3H5LA

Crystal structure of a putative branched-chain amino acid abc transporter from silicibacter pomeroyi
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
397
structure length
397
Chain Sequence
DPVVIGCPAPLTGIVAADGIEFQRGIQMAADEINAVGGILGRPIELVFADTQSKGVDVVIQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVAVHDEMVKSDPDRYWGTFQYDPPETLYGGGFLKFLKDIEDNGEFSRPNNKIAIITGPGIYSVNIANAIRDGAGEYGYDVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFYPQDQALFMNQFMTDPTNSLVYLQYGASLAAFRDIAGDNSVGVTYATVLGTLQDEMGDAFAKAYKERYGDLSSTASGCQTYSALYAYSIAAALAGGPGAPYDDVQNKAVADRLRSLIFRGPVGTMRFHADTQSAWSYPTETNDPSLGMPHIFSQIFDKAEDGVLIAPAPYKKAGFKMPPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative branched-chain amino acid ABC transporter from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Transport protein
molecule keywords putative Branched-chain amino acid ABC transporter
total genus 154
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA01
1DRKA 5T3YA 4KZKA 4F8JA 3N75A 4RK1A 4MQFB 5FBKA 2IKSA 3FGZA 3KG2A 2A9OA 2AYZA 2JVJA 3SNKA 1BA2A 1VLZA 5BRJA 1ABEA 3HSYA 1AB5A 4WXMA 3R0JA 4MR7B 3LUKA 3JY6A 1R8JA 1LJLA 1W25A 2B1JA 3FDFA 3RVQA 4NQRA 2M98A 3GYBA 4RK6A 4Y9TA 5B3JA 4JB0A 3OO1A 2ID9A 1KMIY 2LPMA 3CG0A 1RZRA 1USGA 2MSWA 4MPTA 3MQ4A 2FQYA 1QNLA 5EWLA 1H9CA 2R25B 4KQCA 3JVIA 2QV0A 5TPZA 1ZY2A 2FLKA 3DBIA 4NCAA 1Z16A 2PUDA 3HV2A 3NHMA 2FVYA 4TLLB 5E3JA 3IDOA 2PL1A 3SM9A 3FFTA 3TO5A 1YMVA 4GPAA 2N9UA 3IP7A 4LE2A 3BRSA 1IIBA 3OLYA 5JNVA 3GV0A 1QPZA 4MR7A 3MYYA 1QQBA 1EFAA 1BDJA 1USKA 4G0XA 4Z9AA 1ZN2A 1PUXA 1QQAA 1GUBA 4CBVA 3BBLA 3HUUA 1WETA 4QYWA 1NXPA 5IC5A 3H6GA 3GT7A 3IPAA 1SXIA 3H5VA 4F06A 3KLOA 4OLAA 1BAPA 2GBPA 2IPNA 2RDMA 2QSJA 5IBQA 3S99A 4KPYA 4PICA 2NZVG 2J48A 1P6QA 5JS2A 1EHCA 5EWLB 3M9XA 2RJOA 2R47A 1RNLA 3I5AA 4EVQA 4RSMA 1DG9A 3QEMA 5JNWA 1ABFA 3HCWA 4NCBA 2QVCA 3B2NA 2FMHA 3CTPA 5PNTA 2HJ9A 2XDYA 4IILA 3HZHA 3JPWA 1M2EA 1SD5A 3O2QB 4P1ZA 1T34A 5TQJA 3W9SA 2AYXA 3LKBA 1QP0A 5ED4A 2GI4A 2LBPA 4ML3A 2JBAA 3GWGA 4RKQA 3NBMA 4MLDA 1GUDA 5C5EA 3QK7A 3N53A 3C6QA 1VKRA 4W5QA 1URPA 1MB0A 1P2FA 1YVUA 4F12A 5BR1A 1YS7A 2MYNA 4RY0A 5F64A 4O1IA 4RXMA 4O5AA 4YO7A 4MQEB 4YRZA 5CNKA 2H0AA 3T95A 2M1ZA 2QR3A 1D1QA 3DZDA 3GRCA 5KWSA 4Z4EA 3E61A 4HYEA 3OO0A 3QEMB 4KRFA 3F73A 3MA0A 1PNTA 1A0OA 2VUIB 5C5CA 4P98A 3SY8A 5DLEA 3LUHA 2JB9A 4LE1A 1NY5A 4G0YA 4RDCA 4WZZA 3Q15C 3KLNA 2E4XA 2JBAB 4Z4FA 4OBBA 3O1HB 1GLGA 4TN5A 1NXVA 3RQIA 3TX6A 4EYOA 1SXGA 2CD7A 1LBIA 1CHNA 2FQWA 1LJUA 5IEJA 4MQEA 2CHEA 1Z25A 1JFVA 2A9QA 2RJNA 1Z18A 1ZH4A 2IYNA 2WMYA 3OLZA 2FW0A 1E6KA 4JAVC 4M88A 1DP4A 4MLCA 3M6MD 3OQOA 4KK4A 3KYJB 2WRZA 2QXYA 3O1JC 3KHTA 1D5WA 4JP1A 1EWKA 3HDVA 4NICA 3EULA 4YP9A 1TM2A 4LZLA 2L19A 3N0WA 4KREA 1RXEA 1DCFA 1I3CA 1JFTA 3ILYA 1F51E 2A9PA 3HK2A 3LUFA 1USIA 2E4UA 3Q7TA 3QEKA 5BQ3A 3CLKA 4FB4A 1MB3A 3CZ5A 4LDZA 5EWMA 2E4ZA 4EUKA 2IOYA 2R4QA 4W5NA 3LUCA 1S8NA 3EQ2A 2NT3A 6CHYA 3ROTA 4MS4A 4E7OA 5TE9A 1C0EA 3OM1A 2VUHB 3VNAA 3UUGA 4KVFA 1RZRD 1U2PA 1DBQA 1KRWA 2P9HA 4E7PA 4OTZA 1A04A 2R48A 3HJFA 2LIVA 2WY2D 2NT4A 2MSLA 4EYQA 4N41A 4D74A 4JB2A 1CYEA 4W5TA 4PEVA 2DRIA 3RVOA 3T8YA 3KKEA 3GA5A 1Z13A 3BRQA 3MM4A 8ABPA 2PUFA 3CRNA 2PL9A 2FQXA 1ZAYA 3OMWA 3N6VA 3F6CA 5KI6A 4GNRA 1PNRA 4PE5B 2HQOA 2YHBA 2IPMA 1TJYA 3H5TA 5EWMB 3DLHA 3KJXA 2IDMA 4Q6WA 1MIHA 1PEAA 2LUOA 3GL9A 4MS4B 4NV3A 2NUBA 2MSKA 2ZWMA 1E6LA 3IPCA 4Z0NA 1YK0A 3HDGA 4H3HB 4RZSA 5IULC 4Z4GA 3BREA 3OLXA 2WJWA 4YGXB 4RK7A 2FXIA 2JCGA 3EGCA 4LDAA 2E4YA 5KQLA 1ZESA 5JNSA 2PUBA 1L5YA 2Q5CA 3Q9SA 3O74A 1EWTA 1FFSA 4ETMA 4G0ZA 4JOQA 2P4UA 3H75A 4JASB 4KK3A 3LKVA 1RXIA 4KQ9A 5EWJB 4IRXA 4XASA 3IP6A 1NATA 2KYRA 3FMVA 4RK0A 2FEPA 3O75A 1U0SY 4L4UA 1YMUA 4RU1A 4UHKA 1KRXA 3KTOA 5TPZD 1Z15A 1JH9A 1P8AA 4W5RA 1K66A 1QO0D 3G85A 4KNYA 5FWYA 3HO1A 4G0QA 2HQBA 5HSGA 5HQJA 1RPJA 1J56A 1MVOA 2VYCA 2WJAA 3H5IA 5D2CA 3QELB 2HSGA 4W5OA 1LBHA 4ETIA 5IEBA 5JS1A 3O1IC 2A9RA 4YLEA 5KQGA 4WUTA 4LX8A 4XLTA 4ZMSA 5KQPA 1D1PA 2PUEA 3TD9A 2BGGA 1M5TA 5EWJA 3M9WA 3O21A 4Z4HA 4EVRA 3L6UA 5ABPA 4FE4A 2H3HA 4MR8B 3OLVA 5JNRA 4MR9A 4YWHA 2FMKA 4L85A 2PUGA 5T7BA 3I09A 4EGSA 4YS6A 2GWRA 1QMPA 2ZAYA 3Q41A 5IUKC 2F8SA 1D4ZA 4EYGA 4S05A 3NHZA 3NNNA 2WWVD 5FWYB 1QO0A 3JVDA 3KYIB 1P6UA 3H5WA 2CWDA 3QELA 3RVJA 1E2BA 2VK2A 2OQRA 1HEYA 3JTEA 1E6MA 2LP4Y 1SRRA 1BDHA 1JDPA 3QLVC 1FFWA 4H3KB 4WT7A 4KV7A 2QVGA 4HNRA 3T38A 3MMNA 3LFTA 1NXXA 1Z12A 2PAFA 1EAYA 3N0RA 1F4VA 3OM0A 1NXWA 1L5ZA 2L2QA 3EJWA 4IMIB 4RV5A 1NXOA 2WB4A 4WXEA 5DKFA 3CU5A 2MYUA 1JBEA 1DBPA 4MR8A 1DZ3A 3O2JA 4RK4A 1YIOA 4MR9B 1D2AA 4PZ0A 2X7XA 1ZITA 9ABPA 5FWXB 1DC7A 3MF4A 1JLKA 3UKJA 5KQMA 3EAFA 4JA2A 4TMYA 4S04A 2JVIA 3BILA 2I6FA 2TMYA 1DBWA 1JDNA 1NTRA 3T6KA 1Z2DA 3D02A 3IP5A 1DJMA 2V0NA 6ABPA 5BRAA 1QKKA 1U8TA 4F11A 3TMYA 3CFYA 3MIZA 2QU7A 1W9HA 2MYPA 3OQMA 1JX6A 3VNBA 3A10A 5DCLA 3NNDA 3H6HA 4ETNA 5CNMA 1KGSA 5CHYA 5IX8A 1DCKA 1Z17A 3C3KA 4ZYLA 4Q7EA 7ABPA 1B00A 1YS6A 4TLMB 3P9YA 4MYRA 4RXUA 5JNUA 3QX9A 4ZPJA 3SAJA 5IUNC 2PLNA 3LUGA 2JRLA 1VPWA 4Z4IA 1FSPA 3DGFC 3KS9A 4QYMA 1JYFA 2GKGA 3A0UA 3F6PA 4MRMA 1JFSA 3C3WA 