3H5LA

Crystal structure of a putative branched-chain amino acid abc transporter from silicibacter pomeroyi
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
397
structure length
397
Chain Sequence
DPVVIGCPAPLTGIVAADGIEFQRGIQMAADEINAVGGILGRPIELVFADTQSKGVDVVIQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVAVHDEMVKSDPDRYWGTFQYDPPETLYGGGFLKFLKDIEDNGEFSRPNNKIAIITGPGIYSVNIANAIRDGAGEYGYDVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFYPQDQALFMNQFMTDPTNSLVYLQYGASLAAFRDIAGDNSVGVTYATVLGTLQDEMGDAFAKAYKERYGDLSSTASGCQTYSALYAYSIAAALAGGPGAPYDDVQNKAVADRLRSLIFRGPVGTMRFHADTQSAWSYPTETNDPSLGMPHIFSQIFDKAEDGVLIAPAPYKKAGFKMPPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Branched-chain amino acid ABC transporter
publication title Crystal structure of a putative branched-chain amino acid ABC transporter from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Transport protein
total genus 154
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA01
4RS3A 1E2BA 3OMWA 4H3HB 4MQFA 2IKSA 2HQRA 1NATA 5C5CA 2GX6A 3BRSA 1ISSA 2NZVG 3M9XA 4MPTA 3LUKA 1NXVA 5BR1A 4G0MA 1CHNA 3L49A 3KG2A 4N0QA 1EHCA 5F64A 5JNSA 2PUFA 1QO0A 4EGSA 1P6QA 1M5TA 3CRNA 3OQNA 4YGXB 4O1HA 4MQEA 5JNWA 3EULA 5IUNC 2ZWMA 4N0PA 1JF8A 1USIA 1LK0A 2E4YA 4F8JA 4YRZA 3HXMA 1HEYA 3QEMB 3N0WA 4MLCA 1D4ZA 2Q5CA 3SY8A 4ETNA 5GQSA 1GUBA 4OTZA 3F7NA 1NY5A 2NT4A 1P8AA 5TPZA 1Z18A 2RGYA 4MR9B 3Q7TA 2ID9A 2HPHA 1TVMA 4IMJB 4Z9BA 5E3JA 1YMUA 3RVQA 3LUHA 4W5OA 2FKAA 1BDIA 4G97A 3IPAA 2FMIA 2MSLA 3CKMA 3LTEA 5IC5A 3N75A 3N6VA 5HSGA 1CYEA 3GRCA 1YMVA 4KNYA 5CNIA 5TQ2A 5EWLB 2VUHB 3TO5A 2CD7A 3HUTA 3Q7RA 4PEVA 4RK5A 4Z9AA 1NXXA 1L5ZA 2J48A 4LE2A 2IPLA 2IOYA 3JS5A 4NCAA 2FMFA 5CNMA 2QU7A 1FFSA 2PUEA 1AB6A 1BAPA 2LBPA 4XARA 1K66A 4UHKA 1T34A 3CFYA 2OENG 4RZSA 5CNKA 2M1ZA 2RDMA 1RNLA 1MB3A 5DGCA 1RXEA 5BRAA 3H6GA 4F06A 1Y1LA 3DBIA 1JDNA 1XHFA 2L18A 3OO0A 1USGA 4JAVC 2AYZA 4N03A 5T3YA 3F6PA 3H5LA 1KRWA 5HQJA 1DRJA 3SM9A 1JYFA 1DZ3A 3CHYA 5JNVA 2MYNA 3UUGA 1YS7A 2LP4Y 5IULC 3RVNA 2JCGA 3OLYA 1Z25A 3O2QB 1JX6A 3O21A 4IILA 3DGEC 3ILYA 3NNSA 5KC8A 2IPNA 2BGGA 3HS3A 2F8TA 1CEYA 1GLGA 4JP1A 4ZPJA 1ZN2A 2FN8A 1RZRD 2O20A 1ABEA 1Z12A 3QELA 3S99A 4KV7A 1TMYA 2MSWA 4TMYA 4FE4A 3RVPA 3KHTA 4JOQA 3I5AA 3KLOA 2PL1A 4RK0A 3BBLA 3JPYA 1PNRA 3JY6A 1UDRA 4DN6A 4OLBA 3RH0A 1ZITA 4OATA 3RQIA 4PICA 3H1FA 2R48A 4RY0A 1MVOA 2E4UA 3FFWA 1RPJA 2RJNA 4EYQA 2HQBA 4DADA 5DCLA 3SG0A 2FEWB 4Z4CA 2FTKE 2PJUA 3LMKA 1DBQA 1E6LA 2A9PA 3F73A 4PYRA 4MGEA 3HV2A 4MR7A 5B3JA 2P4UA 4Z4FA 2VYCA 1ZDMA 5JS2A 2PMCA 2LUOA 5TQ0A 4D6YA 4OBBA 7ABPA 4TLLB 2GWRA 3I09A 1GUDA 3RVSA 3QEMA 3FFTA 3RVOA 1ZH2A 1OXKB 3LUGA 5KQLA 4TN5A 5CNJA 3LUDA 5FWXA 3GL9A 5KQMA 3H5OA 3O1HB 1NTRA 3OLZA 4JB0A 4KQCA 2WY2D 4MS1A 4KMRA 4Z0NA 4ZMSA 3CTPA 5JNRA 3BRQA 2WJWA 4MR9A 5KI6A 4N41A 4RXMA 3EDCA 3HDGA 1ISRA 4HNQA 5EWMA 3RVLA 4ML3A 3TX6A 4KK4A 1L5YA 1IIBA 1JL3A 2B1JA 2QVCA 5EWLA 1BDHA 2FQXA 4KK3A 5GOTA 3M6MD 3C3MA 4IMIB 1D1QA 1ZH4A 1M2FA 1PEYA 3N0RA 4MRMA 3SNKA 2JVIA 4JA2A 1PUXA 4ETMA 1M2EA 4GPAA 5EWJA 1SRRA 4MS4A 4YWHA 3LUCA 1JLKA 4E7OA 2QV0A 4EVRA 3HCWA 3KTOA 3IP7A 3NNDA 2I6FA 2PLNA 3MIZA 4WT7A 2FQWA 2JBAA 2JRLA 1D1PA 3A3KA 4MLDA 1U2PA 3D02A 5FWYA 4F3TA 1ABFA 2QVGA 2E4ZA 3NNNA 5TPWA 1U8TA 2FSPA 1KGSA 2ZAYA 4KQ9A 3ROTA 3H1EA 1P6UA 4EYKA 4G0QA 5D2CA 4NQRA 4Q6BA 4MQFB 3K4HA 1D2AA 4YV7A 2TMYA 5FBKA 3C6QA 1VRVA 3EODA 3URMA 5ED4A 3GV0A 2LIVA 2FW0A 1YK0A 2QSJA 2A9RA 2WB4A 3OLVA 2JVKA 1YK1A 1SXIA 2WRZA 3TMYA 2AYXA 2JB9A 3CNBA 2VUIB 1FSPA 1C0EA 1EWVA 4RY8A 4HNSA 1RXIA 3JTEA 4E7PA 1SXHA 4LDAA 1BA2A 5IEJA 3SAJA 3H5VA 2CWDA 1NXPA 4D74A 3HVRA 4YS6A 4EY3A 5KWSA 3CG4A 3KKEA 1JWLA 3O2SB 4IGAA 1TLFA 2HSGA 4RWEA 4EYGA 1F51E 5JNTA 2PUGA 2MYPA 5C5EA 1I3CA 4PZ0A 3CLKA 1DC8A 3CZCA 3KLNA 4G86A 4RKRA 3QEKA 1QNLA 3VNBA 2M98A 4EVQA 4RXUA 1ZVVA 4G0OA 3QLUC 1K68A 1PEAA 4LRQA 4UHJA 2H0AA 3G1WA 3HZHA 1TJYA 3G85A 4YP9A 4ZYLA 1W9HA 2PUBA 3HEBA 2FMKA 1EAYA 1ZHHA 1XHEA 3EQZA 4TLMB 3SQNA 3FDFA 2PUCA 5I4CA 1S8NA 1QPZA 3CU5A 2IPMA 1DRKA 1F4VA 1DP4A 3N53A 2QR3A 3DZDA 3KCNA 3LFTA 3MQ4A 4O1IA 2WJAA 5JNUA 2PL9A 5IUKC 1LJLA 1B00A 4N76A 3TB6A 6ABPA 3HK2A 3A0RB 1QMPA 1NXOA 3QX8A 4F11A 3NHMA 1E6MA 1TM2A 2CHFA 2PUDA 3DLBA 2FEPA 4G0PA 3RVRA 5KQGA 4KREA 1EWKA 2NUBA 3E3MA 3DLHA 3FGZA 2R47A 5KQPA 2A9OA 2HJ9A 3HUUA 4Q6WA 4RU1A 3LUJA 4RK4A 4WZZA 5IEBA 3QK7A 4XAQA 3GBPA 3O75A 3D8UA 1DC7A 3EAFA 4YR7A 2PKXA 1Z16A 3MMNA 4JB2A 1DCKA 2MSKA 4RY9A 4W5RA 3I42A 3OLWA 4MYRA 2L19A 5TQJA 5T7BA 2XDYA 5JS1A 1H9CA 2QW1A 1DBPA 2R4QA 3C3KA 3CZ5A 4RK6A 3BREA 4YLEA 4MS3B 3LKBA 2ID7A 2IDMA 4ZMRA 3GA5A 1PNTA 2A9QA 1GCAA 5PNTA 1R8JA 4NICA 3QLUA 1QP4A 3KSMA 3OQMA 2R25B 1VPWA 1ZY2A 4G0XA 4EYOA 3H75A 3QELB 1YVUA 4NCBA 4RK1A 3LUAA 2PAFA 1A0OA 4Z99A 5IBQA 1JFSA 2VK2A 3K9CA 1U0SY 5DKFA 3MF4A 1EWTA 6CHYA 4IF4A 3ROFA 1EFAA 4XXHA 2FN9A 3GBVA 4IRXA 3DGFC 2GKGA 3ILHA 3CS3A 1OXBB 4YO7A 3MA0A 2NZUG 4LE1A 1JFTA 2FLKA 4RDCA 4O5AA 4XFKA 4LE0A 4QICA 1Z17A 1ZAYA 3KJXA 2PUAA 3FMVA 1KRXA 4G0YA 1NXWA 3R0JA 3GYBA 4RK7A 2IYNA 1QP0A 3RVMA 4OLAA 4L4UA 4MR7B 2FMHA 5DTEA 1YS6A 3T8YA 3Q15C 2PE5A 5TQ0B 3NHZA 