ETJA 2DYSB 2AVFA 3NJGA 1PZBA 2HX9A 4E9SA 3AY2A 5I6OA 5I6LA 1KCBA 3FSZA 1AZRA 3JT2A 4YVNA 1NIBA 5I26A 2PPDA 1ZIAA 4HAKA 4GXFA 2HRGA 1F56A 2J55A 1JZIA 2PPAA 2QDWA 1AQ8A 2H5UA 1E5ZA 3HB3B 2FQEA 2YXVA 5I28A 3AG3B 5AZUA 4BWWA 3FSWA 1GY1A 1AZUA 4E9RA 5B1BB 3DIVA 4KNSA 4YSSA 3SBPA 2YAQA 3NJLA 1YLBB 3S3DB 2UXGA 2P80A 3WIAA 2YAOA 1SF5A 4KOCA 4A2GA 3FQ2A 1E5YA 2IDFA 2QDVA 3GXUB 3QJTB 1AR1B 4YSTA 2MRYA 3CVCA 4DP9X 1W6LA 2UXFA 1ZDQA 4JHVA 1ZIBA 1XMEB 3EH4B 2YAHA 4GP8B 2B3IA 3UAEA 3ABKB 1RKRA 4DP5X 1ASOA 5D4JA 5ANHA 1JVLA 3H56A 5D4HA 2XV0A 1BYOA 3FQ1A 1X9UA 1XB8A 2DWSA 2VM3A 1JXDA 1TKWA 4Q8BA 1NIDA 5I6KA 2OCCB 1KGYE 3FU9A 1GS6X 4KO7A 2J5WA 1TU2A 1ASQA 4QLWA 3ASOB 2XX0A 3UACA 1WA2X 4X4KA 3X1NA 1V55B 2VW7A 1ET7A 4KO6A 2JKWA 1GR7A 2FQGA 1PMYA 1FFTB 2OV0A 3V9CA 1BXVA 2PPCA 3CG8A 2FWLB 2J56A 1AANA 4KOBA 1E65A 3EHBB 1FWXA 4BXSV 2VSKB 4M3HA 1A3ZA 3TBBA 3PLYA 5I5IA 3TU6A 2EINB 4KNTA 3S3BB 4A2EA 3FPYA 3QJQB 1L9OA 1WAEA 1A4CA 2CBPA 3FYIB 5B1KA 3EH3B 1PZAA 2J57A 5AKRA 4BWUA 4DP4X 4JKNA 1J9TA 1IBZA 4DPCX 2BHFA 1BXUA 1JOIA 1B3IA 4AI7A 1FA4A 6PCYA 2ZXWB 2BW5A 2IWFA 3CVDA 1PY0A 1KBVA 4YSQA 1CUOA 1PNDA 2LLNA 1AZCA 5TK2A 3FS9A 1TEFA 2DWTA 2BO0A 5FC9A 4AKPA 1NICA 2FJSA 1BAWA 2MTAA 1W8EA 2A3TA 1OE1A 2GC7C 3UAAA 3CVBA 3UABA 3FYEB 1MG3C 4NERA 4YSRA 3ZIYA 2IWEA 3DKHA 4G70B 4CSZA 1A4BA 1BQRA 1NIEA 2EILB 3T6VA 4E9TA 1OOWA 3ERXA 3IN2A 4E9XA 3V9EA 4GP5B 4YVUA 4G7QB 4W1TA 4G71B 2HXAA 1JXFA 1ILUA 2I7OA 1BEXA 2BP0B 1L9TA 1JZJA 1M9WA 1ID2A 1XB6A 1ADWA 1T5KA 3JTBA 3S8GB 5PAZA 4AZUA 1OF0A 2ZONA 1AZNA 1ET5A 2GI0A 1NINA 1A4AA 3NJIA 3UADA 1ET8A 1DZ0A 7PAZA 3NP3A 1HAWA 3HEIB 2PCYA 6PAZA 2WO2B 1SFHA 1A65A 4JHUA 3TASA 3X1FA 2NRDA 1E67A 3NSCA 3FU7B 4TXVB 2QPEB 2BP0A 2XVBA 4HALA 1RZQA 2FNWA 1QLEB 3FQYA 4BDVB 2QT6A 4YL4A 1L9PA 2GB2A 4DP8X 4E9QA 4F7KA 4YSCA 1N68A 1J5CA 3FSVA 3PXLA 2CCWA 3N55A 2JXMA 1PLAA 1NIAA 4FAAB 1NDTA 1GS8A 2XYBA 3ZDWA 3DTUB 2I7SA 3FU7A 2TSBA 2Y1AA 1SDDB 3NJFA 1JZHA 2N0MA 1HAUA 2CALA 9PCYA 2WO3B 2VW4A 4BDVA 3ASNB 1OCZB 1A8ZA 1WA1X 3OMIB 5B7FA 3FSAA 3MBWB 1PNCA 1IBYA 2VMJA 1CC3A 4CSPA 1MDAA 1NWOA 4KNUA 3AG1B 5I6NA 4W9ZA 1AS7A 1BYPA 1L9RA 1NPNA 2FT8A 1SDDA 1CURA 3WNJA 3CZUB 1AG0A 5PCYA 2VN3A 1HFUA 3TA4D 2ZWNA 3H4HA 2XV2A 5LDUA 4P5RA 2XXGA 1AZBA 1OE3A 3ABGA 1E30A 2PCFA 4GP4B 4AKOA 4GY4A 1ZDSA 3QJUB 3ZBMA 2H47C 2XV3A 1UATA 4L0PB 3U25A 1J5DA 1ILSA 1JZFA 1NTDA 3QJSB 4NB7A 1AOZA 4PAZA 3L45A 3AG4B 1URIA 4NAJA 1M56B 4WKXA 3WI9A 5I5MA 1OCOB 3GYRA 1J9SA 5B7EA 5F7AA 3WKPA 4A68A 1OCCB 3UGEA 2EIKB 2IH8A 3NJJA 3QJRB 4UAHA 3X1EA 4ENZA 1SHWA 2EIMB 4N4YB 2FT7A 3SQRA 1TEGA 3QJVB 1I53A 2HRHA 5B1JC 5I6PA 4BK5C 3AW5A 4EF3A 3X1GA 3OD3A 1PCSA 2Q9OA 1NPJA 2Y69B 1J9RA 2IDQA 1ZPUA 1N70A 1NIFA 4A2FA 1QNIA 2YAEA 3ABLB 1AS8A 4M4RB 3OMAB 2UXTA 1V54B 1JZGA 3OQRA 4BXVA 1PF3A 1JZEA 3PCYA 1J9QA 3NJHA 1SF3A 2OJ1A 1M57B 1PAZA 3FT0A 2GBAA 3G5WA
chains in the Genus database with same CATH superfamily
2F53A 4M4PA 4OD1L 1OAZL 4WJKB 3PNWA 4PJBF 4AITA 5KSAB 3IDJB 3L81A 3ATEA 1U8IB 1D5IH 1M7UA 2APVA 4L3EE 5D70L 5JYMA 2FT6A 2G9HB 4ZBJA 1J05A 4CU8A 5IB5B 4JFEA 4H2CA 1I1RA 1QSVA 3W9DA 4HJGB 1RJLA 5B3SB 3L5XH 4ZFOB 3WO3B 4KGJA 2Y5TB 3S6CA 4F92B 2DQIH 3U79A 4LU5H 1K85A 2YWZA 5E4AA 3NIGE 2BSSB 4I9WE 2WQRA 2NY6D 4XN1A 4D9RD 5HGAA 3SO3B 3KPNA 3O11B 1IM9A 2GSMB 1PX3A 3GIZL 4X9FA 1DSFL 2IBZY 4ZX4A 4K9EL 3T71A 5CEXA 1JCKA 4XMWA 3E9TA 4ZRGA 5T1MA 1GC1C 2V8LA 4JKKA 4K73A 4U1KA 1Z5YD 1LXMA 2NT0A 2NXZB 2UZXA 2X87A 3B5TA 1KFAL 1J48A 3MRRA 4PJAE 4WV1C 4XCCH 1UM4H 3IJ8A 3QJFA 4W4NA 5DR5L 5GGRY 3BZFB 4QXTA 1Q9WB 5HJ3B 4BKLA 4DZBA 2XJLA 4JDZA 4PJFF 5CD3A 2AZUA 4IDLA 4MMXA 4I48A 3FN9A 4NRZA 2MMXA 2ETWA 4JM2B 5AOIA 3FRPB 5E9DA 1QRNB 2AJ3A 3GXPA 3GSNL 4KX7A 4YHKH 5DMIH 2R69L 5DI8A 4AYID 1SOXA 2OYMA 4NJAH 1DFBH 4IKIA 4U49A 3OG4B 2FQFA 4OQTA 3IJ7A 3UYPA 4IJTA 3OV6A 1FN4A 3FU6A 1L6ZA 1BEYL 4EIGB 1KDIA 4GUPB 3N44F 2CBQA 4JAMA 3ZYZA 3SEPA 1N8ZB 1FFNA 4GKLA 4TRPH 4X80H 5E2JA 2A83A 1QO3B 3KW8A 1FNEA 4HKBA 4P2RB 4IRZA 1A0QH 4HWUA 4JB9H 1JF6A 3DVGB 1HILB 1PSKL 4TNVF 4ODTH 4UM9A 2Y3AA 4X50A 1AIZA 1MIEH 2VLJB 3IT8D 4BE5A 2Z92B 3FT1A 3IPEA 3G5YB 4HULB 3NN8B 3OF6D 2V33A 3IFNL 2BWIA 4KO9A 4RGNB 4MNGE 1MXDA 3QDMA 5KVGE 2QKIB 5K9JL 1EQWA 2VUOA 1E7VA 4ELMA 5FO8B 1H6TA 4FQ1H 1HZKA 3F7VB 3MUJA 4GRMA 4YSPA 3WIHH 5TF1L 2VR6A 5DCCA 5INDA 2OXGA 3VB8A 3RZWA 1NCDH 4M8QB 2BVQB 3BDBA 5TFSH 2OXHB 4NO0D 4P46D 1NLDL 3X2QB 2X41A 3DECA 1VIWA 3OTTA 4JFXB 5B1CA 1BA9A 4RH4A 3OJMB 4X9YA 3AS3A 4Y16B 3BVDB 4U6HB 3GNML 2X3CA 4GYBA 1LDPH 1OM9A 4BZYA 1A21A 3ZHDA 1DSYA 1MY7A 5GRJL 5KW9L 2P5EB 4KTDL 4NO3A 4OZ4B 4BKTC 2EVGA 1OSZA 1P2CA 4WAFA 1FJ1B 1MCSA 4YFLF 1UA6H 3AXHA 5K59E 5I0ZA 4OZHE 5G4NA 3DX8A 3FQUB 4MLIA 2IQAA 1E3XA 2IFFH 32C2A 1Q1JH 2DLEA 2FEDC 5HVHB 3UC0L 5I17A 4L18A 3MV7A 4W9HC 5C6TL 5E2VH 2CD0A 