4XARA 1OXKB 5IUJC 3N8IA 4QICA 2FKAA 2IPAB 3CNBA 3Q7RA 1GCGA 4RK5A 5TQ2A 4N76A 5JNTA 3QLUC 2F8TA 4XAQA 4PYRA 5FWXA 3RVLA 4DN6A 3CG4A 2CHFA 4YR7A 2PUAA 4OG2A 1QP7A 3K4HA 2HQRA 1ISRA 3DLBA 1PHRA 1JF8A 2E4VA 3QLUA 1AB6A 3KSMA 1CEYA 4EY3A 1ZH2A 1M2FA 4RXTA 3JS5A 1BDIA 4MGEA 3K9CA 1M5UA 4N0PA 3F7NA 3SQNA 3RH0A 4EYKA 4XXHA 2HPHA 2B4AA 1FQWA 1Y1LA 2PKXA 4O1HA 1XHEA 3LTEA 1QP4A 3A3KA 3C97A 3H5LA 4LRQA 4IGAA 2FTKE 2FMIA 1ZDMA 5B3JC 3H5OA 3HEBA 3H1GA 3D8UA 3LUAA 4Z9BA 1JWLA 4MRMB 5TQ0B 5GQSA 5HKOA 4IF4A 4MS3A 3HM9A 2FSPA 4RY8A 2FN8A 5TQ2B 4F3TA 5KC8A 1U04A 4N47A 3HUTA 3KCNA 3QLTA 5I4CA 4YCSA 3GBVA 4H60A 3OMXA 3RVPA 2ID7A 3LUDA 4MS1B 1YTUA 3LMKA 5TPWB 3HXMA 4DADA 1FFGA 4HNQA 4MAAA 3CHYA 3EODA 3UK0A 3RVRA 1MAVA 2IPLA 3O2SB 3C3MA 4UHJA 1U2QA 4KMRA 3RVKA 4WWHA 4QPJC 4D6XA 3JPYA 2E4WA 3N0XA 1YK1A 2L18A 3I42A 1DCMA 1XWWA 4FE7A 4EVSA 2FMFA 2OENG 5CNJA 4Z99A 4G0MA 3CZCA 3H1FA 4HNSA 5TQ0A 4LE0A 3IP9A 4MS3B 2O20A 3CS3A 3TB6A 1A2OA 3ROFA 3RVSA 4RS3A 2PUCA 2PE5A 2QZJA 2JVKA 3OLWA 3CKMA 2W42A 3G1WA 1VRVA 1TMYA 3FFWA 3ILHA 5DGCA 3RVMA 1XHFA 4MS1A 1LK0A 5TPWA 3FFXA 3NNSA 4G86A 4N03A 4RWEA 1ZGGA 3E3MA 4N0QA 2MYTA 1DRJA 2FEWB 1UDRA 1ZHHA 2L17A 1GCAA 4XFKA 3Q7SA 3HS3A 4KFCA 1JYEA 1K68A 3DGEC 4MQFA 1ZVVA 2FN9A 4DQDA 1TVMA 1NXSA 4G97A 3EDCA 2RGYA 1SXHA 2PMCA 5GOTA 2QW1A 1JHZA 2GX6A 1Z26A 3URMA 3LUJA 2JK1A 2PJUA 4RY9A 3EQZA 1Z2EA 4OATA 5DTEA 4IMJB 3OQNA 3LOPA 1BVHA 1ISSA 2FEKA 3L49A 4Q6BA 5FBHA 2FLWA 4ZMRA 3I45A 5CNIA 4B09A 1PEYA 3GBPA 1DC8A 1ZGZA 1NXTA 4RKRA 4OLBA 3SG0A 1C4WA 1EWVA 5KC9A 4YV7A 3H1EA 1JL3A 2NZUG 1APBA 4G0PA 4Z4CA 4D6YA 1OXBB 3QLVA 3RVNA 4ZJPA 3A0RB 4G0OA 3QX8A 2YHAA 3HVRA 5HM6A 1TLFA
chains in the Genus database with same CATH superfamily
3RWBA 3D6VA 2A4MA 3BL6A 5KINB 1WMEA 3O47A 4I8DA 4U9UA 4MQFB 4YMSA 5A9TA 5I9NA 4C3OB 3KQWA 3T5PA 1I10A 3OJEA 1CVIA 1SCJA 1I80A 1N9GA 2R7KA 5TS2A 4CV2A 4JI0B 3ZWCA 1A7AA 1X39A 3NWOA 1K4KA 2ZLBA 1O87A 3RUCA 3DDSA 4J0DA 3UIEA 3ETLA 1KQGA 1R8JA 4DLUA 1HE3A 4N3CA 5BOVA 2NX2A 4RTQA 2M98A 5F7OA 2I9PA 1KF0A 4I1IA 5KMGA 4JKYA 4L9AA 4JB0A 5K4GA 3ULKA 1ONNA 3FPLA 1Y5LA 3CG0A 5B57C 1OQAA 1D1SA 2UXCB 2HLPA 2XCOA 4FFLA 1HKHA 4S0ZA 2VLBA 2O6LA 1CNMA 1QWOA 3EXHC 3QKRB 3PUVA 3D9QX 3M5CA 2DBYA 3KBBA 4DJEC 1QG6A 4MARA 4OHUA 2AOWA 1QHIA 2RHLA 4Y2PA 3EIXA 4DWOA 1ULAA 3E22B 1VCIA 2PO7A 4LE2A 3EWIA 3F8WA 3VH2A 3TB4A 3EZGA 1FL9A 4OHOA 2H1RA 2G9VA 2X0DA 5C46F 3LNTA 4OV6B 4PHTA 1MP0A 3EOAI 2BR4A 1E58A 2FUKA 2AKYA 4G5FA 2FPLA 2P69A 5B2ZA 3ZY3A 4CBVA 2GAJA 4AJ1A 5IVHA 1E5LA 4AUNA 4D96A 2BEVB 1F6BA 1DQPA 1E9DA 3G49A 4JL5A 4FKBA 1ZM2A 3GT7A 4NEHB 1ODTC 4LJSA 4PZEA 5AR1A 2JCYA 5T64A 3VUFA 5B3LA 1CF2O 3S99A 4AFNA 4PGGA 3ZW8A 4UVIA 1L8AA 4ZO8A 5EWLB 3KZOA 4PGFA 3UW1A 5LR6A 1OGIA 1Y8QB 2IL1A 3ZWQA 4BVHA 1VECA 2XEDA 3COWA 4F3RA 2RIRA 2ZPAA 4WEQA 1KH2A 1I1QB 2R1UA 1PK7A 4E3WA 1LVUA 1YE8A 1ZEJA 2ESRA 3CLSC 2WTNA 3I6MA 4J16C 4NYIQ 5HF6A 5IP5A 5LQSA 4CE6A 1WU8A 4WCFC 4E6PA 4AVYA 1YH3A 1M2EA 1EFCA 1BG6A 2PGAA 4JDPA 1O0BA 4AD8A 2Q3HA 4HDAA 5FULA 3PQ6A 1HUQA 2HAEA 3TD2A 4Z8YA 3LJKA 4QQFA 1SOAA 2HQSA 1N34B 1HETA 1VE9A 3G59A 4G07A 3ELBA 3W2IA 1UM8A 1ZCZA 1LCIA 1KYTA 1YS7A 1AKUA 2O8EB 1STOA 4I8IA 1WTAA 1E0DA 4A82A 1E5DA 3KQQA 5KQRA 2NV0A 4IOLA 2CT8A 2GN0A 2ODNA 2B8NA 1J2TA 1WB6A 3AI2A 3H19A 4BMDA 2OWEA 3CCFA 2QZ4A 1C4KA 3HVIA 4G25A 2KB0A 5FADA 4JQYA 2ZJ4A 5FOVA 2VT6A 3I04A 4JC0A 3UKDA 4WDRA 1Y5MA 1LPOA 1XPOA 2WYWA 2P65A 1Z4MA 2X0FA 1BJRE 4M9SA 4Y2XA 2MCFA 3CRQA 3EARA 1F3OA 3SYRA 6REQA 5DLEA 5L4LA 2TRSB 5D1HA 4G0YA 4FQ7A 1Q0LA 3ND7A 4RDCA 1HE1C 3T0FA 4AMGA 2P2GA 4EYEA 4ZOLA 2YJ4A 4BQEA 2UZ1B 4P4UA 5K0TA 1E1YA 1AQYA 1SVSA 1ZGCA 1ARZA 2CNKA 2W90A 4DNFA 5L8VA 1YASA 5IASA 2RGRA 8MHTA 1NXVA 3KSZO 3ZV7A 1ND6A 3GJZA 1OFTA 2ILTA 3TX6A 5JY1A 2AWNA 4IRMA 3NR2A 4RYDA 1BS1A 1XNHA 2AOTB 2C2OA 2GM3A 3QTBA 3TZLA 1EWRA 2HHAA 5DYYA 5BNWA 4I8XA 1JKJA 4IQ0A 4JN6B 4COKA 1MOQA 4JWKA 4M9RA 3K70B 3UICA 1Z18A 3OT4A 1LH0A 1XX6A 3M1YA 4RF3A 3F1KA 3QMPA 5TGZA 1U3WA 1IQUA 2ZB7A 3N7TA 4OXXA 4A2WA 5JXGA 3FAZA 4ZICA 4JSYA 1TD9A 1YS1X 2W6CX 4J9UE 5FDFA 3UMMA 2O8FA 5JXIA 3R0ZA 2G5CA 2O3SA 4IIBA 3RADC 1V3VA 2C58A 3GLSA 4GR4A 1F51E 2WPDA 1H4TA 1EDZA 3SEZA 5AOVA 1OFIA 2UUBB 1KO1A 2WTMA 1DJQA 2YZ7A 3QV1A 1T5BA 3DEZA 3WB2A 1MB3A 4EB0A 1MX9A 4AKEA 1CXZA 1M34E 2IOYA 3LUCA 1HFEL 4ZIRB 2ZJ2A 3OCYA 1SKYB 1XCMA 3QW2A 3ZU2A 4DLBA 1XK7A 3GXBA 2XBUA 4MRAA 4A6PA 1XDUA 2YC4C 3TIVA 1RZRD 4GLOA 4HADA 3UW3A 1THZA 5TQVA 2DFNA 1KRWA 1QOZA 1A8SA 1EQUA 2JF0A 2Z6QA 3SJBA 3D8SA 2WWGA 4I19A 5C5IA 1Z9BA 2FRVA 1HG0A 1OKKA 3P2EA 1E7YA 4EYQA 2BFDA 2QG4A 1G9XA 2B1IA 3CGWA 2RIPA 1R8QA 4PEVA 1NQ5A 2ZAGA 4J1NA 3WA6A 3ZDEA 1XTBA 2X1LA 4OHWA 4MVJH 4D41A 4QJ5A 1GOTA 2B6HA 1AUVA 3BRQA 4BBAA 1SBQA 2TMDA 5LD2B 2ZBVA 2RB5A 3OMWA 1AK2A 2H31A 4EKEA 1MGPA 3I2KA 1R2QA 4KXYA 2I3AA 2QMYA 4FGLA 3O1LA 4GKVA 5J43A 3AUFA 1PV4A 2YHBA 4TOIA 4KQEA 1YA6A 3WWDA 3UA3A 4D3YA 4EUHA 4NFYA 4HLDA 4EJ2A 2QL7A 1MIHA 1SUCA 2LUOA 2PTHA 4NMHA 3N0VA 3K71B 4JXXA 2VZEA 2C2ZA 1ZRHA 2EDAA 3AOGA 3LP5A 4OL9A 1LF5A 1KAOA 2NN3C 2VRNA 4U2BA 3ROQA 4UD2A 2QM3A 4MJ3A 3LC2O 3RWMB 1CNFA 3G0BA 1PTJA 3UMFA 4NMMA 3AK4A 