2JVJA 1NXSA 3MYYA 1JH9A 2FQYA 4ZJPA 1DJMA 4HNRA 3LKVA 4H60A 5BRJA 1AB5A 3LOPA 4QPJC 1DBWA 1A2OA 4MR8B 1Z26A 3A10A 4M88A 5FWXB 4W5TA 3EQ2A 4LX8A 4MS1B 3O2JA 1VKRA 2KYRA 3N0XA 4L85A 3A0UA 4KZKA 4QYWA 1JYEA 1NXTA 3BILA 2JK1A 3OO1A 3C97A 4RV5A 4G0ZA 5FBHA 1QQBA 1C4WA 3KYIB 2E4VA 4HYEA 3KYJB 5EWMB 1XWWA 4RSMA 3EJWA 5DLEA 4MQEB 5ABPA 2F8SA 3H5WA 4Z4HA 3RVKA 3IDOA 4FE7A 3NBMA 4MAAA 5CHYA 2YHBA 3GWGA 3I45A 4MRMB 3C3WA 5TE9A 1YTUA 2MYUA 2DRIA 5HM6A 4Z4EA 2FEKA 5EWJB 3O1JC 4MS4B 1QQAA 2GBPA 4P98A 2IPAB 3IPCA 3B2NA 4PE5B 3O74A 4RKQA 4LDZA 4LZLA 4S05A 4P1ZA 3EGCA 2FVYA 2P9HA 2QZJA 1J56A 1Z15A 2JBAB 3JVIA 3LUFA 4KVFA 3QX9A 9ABPA 3HDVA 1BVHA 4Z4GA 1A04A 3M9WA 1QP7A 4NV3A 2HQOA 3Q9SA 4OG2A 4CBVA 5KC9A 3T6KA 3QLVC 5FWYB 4W5NA 3OMXA 5B3JC 5IUJC 5TQ2B 1DCFA 2FXIA 1ZESA 4KRFA 1FQWA 2MYTA 5TPWB 4ETIA 4EUKA 1SD5A 4B09A 4S04A 1DCMA 3HJFA 1U04A 4WXMA 1BDJA 3F6CA 4Z4IA 4EVSA 1M5UA 2W42A 1Z2EA 3Q7SA 3HO1A 3IP6A 1JDPA 3HSYA 2YHAA 1Z13A 1KMIY 1SXGA 4FB4A 1JFVA 4MS3A 2E4XA 1D5WA 4H3KB 4D6XA 3GT7A 2LPMA 3P9YA 1JHZA 4Q7EA 3IP9A 3KS9A 4RXTA 3HM9A 1P2FA 1MAVA 3RVJA 2H3HA 3H6HA 3O1IC 3JVDA 3H1GA 4XASA 3VNAA 4KPYA 1MIHA 1E6KA 2L17A 3OM0A 2CHEA 4DQDA 3JPWA 1APBA 1LBIA 1VLZA 2OQRA 3IP5A 4WUTA 5IX8A 4YCSA 3QLTA 3UK0A 2E4WA 2WMYA 3UKJA 4QYMA 1MB0A 2N9UA 2WWVD 8ABPA 3MM4A 5BQ3A 3L6UA 3TD9A 4Y9TA 1QO0D 3H5TA 4XLTA 1WETA 3OLXA 3H5IA 1PHRA 2FLWA 4WXEA 3E61A 1FFGA 2L2QA 2V0NA 4JASB 4F12A 3OM1A 1ZGZA 1Z2DA 1JBEA 3N8IA 4GNRA 2NT3A 3QLVA 1GCGA 5HKOA 4KFCA 3OQOA 1ZGGA 2GI4A 2X7XA 3FFXA 4W5QA 1DG9A 2RJOA 1FFWA 1YIOA 3Q41A 1URPA 1W25A 4WWHA 3W9SA 1RZRA 4N47A 2B4AA 3CG0A 1U2QA 5TPZD 1QKKA 1LJUA 3T95A 1LBHA 1USKA 3T38A 4MR8A 2QXYA
chains in the Genus database with same CATH superfamily
1I4LD 3S68A 1QG0A 2DWQA 4BDTA 2N3ZA 4IRUB 4CF6A 2PG3A 3F1KA 2DUMA 1R4ZA 2NZVG 3G5TA 1YUBA 3KT6A 2QN6A 3G5LA 3LK6A 1GQ2A 3Q0EA 4KCGA 2Y9MB 1OXVA 4RANA 2BPOA 2FWNA 2WPDD 8ATCA 2D3WA 3AUKA 1LQTA 3I2JA 4QA9A 1SU6A 2JJYA 4UE3S 1MEOA 4YJ3A 3LT2A 6YASA 4HDQB 2CMGA 4L0CA 4YGXB 3TLMA 4DCOA 2Q6VA 1KNXA 1XXHB 2DLNA 1USIA 2O2JA 3QXCA 3AF5A 2J30A 4XFJA 4F4DA 3AF6A 2DP4E 2R66A 3L8EA 1P5HA 2QEQA 3F9CA 5H4GA 3PGXA 1B76A 3JYPA 5IH7A 3MOGA 4GZMA 5FA6A 2H7YA 2O3RA 4HAUA 4HS9A 2JFBA 2BLNA 4IHQA 4UEWA 3TTXA 4KHPB 5HJ2A 2NT4A 1XLUA 2ZM5A 2A33A 4V03A 2AN3A 3JD2A 3H1TA 4GM1A 1OD6A 3DR5A 2UVQA 4BVFA 5GP1A 1GJRA 4DUGD 1DC4A 1W87A 1Y8RB 3INGA 4QTXA 1CB7A 2XKAA 2B8JA 3F49S 2HYDA 2YIDA 2FMIA 3QVGA 2ZJYA 4LCJA 3NO4A 2OFWA 1I5RA 4B4DA 2P1RA 4BBAA 5E4FA 3SQOA 4UZSA 3SNHA 4LJKA 4BGUA 1OXTA 3LDFA 3KKPA 4FD2A 4E1BA 1GTZA 3MLAA 1UINA 3MSXA 3IEMA 4M0MA 4I3HA 2QU7A 3OSUA 5HVNA 1GHTA 3HWWA 4J3JA 4QJ4A 3WGHA 3RC1A 2Y92A 3V7NA 4ARIA 4LXXA 2XWBF 3UQZA 5J23A 2WZCA 3NEJA 5AW2A 3M1LA 1I5OA 3DDZX 2I7TA 4M6WA 5DTJA 3NGXA 4JJZA 4RVNA 3WGUA 3N1UA 1RNLA 4U8HA 2BR4A 1ACJA 2VP2A 4QGSA 2PZGA 5MN4A 2P9EA 3D8SA 4DLAA 1UQUA 2WKRA 4MYUA 4R8MA 3GLGA 3HFJA 4ERNA 2VQ6A 2FMXA 4XR4A 3SHFA 3R7NA 1SRQA 2FGJA 3BXHA 4ZQGA 4UQOA 3E23A 1EHIA 2C4TA 1SCUA 1RAGA 5KNCD 2XNHA 4MOWA 5ESXA 2ZRBA 3U6BA 4P0TA 3IQZA 1JYFA 4B83A 3VMMA 2FPRA 2Y1DA 3WKCA 2EW1A 3RC7A 2QPOA 2WP8J 5K0CA 5CEFA 3O2QB 1FPQA 4Q3KA 1U3TA 5CT6A 5TXGA 4OBXA 4DLZA 2Q8QA 1C9KA 1E61A 1M67A 3X2SA 1SVMA 1YO6A 1CEYA 2PA0A 3IESA 4DXDA 4QYIB 2JEOA 3OPMA 3VKWA 1UOPA 2C2WA 4ER6A 5HUHA 1Z74A 4HSGA 1KMNA 1Z4JA 1RHKA 2RHTA 4I6JA 4KV7A 1ZD1A 2HXGA 5HFJA 2X40A 4I8XA 4I0WB 3HLKA 2ZUDA 3VJKA 3OQJA 4EQ6A 5CBKA 2PPVA 1ONSA 1NW8A 1UDRA 3MJCA 1T43A 1SBTA 5C7YA 4JEUA 4HYQA 2FP4A 1HE1C 1M1UA 3V1LA 2ZUTA 2V7XA 3C3YA 1VGQA 4G5SA 2C7RA 1TZBA 4HDCA 1JEAA 1IOZA 3K7EA 4DG9A 4IOJA 4KXMA 1CK4A 3SD7A 1CD5A 1ES9A 3WJ2A 4BO3A 4FUTA 3BMCA 2PT9A 1HSZA 2COEA 4I1IA 3PRJA 4JYMA 3UJNA 3AJAA 2HKIA 3R4CA 3Q4GA 3RJZA 4F93B 2AD5A 2PMCA 1R6BX 5C8YA 5E1DA 1TFRA 1DKMA 1FVXA 1X8JA 2VXOA 2BOVA 2CLCX 2WW8A 4G4SO 2VDMB 3EAQA 1MD9A 1R3DA 3WZ2A 2ZSUA 4X5OA 4B3BA 3LUGA 2QX4A 2R5NA 1Y1QA 2BJVA 1Z5WA 2JATA 2VHXA 5B7GA 1N1DA 4WKNA 4DV0B 1GAEO 3EY9A 4WVFA 3T7DA 5BQOA 4V0LA 1ZN8A 4ZOLA 1EP3B 1BA3A 2WJWA 2DQKA 3BRQA 4R40A 2YWFA 1U9IC 4IDDA 1M7BA 4Y9DA 1BOFA 2W98A 3FSJX 1LVUA 1AQ6A 1D04A 1MDFA 1M7GA 3ZE2B 1BEZA 3CLTD 5EHXA 2J7KA 1CUHA 1AHIA 3TQRA 5F51A 4KK3A 3Q6IA 2XT9A 2QROA 2WTEA 4J2OA 2YHIA 3DVRX 4S12A 1PT5A 4OI1A 1I3KA 2JVIA 3ZH2A 3ABIA 4HYTA 4KR9A 3O8OB 2UKDA 2QTVA 1SRRA 4DVJA 2SKDA 2V7VA 1KQPA 1I30A 4N8SA 1AGPA 2QV0A 3IDAA 1F1JA 3T7JA 3RS3A 1N6KA 4OAQA 5HE8A 1VTKA 3ELBA 1ZBQA 3KFLA 2A5LA 1CUYA 5DOZA 3MOIA 1OYYA 2E7ZA 4A8JA 1H6DA 1ZKDA 2P3OA 4MV3A 2ESRA 4LZZA 2G40A 1EFVB 2VDPB 2ZBUA 5KKAA 4LZAA 1KJNA 4ZC8A 5I4KA 4PGAA 5CUQA 1RVDA 3GXOA 1G0OA 3KWLA 2YJ5A 4UD2A 4KAJA 4XJTA 1ACMA 3K2QA 4JVOA 4IBOA 3U09A 1C7FA 2QGFA 1RQ7A 3AKDA 1QK5A 4YYEA 4BATA 1NW6A 3I2HA 4BAZA 4C4RA 3EPJA 4DKXA 3TRFA 4DY6A 1XROA 1YZQA 4WEQA 2IYQA 1Q6ZA 2H31A 3DP9A 4YV7A 2F64A 3OP1A 3WK5A 5KYYA 1NT4A 5J1SB 5DI9A 4YJ2F 1I8TA 1RRVA 3N8HA 2JNWA 4AZWA 4R1QA 2JFPA 4RH3A 3K9FC 2J1LA 1O8CA 3HGTA 4WIAA 1W29A 5G3YA 1TCCA 1Y4AE 4JXZA 1HO3A 1OIXA 4MP6A 2JB9A 1ZN9A 3A7DA 4AULA 1FSPA 3ZOKA 4GH5A 4DM3A 4M1KA 1O9GA 3KEOA 1YQXA 1ZMRA 1E9EA 2A6PA 4J91A 4O4LB 