3HG4A 3GIVB 4FG6D 1XGPA 2EO1A 4KJWC 4KI5E 3QR0A 2OA9A 4WO4A 2X2YA 3A6BH 3T1FA 1PG7L 2LVCA 3BH8B 4C4BA 1WEJL 4X6EA 1ZJAA 3BO8B 1QPKA 2ZXGA 2R0WL 4A7UA 5FR3A 1HOCA 3NJGA 4KJQC 4RFEA 4KZCA 3ZGHA 4IMLA 2IALA 1AZRA 2Y07L 7CGTA 1ZIAA 5DD1L 4ZMTA 3R4DA 1NCWH 1AR2A 1SY6A 3TVMB 3TBWB 3UIYA 3UPAA 3JUYA 1AZUA 4F15B 1JZDC 5CLYA 4IRSB 1SBSH 2PWGA 2XQYA 2YUVA 5E51A 2YAQA 3GO1L 4MS8D 1A7NH 1YLBB 5BW7C 3IJEA 3D8MA 3RGVC 5DZAA 4Q9RL 2FO4B 4KOCA 4QYOB 1QR1B 4XP1L 1DUYB 3MV9E 1ZA6B 3MODH 1TTCA 1F8TL 3KPPA 3CVCA 4I3GA 3RNQA 1DVFB 1JHTA 1ZS8B 1ZIBA 2CKBA 2VXUL 3TL5A 1P4BH 3ILQC 3LN4A 1XCTB 1JNLL 3DGDA 4WK2B 5HHOA 3FC8A 4KK6C 3ATBA 1OK8A 2OBGA 3ARGD 2YPLE 1IBFA 3SY6A 2Q7AA 3HE7C 2GT9B 1OAUL 3DHUA 3MLWH 4AVHA 1X9UA 4FL4C 4K7FB 2FH8A 4MD4B 3VDCA 1F6LL 3QNXB 4LSSH 3P3TA 4KITB 3G6JA 4OCRH 2A9CA 1R0AH 4RAVB 4LLYB 2ZZUT 1TU2A 1UEMA 3EOAB 4TN9A 5DDHA 1MFAH 3QDGB 3B7SA 1AFVL 3IXTA 4R3SB 4D3CH 2ZKWA 4I77L 4UINL 1ET7A 4UQ3B 2BNQB 3KEDA 1HHJA 4HAGA 3KBHE 3FKUS 1BQLH 4HC1H 1UACL 4OUUA 1BXVA 1ZS2A 1Z7JA 4X6BA 3RIKA 5IT2L 1AANA 3SOBH 4YDKH 1UWXK 2CH8A 5IF0B 2F53E 2QPFA 3ZDYE 1JFHA 3TLRA 1U3YA 2X4NB 4N2GA 5D96B 1TETH 2WMPB 1UWXH 1PX8A 1A9BA 5D7IB 2CGRL 2BSDA 4AYGA 5EOTB 2NUPB 4G8GB 4JFEE 5IQOA 3DOSB 1U8KA 5K1JA 1G9MH 3WY1A 5BVJA 3JZ7A 2WLIA 2CPCA 4KDTA 3OKDA 3B8YA 3MLSL 3VU2A 2LLNA 3BOVA 4U7SA 4FG0A 1ZVSA 5JNYA 1WAAA 5K9QG 5DS1A 2X4RA 4AQ1A 1ECZA 3CHXA 3P54A 1W8EA 3AAZB 4PJEF 4Y4FC 3S96B 2ZWKA 2QVFB 5KUKA 1VPOH 1A3LH 2KH2B 5TD4A 5IMLB 1QBLL 4KC3B 3C09B 4YSRA 4GSXA 3ZIYA 4CC1A 1USZA 4XRCB 4JG5A 2KUTA 3B9VA 2YRZA 1ECYA 3CN2A 2WBJB 1WUNT 4E9TA 3NUKA 3CK0L 1OOWA 4XPHH 1BD2D 3JWNH 4B6ZA 5E8NA 5E9DE 2YD7A 4D8PA 2VGLM 5F1KC 4CVUA 4OJYA 4JK0D 5DEJA 3H55A 4G71B 4JGMA 4GRLD 3VFUB 4UDUB 4ZW6A 1LEKB 3N91A 5JOFA 2CDGA 3NRPA 1M9WA 2JQZA 1LYQA 4AZUA 1EK3A 4P04A 1ERNA 2DMBA 5AOZA 1KBBA 4H88L 2HYMA 4LCYA 3L16A 4PR5B 1BQHA 3HEIB 3WD5H 3RVWC 4K3HA 4APQB 1RL1A 3BVXA 4I1NB 1E5AA 3JWDH 3BRDA 3CMOL 3EZ8A 1RLWA 1CFTA 1XD1A 4PREA 4BDVB 1BVLA 1SXAA 4TULH 3EXLA 4JQXC 4G8FB 3QDME 1J5CA 4PJDF 4ELME 2VUKA 3L3DA 1HESA 5AD0B 4CMMB 1WF5A 4QR7A 4M3KB 3H3BC 4WY7L 2YMXH 1JPTL 3PP4H 2WWKT 5C07B 4ACPA 4EI5B 4YGVB 1VKXA 1YNTA 3CLEL 5BPPA 1FH5H 4KY2A 3TF7C 1VGEL 1VHPA 5T1JA 4BHUI 4L8SC 4QO1B 4FQXA 2AI0H 3VGDA 1HIMH 1LLAA 3MRQA 3OMIB 4KVNL 3EJSA 3WJJA 4N2FA 1FP5A 1QLRB 1ZV5A 3S36L 1DBAH 4WQOA 1AIFB 3BWZA 4YBLB 5JHLA 4JCMA 1CE1H 1SMOA 4GB9A 3OKNB 2P5PA 1V05A 2H2PC 3ARBB 5K33A 2VH5H 4NKDA 3ZTCC 1L9RA 2YPKA 3CDGB 4L8BB 1OF2A 2E8ZA 5ETUA 5INCB 1KWGA 4PLJC 3SPGA 4XR8C 2RMNA 3BXNA 2DQMA 2G2PA 1CXIA 4Y19B 1UFUA 1IARB 1URZA 2VDPB 1YSOA 3KXFA 3JV4A 3U4BL 1DVZA 5BO1H 1N19A 3KYMA 4N0RA 3MV7E 3T08A 3PJLA 1QI5A 1ORQA 1U92B 4M29A 2ZWYA 4XODA 5ESQA 2NDGA 4CGTA 4YHMH 2IQ9H 3GMPB 3EG9B 2OL3H 3ZXAC 1CDYA 3BAKA 5DD5H 3U1QA 4OKVB 2CO2A 4LVEA 3VDBA 3WEAA 5DVMA 1Y6KR 1KTDB 5T1LB 1R3LA 1IX2A 1E2ZA 1ZWIA 4WTZG 2YA0A 2CA4A 2VTFA 3AQXA 2F2HA 2OTWA 5F7EH 1KTBA 4ABVA 5IROC 5TPWH 3GSXB 3QH3A 3FRPG 4UAHA 3HJ0A 4XBGA 4JGUA 5A6IA 3S37H 1FL6B 2DWEA 2WXJA 4Q6KA 3HMXA 1HN1A 4P2QB 3WAKA 3SDAB 1MJJA 4H0LC 4KK8C 4RAUB 1PIGA 2D0GA 2OI9C 5TQ0H 1TZ8A 5EPMB 3MNWA 3UTSD 1RIHL 3GSOB 3BISA 2HTLC 4IK7A 5IV2B 3IGAB 4CGUB 4QHUA 1WG3A 3UC2A 3SZ6A 3KWXA 2GUOB 5E0QA 3RY4A 3ZYJA 4FHJA 5BQ7A 5FDWA 1U9KA 4NN6C 1SF3A 4JRFA 5GGSY 3TBTB 3DYMA 1MHHB 3KBFA 3TXAA 5HHOE 3QDHA 1N18A 1WK0A 2C9PA 4A7GA 3BPLC 5EO9B 4E5XB 1N5YL 4EOWL 5I6XB 1HE8A 1J10A 4HFUL 2DQJL 3MJ9H 2YK1H 1TZGL 1P6FA 2VN4A 4R90H 5D1XB 1E9QA 2I9LB 3IFPB 1MG2C 1CT8B 2XXFA 4N2KA 3Q6GL 4UZUA 4ES9A 3PAUA 1E4HA 2ESVA 1EJ8A 2XFXB 4PGCB 2HPTA 1GAFH 3G6JE 1Z66A 5IVNA 1YQVL 2C9QA 5DRWB 3AY4A 5I5JA 2IH1A 4LIQL 5JA9A 2GTWA 2VC2L 2I32A 4GS7B 4ZI8A 5J13C 4HHAB 1T22A 1JJUA 1HZHH 5E99H 1OGAD 5JHAA 5KSAC 1FGVL 3NZHH 1MFBL 3FTWA 1NOLA 2OZ4A 4Z76A 3SGJA 3H8NA 4KAQL 3ZY7A 2R1YB 2BY2A 2BHYA 2ICWJ 2XZCL 3SOTA 1BSIA 5FYKH 4PRIB 1B2WL 2FSDA 3ELAT 3R0NA 5MEOA 1RI8A 1DO6A 2DQ6A 4TUKH 3SO3C 1QSFB 5AOJA 1NSNL 4AMKL 4M1CC 4NT6A 4YSUA 1XF2B 5AW2B 2VN5A 1I8KB 4XI5D 4XNQA 5FOBA 4RMRA 1WS7A 2MQ0A 5GSRB 3NIDE 1YEEL 1C1EL 3WE1A 1MNUL 3O4LA 1EXHA 1ETZB 2JFCA 4MJ2A 5ALCL 3HLKA 4NSKB 1ZHBB 1MFMA 3T3PE 4KMQA 1H6EA 3QXDA 4AW4A 1WAAE 1O7SA 4MAUL 4N1CA 2G5BB 2QPUA 3L7EB 4XNXL 5EEUA 4IGBA 2CIKB 3QE5A 3FPXA 1BJ1H 1SJVA 4M1DL 2EDNA 4WDIB 3ZX1A 4F24A 3L3JA 2OMTA 4NO2A 4QMEA 1KIPA 5ITFA 5E1HB 5JPMB 4YAQA 3K3QA 1NCBL 5AW4B 1N10A 3MA9L 2NY1B 5DURD 2MWCA 3PJSB 4HD5A 1KLUA 2XWZA 4UTBL 4DJMA 3EYSL 1F3RB 1WFIA 2YMTA 3BHBB 4PS4H 2HJFA 4U31A 1UKQA 1UM5H 3EYUH 4DP6X 4KJPD 3F2LA 4Y2OB 3NBNA 5AW8B 4X4YB 3TJPA 4NBXB 1T20A 4ODXB 2K9UA 4ZUUB 4TNFA 5T5NF 4JQIA 1QBMH 4FMFA 4AEHL 3WAJA 2DQCL 4LMQE 4YHZL 4CNIB 3VI3B 4BQ6A 4WWID 5GGQH 1MCKA 4QNPE 2V4LA 1N2RA 2WYIA 4TVPD 5JW3H 1KCSH 4OFPA 3B83A 2YEQA 