1DO0A 2QVBA 3HR8A 4MYCA 4Q37A 3PJRA 3CVUA 1SCDA 3FRJA 2RHOA 2YNMA 4PPQA 5JNSA 4NXNB 2NVOA 3PLAE 4BKUA 4C7OA 3JXEA 4YAJA 5B4VA 1T2UA 4KK3A 4BL5A 2NU8A 2YXNA 4P3PA 4QBHA 1HL7A 4CR7A 4DG5A 2GDZA 3HCEA 4JDUA 3FOFC 1TJNA 2V7UA 1NG1A 2X15A 2XUDA 3OOYA 5IMBA 4A3SA 4UDOA 1EFPB 2NV2B 4GF5A 2CBZA 3ENNA 5ILOA 1BHQ1 5ALFA 4GW3A 3FMIA 5EG5A 3JAWA 1S6YA 2PZJA 2VDWA 5CAEA 2FPUA 1IM8A 5CYGA 4HMOA 1WSDA 1C0KA 3LSTA 3ZI7A 1FYFA 4UUBA 4YREA 2JGEA 5KTSA 4KNVA 1M9NA 3B5JA 4AO6A 2DHQA 1X7GA 3PJFA 1L6RA 4YRTA 4X66B 5EP4A 1GZ7A 5KTTA 3PC6A 4HRYA 5L3SB 1PG0A 2R4TA 2QU8A 4M7RA 3N07A 4YMTA 3ZY5A 2F4NA 3UJPA 1MZVA 1M7GA 1SCQA 2A0KA 2FPXA 4IFTA 3E9ZA 3LA8A 3MSXA 4M6WB 4P58A 4R8SA 2X77A 4RNDB 3U3RA 4E2XA 1P3Y1 1BX3A 2I03A 4BY9E 1E2PA 3GGSA 2JGFA 2JJMA 4ZVKA 3MB8A 2ZRBA 3HP4A 5KQGA 4I36A 3FI0A 2QM0A 1Z8HA 1MABB 4AJOA 1GPKA 3T1OA 4CM1A 3NAGA 3WJ7A 2Q3FA 3ZZUA 4YFVA 3TM4A 1OZFA 1Q0PA 5SZHB 2R00A 4WBXC 4IDEA 4JKIA 3GYGA 3GLIA 3H2JA 1WABA 1DWOA 1W85B 4IEFB 3MTGA 5LUAA 3IPXA 2G17A 3PQ2A 1NYTA 1MNAA 5T7BA 3NWBA 2NNLD 4MVJF 4IHJB 4MW6A 2Q5JA 1MX1A 1TAGA 3KZCA 4I99A 4QPNA 3TOCA 3IUSA 3THWB 4AN1A 1WW8A 3NHZA 2QSZA 5CYFA 1Y3DE 1XDWA 4JR2A 2YMMA 3PHJA 3VNSA 3O90A 4IWYA 1E63A 5FTJA 3ONVA 1XWIA 3SKXA 1WUHS 1YDGA 3INGA 1PDOA 3TXXA 1QAMA 2IYAA 2YBEA 4BFUA 3REQA 1U2DA 2IXAA 3TLXA 1E3LA 1KBOA 2AN5A 3CF0A 1X13A 3B9RA 3T35A 3X43A 5JR3A 2P30A 1ES9A 3UAWA 1JB9A 4CL3A 4DXHA 4KV7A 1DDIA 3C6KA 2ZT7A 1F4VA 4WXYB 5AVJA 1TVKB 2D00A 4TS9A 2CMFA 2DKOA 3R74A 2GPNA 4IVNA 4O33A 1NT2A 1DZ3A 1U7WA 4ODIA 4JELA 3KT3A 1JQEA 2DY1A 1RPZA 2IHUA 3RJ9A 4XSVA 2ORED 1NV9A 1FP6A 1RYZA 1E3JA 1Y42X 3HB1A 1JDNA 4H17A 2B69A 4B82A 4DM4A 5IT9A 5IKXA 2BFFB 2VG8A 3L84A 3PWKA 1Z4PX 3FUXA 3H9JA 2SECE 2QU7A 1UBGA 4NHOA 3I1YA 2Y6UA 2A3NA 1FC0A 3KR2A 3O3NB 2VH1A 2VKQA 1DAGA 1GUYA 3QKTA 3VNBA 4D81A 2CVZA 1U3TA 4EQ6B 4UASA 2F3SA 2C07A 1P39A 1IZYA 1V5EA 4R40A 1M83A 4X7MA 5DW0A 3GVIA 3OF3A 3ROXA 3V8MA 3E35A 2IV7A 1M6WA 3V48A 1Z0KA 4Z6KA 4FB5A 4TSRA 2BIFA 3OPQA 4ZKEA 3WNQA 2OZLB 2GASA 4HWOA 3GEIA 1GL9B 3BMXA 3IPRA 5D5PA 1L5QA 1HEUA 3QYPA 1U4OA 3BXEA 4IDDA 4U3JA 2VKTA 5EHGA 4DC9A 5BQXA 4HQKA 5AOAA 1X14A 1N0UA 1UOEA 2J7PD 3DG9A 5EGSA 3QFCA 3ZWBA 3SZGA 3LU1A 3RVLA 3ZDQA 3HLTA 4DLKA 2CHFA 2G1AA 2NIPA 4Y6RA 5KNCH 3HJCA 5KNBA 1G55A 4LNUB 4P81A 3M4YA 2C78A 1K7XB 1FP7A 1DAEA 1OGYA 2B99A 2VLIA 4B8WA 2GZMA 1TRKA 2RB4A 5C81A 3A32A 1USWA 3V8QA 4YYZA 3PJEA 1FQWA 3L05A 3NBXX 2ZBFA 1GPUA 2WWIA 3B70A 3K9HA 3HI4A 2TMGA 3L7AA 2FUCA 2RAFA 3IVXA 3DXYA 1SVMA 5DWQA 1Y82A 5AHXA 4FM9A 1WPRA 3R7FA 1ZA1A 3KLMX 4BTLA 3VU0A 2AEFA 2O0KA 4BQFA 4JI8B 3C43A 2VTBB 3BGWA 1IEVA 2GRAA 3AFMA 1QZZA 2DQYA 3I2IA 4HXGA 3R8XA 5A3VA 2FFJA 2J9RA 4TPKA 1I6MA 1CJVC 2OCLA 1MIOB 3IAEA 2QAGA 4ZTZB 2RMKA 4U9HS 3BZUA 1OH5A 1II8A 3ZX5A 2RJ3A 1CNEA 1E1RD 4KE6A 4NBSA 4C6RA 1UIRA 3BE6A 5EJAA 1DHTA 1GSAA 1AZSC 1XNGA 2O2GA 2W6QA 1TO1E 1L7OA 4WWHA 5JI2E 3WLFA 4N48A 1JLHA 1WO8A 4IAOA 4RMGA 2VHEA 2ZI4A 3JPYA 3KKOA 4KAFA 4UATA 2NXJA 3SJCA 5C8ZA 1AK9A 1K6JA 1VSVA 2ONKA 3OETA 5F1PA 4GOOD 2GHRA 3ZCQA 1NVMB 3PFNA 2J5XA 2X8JA 2LR0A 2Z5FA 1R9JA 2EERA 1ADFA 5TARA 2BSXA 1N2IA 2DPYA 2O20A 4J43A 3CUEF 4WTOA 1CY1A 3DCIA 2GRJA 3D1VA 1WXXA 1EUZA 3D4IA 3M6WA 3OOHA 4FQ5A 2FI1A 2C2XA 4DCVA 2FKNA 1RYBA 3T7RA 1T1SA 2HZ7A 3TEFA 2A5DA 2OM2A 3HYCA 5FNVF 1F8FA 2QPAA 4YBZA 4EG7A 4AJ2A 3ZDBA 1I6WA 3ZWKA 4LJYA 5KTKA 3DKPA 3WGVA 2C4NA 5IDVA 5BUZA 2IF0A 3JZFA 3U4MA 1P5ZB 4QDZA 1B15A 4HX2A 3RC2A 1RJDA 2XH8A 1YIDA 3KVYA 5KTPA 2ODTX 1N9KA 3W5IA 2PQ6A 4XYLA 1D3AA 1GU0A 3IS3A 2XUFA 1JYEA 1U1DA 1V35A 3C15C 1N5OX 3PHIA 1F0PA 4G97A 1R5BA 4DIUA 5EP2A 1J0DA 3KXPA 3HMKA 1H69A 3RYCA 3VR4H 4AZVA 4WXRA 3OOWA 4EI7A 1DSSG 2AR0A 4OAPA 2PJUA 3B6JA 2P0YA 3NGXA 3GLFE 3KVRA 2IZZA 4DMLA 1OBOA 3THSA 3V6MA 2VFAA 2P6MA 2YY6A 4HLCA 2FV8A 2DPMA 4K28A 4OQEA 4XVHA 3X2FA 2FEKA 3MJFA 1L8LA 3I45A 4XD2A 4ZRMA 1P7YA 1W1UA 7MHTA 4CCAA 3W8RA 4NULA 2ANBA 3A6FA 5I3ZA 3NJRA 1APBA 1E7WA 4LWQA 5D7NA 5THXA 1QH1A 4DB4A 3QLVA 1UK9A 2FUG6 2HEIA 3VYRB 1JE1A 3IBGA 5K3DA 3L07A 3IAXA 3REFA 3DCNA 5FQNA 3MILA 2A78A 1E3WA 1E2EA 1CJUC 1HE2A 2X2OA 3EEQA 3R5FA 1IBMB 2HW8A 4GZMA 4URUR 4UXHA 4Y6GB 2BFNA 4N8SA 3CA8A 2HGZA 2GD1O 3OIWA 3OZTA 1I7PA 5KYTA 3IKTA 1GPBA 3FYSA 3HSYA 3R44A 2HHCA 4WESA 1W75A 3R0JA 1PG5A 4REMA 1O6GA 1T26A 4WBNB 1B41A 3N8HA 1HZZA 4WNAA 1YOVA 1XF1A 1QRDA 1G64A 4ENVA 5DV9A 4CG0A 4DA4A 4TYWA 5LQRA 1XB2A 4G36A 4E1BA 1FRFS 5BT8A 3AY7A 3VKUA 4B87A 4C4YA 3O9VA 4G3XA 4GSKA 4XJTA 3TUZC 2GN1A 1L7PA 5BQOA 4US0R 2GHTA 2BP7B 4HQ0A 2GD6A 2X9LA 4RIIA 3T7EA 4LI3X 4G5QA 3IUBA 4HL6A 1BGXT 1VMEA 2O1SA 2W43A 3WRYC 3CCCA 1DLIA 3HJHA 1PVOA 2D5AA 5FPTA 1NDUA 1R6BX 1W2WB 2PPLA 3BZWA 1ZXXA 1NGSA 1Y6JA 3OPYI 3RROA 3NHWA 3BRSA 3SYNA 2C4MA 4CQMD 4WBNA 1M1XB 2H1HA 4CU5A 3DAYA 1S8AA 2ZI3A 4Y1GA 3ANNA 4I9FA 3I8XA 2PGLA 1QQAA 3DR3A 1JKXA 1KFCB 3JALB 3M5WA 4FNOA 5DYGA 2XRZA 1UMKA 1V48A 2E6UX 1TM7E 2QRVA 2XHEA 1EXDA 3RC1A 1PWZA 3ANXA 1QHXA 1DELA 2GBGA 3GLIE 2PH5A 2O50A 2VAWA 4GOKA 3HY6A 5JCOC 1SJ9A 3M2PA 4NBTA 5A7HA 1L9KA 3L43A 3G82C 1SU6A 4J0EA 4A0GA 2JJYA 3O4RA 5ARDA 4ZYXA 1P6QA 4X1YA 1EHCA 4CLEA 2NGRA 5CGZA 4EKDA 1TXGA 