2X6RA 3NOQA 3SM3A 3A8TA 4JYPA 4PZUA 2Z0MA 3ZD8A 1Q12A 2ES4A 4RM3A 2WT4A 1XDWA 2H85A 2QW8A 5GJCA 1B6TA 3OC0A 2PMWB 3W9BA 4F4HA 3HCFA 2BEJA 2IYYA 1DQSA 1EQ2A 2ZWIA 3EGDB 3RJ5A 3SOZA 3W5JA 1Y5NA 5AVYA 2HUPA 5YASA 2QTLA 3QEKA 2ECOA 2VWPA 2CUTA 3IOEA 4NZYA 3LCJA 3L7DA 3IFSA 5MGBA 1A88A 1TQ2A 2H1WA 2YNMA 3GJ5A 2GM9A 2UYOA 4U6NA 5EZYA 3RUEA 2WWYA 1CY6A 1U7DA 4B3HA 1TJYA 1ML3A 3SKXA 1NMXA 1EJ0A 1PSDA 5D6NA 1J49A 2GYWA 1LFAA 1LRKA 3ANYB 3ZHVA 3OZWA 1NHWA 1UJCA 1T5TA 1XNHA 3NYIA 4M0EA 4TLMB 1SU8A 4XE5A 3W2HA 4D9BA 3FDFA 3KFXA 4KIJA 2XOKD 1Q74A 4FMDF 1M66A 2QX9A 2QT9A 1WM1A 1RYFA 1FS5A 3O8LA 1V2GA 3CLSC 4ZVPA 2C59A 2V6MA 5DHRA 2GD0A 1ZIDA 2C94A 2ZDGA 1XTKA 1K0UA 1MB9A 4JLSA 3GT3A 3PT5A 3EYAA 4LPSA 1Z33A 4OY3A 4XVUA 4QHYA 3CE9A 3VR0A 3QBVA 2NLOA 1WW2A 1O7JA 4FLEA 1RM0A 3TUZC 3Q9LA 3EWSA 4ALKA 3L4KA 1R9JA 2O1EA 2CXOA 1SHZA 3SOPA 4RMHA 1GFSA 4F96A 5IARA 3FGZA 2C5FA 2VF7A 3NP9A 2IEDA 4DLBA 3L5OA 1DV1A 2QI9C 4C6SA 5JAPA 1YB5A 3UKDA 5CDFE 5FPPA 3ENWA 4J4BA 1QPGA 3QF4B 1XRLA 2ZR7A 1T9KA 2MSKA 3GJSA 3A6JA 4DEVA 3I9NA 2ZJZA 4U63A 5FTNA 4AIIA 1TIPA 2RBGA 2YZKA 1XLWA 3KSZO 3QJ5A 3F0TA 2FSVA 3L77A 1SVSA 4D3SA 3UYKA 3W5CA 1S3FA 4RPIA 4OX9Y 3BORA 3ORFA 3S0JA 2FSIA 3PPYA 4CI9A 3KSMA 5HKLA 3TRIA 2KBFA 2HU8A 1LDEA 3W5BA 3HG7A 5TQVA 3WGLA 4YAEA 5B5SA 4GGOA 3CUVA 5JRDS 4BKMA 2WTMA 4KC0A 4LSWA 4MWCA 2VUTA 2Z95A 5BW5A 1UIRA 1KK1A 1GU0A 3BE6A 2E3JA 2C4UA 3K73O 3N86A 1RP1A 5JFOA 4JI7B 1EFAA 3JQAA 2PYIA 1LZKA 1OBCA 2EKLA 2FN9A 2JLVA 2JGLA 2B8WA 4RO0A 2QRKA 2ZW9A 3M6UA 1ZQ9A 3SF0A 3S1SA 5I7VA 4BMPB 2PX4A 5C2JB 3I53A 3KJXA 2Z6UA 1CR6A 3PR3A 1W94A 5AHXA 3REFA 1E7QA 1ORRA 3T1TA 5BSUA 1QR6A 1TIKA 2JI6A 4H1TA 2B94A 5IAJA 4CR7A 1YVPA 4RK7A 8MHTA 5BYJA 3OPQA 2R97A 1O08A 2NU9A 2IE8A 1QF6A 3UZUA 2DSNA 4HP8A 4L15A 3FPFA 4MDYA 4MP3A 5AI0A 1Q2XA 2NYVA 5TQ0B 3V8EA 1R0BA 3ZHXA 3W78A 4ZDWA 2O5EA 1UK9A 2HI0A 2ZAIA 4Z54A 1DJMA 2VYQA 3OPNA 4LXIA 4DIUA 3A6DA 1GAQA 1TLLA 3HPQA 4ITRC 4JR1A 4LJYA 4E13A 1WDTA 1OZ0A 1ZD3A 4GGPA 5CDYA 3ZIDA 1WUIS 4P4TA 1WPRA 1U8AA 4IYRA 3ZXIA 1I1QB 4L85A 1O6CA 1ODCA 4RX1A 1PJLA 2H5EA 4D5GA 2Q2WA 2I2AA 1F4PA 1II8A 2EGGA 1PO7A 3CR8A 5BSRA 2XODA 2QJWA 1PFQA 1KYVA 3QNWA 5IAEA 3SMVA 1QQBA 3KYJB 5B3KA 1QR2A 4RSMA 1JEQA 4FHFA 3AVWA 4QL3A 2JHGA 4EY5A 1O03A 1TC1A 1V4VA 1K63A 5H80A 2EGHA 1M72A 1C3OB 2GN8A 4MAAA 5BSWA 4YRMA 2X1HA 1WQ3A 4WCFA 1WZIA 4CUJA 3PL1A 3IPXA 3PQ6A 4IZHA 3DMNA 3EEBA 4DV6B 3PWKA 2CFTA 1O9BA 2C7QA 1QFJA 2EAUA 3P32A 2BGJA 1T1RA 1NG1A 1GCIA 1RABA 4N9WA 2EWMA 5AM1A 4AMVA 4CF7A 5KOHB 2BGNA 4Z8YA 1J56A 1B8VA 2FUKA 1Z4NA 2JBAB 2WJIA 4J0CA 5GV7A 5TGTA 4C4ZA 2VF8A 2H4WA 2E21A 1HE5A 3MQ2A 1KDOA 1KK0A 2LR0A 5BN3A 2XCSB 4OG2A 3NPMA 4KYTA 4P4NA 3QYFA 4F5YA 1X6VA 1ILWA 3L82B 3W90A 3A32A 1LDGA 2FHSA 1WE2A 4NMXB 1TDJA 1KORA 3RREA 4BP3A 3EE6A 5F5NA 2YC4C 4CQMA 5SZKB 3HJFA 1A2BA 1Y7IA 3FGPA 4EF6A 2WWTA 1L8XA 1THTA 1XF9A 4I4LA 4ZANA 4XEHA 1EE2A 1D2CA 1G8PA 2Q6IA 3MC1A 1RLOA 2CK3A 5JG7A 4Z6KA 1NPTO 2DFVA 5BR8B 3P2YA 1GTRA 1ECCA 2ZUUA 3M4JA 1VHTA 2DPGA 4D6XA 3HCEA 2D1TA 1N2OA 2BP7A 2FHPA 2OD9A 4AWAA 1XQ1A 1I6MA 3NJ4A 4YJ2B 2WJ6A 4DPKA 3F4KA 3NP7A 1C5KA 5IKXA 3CURA 1KR2A 2Y8EA 4H4CA 5JS1A 4E88A 1L9XA 1MIHA 1NMYA 3DKPA 3SBEA 2CHEA 4IMRA 3B1XA 1MO6A 2FDCA 1FVHA 2DFPA 2JFQA 4JNKA 2W6IA 3JWPA 1IXKA 3VXKA 4MYDA 3GZ4A 5A0VA 1A5SB 2NU6B 2R6JA 1Q7BA 3HYLA 4YROA 3UAYA 1Y1TA 3UAWA 4B31A 4BLPA 2WVHA 1E79A 3J7TA 3LZDA 2ZIAA 2COKA 3GOQA 4GWKA 4MUNA 2WG0A 3IE0A 4HHEA 4QEKA 5KKCA 5TLSA 2D2IA 4W9MC 1TM1E 2P4SA 3FNHA 4GVXA 2R7LA 3TD9A 5KJFA 1QO0D 4FYPA 2UYYA 4IJ6A 4IIDA 3WB9A 1WETA 3IT0A 1Z7GA 1Y4UA 3GDHA 4ND7A 1XYGA 4U39A 3PX7A 2V0NA 4JASB 5I8PA 3UGTA 1DDIA 4YRLA 4QKQA 5LXTA 1ZGZA 2QL7A 4A4DA 4Q7MB 3S40A 3QWAA 4FQ7A 4KYVA 2ERYA 1ID1A 3B6MA 3IP3A 2REOA 4MV4A 3IVMA 3DVSX 3QLVA 1K7FB 2VWHA 3IPRA 2C8KA 1RZVA 4PTYA 1ISGA 4GYYA 1V5GA 3VX4A 3LBIA 1QS0A 1ECPA 3RAPR 4AY2A 4IW3B 3W9SA 1OVGA 2W2XA 4DA7A 4G0NA 5BV1A 2IHNA 5EMHA 3CISA 4V38A 3JZDA 3WXBA 4ED9A 5KNBD 4FMDB 3K4PA 1IM8A 3E82A 3DOFA 2Y93A 2FZKA 2OXEA 1ZOOA 2QMYA 1TQ8A 1U90A 3CJTA 5E6SB 1Y9JA 2CNNA 2ZS8A 3V4LA 4UVGA 4FMBB 1B26A 1VOTA 1QGZA 2GX6A 2VEOA 3PEYA 4R1LA 2PUFA 3WAJA 3CX4A 5JRZA 3RRXA 4X7RA 3EGXA 2IYFA 3RIGA 1XVIA 3QEAZ 1UK8A 5DULA 3KVNA 3D8BA 4NFLA 5FT9A 1N4AA 1D2RA 4DMHA 2VNSA 2NYRA 1HTBA 2GDJA 4N4AA 5A62A 2QAGA 2Z08A 2HYIC 2QMHA 3HU2A 1S4MA 4XYEA 2O07A 3IAAA 1ATZA 1FXWA 2PU7A 3HLTA 4D7AA 4CMGA 2QUZA 2A7XA 2Z9BA 4MQ5A 5I51A 5GPBA 2V0GA 4P7GA 1ULTA 3LBFA 3UWMA 3CZMA 3FKSA 5IJ0B 3L5KA 5DGXA 4YDHB 2QLFA 3QMMA 2O7RA 1P8AA 1X80B 2RGYA 4BFXA 1L5FA 2G0TA 3Q7TA 2ID9A 1Q7TA 4QUKA 3T3NA 1UZLA 3GMDA 4DNQA 3I5XA 4NBSA 1UPTA 3WDMA 1S2IA 4AZ0B 2F1OA 2PCLA 3IPAA 1RJGA 4MUKA 3MHTA 3JQQA 3C87A 4HTAA 4D79A 2CE2X 3BWVA 4WFKA 1NE7A 3X1MA 2AZXA 2NVUA 4PAOA 4DBVO 5EWLB 1PTJC 1MW8X 2WJGA 3O3NB 4KDRA 5D3ZA 1L4GA 4G0WA 4E5VA 1L5ZA 2IPLA 3SQXA 1M33A 1SOUA 1SEPA 2PMDA 2QQ5A 4ZVVA 1JFLA 4P33A 3WC4A 1Z4OA 3AEKB 3QXXA 5DWQA 3M5PA 4DA4A 3AVYA 1L6RA 5BWMA 3EGIA 2I87A 4OJTA 1OC4A 4I3FA 2XCRB 4BYMA 1UC9A 4PWYA 3VTKA 1H69A 3V5NA 4ICIA 1JIJA 5DTQA 1EEHA 3ZGZA 4BBJA 4I19A 1P2GA 2O8EB 4NYJR 4OK3A 2G82A 2AQ8A 