3H5LA

Crystal structure of a putative branched-chain amino acid abc transporter from silicibacter pomeroyi
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
397
structure length
397
Chain Sequence
DPVVIGCPAPLTGIVAADGIEFQRGIQMAADEINAVGGILGRPIELVFADTQSKGVDVVIQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVAVHDEMVKSDPDRYWGTFQYDPPETLYGGGFLKFLKDIEDNGEFSRPNNKIAIITGPGIYSVNIANAIRDGAGEYGYDVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFYPQDQALFMNQFMTDPTNSLVYLQYGASLAAFRDIAGDNSVGVTYATVLGTLQDEMGDAFAKAYKERYGDLSSTASGCQTYSALYAYSIAAALAGGPGAPYDDVQNKAVADRLRSLIFRGPVGTMRFHADTQSAWSYPTETNDPSLGMPHIFSQIFDKAEDGVLIAPAPYKKAGFKMPPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative branched-chain amino acid ABC transporter from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Transport protein
molecule keywords putative Branched-chain amino acid ABC transporter
total genus 154
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA01
3GV0A 2QZJA 1AB6A 4YLEA 2OQRA 1BAPA 2R47A 4LE1A 1EHCA 2VUHB 3GBVA 3HEBA 2PUEA 3MYYA 1ZH4A 2KYRA 2R25B 3N6VA 3LUCA 1H9CA 2NUBA 1JFVA 3LTEA 1DG9A 1PUXA 2A9QA 2JCGA 4F06A 1A2OA 1PNRA 4YS6A 3CLKA 4MQEB 4D6YA 5HKOA 5JNSA 1D1QA 1AB5A 3RVRA 2P9HA 4MS3A 3EULA 2CHEA 1URPA 5TPZD 3A0UA 1JL3A 3HM9A 2FKAA 2NZVG 3OLZA 4XXHA 5E3JA 4NQRA 1APBA 4Z4GA 4W5QA 4HNSA 1DBPA 2PAFA 4HNQA 1NTRA 3E3MA 3CHYA 4FE7A 4JB2A 4MR7B 3O1IC 1M5UA 1YTUA 2QVGA 2RDMA 4JA2A 4PE5B 1PEAA 1YVUA 1KRXA 3MM4A 2RJOA 4F12A 1BDIA 1MAVA 4UHJA 5DKFA 2JK1A 4FE4A 3LOPA 3EODA 1RPJA 2FN9A 3LUDA 4MR9A 3I42A 5C5EA 1EFAA 1L5YA 1D1PA 1PHRA 1QP4A 1SD5A 5EWMA 3DGFC 1W9HA 3M9WA 3C3WA 3KHTA 1Z25A 2FMFA 2MYTA 4WT7A 4H3KB 5EWMB 3T6KA 3TD9A 3T8YA 3QLTA 1L5ZA 3QLUC 1ZH2A 1ZITA 2FEKA 3EQZA 2ID7A 3KTOA 5DGCA 5IULC 1JH9A 5C5CA 1MVOA 3FFTA 3O2JA 4RSMA 1NXSA 3RVNA 4JOQA 3L49A 3RVLA 4JB0A 3RVPA 1JFTA 4N47A 2IOYA 2QR3A 4OG2A 5F64A 2WMYA 3C3MA 4P1ZA 2LBPA 5ED4A 3NNNA 1VRVA 1YK1A 2HQRA 2ZWMA 2PE5A 2I6FA 4EYKA 1U2QA 2FLWA 3TMYA 1B00A 7ABPA 4MLDA 4N0QA 4G0OA 3OM1A 4LE0A 1NATA 4YWHA 6CHYA 5JS1A 5CNIA 4HNRA 4KPYA 3JY6A 1E6KA 2LIVA 3ILYA 1VLZA 4MS1A 4PEVA 2ID9A 4MAAA 3IP5A 1UDRA 2PLNA 2PUAA 3A3KA 3LFTA 5TQ0A 2FN8A 1SRRA 3E61A 4RS3A 