2K6GA 3WICA 3AXSA 4JL6A 2WM2A 1DG9A 3F5QA 4R2XA 1RC8A 1GTVA 4MV3A 4EMTA 4ZXFA 5J2TB 2I2XB 2Q2WA 3CTPA 4MV5A 4P9NA 5GM2A 4Z7NB 3NRBA 1YNOA 3FVRA 4UNIA 3Q10A 5EXSA 2FPIB 5JV5A 2NVBA 4DHEA 1T4CA 4TWAA 2LBPA 1PJLA 2P3LA 1BWPA 1RLTA 2JBAA 4EX7A 5TXGA 4BFXA 3FZGA 1RWOA 1QX4A 3K9WA 3IE1A 2JKYA 3CVXA 3AVUA 3BMNA 2JCSA 2G6BA 4RABA 3WIBA 1Z5VA 4L0MA 3CKYA 2ZJ5A 4R7TA 4FYYA 4D9GA 4OQDA 3SWWA 3BT7A 2PYIA 4JBWA 3UWPA 1RM4A 4D1YA 1SUIA 2ABWA 2EX1A 3KQPA 1QTNA 4QC2A 4GYJA 1YB7A 4ERNA 1T5OA 4PCAA 2CXRA 2XKAA 4QECA 2RKWA 1JMVA 4LY9A 1K1EA 1C7FA 4J0GA 1D1QA 3DHWC 2IF2A 2G1UA 3UMJA 1BU5A 2C04A 5HTKA 4FUQA 3HDTA 1SBNE 4DIMA 3OQHA 5T41A 1SVUA 1TZKA 3IQFA 2HT1A 3AEZA 3B12A 5C5CA 4W4TA 2A9VA 5LJLA 2AEEA 4C07A 1VJ5A 1KIAA 2GPAA 4LRUA 4R84A 2JI9A 2ATVA 1MRNA 1NJ5A 4LE1A 4IOKA 4NAUA 3RCBA 4A92A 4ZI3A 1P9LA 5BWCA 5IWAB 4F8EA 4NAHA 5KTYA 3PTLA 3NFRA 1KP2A 1J2UA 5U1PA 2EBWA 2ZS7A 4TN5A 3RD5A 3FSRA 3SIWA 1T9GR 2X5NA 2HRRA 4IQFA 1DC5A 4PQYA 1YRWA 2R7NA 4JFAA 1B4DA 1E1RA 4AIIA 4A0FA 3BXFA 4S1TA 2HF2A 2IYQA 3GLTA 3MCZA 4MQEA 3W0LB 1W36B 1KO8A 3VHXB 1CTQA 1ZH4A 2XUZA 4M7PA 1S3GA 2DT8A 4IIJF 4N6GA 1O96A 3M2TA 5IJ9B 4A6EA 2ZYVX 5JHGB 2JH9A 1MJ5A 2WIFA 1GG8A 2NZJA 2FZGA 5HRUA 3EIUA 4PYIA 5LWQA 3L4KA 1NUTA 3T4XA 5AWFC 5LIRA 4YAKA 4WX2B 3DLCA 1C7ZA 2P4HX 2E18A 2EOAA 2PK3A 5BMVB 3Q8XB 1CDDA 3W8EA 1FX0A 3EVNA 3ILYA 5FPPA 1OLSB 1JLSA 1YS2X 4CM9A 1SB8A 1U0JA 2OV4A 3SXUB 4CMCA 1U8CB 1V8PA 5I9SA 3U39A 4ZJZA 3CZ5A 3MFQA 5F4ZA 3GHYA 2JA1A 4DY6A 4RGVA 4CF3A 3IH5A 3PWTA 4CLXA 1RYDA 1I5EA 1SOMA 1YGPA 2EZ8A 5FBRB 2HF8A 5JSZB 3VGJA 2Y2VA 1HI9A 3OJWA 4MAFA 4QDKA 4ZXPA 3ZZ0A 4C0AC 5C0OE 2JJ8A 2H2HA 3UUGA 3NVDA 4LDPA 2O4CA 3L77A 4CV3A 2BOVA 1ZM4A 4MJLA 4RMJA 4N0EA 4W6QA 4E5YA 2BFEB 1OHHD 1QTRA 4JLUA 1KNXA 4FT4A 2QE6A 4L08A 2WVJA 2XVMA 3AM4A 4ND8A 3U3OA 1U9ZA 5EZQA 1L0BA 3HWX1 4KXVA 5E1BA 3CC8A 3L7MA 3T5BA 1RBZA 3RVOA 1I2CA 1HC7A 3Q8MA 1RAIA 3T8YA 4MAMA 4W9RA 1C3JA 4YRBA 1P2TA 4GX0A 1E98A 3RU7A 1CX9B 3CEJA 1CUHA 3HDYA 5A05A 4CXMA 4WLOA 1OLSA 3IOCA 3FI9A 2AFHA 3T1NA 4EHNA 1G4UR 5EJ5A 1RWQA 2WEKA 3FPBA 2VHCA 3C41J 3MOGA 3MGGA 3MJCA 3OU7A 3QMMA 4MV0A 4YJ3B 3DLHA 1AGNA 1ADBA 3W9UA 5I9LA 4LYAA 2QX7A 4XPZA 5ERYA 4E4RA 4BX0A 4PZDA 3RYHA 3FCOA 5FLKA 5EJFA 4XVRA 3NEJA 5K3FA 3SE0A 5U4XA 5CXQA 1QRSA 3I53A 4BNFA 1F7VA 3R9WA 4JS0A 1AKEA 3LXMA 1MBZA 1XTTA 1YK0A 2RK3A 1Z6XA 2GFIA 4H3HB 2FZLA 3WQRA 4C2AA 2FR8C 4IX1A 1KHHA 1H2HA 4LY3A 3FWKA 2DPGA 3F90A 5IC6A 2AJCA 4DLTA 1L3IA 3O38A 2NTVA 4ABYA 3IQWA 2OMKA 2OZVA 1KSGA 1BKYA 1BVYF 1AF4A 3C1TA 3TDMA 3RIEA 1LJ8A 4HPJB 3I0ZA 4HNHA 4NE9A 5FUXA 5HMLA 4COOA 2GEUA 4LGYA 2BMVA 4FBGA 3SOZA 4CKEA 1X1CA 3R40A 2OHGA 2BMAA 1KE1A 2DT5A 3KVNA 3LWNA 4MUKA 3P2MA 2PTGA 4KKXB 4QDOA 1C3OB 4XASA 1W1WA 1Z4LA 2X3UA 3JQBC 1AQ6A 3LRTA 1TYDE 2MINA 3NH6A 4G81A 4MROA 1B3BA 1KI8A 3I37X 5HIIA 1S9DA 3FM9A 3SIXA 3WP0A 2AZ4A 1PT9A 2OQ2A 1SUDA 3WRXA 5IFLA 1X1TA 1ZIDA 2CZQA 3ND5A 1G0NA 2CXQA 4HQRA 3IQZA 5L45A 2C92A 2VWHA 3J7AC 1O4VA 1ZOLA 2IYYA 3CRRA 4I6EA 4MW1A 3ZXIA 1NKVA 2VYCA 2WWHA 4KL8S 5D2CA 4NV0A 4O4JB 4MWSA 3RK1A 4M4SA 5L3ZA 3SQOA 1PW7A 2IYFA 4ZZ1A 2XF2A 4IPTA 2XJ9A 3LY5A 1JDVA 2NUAA 3OTHA 3BH0A 4IDBA 4YAUA 3VX4A 3IULA 4UMEA 2WTUA 2YJGA 2PUEA 3ICEA 1M5TA 1P7PA 2C4HA 2GAFA 3B82A 4QXQA 3E1KA 1H3NA 5B1DA 5KSZA 1HH4A 4MO9A 5ABPA 1BMFD 3SBEA 3AVXA 2HLDA 5JWOA 4OJKA 3L06A 2MINB 1BXRB 1C9DB 4L4XA 3E3NA 5LCXA 4YA6A 3W05A 3IODA 4QYTA 3QG1A 3VO9A 1DINA 2D2VA 2WJJA 3FHTA 4ADSG 4JLDA 5P21A 1WCXA 3NJ4A 4Q4CA 1TT5A 4K9NA 1G20E 2P8JA 4CU2A 1G8SA 4FFWA 3WWZA 1O77A 5G3ZA 3JVDA 4I3FA 1RYFA 1XQXA 3ZJTA 2R6CA 1PHPA 3ENWA 4LRSB 1WXWA 4O4HB 5IKOA 5BN4A 3CZ4A 2OQRA 2REXB 1X80A 4FMCB 1M6VB 3K9QO 4D44A 4XVUA 4F4CA 1FFWA 2AR7A 2B2CA 1Z4KA 2HYDA 1W0CA 2QVGA 3EAQA 4H3KB 4R0VA 3GT4A 4XD7A 1H5QA 1TYZA 2PAFA 2Q6KA 1HBJA 3PUWA 5ALUA 3RSSA 1G3MA 4HCJA 1GPH1 2JIZA 1Q3TA 1NXOA 1QGUB 1Y81A 2EJCA 3I76A 4IDGA 4PX9A 5BQPA 4E6EA 4E30A 1ZLXA 2AMLA 1ZAKA 3KWLA 4I4LA 3WHIA 4PSVA 3FNQA 4MLPA 3PLRA 3G2QA 2JAQA 2WD9A 4PZ0A 2QRQA 2I2WA 2D3WA 1VZ2A 3W6UA 1FS4A 2WD7A 2RI6A 2QNIA 4IJKA 5JVDA 5KYGA 2JVIA 3BILA 3K92A 1GILA 1QCCA 1Y4UA 3BXZA 3PYLA 1IRIA 1NTRA 3RGGA 3UCFA 3WO1A 2I78A 4IHQA 4CN8A 4Q4HB 5BNIA 1DJMA 6ABPA 1MQSA 1U8AA 5B37A 1JR3A 5I5EA 4DUPA 1VLJA 1W9HA 2VYFA 3QFHA 1O2DA 1RWVA 2OVFA 3NNDA 4Q1BA 3SC3A 4HDOB 4OMDA 3RS4A 2Q6VA 4FYJA 1MRSA 2XB2A 5F5NA 1JQLB 4MYRA 1KC3A 1UAYA 3ORHA 2PLNA 5TT1A 4PO8A 3ZCTA 1U1FA 3F2VA 1ZS9A 3KU4A 3F6PA 1M8FA 3ONEA 2ZJZA 4P7KA 3KJQA 4Q3NA 4U8HA 1NVGA 1ZBQA 1QFJA 3AF3A 3FVVA 3G3EA 4QAQA 4RLFA 5C37A 2BF7A 3TD6A 1AKRA 3CNBA 2FDRA 4I1OA 3ZUPA 3AY0A 1VIAA 3JWIA 2YMLA 2H08A 4XAQA 2QT1A 2A1UA 1ZYUA 1XFDA 1C5KA 2VRCA 3FUWA 1GKUB 4KVGA 3K4HA 5A3RA 1F14A 3JYHA 3ZV6A 2WSLA 3OTQA 4PVDA 4B4WA 3K0EA 1XP5A 4K6OA 1IQ0A 1SBIA 4PBRA 2C4WA 2GD0A 1II8B 3NBQA 2J41A 5TF4A 2H2GA 2PXCA 3QVXA 1G5PA 4S0XA 3DF9A 1RMQA 5DYTA 3RH0A 1GTL1 1TUBA 1U2RA 1C2TA 4PM4A 2K7FA 3U61B 2AQIA 5HGXA 1BYIA 3REOA 1U0LA 2PA0A 2WHXA 3OQPA 5CCBA 1P31A 1B23P 1C8LA 1OZ0A 1X7WB 3CH4B 3D64A 3QOFA 1FUIA 1ZRNA 2FPOA 4IGAA 4W99A 3S2FA 3WGKA 3CVVA 1THGA 3IERA 2AL7A 3WWEA 2CW5A 3IJPA 1TZJA 4S12A 