3GH1A 5AVZA 5DBGA 3RS4A 2EERA 4X95A 4B9EA 4DIKA 1PN3A 4CE6A 3O26A 3KD2A 4J7CA 4KJXA 4KQJA 5FBQB 2ZVDA 3AVOA 3CUTA 4Z9XA 3RRMA 2R1ZA 4CKWA 1FDSA 5IT4A 2C97A 2H1VA 2CW5A 4FFMA 2OBMA 2MYNA 4DOMA 1TK2A 4OSEA 1LLUA 3IUYA 3U3XA 1E9FA 1JJBA 3ABOB 1SC3A 1DS6A 2NZYA 4IHKA 4RTKA 4TYYA 3OZAA 2CNBA 4QAJA 1WU8A 4NNOA 4KUGA 1QRUA 2ZSKA 5FUBA 5C7LO 4NP6A 4LC0A 4HK4A 1ZN2A 3HBFA 1BH6A 5IHPA 1CEQA 4YCLA 5JHGB 1DC6A 5BOVA 4D43A 3CUEF 4DR7B 1K7EB 2A3NA 3PE6A 3GNLA 3VC2A 5I01A 2OXIA 2ETVA 4A0HA 2EOAA 1PK7A 4E94A 3AF0A 5A3JA 1ISHA 1XBTA 2OG1A 2PX5A 4Q5IA 4C6TB 5K8CA 4WRRA 2BSXA 2I3DA 4RSGA 1C3JA 1FSZA 1Z6PA 1B6SA 1N0HA 4DCNA 4DSNA 2AI3A 1SCKA 2JLQA 1NJFA 5L4LA 2BZGA 2H1LA 1Y7LA 4J0GA 5FO1A 1MJNA 3RBZA 2C5SA 1PJ2A 1T9GS 1LU9A 2X5NA 1JQ3A 1IM5A 4PPYA 5JXWA 3SS9X 1J9GA 3PHBE 4Q05A 5B3AA 4PXAA 4CQLB 4EF4A 4HJXA 5EVCA 5BWCA 2EL7A 1OFUX 3BGWA 4GMDA 4M9UA 4BNWA 1OZGA 2M6KA 3IYLW 5BVHA 3PD0A 2X5OA 5CYGA 2JGDB 1EFUA 1BWRA 3PRKE 4RF4A 2EFCB 3E5NA 3ONEA 2IIPA 1LQUA 3B13B 3B3JA 3D8HA 5DTIA 2PYZA 2LWIA 4PG5A 3ZPXA 1KRHA 3ZWMA 1YQTA 1SQSA 3PF9A 4Y2PA 1MC4A 5LZ4A 3Q8KA 3SLRA 1R0CA 2CXTA 3G5MA 1SUIA 4QGGA 3LUDA 1UMBA 3ZEAA 5M34A 1EVIA 2JZNA 3D3QA 3R8FA 1LNQA 3D6UA 1FPMA 3EZ9A 2JA2A 4J1SA 4JBIA 1G5FA 4QLAA 2A0FA 5A5EA 1E96A 1NNLA 4S1VA 5JBNA 1K5PA 1R12A 2FCAA 1F17A 1RWQA 1LV7A 2OD2A 1BX3A 1L7RA 1RYBA 3E7XA 5FOWA 1H1TA 4PIPA 3KX2A 3QVVA 1UPFA 4CL3A 3TCNA 3SIWA 2FA9A 2XNJA 2ZB4A 1TLTA 2OSVA 3TW6A 4FX5A 2VBFA 4F6RB 4UW9A 3ZJ4A 2Z8XA 4Q9JA 2V3VA 1VLHA 2O0KA 4EGJA 2BM8A 1U2DA 1D1QA 4EMBA 1GDTA 2BM1A 3N0RA 1SXJC 3YASA 1Y7TA 1SXPA 1H4TA 4KXNA 1UKZA 3SHQA 5EPUA 4EHIA 1Q17A 1QIEA 1QIDA 221PA 2HA0A 3WYCA 4CPDA 3DV2A 2P90A 4KITB 1H8EA 2POQX 4MV9A 2ZUFA 3PDWA 4TWAA 2J6BA 5FLYA 2VK1A 4J75A 1DAIA 5DN9A 2WAYA 3BE8A 4DILA 2WE8A 4FYJA 4NARA 3VPHA 1YVDA 3DYIA 3I05A 4Z1MD 1FMCA 4LHSA 4IXTA 5LNK1 5F4BA 4IICA 4GBED 1EE1A 1M2WA 4HI0E 4ONEA 3LIIA 1XEXA 3MK31 5IKOA 4AJNA 3K0FA 3NANA 4DL9A 1HDIA 1ESZA 2B82A 1ZD2P 2HHLA 1ND5A 2OVFA 2AEJA 2IKQA 3EFEA 2GUWA 3RJ9A 2QVGA 3C3CA 1QHIA 1G8FA 2X86A 3OFSA 2II6A 2EEPA 3FOZA 5GTDA 2B5VA 3KQOA 4DABA 4HNUA 5K2OA 2XIQA 4YT8A 1D07A 2TMYA 2WD8A 1CDEA 2XF2A 2XNKA 2AVNA 4MHTA 3P8ZA 4KTVE 1SEVA 2JJ2D 3A2LA 3AUTA 4FILA 4K9KA 5KPDA 1OWLA 3C3JA 2OV1A 5J2UA 5EQDA 4EJ6A 4D8YA 1T4BA 1C7JA 1U6JA 1LF5A 3UWSA 3PF8A 3VTAA 4HDSB 1VFPA 4PX5A 1Q7EA 1OWNA 2DCMA 3W4KA 5KJEA 3UQYS 1R8XA 1BA2A 4Y0NA 2CWDA 2DG2A 3FTCA 2EKPA 3LXMA 1FXUA 4X3CA 4W1SA 1A4UA 3MAJA 4LYYA 4K5QA 1C4KA 2VPYA 1YDMA 3HR4A 3JYQA 2DY0A 4Q9AA 3H04A 4AECA 4YQFA 4DLNA 1ZA2A 4JJKA 3UUEA 4JEHA 2ZJ0A 4NENB 3W6PA 1ESEA 5IXYA 2L0XA 1DT5A 1YXMA 3TCKA 4BBZA 1YIAA 1P9NA 1PU2A 1S4QA 3PIRA 3RC8A 1I1NA 1W36B 3NDIA 5ERXA 3STUA 4JI0B 1FFYA 1SCBA 3HA3A 2Y27A 4S24A 1HT0A 1BXRB 3IAFA 3TRHA 3WBKA 1XMPA 4C7OB 2RGEA 4XWOA 2J5BA 1I7SB 1PWHA 3TSCA 4KP7A 5D01A 1B3RA 1X77A 2DT5A 4BCCA 4PNEA 1Y3AA 1H94A 1S3SA 2R6CA 4HEJA 5G40A 3VZDA 1KAMA 1LX7A 5GJVC 4EJSA 2KB0A 1GZ4A 4YMTA 2ZYHA 4JJEA 2EX1A 4HN2A 3EXHC 1L5NA 3DE7X 5H16A 1B8PA 1L4HA 1YKGA 2I1QA 2JFWA 2W2KA 2ZG6A 3JR7A 3KZKA 3M1IA 1I3LA 4KWTA 1E6MA 5BSGA 5F5LA 2SKEA 1DARA 1KY2A 3U16A 3LIPA 1ZCAA 3GG9A 2OXRA 1PQWA 4RK4A 2CDBA 4LZPA 3QLEA 5L4NA 1JLLA 1KO5A 3Q7QA 1Z6GA 2WYIA 3FDZA 1LZLA 3MB8A 4O4JF 4XAQA 3VAAA 5IFLA 2NQ8A 5SZHB 3WHPA 1FTWA 5C3UA 1UBCA 3LHKA 3QPVA 3RB8A 4DMGA 3DV0B 1Z0UA 3UMGA 4GYJA 4MRSA 1LTKA 3MOSA 5B2ZA 4CQNA 4AJOA 1IMOA 1IBCA 1UXHA 3E9MA 3D7MA 4N3GA 5ENZA 1ODLA 4HXYA 2VOEA 2GARA 2JI9A 3HN7A 3ONFA 4R9VA 5AKKA 3ZZ1A 3MTEA 3VDNB 1GZ5A 4BIMA 3BMXA 3FZNA 3JD3A 4F9EA 3GVXA 1EP9A 4MS3B 3ICVA 1O95A 4MNTA 3IBTA 3O6VA 4P3KA 4ZMRA 2EJVA 1EP2B 2VG8A 2YXEA 3FNGA 2A5GA 3LQFA 4W6QA 4CODB 5C4GB 2G4VA 1R16A 5KYWA 3C8UA 1WIWA 1QGED 1WDMA 2W0SA 3PEVA 3HXLA 4R2MA 3QELB 4W5HA 2QLBA 4D02A 3FPSA 5KNDH 3B5JA 5KYXB 4JEMA 2LRHA 3QPAA 5H0IA 2GO7A 1ODJA 5C18A 1A0OA 1ZK2A 4MVJI 2O2XA 5CMLA 4LFCB 4OHBA 3ZK9A 2Q7OE 1YZLA 5AQ1A 1C7EA 1SC4A 2CCGA 4WW0A 2IXTA 4JUIA 2D00A 1KKMA 1REQB 2AS0A 3H9JA 4KU4A 3BQNB 3LGXA 3RSZA 3EEOA 1U0FA 1QQTA 4HGPA 3TTSA 4RVSA 2GBFA 2QYOA 4K8OA 3PHIA 1IAQA 1W34A 4Q7JB 2Y0EA 3KTFA 4NV0A 4GL2A 5FHRA 3EAGA 1B2RA 1H1LA 2QJFA 4OQNA 1IZ7A 5JW6A 3PGLA 5LQAA 5E9AA 4KKXB 2ZBEA 2DFLA 4JT2A 2A0UA 4LOAA 4XZ3A 2XXAB 1ECLA 5JCPA 2YMMA 3F97A 2VTEA 4C6RA 1JPJA 4UD6A 4RHCA 3PQ7A 3PDCA 4OKIA 1YZTA 1SHLA 3EQ7A 3PYLA 4G37A 2PE5A 4H9GA 5J4VA 1UEXC 3HTXA 6REQB 5EMMA 1FP6A 4JMLA 1D5CA 4BRWA 3SEAA 4E5DA 4XUCA 1U5CA 4OK5A 4BO4A 1AB5A 2DHCA 3FFAA 1U31A 1E0SA 4DHEA 4PZZA 1TQ6A 4GXRA 4P4SB 1VMEA 4QJBA 1S89A 2HK7A 3BILA 3EYWA 2XQJA 1U9IA 4X8LA 2J0EA 4LRWA 4WZ6A 2PBFA 3L8YA 1ZL2A 3TSZA 3AUUA 2OLEA 3U9LA 2A0KA 2JIZA 1VL2A 2E4VA 4QLOA 3QFSA 1YRHA 4GR4A 4NOKA 4BNUA 1A9XA 4PG8A 2BSQA 1Q5PA 1B42A 3TSWA 1IY9A 3ZVLA 4OJNA 2QQ0A 4QLBA 4YUXA 4LKRA 4UBIA 3E4CA 2D0DA 5DJ5A 5IVHA 1ADJA 5T5QA 5JDCC 1FSSA 3F9RA 2B34A 4DYVA 1P3DA 1VA4A 3GI1A 2V7WA 3V4FA 2EKDA 3TBHA 3FBGA 4B48A 2IYEA 1EK0A 1W4ZA 3R5SA 2I62A 4PO9A 2HADA 2HBQA 4NEGA 5T4HA 2Q5LA 3GK3A 3AFMA 4LNAA 3E8SA 2DHQA 3I01A 4JLMA 4MO9A 4I4IA 3VUFA 2R9VA 3W4JA 4JROA 1BKYA 5CDFA 1QU2A 1J4AA 3FGNA 3PUIA 1QP7A 2B8TA 4CG2A 