2YHBA 3EAFA 5JNTA 1USIA 4OLAA 1ZVVA 4L4UA 5TQJA 5JNRA 1GLGA 3EGCA 2FMIA 2VK2A 3UUGA 3KSMA 3JVIA 4MR8B 3F6PA 2L17A 4TLMB 1BDHA 2PUCA 4EVQA 3HVRA 3CRNA 1P6QA 3QEKA 2FQWA 2W42A 3HZHA 3HUUA 5IEBA 3H75A 3CKMA 3BRSA 2MYUA 4W5TA 2NT4A 1A0OA 1BDJA 2WY2D 1Z26A 3CU5A 3Q7SA 5IBQA 4WWHA 4G0QA 3TX6A 2VUIB 1SXGA 5BR1A 3A0RB 4IMIB 2FEPA 5TPZA 2YHAA 2MSWA 4P98A 4ZPJA 3T95A 1USGA 4EYGA 5BRAA 1ISRA 4LE2A 2WJAA 3B2NA 4RV5A 4ETMA 4GPAA 2PKXA 3NNSA 4G86A 1DP4A 3CG0A 3Q9SA 4Z4EA 3I5AA 4D6XA 3EJWA 4RK4A 3OM0A 4KRFA 4RY9A 5HM6A 2PUFA 4KNYA 1XWWA 4W5NA 3H6GA 1S8NA 1M2FA 1E6MA 4OLBA 3F6CA 2LPMA 3FDFA 3O75A 1ZN2A 2JVIA 2JB9A 3C3KA 3D02A 2QSJA 3LUFA 3SY8A 2F8TA 1DC7A 3NHZA 3M6MD 4WZZA 1LK0A 3Q15C 2GKGA 1QO0D 1P8AA 3L6UA 4QPJC 5DTEA 5I4CA 5KC9A 3SNKA 1JDPA 2E4UA 3GL9A 3LUGA 4NICA 5CNMA 4MS3B 4YR7A 5CHYA 1DRKA 5IEJA 5JNWA 2X7XA 3A10A 3BILA 5CNKA 1K68A 3EDCA 1ZGZA 1ZHHA 3LKBA 4ZMRA 3N8IA 1Z16A 3BREA 1JF8A 3F7NA 3O21A 1CEYA 4QYWA 3ROFA 1F51E 3S99A 5EWLB 4Q7EA 4OBBA 4MQFB 4S04A 4KK4A 3OLVA 3OMWA 1NY5A 4XFKA 2IPAB 1M5TA 4JAVC 2GI4A 4MQFA 1GUBA 4YP9A 3KYJB 3O1HB 3T38A 2FQXA 1A04A 1U2PA 1Z13A 9ABPA 4KFCA 2QW1A 3RVJA 2PMCA 3EQ2A 1D4ZA 3HK2A 3OLXA 3OO1A 1YMVA 4XAQA 1FSPA 1QQBA 3Q41A 5TQ0B 4O1IA 2R48A 1JDNA 2IKSA 4LRQA 4ETNA 1PEYA 3QK7A 4G0ZA 5IX8A 1JYFA 2DRIA 2A9RA 4F3TA 1D5WA 3QLUA 2JBAA 4LDAA 3BRQA 2QVCA 5TQ2A 2HSGA 3O1JC 2E4ZA 3IPAA 1GUDA 3RQIA 3MQ4A 5FWXB 1P6UA 2GBPA 4S05A 2LUOA 4LDZA 4YRZA 1DRJA 1EAYA 4MRMA 1DBQA 4IMJB 3Q7TA 3H5LA 3O2QB 4EGSA 2JVJA 4JP1A 4LZLA 4PYRA 4IRXA 2IPLA 3MF4A 4WXEA 1USKA 4XARA 1Y1LA 4G0MA 3LUJA 5DLEA 3O74A 4G97A 4RK1A 4Z4HA 4Z99A 2P4UA 2JRLA 2IPNA 4RK5A 4DN6A 3H6HA 2B4AA 4MYRA 2AYXA 1TLFA 3JPYA 4KV7A 3RH0A 1HEYA 1LBIA 3HO1A 3JS5A 1QPZA 1QP0A 4YGXB 1JX6A 1BVHA 3GYBA 4N41A 3N0WA 3IP7A 2JVKA 2FW0A 3RVQA 1NXTA 2BGGA 5IUNC 1ABFA 3UKJA 3HJFA 1ZDMA 5TQ2B 4B09A 3OQMA 6ABPA 3KYIB 3FGZA 4CBVA 3KG2A 1CYEA 2QXYA 3JPWA 3NHMA 3NNDA 4MLCA 2LP4Y 3H5OA 1JHZA 2H3HA 4W5OA 1WETA 2F8SA 3RVMA 1TVMA 3KS9A 1QP7A 1T34A 1RZRA 3DZDA 4DADA 5FBKA 1Z2DA 4EVSA 5FWYB 5KWSA 5IUJC 4KQCA 3OLYA 4RK0A 1QMPA 3I09A 4G0PA 1Z17A 4IF4A 3H1GA 4Z4CA 1IIBA 4OATA 4KREA 3KLNA 4W5RA 4NV3A 3TB6A 1KGSA 4KVFA 3MIZA 5B3JC 2O20A 3LKVA 2L18A 3OMXA 