4LIPD 1O9GA 5H1YA 3P5SA 5ICFA 1AO0A 1DTSA 4P3NA 2QGFA 4XM2A 4BEWA 2XXBA 4BASA 4QOGA 521PA 3AY6A 1N8TA 2ZBRA 3HUTA 1JECA 3RC7A 5AKGA 2GXSA 1OHHA 3FF4A 1ZWLA 4FEYA 4IY1A 1LK5A 1QLJA 1ZM7A 2DWCA 3ZBUA 1NR7A 3LY8A 2B30A 2H06A 2XMDA 3QM1A 3WZMA 3S5JA 3ZI0A 4DSNA 5JSFA 3U7GA 1T5DX 2GCPA 1M1UA 1MAVA 1K3UB 2PZFA 2HDNB 1G3RA 2IYRA 3NWPA 5K9ZA 4I7EA 4DCTA 2VSFA 4P7BA 2E9SA 2QQEA 3FYUB 3EGEA 3L6CA 3VDQA 1QAOA 4ARZB 2IEAA 1S02A 4HNAB 4IO1A 1GJRA 4NZ9A 1JKMA 1DKLA 4IXMA 4PZYA 3FDJA 4JLWA 2GT1A 5I4IA 2ZIAA 5LYJF 5KX5B 3AVTA 3LPDA 2OG2A 2WOJA 4URFA 5AKHA 1NUSA 1I6KA 1MPTA 2UYCA 4MP3A 2ZBUA 1T3ZA 3A06A 2AFVA 1QZXA 4R1SA 2OFFA 4B79A 1RRFA 1ZGJA 4Q7QA 3FYTA 3HRHA 5SYAA 1LU9A 1JMYA 4ABTA 5EMJA 2O8DA 3V9AA 1WE2A 3I64A 2V54A 4TZ6A 3C6MA 3DEFA 4IJWA 1VQ1A 2OGUA 4BVFA 4HV4A 4Y30A 2R8EA 2OQVA 2I6TA 1A77A 5JS6A 5LXTA 1WEKA 5BNZA 4O4JF 4QBIA 3OY2A 3A25A 4GP7A 4QUJA 3R5JA 5IVDA 1JSLA 5K3EA 4FGWA 4DQDA 1IN5A 4UZFA 2IUUA 2QXTA 1F8UA 3INNA 3Q6MA 3UPUA 1F6WA 3MD9A 4CQMB 4IVPA 3E1GA 4WESB 3UYKA 4RY9A 3KYDB 4W1QA 4ZCMA 1U7OA 5A9SB 1VP9A 3KOUA 1VL0A 4Q6BA 2FLWA 2IYEA 3PNOA 4Q19A 1XZHA 1GA4A 1YDFA 4OJNA 1G8AA 2YFKA 3M6XA 1EHYA 1ZGZA 1FRNA 3BWBA 3D2CA 4DZRA 1O58A 3AV0B 5I5GA 4YMUA 2G1JA 1N77A 5ALZA 2BEUB 3A0RB 4MGIR 4U63A 4Q9HA 5IXYA 4RUKA 3H1AA 4M22A 3NHRA 2VF7A 1AOXA 1TLFA 1XA0A 2XD4A 4KC0A 4Q16A 3KFXA 5LXTB 4K6KA 1GL3A 2PLFA 5DHSA 1QRAA 4ALMA 2CLMB 2RAVA 3EDQA 5JZVA 2VNSA 1V43A 3FGZA 4IEEA 2AYZA 2YZKA 1Z4NA 2VXOA 4H7JA 3A7DA 4C7XA 1T9AA 1TLTA 3EIEA 5BRJA 3L46A 1AZWA 2YDYA 3BCUA 4A91A 1ZN8A 4HB2A 4WXMA 2HA4A 2DR3A 3LDHA 4KDFA 1ORDA 2HSWA 4LVNA 4XGIA 2ZE5A 4KZPA 5AVTA 1YDWA 5KTRA 4FSHA 1SELA 5EIOA 1V5WA 3RC3A 5LN1A 3PEEA 3DDUA 1LJLA 3FDFA 3JALA 1JIVA 3W8FA 1DEOA 4KLAA 2BBWA 3GYBA 1ZN9A 1GZHB 3QF7A 3QVOA 3ONWA 5FR1A 2HRDA 5A7FA 3CRW1 5JYDA 3QUTA 4RC9A 5MFZA 3OO1A 1GM5A 2W8ZA 1AK1A 4GOMD 3WGOA 3GP5A 2ID9A 2LKDA 5LQKA 2OT3B 2B9EA 1USUA 4RTMA 4LNAA 1CZRA 2P91A 3WLJA 4KQCA 1E3SA 3DOIA 4BCDA 5IS2A 1KYIA 4DA9A 4ACBA 4NCAA 1H6AA 4JX9A 4D0RA 1GDDA 4ZHQA 1P77A 3G7SA 2PLRA 3S70A 2G9ZA 3IOYA 5B5SA 4G5SA 1GPYA 3LI2A 4KVZA 4MWOA 2JJ1A 3SSAA 3FETA 1EE2A 3GFPA 3X1YA 1VPDA 3QENA 3T52A 4ZAXA 4Y18A 3GELA 1OFHA 1WDMA 1LGYA 1Z8NA 5IF3A 1E8MA 1JQJC 1ORVA 4K3UA 5JIBA 2B20A 4LQDA 4Y2TA 1P3DA 1DKQA 4BB6A 3UNXA 5IC5A 4HMPA 3S0JA 4AQDA 4AF6A 1GAXA 3KLOA 4YRCA 2IPNA 1UMDB 2X40A 4BCBA 5EE9A 1Y8RB 3KJGA 3H2KA 2OKGA 5GZ3A 1W4LA 2GARA 4JQSA 3H6KA 1RSZA 3HCWA 2J9FB 3D8NA 5DM0A 3A6HA 4ZYYA 5EZSA 4IILA 4TTTS 5F7ZA 5CM8B 2OFOA 4AZ3B 2VDQB 4B48A 4KIWA 5CT4A 1IVSA 1S89A 1IONA 1NONA 2WWRA 2AFIE 5TQJA 2AYXA 5CD1A 3MJTA 1NPYA 4AB1A 3RUDA 2CLOB 3QMWA 4I3HA 2JFVA 4D9HA 4M53A 1ZH8A 4G2TA 4YCBA 3QQPA 5ALVA 4Q03A 5CT8A 1A88A 3K1ZA 4I6JA 1O97C 3SS7X 3H8JA 4L7VA 4NCHA 3C3XA 1TUEA 3ZJ4A 1KZ4A 4JD5A 1LBSA 4EHJA 5CVTA 4WKBA 1T8PA 2MU1A 3HU3A 2ZRQA 1MFPA 4QBKA 1MNQA 4OEHA 3AR5A 3CIOA 3T95A 2WKSA 2PVCA 4JC5A 3WAGA 1UEJA 1XJWA 3DZDA 2YJ6A 4O2BB 1EA7A 3E7DA 2RHRA 1JG4A 3I58A 2QLLA 1N2CA 3P2JA 5J2UB 3RO7A 3VDNB 5FP0A 5I7OA 4DY4A 2FSVC 5CFNA 3G2LA 1V8FA 2XCQA 3KZVA 3WA7A 4F4HA 3EVDA 1D6JA 2I4OA 3HHEA 5AVSA 4KQ6A 2UU9B 2CVQA 4NYJR 2JFYA 2W7TA 1D1TA 1LPSA 2GBCA 3KKQA 4PYLA 2IE0A 1KO7A 1J33A 2BKEA 2CEKA 2HRBA 4Z4FA 5CDSA 4OBBA 4DV5B 4LYGA 3FOCA 5KUTA 1Z35A 3JQAA 1GLGA 3LDAA 1XKLA 3WL5A 1IQRA 1ORTA 4RHXA 5CRIA 2E1PA 1BE0A 4LQ4A 5IJXA 3TOZA 3AP1A 4TV8F 2JLWA 4OAQA 4X84A 1KEEB 1QX3A 3LBIA 2LDBA 1DZIA 5HJ2A 3SCZA 3VR0A 1DV1A 3B20A 1XPUA 3PE6A 2QY6A 3CLTD 3W5VA 2Y4OA 1NNLA 2B3TA 5KU7A 4RCYA 3UAYA 4KDEA 1DLJA 3C5VA 4TXLA 3RUEA 2B5VA 1RQRA 3N2NA 3NRCA 4H18A 3NYWA 2CK3A 3DL4A 4Q39A 3CSUA 1Y8ZA 1NQWA 2YYAA 3L8GA 2RD2A 5H3CA 1Z7BA 1L6IA 6REQB 3MFYA 1JIKA 2X6QA 4N7BA 3QIAA 1KWKA 2GK4A 2YFQA 2Q6TA 5DX0A 4RLHA 3TQSA 1JFTA 1FVXA 2VJMA 4F2WA 1GDTA 3LVFO 4P93A 2I22A 1MUUA 2VT7A 5EIFA 2CCGA 3A3PA 3LUFA 3C8ZA 3QEKA 3RRYA 3FWNA 1AN0A 2WHQA 4UHFA 3OEHA 1EVIA 1RKVA 1RLMA 2X13A 3CX8A 5EWMA 1RQXA 4EUKA 4W5NA 3D7SA 1FYEA 1JPNA 4N49A 5DLQC 3PXBA 3TLBA 3KKMA 2DSNA 3CISA 3HGMA 2ZPUA 4E07A 1X7XA 1D4OA 1X1DA 3DFUA 3L4SO 3FMOB 2B5WA 1FUUA 2R6HA 3BIFA 1NLYA 3D3EA 1I13A 4OTZA 4EMBA 2I5PO 2PMEA 2P90A 4C0QC 2H2DA 3AJ9A 3HVJA 5B64A 5D8DA 5C1IA 1CBUA 3JD0A 1NZJA 4G63A 4JB2A 1FLVA 4GPBA 4K1XA 2CDAA 2EFEB 1Y4ZA 5EJMA 5FLEX 4J90A 2EJUA 2UVQA 4RLSA 5DI9A 1YF3A 3QP9A 3ZLUA 1IOZA 4RA9B 1WJGA 3TR5A 4OX9Y 3I12A 2IJGX 3KUCA 3NWJA 3GEDA 4OKNA 1GZVA 4XX0A 3OIYA 1Z74A 5ETJA 4ME6A 3M4NA 1V2HE 1GQ2A 4NATA 2ZVPX 2HLHA 1A9YA 4B3SB 1ZIXA 1R0XA 3KJXA 3CW9A 4BO9A 2JFFA 2P75A 4N0MA 5LLSA 3KPYA 4W7SA 1OXSC 4ZVUA 2MSKA 1C1HA 2AHRA 2VK1A 2ZWMA 3N3BC 3GFTA 1GT91 1ULHA 3IPCA 5F33A 4R0MA 4U5XA 2PNFA 5F23A 1S4QA 4NK4A 1YACA 1UFRA 3GLHE 1WUJS 2XHZA 2XJ4A 4QBFA 1Y6FA 2R6GA 2XNKA 3OD5A 1IG0A 2VH2A 2PS3A 3H7AA 3INRA 3OSUA 4CMEA 4PU0A 5J23A 3AEQA 1WMSA 4ZOLF 3THYB 2M6SA 4JYAB 5KVSA 1F8XA 1P9NA 1KVUA 2DUJA 2H1IA 3PVCA 1FFSA 2R751 2WSYB 4WADA 1P18A 2Q99A 1ORHA 4OH1A 5CFPA 1RYHA 1X87A 1PF7E 3V8EA 3AJAA 1V2GA 3A6ZA 2JI8A 5KO2A 2J5KA 3PT5A 3P2IA 3LKZA 4HFJA 4C0BA 3M6IA 1IY8A 1IATA 3FTDA 5A7GA 3BPSA 3P0JA 4EATA 2OXRA 2Z8YA 1WCIA 4JGIA 4NPCA 