1AP2B 2AJVL 2H26B 4GINA 1LGVA 4MKTA 2R9HD 3CLFL 3O45B 1D9KD 5AB2A 3A21A 3QFJD 3TA3A 1XF4B 2VAJA 3FU8A 3KEHA 3A4DA 1YYCA 3IK2A 4EKJA 4RMUA 3F64A 4PBDA 3TPUA 4UQAA 3U9UB 1Y6MR 1ZVHA 4N3UA 3FCSB 1ADQL 3FBQA 4L48A 4Y4HD 5K9OA 2WHVA 2MIZA 3MA7B 1JK8A 5BV7L 2YARA 3C6LC 2WIIB 4MZ3A 1R5WA 3SGDI 1VFAA 3AJ7A 5EBLB 5DHEA 2YHGA 4ZOCA 1I8IB 4D2NA 1HJCA 1R3JA 2JQAA 4PGDB 1OARL 1K4DB 2Z8RA 2FUQA 5EOQL 5SV3A 4QXVA 1W0WA 5D1QB 5JXED 5L9DH 3TYGL 2BP8A 3M17B 4FQJH 4S0TD 3ZDZB 2EUZA 2LAGB 3G5XB 4JN2B 3JV0A 5E5LA 5F7BA 3HVNA 3H53A 2JCCA 3QG6B 4H4NA 3TBVB 1U3HB 1U8JB 3O3AB 2G2RB 4JRWA 4EZKA 1CG9A 2UYLB 5GRYA 3V5DA 5I15L 1NFDF 1UWGH 1R3IL 2XZAH 4JMNA 1T7XA 1DBJH 1R5IA 3OJ2C 4WW1B 4KVCL 4WV1A 2PPAA 3OKOA 1AQ8A 1S7TB 3HB3B 1ZLUK 2EABA 3QUZB 1CQYA 2XHNA 3DMMC 1RJZB 5AZUA 3RAJL 2XWBB 2NSXA 1KFGA 4L4VB 3SKMB 1U8NB 3Q5YA 4BZ2L 4DZ8A 1NQBA 1ZLUH 2UWEA 1PCXA 2HT3D 4DEUA 3PAYA 3KXFE 1KEMH 4U1IB 2YD0A 2YJLA 4KKLD 5EU6D 4JFFA 4KXBA 1NC4B 4HWBL 1F2XK 3P4NA 4BFRA 1F02I 2R1WA 5CCJA 1IBGL 3EJUA 3VFTB 4Y5VB 2FZ3B 4AYEC 3O41B 3IU4L 4N9OB 2G30A 3QG7H 1MNNA 4YSTA 3VFGH 5F3HA 1W6LA 4WFHD 4XC1L 1NKGA 4Z7VB 3QQ9C 2UVEA 3MCLH 1UB6B 4M7ZC 4JN1H 3TVMC 2O6EA 3IJYB 2VDLL 5D4JA 1YEDA 5DLMH 2P5WD 2W0FA 4F2MA 4HEMA 2JH2A 4FMKA 3Q43A 2KLTA 4LVHC 5C0ND 5E5MB 1M7DA 2IANB 1ZHKA 1T6WA 1JV5B 5IB3B 4FFZA 2W59A 4RDQF 1JWMA 4HWEL 2PYED 2K3HA 3V4PL 4ODVL 2H9GA 2Z8VC 3CFCH 1UB5B 4PW3A 5MEQA 4AUJA 1MCLA 1CMOA 1VAHA 1ZANL 4GG6F 3D7PA 4YHOH 1JN6B 3KL3A 2A0LC 3WHXA 1N6UA 5FHAH 2KPWA 4LCWB 4LP8A 3QZWA 3TNNA 1NCAL 2LU3A 3CMGA 5AAWC 2WQAA 3P9WB 1V55B 2MPAL 2IAMD 4PWEA 1PMYA 5EOCH 1Q9KB 5J1TC 1XXDC 3D4GA 2Z9TA 4ES8A 1L5GA 4X7DC 3SBWC 4M3HA 1RUQL 4MJ6A 3VWKA 3GBNL 5HYSB 3L3IA 4ZFZA 3HZKB 1XZ0A 4WUUD 3N85L 4POUB 4U3SA 5MP6L 3FBKA 2CRZA 1FG2B 1WFUA 3HZVB 4ETQB 2RQEA 3EOBA 2X44D 3EH3B 4YPJA 3ZZQA 1KGWA 4W9IC 4MA1B 4YJZL 1IBZA 1INQA 3QC6X 4ZOAA 4OGXH 3IETB 1GH7A 3F05A 4FQHB 3Q9PA 4LLAA 1JIBA 1FIGH 1EHNA 2XG5B 3D2UD 4YZWA 4GSQA 2NNXA 1G7QB 4G6FB 5CBEB 1FVEA 2P7TB 2YQ2A 3KGRA 3QIWB 1XGQB 4D0CB 1QG3A 1L9MA 3OHMB 5DMKB 3PY9A 4GW5B 4CILA 3BKJH 3F04A 5AW6B 2CUMA 3KPRB 1LO5B 3CFBB 5HJGA 2A6DB 2D8KA 3V6OC 4XMUA 3QULB 4BSJA 1ML0A 3WY2A 5IQ9B 5KBLA 3FQTB 3FHQA 1KXVC 4J3TA 2HFTA 4XXDA 4O4YH 2D3VA 4R8WH 3KAAA 1DEEB 2WCGA 5JPNC 5J9PB 4Z7AA 2AEIT 4POZD 1XGYL 4KY1H 1CR9H 4HU2A 1H15B 2ZOKB 1UOKA 1ZJBA 4OAWB 4XWOC 1V3KA 4KKZA 5K69A 2TRHA 4S1QH 5D6CB 2YD5A 3FCGA 3O4LE 2AABH 2WTRA 2X10A 2W65A 4NNXB 4RBPK 4YGAB 1I1AC 3V6ZA 1NOAA 3PQYB 5LG1A 3NA9L 1KLGB 4WEEA 2WBJC 1BBJA 3D85D 3LN5A 1ZHNA 4RBPH 3T0BA 4ANWA 2V2XB 5IM7A 3SSGA 4OCXL 2NX5B 4KQ3L 3MJGX 5BW7A 3NZSA 4FZEL 1JTOA 2JKSA 3RGVA 1F0LA 4TXVB 4DK5A 5KTEH 4C59B 2XVBA 4YXHL 2YBGA 3RGHA 3PWNA 4Y4KD 3TIDB 3VA2C 1MAKA 4ZX5A 3NG5A 1HSAA 2CDEB 3QNZA 4LOUC 2UY7A 4IQHA 1CFQB 3GKWL 2WWKO 3N55A 5AYTA 3A6OA 2DN7A 4XAWL 2YOAA 3S98A 3SGEH 4L9LC 2VXQA 2Y9RT 4QAMB 5CD5D 1I1FA 2O1AA 3I50H 4UNIA 3DGCR 1UHVA 2CO4A 2XYBA 4JG0H 5T5FH 3VMOA 3ZHKA 3HE7A 4FG4A 5C0FA 4S2SB 2OW7A 2J2ZB 1IEAA 2PO6B 1EERB 2PABA 4N8CL 4NLHA 2NY4B 1RUPH 5I66A 1D5BA 1IEBA 1M7XA 3ASNB 3CUPA 2R8SL 2K6WA 1MWAL 4NDMA 4EUPA 1FPTL 5B7FA 3A5VA 3I74A 4F58L 1BZQK 2V3DA 5F1IA 1B4JH 1KPRA 4F9LC 3GJEA 1FBIL 4GMTL 2ICWB 5FM4A 3KPQB 5DSCB 5CR1A 2YD4A 5EU4B 2OMYA 4MWFA 4YN3A 2QQKH 2NY0C 4U1GC 3D1MC 3EJPA 5DQDH 4MDIA 4IYKA 4PV8B 3ARFB 4PJIA 4OFKA 4U1SA 2VN3A 1MCRA 3LSOA 3QDJB 2CBMA 2ZWNA 2XKNA 2FWOB 3VXNB 2Y2TA 4OSUH 3WJMA 3DPBA 5EO1A 2X6UA 2WWNA 3BP4A 4M93C 4FNUA 1JNHA 3M1BA 3LNGA 4AKOA 4F20A 2CR3A 2ENYA 1N64H 1KYFA 2QQQA 2VR9A 1OLLA 2JF1A 3POHA 2H47C 2ZXBA 3EKCA 3LZRA 4YO0A 1QLFB 5I1EH 1N4XL 1I9JL 5BZXA 4BH8B 4I85A 2FIKB 2NY3D 5JOEA 5H8DA 1N59B 4M5ZH 5DS8A 4NN5B 4DNLA 2JCCE 3KYOB 4N1EA 5C1MB 2X4TA 3VH8A 1TLKA 4PJFA 1VACA 3H9YA 2IOMA 4MQSB 1F97A 1TJGH 1OCOB 4QYAA 3CH8A 3ATAA 3MRDB 1NM9A 4OGAC 1JMXA 4X8JA 4Y4FA 5G5DB 5AENA 4FQIL 3SPIA 2FGWL 1J1PL 4G6KH 5DT1L 3BEWA 5JW4N 2NSQA 3O6FB 2EUXA 4AIEA 3QUMA 3BKCH 2C1OA 4NNPL 4WHYG 3R1GH 1WFOA 1WBYB 2WSKA 4HS8H 2BC4A 5KYXB 4WFED 2A6KB 2Y69B 3K80A 2FHCA 3D39A 3ARPA 5E6ID 3AUWB 5FYJE 1F4XL 4JFFE 1AS8A 5M7QA 3IJHB 3HE6B 4XCFH 2YD1A 2Q8BL 5ESVB 3FT2B 4Y1SA 2NY5H 1T04A 3D0LB 1R24B 2CDFB 2P42B 3BFQG 4Q7DA 1NA8A 1SXNA 3RVVC 2DIEA 1INDH 4Q9BA 2J1WA 4AMWA 1ETB1 2DB8A 3CDFA 2CUAA 4KXAA 1I4FA 2HLEB 2FSEA 4V1DE 1EGJA 5J5EA 2H32A 3EUDA 3HVDA 12E8H 3F58L 3UZEC 1REIA 4QRSB 3K72A 5HI5D 5L8KB 3FUNA 5CCGE 4P2OD 2D9QB 2FX9L 5JHDB 2JKRM 1J5OH 4O2FB 1RU9L 2B08A 3O0LA 4BUQA 1JXKA 5FF6A 1X5YA 1RJCA 3NA4A 2I60H 3RVXD 4DK6A 4N8UA 3VSUA 1SJMA 3BE1H 4JQXA 4F3FA 4NKMB 3IMVA 4NRYA 5G4OA 3SE4A 4ELKB 4OLYH 5L4FA 3G04A 3PL6B 1KBKA 4LSTL 5IIEA 1WDAA 1AO7B 4Y5XC 1BREA 1G7IA 3I9GL 5EC2B 4HPYL 4KPHH 4FCAA 3V8OA 3F12B 1QVOA 4LCCB 3N9GL 4UU9B 4UYQA 4ZOBA 3UTTB 3MREA 