1E58A 1L7AA 5ALZA 3U6KA 1G3QA 2A86A 2FE1A 3NWPA 4IL5A 3RABA 5JBIA 1R0ZA 1OFVA 4RPKA 4ASUA 5B3JC 1P9WA 2ORIA 4KRFA 3OZUA 2MYTA 3NUQA 2JW5A 3WI7A 5CVUA 1UMDA 1JJ7A 3F6CA 3IO5A 1WVGA 1E0DA 3ENNA 3EZYA 5D1NA 4ZT3A 1BMQA 4ZD6A 1JDPA 2H54A 2CXPA 2NAFA 1KMIY 2QGZA 5B1DA 2EKZA 5AW7A 4HX5A 4BWYA 1NN5A 1Y33E 2L82A 4U02A 1HT2E 3WWDA 2GRJA 4E46A 4LJAA 4PS1A 4REQB 3IKTA 3A2KA 1AHNA 1VRWA 1YBMA 5KEIA 4CXMA 1KOGA 2K6GA 1VGRA 3CINA 1P2FA 3FYUB 1NOJA 1T9GR 4PFSA 3U19A 1MO5A 2FZEA 1JG6A 5KSZA 4P84A 4GVPA 3T3IA 3OIGA 1ZPDA 3SEZA 1GG9A 1KDVA 2X41A 3TNLA 3IILA 4ZHQA 4WUTA 3H9EO 4ENPA 6ADHA 4IQ4A 2BWJA 1XFDA 5AVQA 2IC5A 4NS4A 3UAZA 1PK8A 1E3WA 4E4TA 1WULS 2A30A 3TTWA 2H51A 4PGFA 3SF8B 2B1QA 4HQ6A 4KQKA 4ZIRA 4Y9TA 1EUDB 3ZW8A 5F1YA 2HFJA 3A3YA 2BUCA 5IMSA 1EDZA 2YCLA 2Z2JA 5FAKA 1E4OA 1MHPA 3E61A 3V7FA 2VWQA 3ZK8A 2WIJA 2R65A 5LQCA 3PJEA 3DOOA 1A7UA 2OD7A 3AG5A 4DT1A 1CSEE 1JQEA 3NWEA 1WHSA 4TZKA 2V9ZA 2J0QA 3Q3GE 1L7EA 4FS8A 4ND1A 5AW5A 1EFCA 1CDDA 1HLGA 2PKQO 4L08A 1V1MA 4EW3A 5HM8A 3K1AA 1GTG1 2PAAA 3EZNA 1VLMA 3K70C 1H2AS 1N32B 4E03A 1H2HA 1T91A 5JCOA 1G1AA 2B4AA 2C31A 3CG0A 3OU2A 5JE8A 1I94B 1MUUA 1WKBA 2I78A 5FUMA 4WKCA 4NBUA 5DI3B 3O4RA 1LPPA 3MUFA 1DRVA 1P2VA 2OFOA 3ZJYA 2EYQA 3SBOA 3NAZA 4FGUA 2MOKA 3ZCSA 2AXEA 5CXQA 4INAA 1GA4A 3I04A 4MCJA 5DOVA 4CM8A 5ITSA 1OFGA 2VT3A 2QWXA 4MPTA 1P2SA 1RM5A 3C70A 4YI5A 5KTOA 3GDWA 2AOVA 2EG9A 3L0OA 4BVAA 4OX9B 3UCXA 3JCZA 3IIEA 1FEZA 1KZ7B 1YULA 2FRXA 3TE6A 4O4JB 4I50A 1Y48E 3F3SA 5JNWA 1BGVA 4C4SA 5CVJA 2IA5A 1WR8A 4O2RA 4WNAB 3HP4A 4FCWA 2ZAGA 4JU9A 2QN3A 2VJMA 3C8MA 3JATB 2WUWE 2VF5X 5HPYB 5TARA 2C5BA 3LA8A 1YF3A 2CZCA 5TJ9A 1D4FA 3GNSA 3UOGA 2QTAA 5FTWA 3WMGA 3KYCA 1Z0SA 4YREA 5LP6F 3WQSB 2F90A 4LX0A 4HMPA 4ZAFA 2VNAA 4JC0A 4TRMA 4C07A 1ZNXA 3C74A 2Q41A 2M9MA 5IN5A 2IODA 4X54A 4EKIA 3QVMA 2BMFA 4UCQA 3WJAA 1EG2A 2FKNA 2AC2A 3V4VB 3SLGA 3O03A 4Y2HA 3A4VA 4XWGA 2D7DA 1GFIA 1ZO8A 1JI0A 3GJ3A 1ORWA 3GRUA 4J4HA 3W5VA 1G3MA 3FHLA 4QU8A 1MB4A 4RK5A 5CU7A 4Z9AA 1NVKA 1SBHA 2FPLA 3HJAA 4I9FA 2BY4A 4AY5A 5KYTA 3IL2A 4DIEA 1W93A 1A50B 2BKVA 3CLVA 3NYRA 5I45A 3RUHA 1G41A 4ZGGA 2E89A 1E18A 2V96A 5L7WA 3IURA 1FFAA 1N5DA 2QRPA 5BV2P 7MHTA 1WPGA 2X2OA 3GAAA 4OHOA 4Q4DA 4R8SA 4OYLA 4CJXA 4DCTA 4B3DA 2AXQA 3UMCA 4Q82A 5HKBA 2WU4A 4LHVA 1SC6A 2KX7A 3QMVA 4BNFA 1QMGA 1YU9A 4HATA 2Q4EA 4B3RB 1VKOA 2ZIEA 3HDHA 3FOFC 1QRTA 3WIBA 1PYOA 2CCKA 1QB8A 4JI2B 3ADPA 3G9UA 5FOQA 5EE9A 4BLOA 3DEAA 5GZ6A 5F33A 1E3EA 3EGOA 3OTOB 1QHXA 1B0UA 2JIDA 2TS1A 2IZ7A 2QZ9A 4Y9SA 2CFCA 4JQOA 5CGZA 3VZBA 1NZFA 1QGUA 3E7PA 3OF5A 2SBTA 5IKMA 2YRXA 4Q37A 5AXAA 2JCGA 2VHYA 1YB1A 4HEHA 4HQRA 3BUSA 1X7GA 2DHEA 2GD6A 2HCRA 2GJ8A 1QTQA 3KETA 3KTAB 2VRCA 2P91A 4PQYA 4ZPJA 3ZV4A 4AQ7A 1CZHA 1E2MA 4J0HA 4CR6A 2XRMA 2XV1A 1TF2A 2D3TA 4IIJF 1JSRA 2OP0A 4Q9DA 2J3LA 3P45A 4GQAA 4OHPA 5DLDA 3BQMB 3NIDB 3OE1A 4ZEOA 4CG3A 3CH4B 3TQHA 3WKAA 5K3DA 3WBBA 1HDXA 1NF9A 1Y9ZA 4DV4B 1WKCA 5DIZA 3TI7A 1JKXA 3FYSA 4Q4JB 3W5AA 1N1MA 4N7JA 1PNRA 5JFTA 3GWZA 3RQIA 3A1TA 4OF4A 3V6MA 3VHRA 5B6PA 4QVGA 1VYTA 2ZYUX 2HHJA 2BHSA 1E3TA 3D6AA 1VL0A 3CCBA 3JQ9A 3KR2A 3OKFA 4HS4A 5AJYA 4DLRA 1PVOA 4JBNA 2EIXA 3N39C 3NCTA 1G98A 3B3AA 2Q45A 3DE3X 4BWGA 5B7NA 5KHOC 2VTBB 4A8TA 2FEWB 1YONA 3PQCA 3LC2O 4RH0A 2HFKA 3WFZA 5AJTA 1X7DA 3N2GB 4L16A 4MW4A 2NTNA 3NVKI 1TUBA 4RE5A 4QTYA 4DG5A 3AB8A 4KI0A 4MW1A 2QRJA 4JP8A 1FFCA 4QG3A 1JZTA 2VYCA 1YL6A 4LHXA 4W8GA 4ARZA 3REOA 2KI5A 3B53X 1U2GC 4K8RB 2G9ZA 1Z7BA 4UCXA 5ALVA 1I13A 4F72A 4ZTZB 4RAQA 1E1CA 4OP3A 3GJQA 3L84A 4B2YA 4F3KA 5D51S 2W43A 3IAXA 3A6FA 3TLCA 3H0CA 3S8YA 3ZHOA 5ALXA 4N5NA 2BCJQ 2FPUA 1EUQA 4KQCA 1ZMBA 1GPJA 3UV7A 3VNRA 4D8WA 1OLXA 1XTUA 2FRVA 1X70A 2FXVA 1M2GA 3A1UA 4MR9A 4TTJA 4X1OA 3HR7A 1F5NA 2PY6A 4UJ5A 4WZBB 4BLUA 7AT1A 5JD4A 1X38A 4DA6A 2FPMA 3OOSA 1ISRA 4TQ9A 3VHQA 3M6XA 2NP7A 2YUTA 4HNQA 1SG6A 3ZU2A 3U1VA 3S7TA 1J33A 5EWMA 3ETGA 2B2NA 3AR7A 1I2CA 3G7SA 1KMQA 4KK4A 2GZHA 3FMFA 4MVJE 5DHTA 5ECWA 2HO5A 2C4KA 4WDQA 4ZQFA 5C51B 2E18A 2PQ6A 3URKA 5BXQC 2F3QA 2REBA 3SJ7A 4ZARA 3NHAA 1CS0A 5AW4A 1HQDA 4QFBA 4RCYA 3CT4A 3U49A 3ZWOA 3PEUA 2RJ3A 2V54A 1Z0IA 4KIFA 4J3NA 3DUFA 1C81A 1U5BB 3EIXA 4P31A 3PUVA 4UARA 1GPUA 2PLNA 5ILGA 2ALJA 1VJGA 2NU8A 2NZWA 3WMWA 3LQ1A 4ER0A 2J9XB 1FUEA 1RKXA 3BYZA 1OWOA 5K0SA 1JPNA 1QQ5A 4Q39A 3KJGA 4B17A 3BD8A 1KJ8A 1Y4ZA 2KSQA 3EXIA 4Z2YA 3TQSA 4HQOA 3UWPA 3KXKA 1PJ8A 2ACKA 3WGNA 3PFKA 4GUDA 1T5HX 1E2PA 1GGFA 4ZQBA 4JZKA 4LYDA 4QBHA 5ELLA 3UCFA 3GP5A 2AIRA 1IK4A 1V7QA 1KIMA 2QK4A 1IXRC 1DHTA 1T8UA 4YAJA 1JBKA 4ZAXA 3KSUA 4B3SB 4KQ9A 2HX1A 3ND9A 3MJRA 4NG4A 4TM7A 4G0UA 1GYRA 2ZB2A 3W1VA 2BV3A 3USZA 2BIFA 3ASZA 3QSGA 2F3PA 1XD2B 1G5HA 4BFZA 5ED4A 3UHPA 5TMDA 1ZWLA 4XD7A 3OCVA 4UBKA 3T0IA 3ZU5A 4KRXA 2ST1A 1JR2A 3C3DA 3JQ8B 4JT9A 3KDAA 5FWAA 4BQSA 3E2PA 1DUIA 1ZUD1 4GEGA 1EWVA 1WLSA 4IX1A 4IUYA 3C24A 4YMGA 2O3JA 2O52A 1HE8B 1TJ3A 4LDAA 3PFCA 3EEQA 1HMYA 2ZJ8A 3ICPA 4TZTA 1XNJA 3TD6A 5KB3A 3Q7IA 3ITNA 1AUPA 1FBNA 4K88A 5CURA 2XYGA 4EFDA 4ZP1A 3TQCA 1NUAA 3DHWC 4AQDA 3R6WA 2P4QA 4JUFA 3WP1B 3L6DA 1OPRA 2R6FA 3DZFA 4WKPA 2PX0A 5A4JA 2IK8A 2J4DA 4IIUA 3VOTA 