1WD7A 4QXAA 5FLYA 1FW8A 1UIMA 1LTKA 1TKAA 3NCTA 4QO8A 3ZZ1A 5FBZA 3W5CA 1MEEA 3OZXA 4JJFA 2XADA 2Q28A 4QGSA 5DM60 1K89A 3KEGA 1EFHA 3KQUA 4P3YA 5JD3A 4ZZIA 1P2VA 2CLIB 2GPSA 3EG9A 4HAZA 4MQ5A 1XTRA 4PXSA 5BNFA 3UFBA 4R2HA 3EIFA 1TLLA 4YCCA 3PJDA 5JH7A 2TSYB 1RJWA 3AONB 5EIBC 2FUNB 2XE6A 3EZNA 3TL6A 2C2MA 5AHWA 1UFQA 5CA0F 1F1JA 1UJBA 3L6RA 4MV4A 5FIUA 4P7FA 2Q5IA 2HA7A 2GCGA 1LWOA 3M9WA 4OHRA 2ZXEA 3QH4A 1YGYA 3LECA 4K6MA 4TM8A 4D82A 1Y3IA 1J90A 2HHLA 3CGGA 4H4EA 4M86A 1S2DA 2LXNA 1XZQA 2QN6A 4X71A 4P4SB 1OX6A 4B3RB 2TECE 1T9KA 2WD7B 3D6TB 4QOSA 3I09A 3ZXUB 4ENRA 2GNAA 1XQ1A 1R8SA 3TH5A 5BPFA 1A50B 2NP7A 2PJZA 4RLQA 1FX1A 2AI3A 5FUWA 1U2DC 1VL1A 1PSWA 4G1CA 4TQAA 3TFQA 5GM1A 1YRLA 2COKA 2BFPA 4EL5A 2ZUWA 4WCDA 3UH0A 3B5EA 3QEOA 1U65A 4FYKA 4GPZA 1T3LA 1KJWA 3B53X 2YV2A 3C4QA 3KQMA 5F9FA 2VK2A 4J76A 1YQWA 3PQCA 4WK6A 4FDUA 1FJHA 3R8CA 2G1PA 3VV2A 3WC4A 1BNCA 1NIPA 2QLFA 5K4AA 3BJMA 4F2PA 2K2WA 4UE2A 1G7CA 1RXCA 2F43B 3PQ7A 4LX0A 1F2UA 3DYBA 4KJXA 4TTVA 5T5QA 3DQQA 2WF9A 4CDMA 2QUAA 3RREA 5J5VA 2PRYA 2IV3A 1VFPA 1WD5A 5DXFA 4ZU6X 2ZUFA 1Z56C 3MTAA 2WB4A 3UMSA 2C7OA 4PVCA 4U3JB 3S7ZA 2COUA 2H4HA 1MTOA 5FOXA 1VE6A 4BNDA 1TDJA 1M6EX 4MR8A 4N5NA 4RK4A 1V9LA 1YNSA 1WDWB 1PYGA 2WAAA 3ESXA 4DLYA 2YXBA 4JP3A 4G4GA 3WTBA 5FWXB 3NRJA 4KN8A 4QGAA 1XGKA 3C8MA 5E9JA 3HA2A 4JA2A 3GP8A 4G0WA 3GOHA 4GC5A 4FFPA 4RHFA 1SC6A 3NONA 4ZQEA 5AUNB 3ZJUA 1W19A 3ZCRA 1IY0A 5BQ5A 5MN4A 1L9XA 5SZKB 3SLGA 3U2QA 3OQMA 1EXVA 2JGMA 2LKCA 3AGPA 3OJXA 4XH9B 3SHTA 3U7HB 3JZAA 4ENTA 2JGKA 3PTAA 4IVRA 4F1WA 2O3UA 2R4UA 3A14A 4J3FA 4B83A 4F6CA 5MGNA 2AK3A 4M87A 1VPWA 1JYFA 1GCUA 4ZK6A 3P9SA 1SUPA 4L74A 2DFLA 2RHBA 2W83A 4PZCA 4IV8A 3CSDA 1CDOA 1RJ9B 4LQLA 4OP1A 5DMHA 3U49A 3UM9A 1KPHA 3ELDA 1PL6A 2R8YA 2WA2A 3NYRA 4L8VA 1H6BA 1KI9A 2ZR0A 2OY0A 2C5FA 2WFLA 3RYFA 1PIWA 3ED5A 1Q7GA 4PZAA 3R0VA 2NYRA 2ZRGA 2WIBA 3MT9A 4K87A 1CC1S 2E4VA 4CVNA 4CLRA 5EUQB 3ACDA 4GWGA 4JLMA 1MIOA 4W5HA 3I0NA 5AVUA 2FZVA 4PIMA 4ON9A 3Q8LA 1UJCA 4X91A 5C5DA 1BW9A 2R00C 4Q12A 4TKLA 2D7CA 3HYNA 4CUJA 2VPTA 2J30A 3A58B 4PZZA 1WY5A 3HVUA 4MWDA 1XHEA 1A2BA 3PI6A 5FNVB 1GAWA 1U0NA 1DRVA 2FPMA 1VLVA 2FTKE 3ZHBA 3JTMA 2O2ZA 2R60A 2WP8J 2C7BA 3WZ2A 1U5BB 3KP1A 3B8EA 4CQLB 4OYLA 1Q1AA 1TF7A 1CZKA 1RVV1 3G0OA 3Q98A 1UFOA 3GFVA 2CNBA 4IXNA 4NBVA 4EPWA 4AS1A 5JARA 1X2EA 4RY8A 2PGXA 3KEFA 4TMTA 4DPMA 1FLNA 5C35A 2CL6X 1CDZA 1FSGA 2Q5HA 1SBYA 2J4CA 4Y9RA 4H60A 4FYMA 3RVPA 4MRRA 3PC8A 3M83A 1CQPA 3LMKA 4OP2A 3SQDA 3C1OA 1KI1A 4LXQA 1E20A 1UBEA 2C9MA 4IGIA 3U81A 4L5CA 5KYWB 4P83A 4YPFA 3F5DA 3DNMA 1PNQA 3AVQA 3RVKA 5E6SB 3KSRA 4YNBA 4RA6A 3EA0A 1FTQA 4PO9A 3QFFA 1LDYA 5FNVA 1VIYA 1TFUA 2P1RA 3RASA 4EVSA 4GPIB 2Z98A 1FY2A 1A5AB 2VDLB 121PA 1Z83A 2VQ6A 3USES 3I1FA 3QWBA 2QTVA 3PL1A 2AG1A 2Y1XA 1LSJA 1J49A 2QTFA 4NBNA 4CQLA 5D86A 3C4VA 1W36D 1A2OA 1HF3A 2JIOA 2CF5A 1F8YA 2Z83A 1GV0A 2QT9A 3GJ3A 4D3ZA 1CRLA 4CTJA 2GA9A 3OLWA 3CKMA 4J4TA 4U0KA 1YAHA 5CK4A 3RNOA 3G1WA 3UHOA 3E8MA 3GGOA 3NDBB 4IIDA 2ATEA 3GQVA 4FEAA 4B2LA 7MDHA 3FFWA 1XL1A 4DLLA 1ZJ4A 3A37A 1YI0A 2H54A 1LK0A 4PLHA 5FFNA 3RJMA 4A26A 2VJCA 4K9MA 4P0TA 1DKRA 4G4SO 1OI4A 4HRAA 1EGMB 1WBDA 2AR9A 1ZUNB 1UDRA 3LDFA 1J23A 3EBOA 3F1LA 5JS7A 2GFHA 5IAKA 3EE6A 2FP3A 2ODAA 3AIOA 4HF7A 4K9QA 1H05A 1B0ZA 2R5NA 3O83A 4OGWA 4B43A 4HEJA 3AUKA 3K0HA 3WLQA 4EP1A 1AZTA 1REQB 4P5DA 2NXNA 3PUZA 1MB2A 1N6NA 2CFTA 2HC9A 3IVGA 4TLCA 4M7WA 3IBSA 1ZZEA 5IKPA 2W2PA 2EGGA 1QMGA 2VRCD 4BVEA 2AZXA 3F7TA 3JQFA 1EX6A 1O94C 4TVSA 1CFZA 3KHSA 2IZ7A 1Q91A 4FBMA 5KOYA 4OLBA 2CWWA 1DC4A 1FP4A 2ZE8A 1Z0UA 2QN1A 3PX2A 4Q5IA 1MJGM 2V7PA 2XMPA 3OOJA 5BWNA 1P4GA 1FNCA 2PH1A 1PFQA 3TOXA 5EIEA 2Q4EA 1UXIA 1B0AA 4HAIA 4HY3A 4PRZA 3HVRA 1OB2A 4QOJA 2Y6VA 1X3SA 4C89A 3MRSA 1XT6A 3A4VA 4UBKA 3VBCA 4R9RA 4C5AA 3EQ8A 4UUNA 4U2CA 4L8GA 4ZWNA 1XCGB 4EW2A 2X5OA 3BWMA 4YMVA 3WKCA 3L0BA 3W06A 3A9CA 3CEPB 3HSSA 3IALA 3FUTA 4P2BA 3SF0A 3T7CA 3DE6X 4DBLE 3DV0B 4O5OA 1E6EA 4BGVA 4D46A 2Y2UA 4LAFA 2V5UA 4NK5A 4CTKA 3DM9B 2VUTA 1RTKA 3DTVD 1WXEA 2JGDA 4LC1A 4NQRA 4OK6A 5LXTF 4RTRA 4YAFA 1OB5A 1SULA 4RK6A 4RS4A 4PAQA 1MJNA 1U6IA 4DXAA 1J9EA 1TJ3A 2P2YA 4L16A 2FSIA 1YDHA 4QQKA 4BTVA 4RPJA 5ITSA 2P3OA 3L02A 4LOKA 3X1WA 4BJHB 4P0QB 4FFRA 2CJPA 3MUOA 5DCUA 1QYRA 1HV8A 1E69A 2DBZA 5CLIA 5E0KB 1JDTA 3DBIA 2GEJA 1VXRA 3FSGA 1JPJA 3AT1A 3HV2A 5B3KA 1XTPA 2J9FA 3R3VA 4HT3B 3U19A 3AKEA 1Y6ZA 3IDOA 5NULA 1I2MA 2CDNA 1TK2A 2CNDA 5E6UB 2IY7A 3SF8B 2QRLA 3SHQA 4B6SA 5ICSA 2JLAA 2A0WA 1HTBA 3DKKA 5HS6A 2NZ2A 3IP7A 1ZEMA 2WJGA 4M9UA 5HJ5A 3LZ6A 5HKKD 2AD1A 3H65A 1QQ7A 4K3VA 3N7AA 4MR7A 1Q14A 1L5HB 2WABA 3D59A 2ACVA 2QX6A 2XA2A 3BHNA 1VE5A 5DE3A 4ALIA 4BS9A 4BN0A 4ZI2A 1Q12A 1MTZA 4HGYA 1SBZA 5T3UA 1Z8DA 4XGKA 1JHVA 3PNVA 3G68A 1SU8A 2O8EA 2Q3BA 2Z3VA 4FFBA 2JLQA 4O3MA 2FWAA 4FYIA 1KA9H 1KFKB 3GFRA 1XTIA 1JGTA 2P9JA 3ISTA 5JS2A 3USZA 4B3MB 2DH5A 2VAXA 1FJ2A 1XU4A 4P92A 2G07A 2GNOA 1L5FA 2H07A 3ZU4A 4QNNA 3E9RA 4AP5A 2HBYA 5FI0B 4X8OA 2I6QA 3PNBA 5BV2P 5JLAA 1CUWA 2REQA 5H02A 3R7WA 4BYGA 3RHZA 2XDYA 2AMVA 2AS0A 2GZHA 4WJLA 1N8NA 3L9XA 5KREA 2JD1A 1JEYB 1UOQA 1NBME 2ZTSA 1WXIA 5EESA 