2D03L 5M94B 3VXRA 1YYLH 2WCSA 3NK4A 4P2AA 4PJBB 1C16B 4RMVA 5AOMA 4F7MA 4L8SA 1NFIA 3RL2A 3NP4A 5I6XC 1OGPA 3C2AH 2VZUA 2FWUA 1P4LB 2YPVA 4UT9H 1FYHB 3OC5A 3DUUA 2HLAB 1K8DB 2X6VA 5EF0A 1AGFB 1XEUA 2DLFL 3QO1B 4LLQA 5KVGH 4G43A 1DL7L 1MVYA 2CLVB 4OV5B 2H1LM 3BEVB 2HX7A 5I19L 5DZLA 4UBDC 3V52L 3I3DA 1SOKA 2HX8A 4WWKD 4X6DA 2FX8H 5KVEE 5FA3B 5TE7L 3SCMB 1SNRA 5JR1H 2AJXL 3O6ML 4J12A 4U1HB 1R3HA 2ADIA 3ORJA 1BQKA 4RMBA 5E95B 4KNQA 2AJYH 1NGQL 3QQDA 2K7PA 4LPTA 4MA3A 4KMTH 3RB5A 1GGBL 3I84A 5DQJA 1V3JA 4YSEA 1ACYH 4FEMA 1SHMA 1C7SA 5AKTA 5IVOA 5KYYA 2B9AA 2WV3A 4AL8C 4RCAA 4OIIH 1I75A 1NBYB 1BPVA 3HC4H 1RHHB 2EH8L 4LQFL 4RGOH 2DM3A 3RL1B 4P3CL 2VMDA 4BHUA 2X6CA 4YHLH 2JK5B 1KCUL 1VFBA 4JREB 3WDIA 2QADD 4JHAL 4DKDC 5IROA 5G2NA 5L2KA 4ENEC 3BGFC 2JTYA 3QHFL 1PG7W 5EORH 1ASPA 3L3GA 5EMYA 5DEGB 3ZDXF 1JGEB 4DFIA 2ZE0A 1GIGL 3QXTA 3TBYB 4YDLB 5ILTL 1G4RA 4MXWL 5JPMC 1DVQA 3HUJA 1CLYL 1E2WA 5GS0L 2ZKXA 2KBGA 3FUFA 4BFJA 1QA9A 1W8OA 4JFPA 3T0DA 1A6AA 3X12A 1JD7A 3AT9A 3GMQA 2OW6A 1M2VB 3QW9A 5FV2A 3TNMB 4F57L 2KL6A 4J3OF 3L13A 4DOHB 4PRNA 5IJDC 1UD3A 1PKOA 3QPQC 1C8PA 2OR9L 1WO2A 1WH0A 1IFHL 5ECJE 4RAHA 4XBEL 1I3UA 1V7MH 4ANXA 3EHBC 4QTFA 4IRJB 1IGML 4N8VA 5SX4I 2ICES 1H3GA 5HYJB 4Y9CA 3F7LA 1CFVL 4XPGH 3SYQA 2F19L 1XF3B 1WC7A 3ESMA 4JFDA 4TVPH 4QHKI 2CUIA 5HTSA 2YGQA 2CAKA 1A1MB 5IFAL 2X9ZA 2Z31B 2ZPKL 1WZAA 3QS3A 4PVNA 4UTCA 3T6WA 4B27A 2CM5A 2F7OA 1CU4L 1MJUH 1QQDA 1VADA 4PYHA 4XN5A 4B41A 3L3HA 3E1F1 4YSOA 2CBOA 2IJ0C 2XBDA 4OLUH 4Y2DD 4BSWA 5I1AB 5FYKU 4G3YH 5HYSG 2AVFA 5IOPB 3DI3B 4BSVB 4JFOA 4UYPA 1G7JB 3ISRA 4C56D 1QI4A 5KSAA 4GKOA 1VERA 3I6LD 3BP5B 1UOVA 3VGEA 5A7BA 1C5BL 1PZ5B 3F7RA 1AZZC 4ECNA 4PJIE 3HAEB 5E8OB 3TTYA 3OLIA 4PRAB 5JW4M 4K3JH 3WS3A 3T2NL 4MNQD 3FSWA 4ZFOA 1IAIH 2C7UB 5LVEA 5CP7B 2LTQB 1AGEA 1RHFA 1G0DA 1WFJA 2GSIB 2ZWLT 1EEYB 4I3SH 2WNWA 4NC1C 2BSSA 5GZND 4NM4L 4P5MB 3RBSA 3DXAD 1IT9H 1ZT4B 4M56A 3WY3A 3V4UH 3EO9L 2HVJA 3S3DB 1U3HC 4P48A 1GGTA 1GRWA 4A55A 3TH3T 3CQFA 1QABA 3WEMA 4YBQC 3BWUC 1SLUA 3S35H 3F5WB 1BZ8A 4Z95H 1PBYA 3M86A 1CXEA 1AR1B 3TWCL 2F0CA 3TEZA 1DQVA 3RTQC 3FQWB 5KSVB 4PV1C 1U91A 4PJFE 1E6OH 3BZFA 5ADOL 3QUZC 2XRAL 4H20H 3V5KA 5FX3A 1UJTA 4ZMLA 2BXYA 2EE0A 1TQUA 4MJ5B 1GZQB 4RX4D 4P9ML 5D4HA 3RZCC 2VZ1A 3BCDA 3EOTH 3IMUA 5DO2D 4OF8A 1HEZA 5JUEL 3H3PH 2V2WB 2DICA 3NK3A 4B0MM 1EFXD 3R06B 3MV11 1MFVA 4GI8A 3GHPA 2J73A 4ABUA 3RPIB 4A7TA 1UM6H 3O2DA 3QUXB 4KROC 1RK1B 3D39E 3TFBA 3GHEL 4GUPA 4P59L 4XVJH 3AXIA 2APBA 3C5ZB 3P9LA 4WWPA 4CDHA 5C2BL 5I18L 4HK3N 4ZPVA 4PG2C 1IQWL 4M7LH 4BELD 4P2RA 2ITEA 1R4XA 2OV0A 2NY7L 5DK2B 3NZ8A 4XGZA 3DVGA 5FLUA 1HILA 4O9HL 1J0YA 2JELH 4M61A 3JWOL 3HMWL 4KZEH 4H1LB 3PWVA 4JVPA 3KWTA 4G1MB 3NN8A 3OXRA 3Q6FB 3D4ZA 1L9OA 3V0GA 1NEUA 4LSUL 4PJDA 4HG4J 4H8WL 3VCLB 2QZQA 2B16A 2Y1ZA 2GEQA 4OJCA 2RA1A 4ZSOB 4JPSA 3VXMD 3L1GA 4N5EC 2BIHA 1IKNC 5CJXC 4OT1L 5FO8A 2OTUB 3G6AA 4NQEB 1SN2A 5HYQB 1QFOA 3SD5A 5I1GL 5I1DB 4PJ9C 4OQTH 5AUMA 1KB3A 4MXQD 5IG7B 1AZCA 4FULA 4JY4B 2XWXA 2FVNA 4ZTOH 3C6LA 3QCTH 5LXGH 1DJIA 2GJ6B 4JFXA 4RMQA 1D5MA 2AJZB 4X7TB 3L95B 2OP4H 3UABA 5DZJA 4Z7OE 3VXRE 1HC1A 2VR3A 4Q9CA 1CXLA 1OZTG 1KJ3H 3D2TA 1TZHB 4MA1C 3HZMB 3VXQB 1ZXKA 1Z9SA 1KCRH 3Q2LA 1OPOA 4OZ4A 4UUJB 3RDTB 3KLHD 2JJTC 1EVUA 1AGBB 5ALBL 3RTLA 3SYOA 1Q0YH 3BWAA 2BP0B 1MRDH 2ORBH 4CA4A 2GABA 1BYNA 1JGUH 1J1OL 2Z1PA 2BXZA 4Z9KB 5CJQH 4YUEL 3VGAB 5LQBH 4ZG1A 3U36A 3QXWA 2LU5A 3DMMA 3GLAA 3GIVA 5IVXF 4AJYV 4LNRA 1AKJB 1A4AA 5C0BD 4FA6A 3SKNB 4KRPB 1ZA3B 4JO1H 1YEHH 4HUKB 5C0EB 1EJOH 3FFDB 5TQ2L 1SFHA 4JHUA 5T3ZE 2W95A 3RIAF 1KC5H 2CGYA 2MQGA 1U2HA 1K4CB 4FQLH 4ONGH 2Q7YA 4XB7A 2YUZA 2F58H 3V9FA 3ULUL 2GB2A 4JCLA 1A9EB 4W6YB 1XIWC 4RWHA 2LFGA 5GRUL 4LASL 3CH1B 3TFKC 4LPYA 4CUCA 4IOFD 1AE6L 3QR2A 3TVMA 1KN4H 3TBWA 3MQIA 4WRLA 1NIAA 4O00A 1EO8L 4PJGF 2AK1L 2HJLA 1N0LB 2ICWI 3KH4A 1QEWA 5LCVA 3S48A 3VG9C 3VXSA 1I9RL 2WZ5A 3P69A 5L2KE 2XG4B 2Q87A 4IRSA 2X4PB 4HZLB 5I1CH 4U3HA 3FU7A 1I7RB 4HIQA 5FM5O 1K9TA 4JFZL 4XMZA 2FO4A 1QR1A 3HUJE 2APSA 5DUPL 2E6JA 4GUCA 4PP2B 1XT5A 1OM3H 5I1IH 5GSVB 1EDHA 4HMDA 3VFWA 4RFNB 3FB6B 4PRPA 5AAWA 1I1CA 5K9KB 2VLLB 4FKEA 1BYPA 1SEBB 3DX4A 3WJLC 4X5PA 1R34A 2WQSA 2GT9A 4KQ4H 2PUQT 1KXHA 3AU1A 4LHQB 3IAQA 3SQOH 1UH2A 3I6KB 2PO6C 3R18A 5BZDB 1SY6H 5J12B 3W5NA 2XQYK 1IU1A 3Q44A 1NUGA 4MD4A 4XBMA 3MAWA 4FABH 3CXHJ 1OT1A 1YEIL 5F7MC 3IXAB 5AVYB 3QCVL 2LU4A 5CEZL 3DX7B 1E8XA 3VG0H 4E42B 4CW1A 4RAVA 4LLYA 3EOAA 1BMWA 1IKFL 4GT0A 4YDVB 3D69B 4KFMA 2O4EA 1X4YA 1TJIH 1XTLA 2R0ZL 3GZKA 3U25A 3UJIH 4PN6A 3W81A 1U93A 3SPHA 1MQKH 1NTDA 2BNQA 3KH3A 4MS6A 2PWFA 4NAJA 3EJJX 3CFKA 4AEIL 3CPUA 2SEBB 2VDRB 2CKBH 4QTIH 2EKSB 3S4SB 3BN9D 2O5NA 1N6QL 3ZUNC 2CSPA 4J6IA 4OJEH 5FECA 3DV6A 4JG1H 2BERA 2FYYA 2Z3FA 3PHOB 3STZA 3CV5A 3V6OA 