1DIHA 1RYNA 3KR1A 4IDOA 3AHGA 3JRXA 2RGUA 3KLNA 4OQ4A 1FLAA 2BGKA 2OILA 4PIMA 4Q00A 5THKA 5LP6B 4OHYA 1PR6A 1RPNA 4O8CA 5IAKA 4EVQA 1BE6A 2WMOB 4RHUA 1F8XA 1U4OA 1HX7A 3BCSA 4ZMBA 2CN1A 4Q18A 4J1NA 4C43A 4AXXA 4QZVA 5J2TA 1YOBA 1M6WA 3E9CA 2YJ3A 3VR4H 1L4KA 3NVAA 1SO8A 4NX2A 2BMWA 5ALJA 1PTJA 3ORSA 1CRPA 1GPYA 3CV3A 1W1WA 3U7RA 4IOLA 4NPHA 4BB5A 1DRKA 2ZCUA 3AVVA 1Z39A 2O23A 2QR3A 2ZRNA 5CLHA 3CNOA 3K15A 1PWEA 4J16C 2LDXA 3FBWA 1LRJA 4MLPA 3R7SA 3EVNA 3U7QB 2NZJA 2B69A 4OQDA 1RBYA 4GQIA 1TM2A 4GXTA 1L7BA 1TAHA 3ANSA 4H4DA 5FAXA 2KWIA 5FO0A 5B7PA 1TUGA 4RY2A 1BDMA 1RYHA 3T61A 4YAUA 1S2MA 5IEBA 2HDNB 1O96A 3CLSD 3QK7A 5ECYA 1XQWA 2GPJA 3HPRA 2QRNA 3ZE9A 4II7A 2PM8A 4H3VA 2AOUA 2LNDA 2C7OA 4L5BA 4DSAA 2QZZA 3FTPA 3WWOA 5CB0A 1XRRA 4MIYA 1XG5A 2GJAA 1R50A 5TJHA 5BMVA 2D0OB 1QTIA 2QW1A 3UKOA 2Z9DA 1FNMA 4CKEB 3B8HA 2R2AA 2F9FA 4QASA 3STXA 1V25A 4B4KA 2ZYWX 3IUJA 3JRNA 4CLOA 2GM3A 2BEWB 1HSOA 1V2HE 4RKWA 1N2CB 3RSOA 2NXEA 1DFHA 3KOUA 1NUUA 3QLUA 2EFDB 1NFFA 1R74A 2YXLA 1ZY2A 4EHAA 3NBKA 3UEOA 2QM7A 4J0KA 3EPKA 1E5DA 1RI2A 3EISA 2I33A 1PCXA 4AF6A 1GUYA 4IIJB 1G8KA 1JFSA 1AS2A 1MMFB 2D5IA 3AP1A 1G7TA 1J06A 3BJZA 4HGOA 4MP8A 2VSYA 5J4YA 4UNSA 1EFTA 3LDUA 1QFMA 4UXHA 3MWJA 2B0CA 2XUJA 4HC4A 4QOGA 4IKOA 1N77A 1OU4A 4W9RA 4OKSA 4L8LA 3PR2B 4TL9A 4WHMA 1V8ZA 2O1WA 2VT2A 2WYWA 3U5TA 4LE0A 4MPJA 3QFHA 4HSEA 4TS1A 1P62B 1MC5A 1DQNA 4JUDX 1R0RE 1NBME 2PSSA 3H8VA 4DSOA 3IUEA 4L2IB 2BRUA 2XADA 3VKFA 3L1HA 3WBFA 4ZK2A 3BAZA 4I1UA 4R9UC 1Y6FA 5BQXA 3RSQA 2A57A 1SURA 1XNGA 3WDSA 4RJKA 1A9RA 4BVEA 1BD4A 3IELA 2XUGA 2P8JA 1EIZA 2FFQA 5CJ2A 3WAKA 3SR0A 2J85A 2GK7A 3EVFA 1RI3A 5K8JB 4OK6A 2AG6A 1Z5NA 1MX1A 3FCOA 3MMSA 3C16C 4OLJA 1K88A 1ORHA 2HHHB 1ULUA 2RARA 2E2WA 2VNJA 5BRJA 2OGZA 2ZRAA 1KMHB 3JYLA 4JDPA 3R7BA 3GMIA 4BAGA 2H16A 1P8JA 1ULHA 2YJZA 4I9NA 4KN5A 5T41A 1EX9A 1TKRA 2YIMA 1T4DA 4U0KA 1F0KA 4LK3A 2H17A 4NJEA 1CQZA 1EVKA 1QIFA 4J07A 1SQFA 2GBIA 1UM9B 4YP7A 1ZRMA 2AXPA 4OYRA 3RO7A 1T3ZA 3MWEB 3OO1A 4MV8A 3RYHA 4P35A 3K9GA 4R0VA 3HVIA 2MSEB 1C80A 2P2SA 4FXPA 3M33A 3OKCA 10MHA 2NV2B 3DBHB 3EJWA 3LUPA 5DP2A 1BXKA 5GGYA 3RTDA 3WKBA 5C3MA 5C1OA 3WYGA 5JQGF 1HMPA 1KQFA 4BTLA 3GP8A 2AJ8A 2BDTA 3NT5A 2CDRA 1UOQA 1Y8QA 5DT2A 4L7VA 4WADA 1FUYB 1R00A 3OQPA 3I2YX 1RWMA 5AI5A 2GAOA 1YI1A 4RPGA 3AR5A 3WO1A 2GBPA 1PUIA 1Z6XA 3G49A 4PPGA 3L18A 4FOSA 4PYQA 5FJJA 2M32A 2WTXA 4GS5A 5JAIA 4RKQA 4LZLA 2QZJA 2QG9A 6AT1A 4K9QA 3QNUA 3VR2D 3EFOA 1XKTA 1R5BA 2O6HA 3MUNA 2HSWA 1KC3A 2MMCA 2AV6A 1G20E 4Q21A 4XGIA 4UXJA 3RM3A 2AN5A 3UPUA 2GHQA 3EDQA 4RTQA 4R69A 5CAEA 2WSSD 4MK4A 5L3VA 2HEGA 1G8AA 2MJLA 2RHCA 3RVBA 4A0RA 4OL0A 4RGBA 3P94A 2QE7A 1YDHA 3JWIA 5G2OA 3TFQA 5HOQA 1G2IA 5ALTA 3GU3A 2RH5A 4WA8A 1E2UA 2RBEA 4HTFA 3Q3IA 3BIXA 5JPIA 1A7AA 2BL4A 2GNPA 1TT5B 2I4TA 1TM5E 2RE8A 1M10A 5DFAA 3ZDDA 4MIKA 4PZ9A 3IDSA 4UMDA 2R2GA 1SVNA 4K05A 4EEZA 2D0IA 1X7HA 2HXSA 1ORVA 1VHWA 3LVQE 4O08A 3T4PA 3TIVA 3MILA 3WL7A 3VDRA 1NW7A 3IMKA 1F2UB 2O50A 3ZYZA 1N0UA 2G80A 3AW9A 4KXXA 2VAMA 5SZIA 2H3HA 4R0MA 3WLRA 5KSWB 4NULA 2V65A 2WWIA 4KPYA 2GPAA 2IU0A 3LT4A 1L5HA 4AJ2A 3C45A 5B2FA 4H7JA 4L7QA 4TRJA 2FGKA 1I2ZA 2F9MA 2NPOA 4QJIA 4DQXA 1MA0A 1TO6A 4H0FA 1XMOB 1JE1A 2PEYA 2BFDA 3M49A 5EUCA 3PC3A 3R3UA 4C4TA 3SX4A 4H59A 3N87A 2X0EA 4C1NA 4KZPA 1JMKC 1HYHA 2Z43A 1GPDG 3BE4A 3HKBB 1ZUNB 3L1UA 4N6GA 2JFHA 1EFPB 1NNUA 3WBJA 4AF7A 5IF9A 5BWBA 1TCAA 3QPBA 4TVKA 4YDQA 1HNWB 1F38A 1UCFA 2C2YA 3E70C 3BRWD 1Z2DA 1JVSA 3QX7A 3AFGA 1G5PA 1VE1A 1T26A 4MKHA 4IJQA 1ONBA 2GEDA 1G7RA 4PC7A 4TKUA 5CFQA 1GCGA 4K6MA 2B92A 3RFVA 2FR1A 1IZYA 2NUPA 3Q6MA 4DJTA 1TECE 3QKUA 4U3JA 3H2GA 3K1JA 1NXQA 1X14A 3OIYA 4Q3BA 5HQ3A 3EN0A 2XDWA 1ZX1A 3HKEB 4UDYX 1X3LA 2JGMA 3OCUA 5BN1A 4LYEA 3BWXA 3R5JA 3G59A 4MI1A 2IUUA 4AY4A 1S3GA 1JT9A 4EHNA 4HUQA 3ZLBA 3ZV5A 4FEEA 3SJAA 1Z06A 3WHLA 4CM5A 3PPVA 2IE0A 5EKXA 4C03A 3DM5A 2HQRA 4X1IA 5FLEX 3TZCA 5C5CA 1C1HA 1GQSA 3LUKA 1QOZA 3QV2A 4G0MA 1RWXA 3L49A 4B6OA 4XA8A 3IE1A 1E6EA 1VKZA 2BTQA 2BELA 4PAQA 2R62A 4IV8A 5AM5A 3JQPA 3FCCA 4E5UA 2HA7A 1PNOA 1M5TA 4LBZA 4MX8A 1OZHA 1E4EB 2CVHA 4WE3A 1XRJA 4JGIA 1U8XX 2O2ZA 1YE8A 3G8DA 4FK8A 4MKXA 3SSNA 2W2MA 4CCAA 2HWYA 1GNLA 5IUNC 5JH7A 4EW2A 1SKQA 3HVUA 1K7SN 3ESZA 4KR0A 4LXGA 4CM9D 5IJZA 4QAQA 1KAEA 1CLEA 3RUDA 1RHUA 1E2DA 2QRLA 3DWEX 2BFWA 1ETHA 3OZ7A 1T5LA 3IMEA 1MXFA 5I7FA 3OZSA 1T24A 3I2GA 2AFRA 2DC1A 2ZT5A 4YACA 4AIRA 4GLFA 5HXAA 1H42A 4WOPA 3R7LA 4UREA 4W9NA 4ZOEA 2E1PA 3USES 4TUYA 2A0YA 4FOOA 4WAUA 1P4SA 2Z6AA 3BQ9A 4IOKA 3OEHD 4GOND 3L3BA 5CBPA 4X1YB 1SCAA 1DAMA 2HEIA 2FP3A 3HSSA 4V0OA 1CUIA 2XJ9A 1K6MA 4AP6A 1P2BA 1SZCA 2OGUA 3BS4A 1RWOA 4LDQA 1QIGA 2V4MA 3A9CA 1YMVA 2JHAA 4ETWA 2OESA 1E2JA 4L4XA 2CD7A 3UJ8A 4EITA 1BN7A 3P97A 1PFWA 3I1FA 3O5AA 4YAKA 1ISIA 1AUXA 1J90A 1QGDA 2DWUA 3QVUA 3I4CA 2OHHA 3GVPA 3V8RA 4TVSA 1SKUA 5BR7A 1QCYA 2CB0A 2MINA 1EPUA 1XQ6A 4I9UA 2BYTA 1WMSA 4GOMD 1T34A 4EG0A 1VJRA 4KPEC 1MB3A 1W35A 4BKPA 4C5BA 4BTEA 3DKIA 5TF4A 3ZU3A 1GY8A 1Y42X 2EQAA 4LN1A 4OP1A 4CL2A 2ZE7A 1OFTA 3HGMA 2AMJA 3UMFA 1UDWA 3OLCX 3M83A 4PLHA 3BK2A 1YOVB 2WI8A 4DAOA 3AEQB 3HE3A 3KDSE 1VIAA 