2JLZA 5C4IA 1C9EA 4KQMA 3IHLA 2GI4A 1DQNA 4DMCA 1S8OA 3CUVA 3OX1A 3GJYA 3VZRA 1N5JA 3UB2A 1C30B 2WVHA 5K8JB 1C9MA 2C54A 1CF9A 3OCVA 1G8GA 2O14A 2X7JA 3QK7A 4LV5B 5JJKA 1YR1A 4W5QA 2OV6A 1G5FA 4BLWA 2VP0A 3U80A 1P62B 2R6JA 2H7CA 1YQ9A 1R27A 4F12A 5BR1A 4BGDA 3DAFA 5TY0A 4BBZA 1JJIA 2M1ZA 2CCJA 4HGNA 4X1YB 4ND3A 3G8AA 3IEIA 4HATA 4NFSA 4Z0PA 3LHDA 3Q0IA 1JEOA 4N8EA 4UCXA 4RGBA 2QN8A 1P4AA 2X42A 3IAHA 1RRKA 3WGTA 1N6KA 3R5KA 2QMZA 1JPVA 1RHJA 2O2CA 4GGMX 2Q3EA 4L4SA 5FTNA 3T7TA 4P22A 3WL3A 5AIBA 1JMKC 5BMVA 1TTTA 2NG1A 4XM0A 1T4CB 2JGNA 2PX5A 3FB4A 4Q93A 4UM8B 3RFUA 5I7AA 2F3RA 2Q50A 3RUFA 4OIFA 1BGVA 3W1WA 4D9MA 4ENSA 4MX8A 5IT0A 1V0JA 2NVUB 3LT0A 2QTCA 3HFRA 2I55A 2NQ8A 3Q5DA 1F2VA 1T1JA 2HJRA 3QJYA 4ZVTA 2C94A 1YJQA 5KU1A 1HMPA 3U3JA 4RIEA 2IX9A 1CVRA 5IM5A 3I01A 1FSSA 3R9IA 4TS1A 2Q1XA 3H18A 1NN0A 1BDMA 2HJSA 3DPSA 2BTQA 1LFDB 4QVGA 4NYIR 5LB4A 2BDUA 2IYNA 5C51B 3U60B 3G7NA 5IAJA 1BGWA 1TEHA 2OO3A 3OQOA 4X7RA 3WWOA 4BCCA 3TLMA 1KFJB 3W7VA 1JALA 4L2IB 3ELWA 1KTVA 4KR9A 1NW5A 1X7DA 2OOKA 3I2YX 2CVHA 3Q3GE 4QIHA 4RIFA 3ZX4A 1TM2A 3FPSA 1GITA 3RDPA 5F52A 4US2R 1YCGA 4FDAA 2OHJA 3O7WA 4Q3EA 1JHPA 2NLOA 5DK6A 1JU3A 1UT5A 4AWBA 1N5RA 3EEBA 3VZQA 2VDVE 4INZA 1EEXB 1GZ3A 1U2EA 3PIRA 5IC4A 2PMFA 4G4JA 2EU8A 1NJ6A 5GADl 4ASUA 4KODA 4MVJP 4Q4JA 1C9JA 2B4RO 1ZMXA 4W82A 2FEOA 1G21B 3TOVA 2CFOA 4C6HA 4EY5A 2CNOA 3IILA 3HACA 4KO4S 1EUDB 4UXJA 2ZXUA 4DB2A 4HEHA 3KWMA 4CL2A 4PZ9A 2BRUA 2VOEA 2WZQA 3SSNA 2VUHB 1QHGA 4NF2A 2HF7A 4FD3A 2C5BA 2FUG1 4MVJG 4YV1A 4MINA 2IGTA 4PFKA 3HA7A 2QOEA 1NAHA 5ISMA 3T54A 1Q7CA 4EGAA 1KQOA 2X22A 5HTOA 2DB3A 2DQKA 4U7FA 3VOTA 5A02A 1ST3A 4M1OA 1R6VA 1X70A 4EBFA 3L41A 2VT3A 2X9QA 4NDNE 4D0NA 5I51A 2IDKA 1T6BY 2B25A 2NO5A 1OWOA 3D31A 4KBYA 4ZAGA 4B6EA 4DLAA 1FDIA 1XRSB 5K09A 3UJ6A 2RGUA 4RMHA 4G01B 5B55A 3U44B 1PLJA 4ZCTA 1FFEA 1R10A 1L1FA 3RK0A 1QH9A 1QPBA 1W5BA 1KIMA 1Q3HA 1U3VA 3BK1A 3PXXA 4PZPA 5ALJA 1ENPA 4PE5B 5KYNA 1QXSA 1EFPA 2R96A 3PC4A 2BGMA 4TZ0A 1B73A 1WCIB 3EZFA 2HM7A 2WU4A 4Q6WA 4HB0A 4IR7A 3EH2A 4R5HA 5F78A 4MITA 3LL7A 3WMEA 4KO8A 3WYFA 5CG2A 3EQ6A 4J7UA 4Y6SA 2PD3A 4YRAA 5AJHA 2CJWA 4D8YA 5DULA 2MR6A 2ZJYA 1YC2A 2G1KA 2OCDA 2WE7A 5HW0A 1QU2A 1D2NA 1XZDA 3E82A 2XY4A 5DSXA 2WJWA 2X3FA 4IQGA 1IFXA 1KYZA 4C0LA 1U0TA 1NF8A 1W581 1N8SA 1T9CA 3AI1A 1NW6A 1VG9B 3IE0A 4FDMA 3Q9SA 4CM4B 1EUCB 3L1UA 4HAOA 4QTXA 4Y1RA 2OHOA 3FAKA 1UBFA 3O74A 1LXCA 1YL6A 4UTXA 3S2IA 4B7XA 2NO9A 3JQAD 5AHOA 5L4NA 4ALJA 2H7XA 3U0BA 1M2WA 4YROA 1IN4A 1RHRA 2QIOA 1GQRA 5F7JA 4ZYTA 5JNTA 2CUNA 2AFHB 3CBGA 1ZN7A 3KTAA 5DHTA 3T5GA 3FMVA 4V39A 4X44A 2AJDA 2BT4A 3ZK8A 1ZOIA 1TK9A 4ZVRA 2BGUA 1DKPA 1EJ6A 1YMUA 2FXVA 3CONA 1XXHB 4NNJA 1NL3A 1CUXA 4Q3AA 4U7WA 2D8AA 2RK4A 2Y1CA 1PO7A 2QJRA 3U7FB 4DV0B 1A8IA 4N9QA 3RVDA 3II6X 5T4HA 2ZATA 3A4TA 3RSOA 1K86A 3D8TA 4RACA 5KYKA 2Z95A 1JQDA 3C0KA 2IHTA 3RC9A 4ITUA 1M2OA 1T5LA 1NIJA 5JPIA 1YE5A 2AD5A 2GVNA 1UFKA 2WPNA 3BSWA 5COQA 5GV7A 3UXHA 5CR9A 2BR3A 5ESRA 2E87A 1GAQA 4K81B 4OBWA 1PBNA 1PR9A 2AVNA 3MWYW 4JQOA 2RFLA 1FYWA 4F9FA 1XTJA 4F3KA 1ECLA 1P3JA 1H2XA 1I7NA 1RR6A 5LA6F 3ZD9A 1Z7EA 1RE1A 4HWRA 4MEJA 4BVJA 1UPFA 2EEZA 4C9BA 2XKJE 9LDBA 3EIHA 3R3UA 1YBHA 3ZHXA 3OZSA 3L6UA 4EHHA 3DXZA 5C53B 1LFAA 1UZLA 4JP5A 3CVJA 1ZX1A 3OLVA 4OHXA 2MMGA 4MR9A 4ZO4A 4YWHA 3NHSA 3UB4A 1J97A 3VC2A 1EFRA 4IIYA 5H4GA 4ISBA 1F38A 5G0TA 4QASA 3C5CA 4PR0A 4F4JA 1GPMA 1YZYA 1TCAA 3Q41A 3QE4A 3JQ8A 2F8SA 1V26A 3MAAC 4I5FA 3AR4A 1CV2A 1S2OA 4M46A 3VKVA 5DNCA 4DEYA 4O4LB 2Y68A 3OT1B 4V0NA 3DXFA 4YAOA 3RVJA 4ZQFA 3QOXA 2V7XA 5B1IA 1CR6A 2YYSA 3UK6A 1POXA 2OUKA 3N8DA 3R7BA 2ENWA 1KR5A 1SQ5A 2ZSEA 4LJ5A 1X1EA 4M8IA 1UT8A 2ERXA 3AJ8A 1FQKA 4B84A 3SIRA 4EL0A 1A2KC 5EFZA 5U4QA 1FFCA 4DLVA 4FYVA 2NU9B 3H13A 1VSBA 4XVQA 5GTDA 5JAHA 5LKRA 3EN0A 4JLSA 3HL4A 4YJHB 5DTJA 5T6MA 3VH4A 9ABPA 4F96A 1OWNA 3E58A 4HDMA 1BFKA 2OQIA 4EQZA 4NL4H 4F46A 2P9YA 3EAFA 5A9RA 3AU9A 2ST1A 3KQSA 5LQMA 1MU0A 4P54A 1DBWA 1K7SN 2DJIA 4S2EA 3V8NA 2QJOA 4F11A 3TMYA 2V7VA 3ED1A 4BRUA 2GXQA 3HJBA 4LYEA 3V3TA 1WBJB 2YYZA 3NM6B 4IBOA 2I3GA 3HYSA 3E2PA 1P45A 2GVDC 2XRFA 4J07A 1IZ8A 2XVZA 4KQIA 5DHQA 4C7BA 3ESBA 4TLMB 4ESEA 1VSQA 1F2UB 4ZPJA 4UKDA 3SAJA 4NE2A 1QYIA 1U94A 4DRYA 1U3UA 2OXTA 4BNNA 1KPIA 2D54A 2J9XB 2GKGA 4M8NE 3IA2A 1W6UA 1PWHA 4NY1A 4XDZA 1HDGO 2XNDD 3NDRA 4BNDB 3VR2A 5CYOA 4OHVA 1WMDA 1L5SA 5J4YA 2HPAA 5CXXA 4FZJA 1BMQA 1KQPA 2UV8A 5EIBD 5ERXA 2SKCA 1L5VA 4AW9A 1JN0A 5C8YB 1E3TA 2EG5A 1D0VA 3IVCA 1PTKA 2EZ9A 2WU0A 2Q4RA 3BDIA 3PUXA 3RAGA 1K7FB 5J3JA 2J3KA 5BWLA 4HX5A 2G9RA 4KR6A 1AB6A 5EKSA 3SM3A 3L4BA 1N75A 3TAHA 1CW2B 1W59A 2H17A 1M73E 3M4ZA 1X7HA 4JLAA 4YN3A 1XEFA 3K9BA 5TEWA 4BNVA 5HQ3B 3P32A 3WGLA 2ZKLA 3ENZA 1IEWA 1SBHA 2PKXA 1NU6A 3NXSA 4KWCA 5E6SA 3MTDA 5LZ8A 2IWHA 4FZ5A 4KHZA 4U2GA 5EAIA 1XMSA 3SS8A 3FLEA 2CB0A 5FJJA 3W7BA 5AJVB 5ALNA 1OY1A 3A05A 1EVQA 1FPMA 3NXKA 3JRNA 4QYIA 1XO1A 4OI2A 4H6WA 3KOMA 4N0DA 3TECE 4ZAVA 2WQ6A 4IJUA 3RSGA 2OXEA 5HF8A 4HUTA 2NV6A 2ZAMA 2OZPA 1RZUA 4UMVA 1U0OC 1LSOA 3KCNA 3URKA 1P1CA 2IZ1A 3AY3A 1M0WA 2J0VA 5DT9A 2J07A 5F21A 5HBGA 2ZIWB 3V4VB 3N39C 2Q6LA 4B74A 