5D7IA 4CKQA 1S2EA 4NJ9H 5EOTA 2NUPA 1KXVA 4G8GA 5I6PA 3DOSA 3VSVA 2VN6A 4OFVA 1T1YA 3VXUD 3DSFH 3HCVB 4AQAB 2Z0UA 4O02B 4F5CE 1K5NB 2CO7A 4UMGA 4GKNA 2YAEA 2WSPA 2CXGA 3JTTB 1NPUA 5IQMA 4I3RL 2NY6B 2NTFB 5KVDH 3Q8CA 3GJFA 1H5BB 1V54B 2N7AA 2R2HB 5F6IC 3TN0B 3AAZA 3SKOA 3L1OL 1PF3A 1OTUC 2O5YH 2WXQA 2YA2A 2NXYD 4HKZB 2CR0A 1I1AA 2OJ1A 4ILDA 2XZQH 4JY5L 3G5WA 2CG9X 1CGTA 3ZKMD 4CU7A 3FTGA 4OZGF 4KXCA 2WBJA 1M1SA 2CRIA 1NC2A 3LEVL 5SWQB 2VQTA 1HH6A 4PYGA 5EZLB 3SODB 3RDJA 5B39A 5JDJA 1PZCA 1OE2A 5C8JA 1F45A 3U0WL 4Y2LA 1LO0L 4FNRA 3HE6C 3VFUA 2YRPA 1EHKB 1IGCL 3MLXL 3EGDB 1BVKA 2OX5B 1M6UA 4DK3A 5I73C 4KXDA 3QJXA 3T65B 2A73A 4BIKA 5IVZB 1P5UC 2EVJA 1R1CA 2VDOH 1GGYA 2P48B 4L9LA 2WOYA 3AREC 1KELL 2O26U 2WVTA 4Z5RB 4YE4H 5D7LD 4P2RE 3ZTNH 4DP0X 4JRXD 4IK6A 4OGYL 4AKQA 5IMOB 4K8RL 5CKGA 3MRIB 2AGJH 1EFQA 4MHHI 3B2VL 3WFHB 2ZWZA 2PTVA 1HL5A 3TV3L 4F9LA 2H2SD 5BS0B 2X9XA 4PJDE 3VFVB 4A7SA 5I6MA 1Q9OB 3DROA 4EN3D 3H7BA 4A67A 4WTXA 3OQ3B 3MLTB 1WVZA 1IC0A 4CMMA 1OCWH 3RA7L 1WBZB 2R23B 3WKMH 4JO2H 1TTBA 2X9WA 4YLQT 3JQOB 3SKJH 3UJJL 2AQQA 3D48R 1FORL 1K6QH 1M6OB 2D2CC 4PJ5E 4NO0B 4P46B 1F4YL 4Z7QF 1ZV2A 2C3XA 4G7YL 4PI0A 4E36A 2YSSB 1F90H 4HOZA 1QLRA 2WXLA 3I75B 5E1AB 4NWTH 1NFDA 2XTJC 2CO3A 2R29L 1QTYT 2IIJA 1I8LC 4O5LL 3OKNA 1JHKH 1CJYA 1YJDH 4K3DH 4WI9A 1HYSD 5TH2A 5FYJL 2JKIS 3EJZD 1CIDA 1FNSH 4M48L 1NBVL 2VR8A 3HAEG 3BW9B 4MQ7B 3NACH 5D7KE 5INCA 1GL4B 1FAKT 3K46A 4OTXH 1YYML 1RUMH 4CJ0A 2BZ7A 2D0HA 3C8KA 4Y19A 1J8SA 3NIFF 2DDQH 1ZEAL 1RULL 3O6LL 4V2CB 4XXCC 1ZE3H 1Z3GL 1DN0B 1KNOA 3AT8A 3GLDA 4R4BA 2WZPA 4QGYA 1U92A 5BMFL 4FG2A 1EZLA 1X5FA 2NZ9C 2RFXB 1U36A 3RVUD 3GMPA 1UJ3B 3U7YL 4HZAA 4HBQA 5D4IA 1OXYA 2CJUL 3JVGC 1TO5A 1HCFX 3RWFB 2HFEA 2ZCLL 3P73B 4NI6A 5IR1A 1PX4A 4F8LA 1M1XB 4LRNL 1QEXA 4N2OA 4IU3A 4LPCA 5F3BB 1L7IL 2VQUA 4O58H 5IEKB 1XSKA 2GSGA 4LDCA 4MVBD 1OWWA 4YDIH 1FL6A 5DFTA 5EF2A 3GXDA 4WW2B 1H3PH 1JXGA 1UT9A 4ATTA 1DE4B 1A2YB 1N12A 1U8OA 4G8AC 5CCHE 3VD5A 2WNXA 4RSYA 4ALAH 4ICWA 1SDYA 4RAUA 4YDLC 3VXSE 3UZEA 4YFLI 4PMFA 1A6ZB 1TTGA 2H3NB 5IKCB 1OAZH 3BPNC 2X7LB 3U0PB 3GSOA 1U8CB 1FE8L 5FYLE 4F91B 1T66C 1CTNA 1CGXA 3PGFL 3IGAA 5EDXA 4K4KA 2E27H 1XB3A 3DLQR 3CU7A 4OVUA 5LBGA 3QT2A 5DJZB 1DQQB 2B20A 4IBTA 4X6CF 5L88L 2ZOUA 3QQ4A 4H1LG 3VI4F 4ZS7L 4A6YB 2LV4A 1YY8B 4Y5XA 4WU5B 3TBTA 3RILA 3CHRA 4PRPE 3BCFA 1UOLA 2YC1B 1NKOA 2DOCA 5CEYA 4HIJA 4ZMZA 3GIZH 1S6NA 3QNFA 3RI5K 5IUSA 4GXFA 3FHAA 3U9PL 2HRGA 4E5XA 2BVYA 4DN4H 3IE4A 4HJJH 5H4ZA 1VFUA 4L1TA 3SQBB 3HMXH 5KZCB 2MTPA 2Q3ZA 3DIVA 3BKYL 5D1XA 3SBPA 3OGOE 2B59B 1J0IA 3MJ6A 5J6GA 1KGJA 3CC5A 2QVTA 4PGCA 5D9SB 1MF2L 2GEEA 2R2EB 4G5ZL 3TT1H 2P80A 2W9EH 3KYAA 3DTXB 1R5VB 2FNBA 1E28A 1KPVB 4ZQKA 3T3MB 1XF5A 4HHAA 3ZTEA 2PTUA 3QA3A 5J7CC 5IBLD 5L7XL 4PS8A 2IG2L 1GMEA 4ZDHA 1BFOB 3MRHB 2R1YA 4N6RB 5JOPD 3UAEA 2B77A 2Y23A 1NGPH 1CTMA 2LTQC 1X7SA 4MA7L 4DO4A 2VDNH 2ZUVA 2XWDA 5DFVD 1YUKB 3O8XD 4A2LA 3V6OE 4ETYA 1I7TA 4XNZC 5D7IE 1XF2A 1MKFA 5GHWL 1F2QA 3B9KD 4N28A 2NY2D 4OIBA 2A1WL 4YDNA 1ROCA 1MFDL 1X5KA 4QXUL 3NCJL 3MXWH 3TBSB 3D06A 1G9MC 1XZWA 3HLAB 1EBAA 4H44C 4JO8A 5LGHL 2NT1A 1IC4L 2XFGB 3ULVL 3B2UC 1ZHBA 1KULA 4M6ML 4I9WD 3LJ3A 5J57B 2H1PH 5HVGB 2BNRD 4X9GA 4ZAKD 3FB5B 4WDIA 2OZ4H 3EYOB 4XO3A 5GISL 4TSBH 1LE5A 3L54A 2YD6A 1KCVL 3L9BA 4EI6A 5JPMA 2HRPL 2EINB 5HDOA 2AKRA 1PZ2A 1MUJA 2BSEA 4IKNA 3PJSA 1MW1A 4URTB 3JT0A 3QUXC 4OFQA 2EDBA 2J57A 3FUDA 5LBSA 5B8CC 3BRGC 4GG6B 4I89A 2Q20A 4YHYB 2DBLL 3DNKA 3C5ZC 3I85A 3MRJA 3WDJA 1JOIA 2DWYA 1AY1H 1KENH 1KBVA 4ZUTA 5AZ2L 3U2SB 4GRLB 1ZGLA 4JS7A 5J11C 1N0XL 3FS9A 1MRCH 1OGSA 2HSIA 1EHAA 2G75B 4CNIA 3VI3A 2Q10A 1NCNA 2XN9A 3VTMA 1CL7H 4DFHA 3EW3B 4NQVB 4DT2A 1BHGA 4F8NA 2H26A 1Q72L 5EBMA 3UYRH 5HDBE 1QUNA 5KVMC 1TTRA 1JGIA 4JMXA 4G70B 3QRGL 1XF4A 4UV4H 3O0RH 5BJTB 4HJ0D 1BM3L 3CZGA 4HLZG 4RETB 5IJCC 5E00B 5EN2A 3PWPB 1A8JH 2CHNA 3U9UA 2C1PB 4L3AA 4ZX6A 2XICA 3V4VB 1DCLA 3VTTA 3LKRB 1HHHA 2NCEA 5MEPA 3TIEA 4Y7OC 3BSHA 1NCOA 1XH3B 2I7OA 1TZOA 5CNHA 3TWYA 2G60H 4OZIF 2UUDH 2J1ZA 4JQIH 2HAZA 5PAZA 1OF0A 2V5MA 4M5SA 4XX1G 4FP8L 5DD1H 5IGXH 1K4DA 4AEEA 3STLB 4L3CA 5F7DB 4LHUB 5F0JB 2IOIA 1TFHA 5ICZB 3VRIB 4JN2A 3DO4A 4R4NC 4WI7A 3QG6A 4ZO9A 3RDTC 3JSSA 3TBVA 1U3HA 3EYQC 3TASA 2WLJA 1P6WA 1TPXC 2NRDA 5DZVA 3X1FA 2G2RA 1NFDE 3S4SG 3K71B 3GO1H 4D7PA 3HNVL 5EBWA 3D3VA 5DJXB 4B7IA 5JQHC 3QUYC 3IAPA 1B9KA 3OR7B 3A4FA 4RGMC 3RTQA 4TKWA 3RWJA 4YSCA 4NQTA 4M1GL 3OB8A 5EBGA 1F8TH 3QUZA 4MAYC 1RJZA 3WL9B 4R26L 4GSDH 3MV01 3RPKA 2DPKA 3L5HA 4L4VA 4U6VL 5GQBA 2FATL 2G9KA 3RZCA 1GYWA 3LPFA 3NDYE 2F9BT 1ZLEA 4KRPC 4PTUB 4OFYA 4X9BA 4R96B 3VGFA 1X5MA 1WD8A 1CE6A 2E9WA 3QIUD 4MX7B 3Q8FA 4MDJB 4RLDA 1PU0A 4Q14A 3BLKA 3O41A 4P4KC 2AXFA 1X5AA 3MZTA 3SPVA 4KI5D 5CJBA 2ZXAA 5T3XL 5HVWA 4IEFB 1OWRM 