4HLUC 2OFFA 3SM9A 4D4GA 1H6AA 1KOJA 2GA9A 4ITUA 4KQWA 2I4OA 3O31A 4TV8A 3OM8A 2BFMA 1OY1A 2LP4Y 1X94A 1Z25A 3HU3A 2AWOA 2O2SA 3CN9A 4G26A 3ISVA 4P9NA 4Y18A 4YJHA 5D3MA 5IYZA 2UU9B 1WVMA 3O21A 1QE3A 4YUVA 4RJTA 1MA3A 1SAYA 1UAGA 1MABB 3ENZA 2P35A 3I1YA 5DHSA 3RYCA 3NT4A 4DDVA 2C2KA 2Q4OA 1Y3IA 1CY0A 3CUSA 3IVXA 4TOIA 2EWVA 5HRUA 3Q8MA 2CMFA 1G9XA 1LRLA 3QYJA 2PH1A 1E7WA 4BQOA 3EFBA 5AHRA 4QBTA 2HT1A 5JQGB 3W5IA 4JOQA 1ANKA 2QLTA 2ZB8A 1SQGA 1ENYA 1DEOA 3I30X 5K0BA 1VZ3A 2IP2A 3K5PA 1ZITA 2ACEA 2GBGA 2XTZA 2WIAA 1Z3CA 4F4JA 2LTAA 4PFKA 1QDUA 3SJZA 1TUIA 4XX1A 2OZLB 1TT7A 2XUOA 5IAOA 1JB9A 3Q3CA 3NHUA 3H1PA 2IIBA 4X92A 2W37A 3RK1A 2DUJA 3L9WA 3WADA 2ACVA 3L7YA 2AMVA 3PFIA 4R8KA 2BFCA 1ICIA 1NJGA 4YCMA 1YGYA 2GJSA 1PRYA 5F1PA 5WRFA 4XWKA 1Q92A 5C8YF 5JMTA 1SZJG 2F43B 5B3JA 3B7GA 4IZOA 2P68A 3OQIB 2AC4A 2HHAA 3M5WA 1YJ8A 3I09A 5AK6A 4R41A 1MKYA 4D8XA 4E3WA 3DTVB 1MX3A 2QGNA 3KZNA 4FYYA 4URUR 5F1OA 3DXYA 5JCZA 3D2LA 1ZOSA 1J24A 1LWNA 2DECA 5KQLA 4Y6GB 5FYQA 3BH6A 4CEHB 5CNJA 1VP3A 4IH4A 4Q4AB 5SZJA 2XMGA 4GKJB 4BNNA 4ZMSA 1AHPA 4YJHB 2PXHA 2QSZA 3IV6A 1ZD8A 3ZIAA 2OYSA 2PJRA 3E48A 3T5MA 3DPSA 3LXXA 4BE9A 3SFZA 3P27A 2A92A 2EHJA 4CT4B 1NOKA 1ZXXA 1CQPA 2GTPA 3MBOA 4GPZA 4JP3A 5E2BA 4AU1A 4FB5A 4MDEA 1ECGA 2AK3A 5K99A 2WTNA 1F7VA 1UXGA 4U2GA 3FCAA 1Y0BA 2CMHA 2GPNA 3U40A 3KQKA 3WLPA 4KIUA 4LQCA 3TH5A 1GILA 2VYNA 3L7IA 3M7IA 1OKKA 1NRJB 3EPRA 3ONWA 4ALMA 1ZJWA 1IJKA 1QJ4A 3RASA 3RSCA 1T6BY 1NVXQ 1N7IA 2GYVA 5IF3A 1H5NA 3B7PA 3FOCA 4O02B 3TAXA 5C80A 5H1YA 3GRRA 1EEXB 2C5AA 2W2OA 3RV3A 4E5PA 3KTOA 3IP7A 5BP7A 3GUZA 2FPKA 3OJLA 1UMKA 3WIEA 1OX4B 1S01A 4ZU1X 4M49A 4ACAA 5CD1A 3Q2OA 4E3ZA 1SXJD 3PEFA 4I9GA 3AFIA 5HJ7A 4OU4A 3BJIC 3L4BA 1BKDR 2B61A 2AI2A 1GNTA 5DTRA 3ZWXA 2YVUA 2DERA 1YS2X 1G38A 3SLKA 3FFBA 1JR4A 1YZHA 3W4IA 4DR4B 3PK0A 4YRPA 4BZPA 3DOUA 4ARVA 5E6RB 1V48A 1UAYA 3BFKA 3U3ZA 5CG2A 1JN0A 4GL4A 1G8JA 2C0QA 1P6UA 1GNPA 5BSKA 1DLJA 4B4OA 2VCYA 5JAQA 1R6XA 5DHFA 5HIMA 4BNVA 1JNXX 4DMKA 3GROA 3AIKA 3COWA 1A4RA 1U7HA 2FW0A 1ZISA 1OIWA 3KVRA 3ZXSA 4WGGA 3LT0A 3VU3A 4RVFA 1SXIA 4B6JA 4QYIA 5JASA 3TMYA 4Q1FA 2ANCA 3V2GA 2GPBA 1Q77A 1WUHS 2JAXA 3B78A 2P2NA 3QXJA 4G8BA 4DLWA 1RXIA 1KXZA 3FW1A 1NR7A 3RKRA 1QU3A 3T5TA 3GFRA 1KI8A 1XALA 4OM7A 3B6EA 3G17A 4KFUA 1FDWA 4D74A 3LSYA 5G0SA 3TNFA 5ALSA 1MG0A 4IGAA 4YRJA 2EATA 4BO9A 4KODA 4S1WA 4C0QC 4D42A 4EYGA 2AUTA 4GECA 3DVQX 4RADA 3CZCA 3ML1A 3Q0IA 4LIPD 1X1TA 1XZ8A 5EZYF 3X1JA 5J4KA 3K16A 3ZDBA 4U7DA 1FLDA 3L7OA 3AGQA 3PKJA 3ORYA 1WNFA 3OAAD 2R6HA 4G1VA 5D87A 1QFXA 3PDUA 3WHKA 2IYWA 4EUNA 3QVGB 3MLEA 1FY2A 2HL6A 4LNHA 3HZHA 2Q4RA 3W2IA 4N39A 3AY3A 3LX5A 5K0JA 1W9HA 2PUBA 3DT6A 1L4LA 3UGQA 4PX9A 1HFWA 4X0EA 4ZU6X 1N6PA 4LOLA 1QDLB 4ARUA 3C7KA 3P0JA 4BP8A 1YDGA 2P7IA 5B2EA 1Z4PX 1YBHA 1N8NA 3H17A 4FOPA 5A7GA 4ZREA 3UNXA 3PA8A 3RYCB 2OZVA 4EYSA 1A9YA 3R09A 2OAP1 1QMPA 1L5LA 4FBMA 2P5SA 2WJ3A 1J9EA 3C41J 3GLGB 2PX2A 3ZY4A 1KO4A 3CGWA 2OZKA 2O19A 2CY0A 2HNBA 3UFXA 4IS3A 4DG8A 1SZPA 4MVJA 4TL7A 5JJBA 1GPH1 2YOFA 4KGVA 1SCUB 4E32A 1RAAA 1X7WA 4NESA 3RBAA 1F2TA 2I6UA 4MVJG 5C9ZA 1OQAA 2ECKA 2ZE5A 4G01B 5CYPA 1WXDA 4ROSA 2V8OA 3KJEA 4GE0A 3ZHTA 4RVHA 2QBYA 2GHIA 1ZKMA 4NQZA 4CIAA 3C3KA 1XDUA 1GARA 2ZJ3A 4L5JA 4P2GA 5E8RA 5FWDA 3U5ZB 1FMJA 4WK6A 2OK8A 3EVGA 5B53A 4QDZA 4DNXA 3O4GA 2PFGA 3W8NA 4JKIA 1Z2CA 1UKBA 2V1XA 3QPDA 2ID7A 4IH1A 1RDFA 5C4IA 2A1TS 1P73A 2P6OA 3ICQB 2CLIB 3R5FA 3EH2A 1VPWA 1RU3A 3VVMA 1I6LA 1R88A 1TFUA 1U0OC 4Y2YA 1OXMA 3MGCA 1C30A 3QUQA 3P4XA 1GADO 3PYXA 1YQQA 2EZ4A 4K40A 4JUAA 4ZODA 1U9CA 4YJKA 4EQ6B 5CIYA 3W6NA 3GPIA 4EECA 13PKA 3F5QA 3A2NA 1MGPA 3HUDA 1AUVA 3EHDA 3E84A 1PJBA 3MINA 3ET4A 5K2MA 3V4SA 2EP8A 2FP4B 3DEJA 3DGFC 2F48A 4KYUA 4L76A 5AOBA 4DLVA 5I5EA 1N6NA 4D45A 5BV8A 5AIAA 2NZUG 3WGOA 4YJFB 5KOIA 1YKSA 5AKZA 2P40A 1PKXA 1Y1KE 5AKLA 3RBVA 2ZM6B 1DC3A 4G56A 4P7FA 1BCSA 4IGEA 2WKQA 3GCWA 4P58A 4J03A 1JQAA 4DSUA 2ZVJA 2RH9B 4UUMA 3QGMA 3ZZTA 1G8MA 2DFDA 3DPIA 1P5JA 4QRHA 3BMCB 1C8BA 1EWYA 5CFRA 1DADA 4X60A 5TRTA 3WGJA 2MR5A 3HVKA 1YS9A 3KT3A 5C8YB 3NHZA 3KKZA 4PLFA 3F8WA 1W0JA 4XD2A 2ADOA 2BUBA 4O4LA 4TSRA 2ZR0A 1LQ2A 2J5RA 4OGLA 4AKSA 9GPBA 4QPJC 1WO8A 1W9MA 4IPTA 1Z26A 4M88A 2OG2A 5AKYA 4KXLA 1GM5A 3UV6A 1BOOA 3W7AA 2EZ8A 4EBFA 5BW4A 2KYRA 3FCXA 2R751 1J39A 3EGDA 2YY5A 2QD3A 2QX6A 3SC4A 4DLKA 5ILOA 1W5AA 2YWXA 4MMZB 4R7GA 2ZIZA 2H2HA 4AT1A 4RKYA 4YCNA 4YCJA 1W46A 4MW7A 3QNMA 2EX4A 4ZZ0A 3Q9NA 1LPAB 1WSWA 1XRQA 2ZWAA 3G88A 4M1YA 4ZAZA 1E6WA 1O54A 1AKYA 2WOJA 3L0IB 3VVBA 1U9JA 5D1HA 1GPLA 1RYMA 4LPKA 5COAA 3SVLA 2OBYA 4ZC1A 1XIVA 3U4AA 3L6RA 1CFJA 3V9PA 1XDDA 4FHZA 2NNLD 1Z62A 4L02A 1OHHD 1DFIA 2BZSA 2QTVB 3UK2A 4DJJA 3SZ3A 4H27A 2FVXA 2APJA 1PG0A 4QOHA 3LRPA 4BJ1A 1I14A 4IXDA 8LDHA 1GRNA 1Y6ZA 3R41A 5F77A 2CL0X 2W6NA 4FTWA 5L3QA 1U4SA 5EIBC 3OJCA 2XKKA 1WJGA 5HIIA 3U44B 4JI8B 2Z2IA 9ABPA 4A8JB 1BMDA 2XE8A 3PNQA 5EJ4A 1VLJA 1UPBA 2VBCA 3FYHA 2WIGA 5GINE 5BN5A 5AW3A 3CIOA 2IEIA 3A1FA 5DMXA 3IKJA 1FNDA 5KSOA 1UIMA 2ZUWA 1MPXA 3GJYA 3Q8WA 3QBDA 3FLMA 1F8FA 2B4KA 5C52B 5HILA 3FOEC 2IQ5A 3DDSA 2R7KA 2M2IA 1AC5A 4E2YA 2JAUA 4H18A 