1PJ8A 4DADA 4HC4A 3HB0A 3CHYA 1BDBA 4J3JA 4DMFA 3O8OB 4J0IA 5CVJA 3O2SB 1J0XO 5LQUA 2V8OA 1BKDR 1EE1A 4R6WA 5LA6B 5CBPA 1GUZA 4QPJC 6GPBA 2Q07A 4KRXA 5JFTA 1RWBA 2P5TB 2EEPA 1EBBA 3JVUA 4HDSB 4M0EA 3KQHA 3GFFA 1DCMA 1MVNA 1XMVA 1XWWA 2A94A 3EIOA 3QF4A 3HBNA 4MIYA 5CNJA 3ZWOA 4G0MA 1GGFA 1KJJA 4ZO7A 4M8SA 4IWNA 4X24A 3ZTYA 1SC9A 4JXJA 3W9YA 1TCVA 2Z09A 2GILA 4REQB 4ZEWA 1MO3A 1RPTA 5K3BA 3TRFA 4UTPA 1GCIA 1XLTA 1DX9A 2I54A 4KPEC 1CZLA 3GMDA 4EY6A 1C8BA 4LS3A 5EZYA 4GLJA 1PT8A 5C18A 1OIWA 1Z6PA 2IUEA 1JFLA 2ZPTX 2GF2A 1NSTA 1XMIA 4ESVA 2BN4A 1VJ1A 4NG5A 5JJCA 4NZOA 4BO1A 2NXEA 2F7SA 2BM0A 1V39A 1BD3A 3HS3A 3OHSX 2WT4A 1K68A 4PSAA 4WA7A 3EVTA 1DDGA 1TVMA 2YHSA 3IA7A 1XROA 1Q84A 1K7EB 1ULUA 2MDTA 1FLDA 2OGZA 3UHFA 4I2NA 5HR5A 4X85A 5A71A 5CB4B 3SFZA 1UDXA 4BFSA 1WF6A 1J0AA 2W8BA 4NCNA 4XYGA 2OWDA 2HMUA 3WI7A 3HC7A 4YQEA 5FI3A 1LDGA 2Q1YA 4G1EB 4V24A 2WQ7A 3DP7A 4YT5A 3TS1A 1L4NA 3HXKA 3EXFB 4JIMA 4JP8A 3RT9A 1B93A 1QORA 3CRVA 3IQGX 1P17A 3OJOA 4NLLA 1KZGB 2CYBA 4OOFA 5AM0A 5KSWB 5E2IA 3QVGB 1CZNA 3H9CA 4II7A 1DO2A 3AR3A 1UXHA 2PBLA 1C4WA 3GCGA 3I9OA 4G0UA 3KPWA 4MZXA 1NPTO 3CRZA 3GJRA 2L82A 3U48A 1YZTA 3DFKA 1XBTA 1PJTA 4G5XA 2OO5C 2Q0XA 3DBHA 1FFBA 3G8BA 4Q4DA 3BJEA 1RKXA 5EHZA 2B4KA 4GS5A 3WGHA 2Y1KA 3PHHA 4LGMA 1DJPA 1QFZA 1ZJ6A 4UD6A 4Q00A 2DHEA 3N75A 4XGNA 3BH6A 3KV1A 4AN4A 4BX8A 3K72B 3CH5A 1DQZA 3KDPA 3S7TA 1LWNA 2DP4E 2ZWVA 1RKQA 4HSGA 4Q34A 4YAWA 1XZ8A 5GP1A 3STXA 8ATCA 5EUBA 2H1VA 4P31A 3KTFA 3LUBA 3EUFA 1J1UA 4JU8A 1OJ7A 2JFZA 4WCVA 4E5UA 4MVJI 3RVQA 3FGPA 3K3PA 3VC7A 3R9XA 1R6UA 1GP2A 3O4HA 3SHOA 4OLHA 1UANA 3A7EA 5JJLA 1VI2A 2Q5OA 4M55A 4E14A 1RJEA 3OE7D 3BSYA 3IQEA 3P9KA 2R8BA 1EDDA 1MRZA 2YCLA 4R8KA 5TNXA 4B32A 5IJ0B 2PYZA 3ZR4B 2E6KA 3DBHB 5EWLA 2WYVA 4FC7A 4HI0E 4ILKA 3HXLA 4IGKA 3RU3A 2B98A 2C59A 2GHQA 4CMIA 3QVSA 5DLYA 3TZQA 3FWHA 3E9NA 1U02A 3WYBA 2QX4A 3TMAA 1QIKA 1JEYA 1C4OA 1WP9A 3WLTA 3OESA 2D2IA 1XJCA 3X1DA 1NMYA 1I2BA 3U9LA 1WZIA 1K2WA 3G8DA 2XAUA 4H3SA 1IIBA 2QZZA 2WHRA 1WB9A 1H5NA 1N6OA 1T4GA 1ATZA 2A30A 3OTWA 3QLJA 3D6UA 8OHMA 1GUBA 2AC4A 4ILEA 4XWYA 3VZBA 3WYDA 4Q48A 5EJ8A 2ZSFA 2PS1A 5A4KA 3OUTA 3HLYA 3TF5A 1CIJA 1CUUA 3CX4A 1US8A 5COBA 1Q77A 5CBKA 3UJAA 5GV8A 1KI6A 4KAJA 3GLGB 3L8ZA 4DMMA 3AVYA 4H0CA 2EQ5A 2Q7XA 2QYOA 2HU7A 2PXXA 3D2LA 1WNTA 4TMWA 4ZANA 1AKMA 1G8PA 4P84A 4P32A 5LIPA 4H59A 4F71A 1ABFA 5HK9A 3G79A 1XC7A 4BNZA 4LKRA 2Z5VA 3VR5A 1MG0A 2AEMA 1IN7A 2NO4A 4JUBA 4PG7A 3DE1X 3N2GB 3SF8A 2FJ0A 1H2FA 4U9IS 3HWSA 1CEXA 4KYIB 3QUCA 1GFSA 1XA3A 2QPTA 5HIJA 5JMPA 4CIAA 1T5IA 3O03A 3HXOA 1SXPA 1NLFA 4ML3A 1ZG3A 3AR2A 2QAJA 5DPMA 5CH5A 2BUAA 4NOKA 4KRGA 5IJAA 3OQ6A 1EDBA 1SXJD 1TAHA 1YVUA 2ZRPA 5CIYA 1E2IA 3UJ8A 4KITB 1I0LA 4L4ZA 5F98A 3A1NA 4W1PA 5JAIA 4ONEA 1KI6B 1JKJB 2I4RA 2QLBA 2QZ9A 3AZOA 4ED9A 1PVDA 4LHXA 4YY3B 3ZOZA 2HV8A 2WJZB 4GT1A 4DW8A 1N5KA 3PDUA 3WRXC 4RQBA 2ZDHA 1QGED 1D7OA 2C4UA 4OB8A 3TZKA 2PIAA 3MA0A 4PINA 1QPGA 5CH8A 1UKZA 2BBOA 3MMPA 2X14A 5F35A 5KNCA 4JJEA 1SEPA 3E9QA 4CLHA 2HIAA 2OB2A 2W37A 1E4OA 2C88A 2Q4DA 2H4ZA 3CVOA 1WOMA 3DDCA 3IAM6 3N6XA 4LISA 3BULA 5AM1A 5AMXA 1I1HA 5DRTA 1PJZA 4D8UA 3UGJA 4LFAB 2V6FA 4L0DA 3VSBA 4HBZA 2IY9A 3U13A 1CRZA 4J49A 1QVWA 3ER9A 2GPWA 1T3TA 5AQEA 1DU4A 1HOXA 3UJ9A 1WZCA 1K3FA 1EUYA 4R6XA 1U28A 3ZWAA 5KAPA 1KZ9A 5LFAA 4DV7B 3DM5A 3FKSA 5C3MA 3CUSA 1IC6A 3MERA 4L07A 5CDFE 1ESZA 2CD9A 4FCVA 2QR5A 2WTXA 3NHUA 4L9RA 1WZNA 3NORA 3ORQA 3ZE9A 5L51A 4XFDA 1YJAA 2PXHA 4R98A 4PPYA 5E3IA 2DUNA 2YN0A 5A3QA 3O2NA 5FR2A 4R8VA 4LHEA 1JIIA 4JVSB 2JIRA 1SH7A 2CHGA 4UM5A 5IH3A 1Q0RA 2HU2A 3A28A 3EXHB 5B6PA 5KOIA 1JIUA 5LDGA 1XQVA 2G0NA 1JEAA 2FN4A 1EZ4A 1P5JA 3NJ8A 4RZ2A 2V8BA 1RXEA 2OEPA 3LQQA 4RA9A 4PCLA 6AT1A 5CURA 2B36A 5BYKA 1I9GA 2IEGA 5LSAA 3DHVA 4QUDA 1ZMBA 1UOPA 3E18A 1NHWA 3K0FA 4EJ6A 1NQTA 3R5SA 1F1BA 1FU4A 3CNQS 4M1YA 1X1SA 3WLMA 2W2NA 4HNGA 1UJ6A 4EY7A 4FHCA 4IIJB 1NZDA 1FXSA 4IDNA 1DRWA 1F9AA 1G19A 3I72A 2EYUA 3ILSA 2IYZA 1XTQA 3MWKA 1QQ6A 4L3OA 4PWYA 2CLFB 5FBQB 1JEJA 4XIIA 5KTNA 1A71A 3LVRE 4DLNA 1IJKA 1BE6A 4RVNA 3L4JA 1UKBA 1SCKA 1VHQA 1G98A 1WLSA 4F6RA 2IHYA 3R7DA 3ROZA 4F7WA 3S1AA 2QTMA 1YS4A 3WWPA 2E0IA 2NO7A 2ODBA 3PPWA 3GMTA 3B1VA 1UWLA 2H4XA 1W0JD 4C14A 4HZUA 2I2BA 1KI2A 1VP3A 4MW4A 1VA5A 4C78A 3BFVA 3GA0A 2JLVA 4B4VA 3KKEA 2JW5A 1I2AA 1OVMA 2H16A 4PZUA 2FYTA 3IBFA 4KXQA 4L5JA 2X76A 3VR6D 3PYMA 1D2GA 4AMBA 5KVCA 1MXHA 3KTAB 4P4NA 3JR3A 4PYMA 2A2ZA 1QANA 1HDCA 1TJYA 4LHWA 3DOJA 4ND4A 5EWMB 4EW3A 2I7CA 1ADYA 3COZA 1SIUA 2O9JA 1HZZC 3PCTA 5E4FA 3VH3A 1CUDA 3GMSA 3EWAA 3K8OE 3AERB 1E6LA 1EWYA 2BI8A 1MR3F 3T7IA 4DXDA 2ZUCA 3QBTA 4AJ4A 3WLNA 2DG2A 3BREA 3RRJA 2I3BA 1GSOA 3K5HA 3OLXA 4J6FA 4KVAA 5K51A 2IU0A 3ZE0B 4RK7A 2FXIA 1HYGA 4DDUA 4CKWA 5KQLA 4O0LA 3UJNA 1Q20A 2IVZA 3SKVA 5ECDA 4AN0A 1WV1A 1E2JA 1TAQA 4KAXA 4V3CA 5EJ7A 2VF8A 4KQ9A 1JU9A 1IZ7A 2VPZA 1RXIA 2OILA 2PMWB 4GOLD 4EGJA 4IRXA 5MFPA 4WECA 3I5YA 2XZLA 4RJKA 3V46A 4DANA 2Q45A 4NNPA 3UWSA 1RXVA 3CZQA 2EJVA 4YP5A 5K03A 3AB8A 2GZ2A 2V7QA 3HMQA 2WC1A 4M9XA 3KTOA 4ID3A 4I5EA 2WIGA 2DCUA 3IXLA 3AJEA 1TT5B 1DB3A 1WWKA 1J20A 4KNYA 1OT5A 3QPWA