4KK9D 1UB6A 4HXBH 2R39A 4NBYB 2AQTA 3IJYA 5FGBC 5DUML 1GC1H 2NXZD 5GZOC 4AQOA 3EH2A 4UINH 3OB0K 1KJ2B 1AG0A 2IANA 4HBCL 3MV8E 5IB3A 5FUOL 1FO0B 4Q0XL 5FFOA 3EOYG 4FZ8H 4YC2C 3X3FL 4RISL 1FLTX 1UB5A 43CAB 4DGYL 4GKZB 2NUTA 4JM4H 4OLZH 3MJ7B 1JN6A 4JM2D 2X09A 2H4EA 1QRND 3WO4B 3FFCD 1HCYA 1UZ8A 2J4WL 3QB7C 3MTRA 5CJXA 5GS3A 4RFNC 5C97A 1GCFA 1KXTA 4LCWA 3CXDL 1HI6B 4LOVA 4HD9A 4S1DC 3QPXL 4TMPA 4PJ9A 3CGTA 1KZYA 3VYPA 3L9YA 4AIZA 1JZFA 1DLHB 2QMJA 3O3DA 3MC0A 4HMEA 1URIA 3FQ4A 3Q5OA 2A9NH 4MASA 4YIQB 3QHZH 5BRPA 5DJ2A 1OPGL 3ARDC 1YCSA 3MBED 1W72B 1S7RB 5IB2A 2IH8A 3QJRB 1SOSA 4RESB 4PJ7F 1S5IL 4XZ4A 5HPOA 4ETQA 5HY9B 3OWEA 4GAFB 2VLJD 3CFDB 4HPHA 2HKFL 4XWGH 4FFZH 3LRGA 3ZW3A 1GYAA 1JPFA 3UDWC 3ECBB 5CF3A 3UBXB 3UPRA 3TCXA 4NXSA 4FQHA 3MN8A 4FXGC 1DVXA 1PCSA 1U41A 1J87A 1M2OA 2JQMA 2WKLA 2JJTA 2ZP8A 4WO0A 5GRZA 2QHLA 4GBXD 1JGLH 2XG5A 1N70A 5C09B 3TZVB 2ZKHL 4GQ9L 2ARWA 3VRLF 1QNIA 1AGDB 1IL1A 1DJHA 1QSED 2P7TA 3NH7L 5CBEA 1XGQA 4MMYA 3IDIA 5E70A 2WLZA 3KPRA 1DVSA 4H8QA 3CFBA 5E6UB 1KV3A 3NSXA 4LVOC 4MRCA 2A6DA 2ID5A 4TPRL 5DO8A 4NN7B 2BSCA 3ML8A 4NFDA 3SDDC 4Y16D 4OLVH 4MA8H 4EVNB 4H88H 5JDSA 4JY6B 3B4NA 4JHBA 4LOEA 1JCVA 2BOCA 2F53D 1L9SA 4MFHA 4QRUB 1J18A 2XN2A 1H15A 3HOGA 4I0PC 2P5ED 2ZOKA 4PCKA 1MRFL 2W60A 2A9DA 2NY6C 2YAFA 1HNFA 5KVEH 2KLSA 4MCYB 2A6IB 1DJSA 2EDXA 1CGSH 1J88A 1ZTXL 5HVFB 2BS71 2ROXA 4H13C 4N2HA 4RFOL 4LKXB 5EU3A 1QWUA 2I5YH 5EEZA 4NNXA 4B9YA 3H2QA 1S8DA 1PLCA 4H25A 3CHQA 1S7UB 3OAUL 3TYFB 1CLZL 2X0WA 3H0TA 4L5FH 3T0EC 2GIMA 4JJHA 3SHSA 2EIBA 2EDEA 5BCAA 4WY7H 2V2XA 3UZVB 5B7MA 5HYFA 4QDGA 3UIZA 3CLEH 3CFUA 1FLRL 4AC4A 3AT0A 3AG2B 3O2WH 5GGUB 3T0WA 2AMUA 4X4MA 3TIDA 5IQ7H 2ITFA 4JX0A 3CSPA 2OJZH 4HIIB 4Z7WF 2CDEA 3S36H 3L4XA 1CFQA 5DURB 3WJLA 3RNKB 1LILA 1IAIM 2DQDH 1ROWA 3GGWA 2F5BH 2Y6SD 4C57C 5C0IA 3RUGF 1CF8L 4HF5H 5AYUH 3KLSA 2NNRA 3QQXA 3B5GA 2PO6A 4CSTA 3US0A 3BGAA 1PLBA 3BVVA 1CDUA 4O2EB 5CINL 2LVEA 3MOAL 5CILL 1CYGA 3ZE1B 5A3ID 5A2AA 1KIUA 2O6DA 1HXKA 2ED8A 2XN9E 1CS6A 3PAZA 3GPEA 4J3SA 4MJIB 1UXSB 3HNSL 1EJFA 4MRBA 3U4BH 2ICWA 1NH6A 1KIRB 4HHGA 3UYOD 3CVHB 5CCKH 4DQOH 5D55A 5A7EA 5DSCA 1P4IH 1JPSH 5EU4A 5J6HB 1JFQH 2WLMA 3P77B 1A4KB 1UZ6F 5ISZD 2AJSL 3IBOA 3NCYP 3QFJB 4MCZB 1DVFD 3HC0B 4E9WA 1SRDA 3QDJA 2BZCA 4RA0C 4GUOA 2FWOA 2BRQA 3RWIB 4KK5D 2VXQH 4Y4HB 4P46C 5DLLA 2UXVA 5EHFA 1CFNA 1G1YA 1IUZA 1X3DA 3NCYS 4GQRA 3BAEL 2Z91B 4M9PA 3FUKA 1EBPA 3LX9A 1QACA 2Y7QB 2DYRB 4NHUB 4X98A 5C08E 1WRFA 5ID0B 4Z7NF 3BDYH 2X38A 3PXJA 4EUPH 4R2GC 3MRMB 2W81C 4NC1E 5B1AB 1N59A 4IHBA 5J1AB 4IBVA 1BAFH 1EHXA 2CMRL 2ZSWA 3KVQA 5F97E 2EH7H 3QDGD 3GTVA 4KXZI 2D31B 4L9DA 3VWJB 3TS8A 2EDLA 5FO7B 4OR1A 2P24A 1JHLH 4U0RC 5G5DA 5JHBA 3D3VE 5I74C 3QHTC 5CLTA 2B1HL 3BZ4A 1MCEA 4KTYA 3KWWA 1KACB 3II2A 3WG7B 4N2LA 3QCUL 5IFHH 3EYFA 3BGMB 3C8HA 4HS6B 4L4VE 4WSKA 1UJ3C 4TNEA 5KYXA 3VD9A 2A6KA 5AOLA 1KSRA 2W8CA 4WSJA 4NZRL 4XN7A 1M71B 3Q1SL 1ZHLB 4L1LA 2UVFA 2WZAA 5L8JB 3MNZB 4IIQB 3IJHA 3HE6A 2MOGA 4A7VA 4M8UA 5F21B 2H1XA 3FT2A 5EU6B 1YNLL 2W91A 4HJTA 1KWKA 4UOZA 4LLVB 1TZGH 5DK0B 3DJTA 1P5UA 3S2CA 3FTYA 5IW1B 2J12B 1RZFL 2DQTH 1ETJA 1MCOL 3QISA 4LSDA 2EZ0C 3AREA 4MD0B 4RDQG 4QCIB 1C9SA 1UWFA 1HWHB 1WWBX 1UFGA 3NIGF 4FOMA 1YQVH 4PB9L 3G5ZB 5BRZA 1NJ9B 5C92A 4LIQH 3L9EA 1G5AA 4LDEB 1A64A 3KDPB 5EIQA 4QRSA 3AFLA 1BZ9A 3IDMA 2Z34A 4FLQA 4DN3L 3U1SL 3GWJA 1MFEH 4JPIB 5JHDA 2P5WB 2R1XA 3RFZB 3PHQA 3QUMH 4BWWA 1UTDA 4X0KB 5F7HA 1S46A 5AVUB 5B1BB 5IBUG 1NFKA 1YMMD 4OM0H 4MS8C 2WUCH 4OF3A 4WLCA 4FERA 2PYEB 5F71A 4ODBD 4NKMA 4U2YA 3NJLA 4ICXA 5IW3A 4BYHA 4ELKA 4Z3EA 1AQKH 2VDRL 3HR5B 2WLYA 2F8OA 4V33A 4TNVK 3WIAA 1EAPA 4FXKB 1FL5A 3QWRD 4S1RL 2CHWA 5EC2A 3ATFA 3M46A 3V5HB 3KJ6H 3WIHA 1NANI 2VRKA 1J11A 2WXFA 2IAMB 3SD2A 4M7KL 1YUHA 3WUWA 4FJYA 4ACTA 1RKRA 3ARGC 4RMWA 4NYLA 4IBZA 5JORB 1EGJH 2H32H 4JZJB 1K8DA 1NBQA 3LDBB 1NDMB 3FQ1A 4MAUH 4NUQA 1G6VK 1HX0A 4AM0B 4TSAL 4APQD 4C54A 1HZLA 1GVIA 4TLTA 2CLVA 1I8LA 4WUUB 4M1DH 1QFUL 3Q5TA 2WINA 1JNNH 1K8IA 4FDWA 4PGJA 1IE4A 3X11B 5HGDB 2DF3A 4LKCA 5GS0D 2R2BA 3P0YH 3EJQA 3DIFB 3I9PA 4RQQA 1T1WB 4QLWA 1MY5A 4LHUG 4U1HA 3DA0A 1S7QB 3D2UB 4TSCH 5H37G 1FVDA 2OMVB 3OC8A 1BGXL 4XH2A 3T8MA 1E8WA 4XXCA 5C07D 5EZOL 3NCBB 5E8DL 3ZE0B 4GNKB 2FWLB 2YR3A 3LTVA 1U3JA 3QUHA 1ZY9A 3GHBL 3T1WA 1NBYA 1XL4A 1WTGT 1KBGL 3OKEA 5FYLL 4PJ8B 3GI8H 5HDRA 1RHHA 3H54A 3JVGA 1A4CA 4NI3A 3RL1A 5SX5K 2E5EA 3AXLB 2N56A 1PG7X 3THML 2EDHA 2ARJA 4ODUA 3K1KC 4WUKL 1X9LA 1DBKH 1XGZA 2WAQA 1B3IA 1JK9B 4AI7A 2Y0SA 2ZXWB 3ZDXE 2UZIH 1Y18B 2PCPB 2PXYC 2VXVL 4W9KC 4N9GA 1XR8B 3Q2WA 4G82A 1KJMA 3FN0L 3BP6A 2NW3A 3WIFB 1H3TA 3P0VH 1U8LB 4Y88A 5D5MF 3EFFB 4JNXA 2PWEA 4RNRB 5K59F 4XP4H 5T3ZH 2PW2B 3TNMA 2JIXA 1LO2H 2AEQL 4QHPA 3IGKA 1WFNA 2ATAA 1XGRB 5IZ7A 3D85B 3NFNA 3ZHFA 