4MRVA 4G25A 2AZ4A 2R44A 2ZSEA 1M6EX 1R0SA 3OCXA 3TVDA 4BPBA 5KYYB 1HF3A 1FNSA 1N2XA 4B34A 2OQ2A 3E7FA 3WRXA 2OOKA 3D4OA 4JWTA 3W8FA 3P9YA 1C7IA 4PRZA 2CBZA 4FT4A 2YXNA 2FI1A 3G23A 4DIDA 2LCFA 1QNFA 5BPFA 4G1CA 3UA3A 2GPSA 1VJCA 2W22A 1Z6ZA 1SD1A 1Q0RA 2GCOA 4R9RA 5EXTA 3C1AA 1B7GO 4IS2A 1KY5A 4KGXA 4U6QA 4WLVA 3RYIA 1WB4A 3EX7C 2Q3DA 1J8MF 2ODTX 1Q0HA 2AN4A 2RHOA 2OO7A 3H5AA 1JPVA 1WQ1R 1Y6RA 2DH5A 2VT6A 3N9IA 1PGNA 3MM4A 4PU0A 4BFLA 1ODTC 1YBAA 5JARA 1JI3A 1K4KA 2R85A 1NBMA 3BGOS 2BKEA 1O6GA 5TSDA 1V7CA 3TNJA 4B5KA 2O0JA 2FLWA 1AKMA 1EVEA 4ZZ1A 2TRSB 2W90A 4LI0A 1BVRA 2F59A 2O2HA 2QP3A 2QSUA 1QGAA 3H9GA 3VI3B 5AJZA 2VZ0A 2QRUA 5KZMB 2D2VA 3FZEA 5EZYB 2VJQA 2IYOA 2JLWA 3AL2A 2WTUA 2XCQA 2BH9A 3PHLA 2BZ1A 1E2LA 5HKOA 3I34X 1CJBA 3ESQA 2H2FA 3NAQA 4DLSA 3OPYA 2WA2A 1W581 4RACA 5LC1A 1PV4A 5IM5A 2PR7A 1PZNA 2IEBA 1U8YA 4C89A 2QLNA 3BXOA 3ILSA 4Q15A 2ZSDA 3ZS8A 1N78A 1ADBA 1T6NA 1V8BA 3KWMA 5JD6A 1BWSA 1Z73A 4Q66C 5F7XA 1KS2A 4YB8A 3SHTA 4OI2A 2FDRA 2A4KA 3KHUA 2QTFA 5I9BA 2HTEA 4PC3A 2BKUA 4JLJA 2GZAA 2IP1A 4UTOA 1JAIA 3RU7A 3D7NA 4JK3A 3IDFA 4JBYA 3U4QA 2A2ZA 3K70D 1G3RA 4P32A 2FW6A 3C4VA 1KFEB 2DKNA 3CMMA 1UXKA 4UC0A 4FJ1A 1G3IA 1NN0A 4XFDA 1X13A 1E3SA 2JCVA 2AYYA 1FXWF 3LT1A 1KYYA 4YAIA 2I65A 4C3UA 3F5SA 3U17A 2B2CA 5EJ8A 4R51A 1OMOA 2O1SA 3CYFA 4JBXA 4UUOA 2WHXA 1KP3A 3NRCA 1L0BA 1FYWA 2C95A 3EXG2 4MKRA 1QRAA 5I4IA 1GSHA 3LWNA 5MFZA 1WXGA 2Q5EA 2XR1A 1AGRA 1NUQA 2GFQA 1KDRA 1U0NA 1G20A 1JYSA 1N2BA 4HMQA 5KOHA 2C82A 1UJ5A 1X1DA 1M8PA 1U80A 2HPHA 3RVQA 1UC5B 3LUHA 2HT6A 5D7BA 1TYBE 4MW9A 2RHJA 4CQMD 5ARBA 1O3YA 1BDBA 1OI2A 3E9EA 3OI7A 4GOKA 4NE9A 3T5DA 3VYTB 1CJMA 3ITDA 3QENA 4K7JA 4L74A 4MLZA 4N0MA 4QFDA 4JODA 2YWHA 1P0MA 1QAOA 3A3NA 4J43A 1NVTA 3FPEA 4JHLA 4LMPA 5CW1A 4AXBA 3ER9A 3TO5A 3JQAB 1QM5A 1V5EA 4NLLA 3GJXC 4MYCA 3BIFA 2J48A 4LE2A 5DNAA 4ZCRA 1M8FA 1W8IA 4KAFA 4X6XA 3H7AA 3NTUA 1GVNB 1GD1O 1GG5A 1XT6A 2OCLA 4XARA 2AT1A 3QU2A 2PKEA 3CXRA 4G4SP 4LGCA 4R68A 4BNIA 2UUAB 2HDHA 5IEJA 2JZCA 1S96A 4GRAA 3OCZA 4IMPA 4O2AA 5EIFA 4EVIA 5M2QA 2P6PA 1MJGM 4JHXA 1QCDA 4MQ4A 3T1HB 5EXDA 3M4YA 5HTKA 4MUYA 2NU9B 3RAFC 3AI7A 5G0WA 4D9IA 2RGBA 2D8MA 3ESBA 3I32A 4ND6A 4TVBA 4ZKEA 4F06A 3ABZA 4F5WA 5A6SA 1USGA 1DI0A 3AYXB 1KKLA 4UXIA 1B1CA 2ORWA 4OXRA 1EXWA 2PV7A 2X5XA 1Z8NA 3OIUA 3KZCA 3N8KA 2YJNA 3IBSA 4MGYR 4Q12A 1I1OA 1Q0QA 1YS7A 5CR9A 4EDHA 5C1PA 5JR3A 3ZE1B 3MTIA 3C6YA 2WTAA 4FGSA 4OXQA 3KT0A 1HC7A 1II8B 4PZAA 2G6BA 2GZ2A 1SUCA 2E48A 1IVYA 3IQHX 1H2XA 2VTVA 3PC4A 3PE4A 4Q7QA 4ZFNA 1G21E 1PGJA 1JA9A 1FBTA 2QIOA 3IB6A 3ACCA 1SOAA 3G2OA 3MB5A 4YK7A 1JEQB 1GGHA 2ZI7A 1SFRA 3DF7A 2WWWA 3F71A 3TNDA 3RODA 4HQKA 1AKWA 2Q7DA 1YR9A 2J3KA 3C8ZA 3W3AD 4JYZA 1AN0A 4WCFB 2Y1OA 3BWBA 3KHTA 3OEED 1TVCA 3KO8A 1TVEA 1OLUA 4OHUA 3TTUA 5FOSA 4COOA 5CEEA 5CDUA 1T9CA 2J9GA 4EPRA 3CLHA 2ZCVA 4M9ZA 1KHHA 4B0PA 3TR5A 4JELA 1GCUA 4J0DA 2QN9A 1TADA 5FPSA 1PR9A 5KTSA 3IMCA 2WEKA 2ACWA 5TMPA 5BN3B 2IXDA 2ZJOA 5LDHA 2X4IA 4OL9A 5A71A 4GWLA 1DG1G 4C4PA 4IDBA 4FDVA 3FUXA 4B8YA 1E6LA 1Q20A 3HRKA 2GJ9A 3LTNC 4DR2B 4CEIA 5FUWA 4PYRA 4MGEA 4WN9A 2PWBA 4XCQA 4L1KA 4MR7A 4FYIA 3DZGA 3H9UA 1YJQA 3I5YA 4XB1A 4JVSB 5F12A 3QVXA 2H2DA 1OBFO 4KI7A 1ZSVA 4PZEA 4BNLA 2F8LA 2FZGA 3VPAA 2HC9A 5BWNA 5HQTA 5LMNB 1OU0A 4C20A 2ZYRA 1ADYA 2BP7B 5IT0A 1F8GA 1DZIA 3UOAB 5CK5A 4OHVA 5K6TA 4M89A 4RD6A 2NO9A 2QS9A 1QG2A 3R6LA 3FYCA 5HE9A 1DWQA 5JMWA 2AEMA 3KQSA 1FDVA 3PS9A 2C00A 2GLUA 5LLSA 1L4UA 3DMYA 4P2BA 4AZ0A 3A1DA 4R2JA 5BUQA 7ADHA 1JKIA 1ZGAA 2NVWA 3ZXYA 3U1BA 2WUVA 5EWLA 4J0EA 4BE7B 1PW5A 3DE4X 3C3MA 2IYPA 4OQZA 4DE5A 2NO1A 3OC6A 4I46A 3QXHA 1CZNA 3FSGA 2VWGA 4G5HA 2HN9A 3R3HA 4LY0A 4XWAA 3LAWA 4KPUA 4M8IA 3ZR4B 3ZG6A 3I9LA 4FDMA 1Q0UA 2QVZX 2IWRA 5I48A 1I32A 1JAHA 4UNIA 2Y05A 3IEKA 1CUAA 4QUEA 3OKAA 4HDKA 3ENKA 3L8HA 4B4WA 3O8QA 3H86A 1E1RD 1ZK4A 5AK3A 1WTCA 4TKVA 2NX2A 3AF2A 1YE3A 5GV8A 3G79A 4N3AA 1QS0B 1U2PA 3NIFB 4HAOA 2QVLA 5T8KA 5EJ2A 1W4LA 3IV9A 1ZOLA 2KE5A 3GMTA 4PCLA 2VF2A 1JILA 1WF3A 2Q3LA 4YP0A 3HUEA 3LCVB 1KGSA 1VJTA 2XF8A 3D6FA 3E1SA 2IHKA 5DXAA 2RGWA 2TMKA 3EIWA 2FZ4A 2ZANA 3KRTA 4E07A 1R15A 4HN9A 3U3DA 2C3UA 5DHPA 5J2UF 4RIIA 1NW9B 5FL7A 5JIBA 3CZPA 5I7HA 1HM5A 2QSJA 3KAPA 1YK1A 2AE1A 2R1TA 3AHCA 1JSCA 3H1AA 1KEPA 1P31A 1LX6A 3IBCA 1OW3B 1M6VA 2H4XA 2E6KA 5JI3E 1YA6A 2YVKA 1OAOA 2N47A 4CQJA 3C8DA 3QVKA 1DKUA 4PGHA 1SVUA 2GK3A 4G1MB 2ID4A 3H5VA 2I3AA 3DHNA 4US0R 5G0TA 4EY3A 1UT5A 3GFOA 2FR0A 5J59A 3KKQA 4BTVA 1JU9A 3G2QA 3AFHA 4LCBA 5IP5A 5AKGA 3MAAC 4L0DA 2X5JO 2VDVE 1ZLXA 1UKEA 1VCHA 2ZBRA 1X0VA 3Q3HA 3SR4A 1XD9A 5K0FA 3JD0A 1G64A 2X76A 4OQMA 4MUAA 5DM60 4Z2AA 2Q4BA 1I51A 1EBUA 4UHJA 1CIJA 3L7AA 4OP2A 3DTYA 3KEGA 1I4EB 4YDRA 3VH4A 2PZKA 4ADSG 4CQLA 5L6LB 1DCTA 2NVUB 4L57A 4B3TB 1U2ZA 3R9KA 1NV9A 2JGDA 3G2IA 4ZK6A 2I2XB 2VQFB 1SUPA 5M5BA 4YRFA 2PUCA 4QPDA 3HFRA 4FCCA 4HB3A 3WYNA 1QH1A 4EHKA 5HZKA 2D5LA 5JDIA 3CZRA 3H0EA 3LFTA 3P9PA 1OASA 1UT8A 3F5DA 2JGKA 5CGQB 5THQA 2VJNA 3WICA 1IMJA 3ZY6A 1H2EA 5H82A 3IV7A 4HRVA 4HDAA 4AS2A 4XCXA 2XWSA 5L9AA 1RLMA 4WZAE 2F6RA 4QOSA 3ILXA 3H3JA 3BB4A 3TUJC 4KNVA 5DYYA 5JANA 3GG2A 5KMGA