3ALWA 2B1AL 1WJ3A 3BUBA 3FSOA 4YHYC 1NFAA 3MYJA 4UOW1 3T6VA 4JANB 2X53A 4APXA 1DCEA 1CLOL 1WPCA 1JPST 4X4ME 5T1LD 3PE9A 1FYTB 2ZCKH 5E5RB 4L8CA 4Y4KB 3GBML 2Z4QA 3FTUA 4HWZB 1MIMH 1X5IA 4P5KA 2DWDA 5HYJA 3EFDH 1ILUA 2X4UA 4JFWA 3PFQA 4BRJA 1LK2A 1L9TA 3CBJB 4QRTB 5I15H 1XF3A 4PJCF 5IJKC 4LHJB 3ME0B 3D9AL 5A2LH 4P2QD 1DN2A 1A1MA 3SDAD 1FNHA 3NJIA 4TS6A 4UQ2B 3S7GA 3UCQA 2QLYA 1DZ0A 2W92A 4Z8FH 2YKLL 2CLRB 5DJDA 4P9HL 5F1OB 3PWLB 3Q13A 4PU2A 4LT7A 3OLEA 4LLMA 1A6UL 1F58L 3QBTB 1IEHA 4BSVA 4XP9L 2W94A 1IBGH 1UCBH 1FCGA 3BP5A 2VE6B 3RE0A 5E2WL 3IU4H 5IHHA 5CN3A 3FU5A 3P3YA 4A04A 3OZKA 5E8OA 3KDMB 4PRAA 3G7TA 4G80B 3QDJE 3B7UX 3FQXB 1SBBA 2HFGL 2ZOLB 3WN6A 2GIXA 4IBWA 1QFWM 2IBBA 2A77H 4FNSA 3CE1A 5IVXB 3KVPA 1MFUA 3ZKQD 4MBRA 2GSIA 3CFIC 3SY0B 1EEYA 3RURA 1FGNH 1UZGA 3VXOB 1MLBA 1JZHA 4XMLL 4J6RL 4N1HB 1A6TB 4P57B 4ZPTB 2QKSA 1WZMA 5DYFA 4HWEH 5IESH 4ODVH 1PNCA 5AW1B 2VR4A 1F4HA 3HRPA 4FFTA 3LQZB 1IC5L 1VJSA 1XV8A 2Z65C 5C7XH 3FQWA 1AQMA 2NY3B 4NQSB 4OZGA 2BS8A 1TIUA 4OLWH 3H9SA 3E80A 3HG1E 1DDHB 1Z0MA 3V0HA 4AY0A 3VX1A 4MJ5A 4Z78A 4HV8A 1FNAA 1U8MB 4XN9A 2V7NA 3RIFF 5I0VA 2HG5A 1OAYL 1S3KH 2V2WA 3MLZL 1RV6X 2PWHA 1D5XB 3R06A 1WBXB 4WCYH 2ZX8A 4GFXA 4QT5B 3B3IB 2XJKA 4G9DA 1NEZB 4HPOH 4L4JA 2B0SL 3QUXA 4A6YL 1MHPL 1TQBB 5B8CA 1Q4NX 2KZWA 5MP6H 6TAAA 5DK3A 1QSFD 2EDQA 4GMSH 4XHJD 5CFHA 3C5ZA 4H5SB 1XH0A 5E8EB 5E6IB 4K15A 1M3IA 4AIOA 2JMRA 3UBXI 3W57A 1KG0A 1XGUA 2XA8L 1IRAY 2NY5C 5DK2A 1HHKB 5D7SL 3DGGB 4WKXA 5B7EA 3DUHA 3QEQD 4OD3H 2OMWB 1RURL 3DRTB 1YMHA 5BRZE 1B0WA 1WQVT 3MRLB 1TJXA 3AWGA 3EGXB 3LZQA 3SDXB 2WW8A 4W70A 3TGXA 2B4CC 4LSQH 2AAAA 1QNZL 2ZJSH 2OTUA 1AHWB 4MB5A 4NQEA 2NY1D 1DJZA 5I1DA 1CD8A 1YEFH 3FT4B 4S11A 5HD8C 2WD0A 4IM8A 1NLBH 4ABQA 4A2FA 2FLRT 4KKQA 1AD0A 1LP9B 3G08A 3HS9A 2W5PA 4WTWA 1IM3A 4OZFG 1F4WH 1G87A 5T1DL 3BAYA 3HBZA 4DGWC 1R75A 2AJZA 4OCNC 3ULUD 4PTTB 1GGIL 3PCYA 1QYGL 4EBQL 1O6SB 2HT4D 5BVPL 1NGYA 1THCA 1CXKA 4HCIA 1MW2A 1KEGH 4LOFA 4NWUL 2VDQB 1U21A 5T1KB 3RDTA 3CTTA 3NA9H 1AGBA 3MVSA 3MUY1 2XTJE 1UVQB 2ODHA 1VA9A 5C0AA 4KQ3H 3MLYH 4HOXA 4FZEH 1EO5A 3N42F 2ZX7A 4EKXA 5D8JH 3QUYA 1UT1A 5AB1A 2CUHA 5KJRH 2J21A 4U4IA 2ICEC 4WWKB 3PAVA 3OGCB 3HNTL 3LIZL 1V8HA 3ETBJ 1J1XH 3NEXA 3F7PC 1CICB 1AKJA 3RJOA 2E76C 4NN7C 1B2YA 2QPDB 3OPUA 1MAMH 5C0JB 2YKKA 2BHUA 5DRNA 4K7PH 4ELMF 3FFDA 5BO0D 5EH1A 2AQSA 1VENA 2F1EA 3I9IA 3LQAL 1G9NC 1RZKC 3TEUA 1K4CA 3JTSB 5KN5B 3KR3H 4WFGD 1G0YR 3OWRA 4P4KA 2VIRB 3BT0A 1J8HA 3C60B 5LGJA 2V2TA 3SYCA 1FPTH 1KT2B 1T0MB 2UX7A 3CH1A 4JKPL 5CEZD 2WLNA 4XI5C 5GS2D 1QBAA 1QZ1A 4PJGE 2RALA 5DFWH 1FBIH 4AV4A 3PIQB 5H2BB 5C9JB 4FFYL 5FGBA 3T6XA 2FWSA 3C5JB 4E41A 1AXTH 2KQNA 4NZTH 5GZOA 4MQTB 1I7RA 3MR9A 5GJSL 3X3GH 5BRQA 1P84J 4I0CC 1BZ7B 4J3OG 3WNOA 4X6CA 1S9YB 4PRDA 4P3DA 2NZ1A 5HI4C 2FTAA 2DQHH 1VEMA 1SLXA 4Q9QL 4L4TD 2EO7A 5GSVA 3MACH 1SJXA 2AQ2A 1NC4D 1AD9B 3WGUB 1MCPH 3GDCA 1MCHA 5CGYC 2VLLA 1OAKH 3PPSA 1SEBA 5EA0L 3SGDH 4DKEL 1EEZB 1EX0A 4QRAA 4PS7A 3EH5B 3H1ZA 2EYSB 1I9JH 2QV4A 1CXHA 5ESAA 4KJPC 1ZAGA 3GLZA 3ARDA 2Q5BA 2IGLA 4YBHA 5HYJE 4PV9B 4HLJA 4JZNB 1PYWB 3WNLA 1PFOA 5LCVH 2B15A 2WJ5A 2HTKC 3IB4A 3IXAA 3UFIA 5J06A 5AG9A 5JYLA 5TK4A 4OJFL 3NEOA 3LEXA 1NMAL 1BOGB 3DX7A 4G6MH 3UDWA 1IKOP 2J6EL 4B0MB 5C0GB 3D69A 3EJCA 3K6DA 4FXGA 4B9JA 1MVUB 2XWTA 1CD0A 1F3JB 3MJ9A 3D6GA 5F7WC 3ARWA 1BOYA 1D9KC 4IHOB 5I30H 4BH7A 2BY1A 3KMDA 2NNCA 1QRKA 2SEBA 4YQXL 4TTDD 2ADFL 4YX2H 3N0PB 2V17L 1H3WM 2PWDA 4DPBX 3RWHA 1O9WA 1RCYA 4QJ4B 3BUTA 5A43C 1IGJA 4JFUA 1BW8A 1WZKA 5GGVL 3TA3D 5EZIH 4G6JL 4UIMB 3NIFB 2BIIA 4C56B 4HGMA 4HUXA 2H41A 2VL4A 4PCSA 1BVNP 5HDLA 4AT6A 2GIYA 1SZNA 3SDDA 1ORSA 4DKFL 4QKTA 3B43A 1F41A 3K2UH 1JTTA 1P1ZB 3EUUA 4JJOA 4O02A 4MNQB 1CYXA 5JXEC 2J8UF 4LBEB 1LEIB 4K8RD 4LEXL 2NTFA 1J12A 2R2HA 1YEKL 5TE4H 1HEHC 3CFMA 1KJ2L 1VEPA 4LP5A 2E59A 1F1GA 4LZKA 3CDZA 5HHMB 4YLCA 3NSYA 3WIIL 2DYSB 1FO0L 4HKZA 2H6OA 3QIWD 3NABH 4PB0L 4OZGE 5CIPB 3FSZA 3D87B 3H9SE 2RB8A 2OL3B 3VE0B 3CU1A 4HAKA 1QHOA 2R83A 3G6JF 4HKXA 1A6VH 3MROB 5SWQA 4QGTA 5IHUL 4BQ9A 2YXVA 1MCFA 2O93L 5EZLA 3GSWB 1S7XB 1PY4A 2X4OB 3VFPB 2HT3C 3B2PA 5JZ7C 4FYQA 4IIQC 4NBZB 2X2UA 2G3XA 2GBUA 3O3BB 3A0OA 4I5BA 4B9ZA 4F8TA 4KKLC 3KJ4B 1EFXB 3GLEA 1A7RL 3BAJA 2YUWA 2PR4L 3GJFK 2EXTA 3MO1B 1PD0A 2UZYB 1NAML 1DL7H 3LNDA 4TL5A 4UNUA 4QRQA 2GK0B 3VI4B 5I19H 4JHWH 1KTLB 5FYJD 4DVRH 3QJTB 3V52H 3PFUA 4Z5RA 2DJMA 3LCYA 2KT6A 4PGBB 5HHQA 4MDRA 3LKQB 4WK0B 1QATA 1I7ZB 5B38G 5IMOA 3GI9H 4UMSA 1DP0A 3NIDF 4UT6A 3ZR6A 4AWJC 4WNJA 3W9EB 1U8QB 2W1NA 3PQYD 5I0YA 3F65A 5E0FA 5C0NC 1IC7H 1TYRA 3WFHA 1ZLVK 3FCBA 1RZ7L 2NX5D 2J88L 1NGQH 3FJTA 4V1DD 1Q9OA 3QNYA 1WAAF 3FMGH 1BDYA 2MQCA 5EN3A 3ZKXC 3DBXA 3OF6A 3BSZA 2DQGL 4U6YB 5KSBF 1EHLL 5EZPA 3V6BR 1T83C 3LEYL 3VXMB 2R23A 3RWCA 3KPLB 3X13B 4M5YL 3VXTA 4ZNEA 2J5WA 2VISA 3UGXA 1UKSA 4K23L 3AQYA 3RWGA 1O9ZA 1M6OA 3CZNA 3BPCB 2DD8L 2L8AA 3DX9A 1NGZB 3F3HA 4QF1B 1KCUH 4KO6A 1FC2D 4NO0A 4P46A 5ERWB 5A2BA 1GKEA 3WUWG 3I75A 5HGBB 3QHFH 2J56A 3IBEA 4NO5B 4R0LC 4X5XB 5A1AA 2NR6D 25C8L 1GA2A 3MRNB 3O4OB 4M7JH 2CBTA 4BK5A 4Q6YA 5ILTH 2OMNA 7TAAA 3BW9A 4MQ7A 2J1YA 3VW3L 1T0NB 5DQ9A 5C0AE 1BXUA 3REWA 3CFQA 4MMZB 1PDKA 3W0WA 1E4XH 1TZIB 5KBMA 4D0BA 4G9FE 2NNAA 3ARFD 4QLRA 5FKAA 2G3NA 3LKOB 3G9AB 1KYDA 4S1SL 2CK0H 1W8NA 2AEPL 3QEGH 4U1MA 2GW5A 2ADYA 2A3TA 2NYZA 1OE1A 5FXCH 3HS8A 1UJ3A 1L3WA 2BVPA 1SXCA 1CFVH 1GHFL 3FYEB 3W2DH 1HK6A 4ZD3L 1RSFA 3D30A 5F1NB 3RWFA 1B4LA 2B3RA 2O30A 3ARVA 5BOPA 4DUXA 1ZT7B 1BVNT 4P05A 2FEDD 1Q9LB 2ZUTA 3CX2A 1HSBA 2VLME 5A40E 1FH2A 5C86A 1XH2A 4POZC 2CO6A 4CN4A 1CB4A 1YNTF 5IEKA 1UGKA 1J8HE 3GSVA 2PW1A 4GSRA 5GRWA 4XP5H 4NENB 2VDMB 4XOAA 3EO0A 3IKCB 2HXAA 4LLWA 2D7NA 3GZOA 4NQXB 2YLKA 3UO1L 1GPOH 1NEZG 2F15A 2HN7B 4E41E 1X6NA 3MPCA 2VDPH 2H3NA 1OB1B 1G6RA 1CGVA 4A39A 5FHBH 2K8MA 2DH2A 3EDEA 3W5MA 3AROA 1BWMA 4K3EL 4X6CE 3ML9A 3LHAA 4OB5H 4EZMA 4NKOA 2X6AA 1HDMB 2F54B 4OF5A 4R5XA 4UZSA 3S88L 2WXNA 1IGTB 3RQ3A 1YY8A 3QZOA 2GUYA 3GS4A 1KGXA 1RVFL 4Y4KC 4Z77B 2YC1A 2WYTA 5F9JB 1AJ7H 1ZTMA 1OY3B 1MJ8L 5EWIL 4OZIB 4BFFA 5TGBA 1C5CH 4DO6A 3GRWL 5CMAB 1S9KC 4DCQB 3ULVD 3SQBA 5LNDA 1YZZA 3ARGA 4HUWB 3FT3B 3U2JA 3F6JA 1KTCA 2VJ8A 3ZMEA 3BN3B 1E50A 4Z0BL 1BF8A 1J0ZA 3KLAB 4BRVA 3UX9B 1KTRL 1F6AB 1N5AB 4P9MH 4ZO6A 5L2JB 4X5RA 1XXFC 3MOBH 5I16B 1KPVA 5K39B 1GYUA 2K45A 2V9RA 4XAKE 5C7ZA 1HINH 3ZKND 2WWMD 3DSNA 1N7ML 3H7LA 4CVXA 3HFML 4P4RA 3PL6D 1SJEB 1KPUB 5CZXD 2AK4D 5TE6L 1AO7D 3AG1B 1F1DA 4N6RA 3GHEH 4W9ZA 1NPNA 4XC3L 5FGCB 2N4IA 1DLFH 3FCTA 3UTTD 3CZLA 4LCUA 3NQIA 3Q06A 1T7WA 1CURA 4ONFH 4IKKA 1NUFA 3MGOB 2NY7H 3ARSA 1AZBA 3JWOH 5SWZB 1A4JA 4CADB 4MAZA 4GRWB 4LSRL 5D7JB 2WGXA 3TJEL 5F88A 4AENA 2FJHB 1DQIA 3TBSA 3L7FB 4MZ2A 2BK8A 1DDTA 3VXUB 1VGKB 3P2BA 3FO2B 4LEOB 4QHLB 2NY3C 1U58B 4L0PB 1O5DT 3KPSB 4A7GF 4IOSD 1G7MB 4YPGB 1X5GA 1T3FB 2ALWA 3BVNA 1G1KA 4TNGA 2CE6A 2PXYA 3SCMD 3STBA 5DWUH 4HH8A 3BPOC 1RXLA 5I5MA 3GYRA 4NS0A 1RK0B 1A7PH 3WKPA 4TYUA 3MRGB 1BIHA 3T0EE 2FB4H 1CGYA 3IMRA 1CBVL 3WXWL 1TEGA 4AV0A 4Q56A 4AL8H 2HRHA 3QXAB 3N06B 3APFA 4PWKA 2E9IA 1IVTA 3MCKA 2F6AA 3OSKA 1BD2A 4Y1AE 5F7NC 2AXJA 1X9QA 4LARL 5EUOF 1J9RA 5I8CB 5E4IA 3JWNG 2P8LB 4GRLA 3OAYH 5JO5B 5LN8A 1BLNB 4FTVE 3TP4A 1IMHC 1G5GA 4M4RB 3GRGA 1Z5LA 3B8SA 5GJTL 3OQRA 3SE8H 1FI8C 3HI6H 5IJKA 4X5WB 2HWZH 2EUVA 3L3OB 3MUHL 4FYRA 4PWGA 5DJ8B 5CUSL 2QL1A 4BQ8A 4U05A 5I0XA 4YLBA 5L8LB 4LRIC 3IF1B 5HI5C 3VB9A 3RY5A 3BJLA 4P2OC 1JWUA 3WTTA 4PQXA 4TUOA 5E00A 1C12B 4R4FH 1H9VA 3T8VA 3GSRA 4CVZB 4GO6B 2R7EB 3V4VA 3LKRA 5LBSH 3RVXC 3P02A 2XIDA 1P7QB 2DQIL 4NNYB 5DF0A 3NCFB 2MEJB 4LU5L 4QPEA 1ZLSH 3UP6A 4P5TD 3HC3L 4EN3B 2YD8A 2GBTA 2FO8A 2GTZA 4I4WA 2RJMA 4IRJD 5T3XD 5GRUH 2EEBA 2Z7UA 3Q9QA 3B5HA 5FUCC 4NKIL 2OR7A 1AXSB 3E6FB 3VFSB 3ZE2B 2C9UA 3STLA 5F7DA 2AEOA 5BXFA 1FZJB 1TR7A 1D7CA 2D9CA 4F33A 1EO8H 4HK0B 2VQ4A 1MCCA 2AK1H 5ICZA 4ZYKB 2WPGA 1QUPA 4N90E 4XCCL 2V9TA 4N2IA 3SB3A 4DPAX 1UM4L 2Z31D 2VM4A 3ZTJG 4N26A 5FCSH 3IWUA 3GMOA 3K71A 2Y3NA 1BFSA 4XPTH 4FXTA 3ZYOA 1Z9MA 3E2HC 3P2DA 2OMZB 2ZUYA 5DJXA 5MERB 1DZBA 2IPKB 3OR7A 1HHGA 2A99A 2FEEI 3C75A 5FFGA 4RIRB 1WUZA 4B5ZA 5DMIL 3K7UA 5KG9A 4NJAL 3APNA 4HEPG 5GS1B 4DKAA 1XR9B 3OPZH 1CDHA 5SV4A 3W0WE 1PKQB 3ALPA 1A5FH 2P8MA 1NM4A 4QRFA 5TDPA 2HH0H 3QAZB 4GO9A 2Z4TA 4BZ1A 3KPMB 2IBZX 3ZMRA 4X80L 1FL3A 4MX7A 4PLNC 2QSCH 4MDJA 3LXBA 1A0QL 4JEGB 1FSKB 3FQNB 1OHZA 4ODTL 3BH9B 3II1A 4IEFA 2JE8A 1MIEL 4KUZH 5L4IA 3SDCB 3NYKA 3WJJC 2EIJB 4Z7WB 4XCNB 3PWUB 2OK0L 1XSOA 2EC9T 2X70A 1AR1D 4C4UA 3KCPB 2JLPA 3OXSB 5C0CE 5DJAB 3A6CH 4PBWD 2QADC 2C34A 2MHAA 3A22A 2Q8AH 2N0KA 3X17A 4A2HA 4HX1B 2IO5A 4U1JB 3C8DA 3CVIH 5FK9B 4OH2A 1HVXA 1XCQB 2BOBB 4AEIH 4NRXA 5JIDA 2ZICA 3KL0A 2JCCF 2XWCA 1NCDL 1DVUA 2OLDA 2EE6A 4XO4A 1N6QH 3DYPA 3MJ7A 5TFSL 2NZIA 3C6SB 3GMRA 3LPPA 4ALAC 3VXPA 2VC2B 4R7NA 2YRBA 4C8XA 4MB1A 5L2KD 3DX6B 3UTSA 1HI6A 3N43B 2DZEA 5F89B 1PVHA 1AXIB 1DLHA 4MQXD 2K6YA 2DEYX 4KK8D 3PUCA 1LVEA 1LDPL 3NJKA 4FMVA 3H4FA 4YIQA 3KHQA 2BFVH 1OP5H 2UWEF 1I8AA 1W72A 4P23C 2OSWA 2Q3XA 1I1YA 2X1XR 3OMZA 4NUGH 1YPZB 1UA6L 3RRQA 4F7CB 1SUHA 3L1OH 4ZO8A 2MQ3A 1MSPA 4NQDE 4K9EC 4H0GA 1S4IA 5FB8B 5E6RB 1FZKB 4K5OA 3KLQA 3DO3A 4K0OA 4RA3A 2FLBT 1FZMB 3DURB 1ITBB 1PGRB 3UBXA 2IFFL 3TO2A 2BP3A 1CFSB 4BFGA 5IY5B 3VRLE 4UT9A 2CHZA 1XDTT 2BSRB 1MFCH 5DYOA 3UJTL 3BQUB 4X99B 2F5AH 3MRBA 1AGDA 3OG6B 1I8UA 3ETBF 1FFOB 3HBPA 4ZFQA 4K3GA 4Z3IA 4XE0A 3U0WH 3T3ME 4Y2DC 5FM8A 5CJ8A 2ICEA 1F18A 1V3LA 3UP1A 5JLZA 4DEPC 1QOKA 2X2IA 4Y5YC 3HKZA 4E9SA 2X3BA 1OGAA 4FFWC 2GJ6D 2ARJQ 4JE0A 3HRZB 4N2EA 2GHWB 3GEWB 4PG9B 1KELH 2QQNH 4PHZ