1DZ3A 3CG4A 2WJWA 1DC8A 4MS4B 4ZJPA 2IYNA 3I45A 4RK7A 3HV2A 3FFXA 2GX6A 3QX8A 4RKQA 3HXMA 3CS3A 5KQLA 4RWEA 2FLKA 4OTZA 3RVOA 1MB3A 1ZESA 4H3HB 1RZRD 3O2SB 4KMRA 3TO5A 2FQYA 2AYZA 3GRCA 1K66A 3KCNA 1LBHA 1MIHA 3JTEA 5KQMA 1DJMA 1U8TA 3F73A 3SAJA 4RDCA 1JBEA 5DCLA 4ML3A 5GOTA 1QO0A 1SXHA 2RGYA 1LJLA 2E4VA 4D74A 4MQEA 4RY0A 2FVYA 3URMA 4F11A 3R0JA 4N03A 1QQAA 3CNBA 2MYNA 3N75A 1RXEA 2L19A 1SXIA 3GA5A 2NT3A 1F4VA 4JASB 1KMIY 1PNTA 1ZAYA 2PUBA 3LMKA 2FMKA 1I3CA 4N0PA 4N76A 4EY3A 1ISSA 3HUTA 3H5TA 3SQNA 4G0XA 1EWTA 2MSKA 2CWDA 5EWJB 1NXPA 1BA2A 1P2FA 1U04A 2E4YA 3FFWA 4RK6A 2MYPA 4NCBA 2MSLA 2E4WA 3HSYA 2WRZA 5BRJA 1JWLA 4QICA 4Q6BA 1TJYA 2IPMA 5ABPA 3QEMB 1DCFA 1GCGA 1TM2A 4RKRA 2R4QA 2M1ZA 3CZ5A 4YV7A 5T3YA 3SM9A 3K9CA 3MMNA 5JNUA 4Q6WA 2H0AA 4WUTA 5IC5A 5FBHA 1U0SY 2FMHA 5B3JA 2VYCA 5FWXA 2XDYA 3HS3A 2RJNA 4NCAA 1YMUA 3OO0A 4E7OA 1ZGGA 4Y9TA 3KJXA 1R8JA 4FB4A 2PUDA 2HJ9A 1XHEA 3SG0A 3KLOA 1EWKA 2TMYA 5EWLA 2FEWB 2PJUA 1XHFA 3GT7A 3Q7RA 4MR9B 1ZY2A 4MRMB 3LUKA 4MS1B 4HYEA 4LX8A 2L2QA 4DQDA 3RVSA 4O1HA 3DBIA 3N53A 2QU7A 4G0YA 3NBMA 4GNRA 3K4HA 3LUAA 3N0RA 2V0NA 3QX9A 1DBWA 1EWVA 1OXBB 4L85A 5T7BA 4RXUA 1DCMA 1M2EA 1RXIA 4RY8A 3HCWA 3DLHA 1C4WA 5HSGA 3GBPA 4XASA 5TE9A 1FFGA 5KQGA 1YIOA 2ZAYA 3CTPA 1Z18A 3CFYA 4PICA 1YS7A 4MR8A 1JFSA 2JBAB 2CHFA 2FXIA 4KK3A 3HDVA 1D2AA 3QLVA 2GWRA 2CD7A 3HDGA 4EYOA 3IP9A 1GCAA 3GWGA 1JYEA 3P9YA 1Z2EA 5CNJA 2M98A 2QV0A 2IDMA 3BBLA 3H5VA 2A9PA 3OLWA 3UK0A 2PL9A 3JVDA 4Z0NA 3CZCA 2A9OA 4Z4IA 1NXOA 2HPHA 4IILA 2FTKE 4IGAA 4YCSA 4E7PA 4EUKA 4TMYA 4TLLB 3D8UA 2HQBA 5KC8A 1W25A 5FWYA 4MGEA 1C0EA 3RVKA 4ZYLA 3IDOA 2PUGA 5KI6A 1E2BA 1MB0A 4RXTA 3ROTA 3DGEC 3H5WA 5TPWA 1JLKA 3ILHA 1NXVA 2J48A 4M88A 5GQSA 3G85A 5IUKC 1Z15A 1ABEA 1YS6A 1FQWA 2WWVD 3DLBA 5TPWB 1FFSA 4YO7A 1VPWA 4H60A 4MS4A 1FFWA 3MA0A 3VNAA 4Z4FA 2WB4A 1RNLA 3C97A 3LUHA 4RZSA 2Q5CA 4UHKA 4EYQA 2HQOA 1LJUA 2FSPA 1DCKA 3H5IA 3H1FA 3C6QA 4XLTA 5JS2A 3QEMA 2N9UA 5D2CA 3N0XA 5JNVA 3H1EA 1CHNA 1Z12A 1NXXA 1J56A 4KQ9A 4QYMA 3G1WA 4Z9BA 1KRWA 3KKEA 2PL1A 3OQOA 3IP6A 1QKKA 1VKRA 5HQJA 5PNTA 1OXKB 5KQPA 3W9SA 4WXMA 4EVRA 1QNLA 1YK0A 1TMYA 1NXWA 4ZMSA 4KZKA 4O5AA 4TN5A 5BQ3A 1E6LA 4PZ0A 2B1JA 3QELB 3M9XA 4ETIA 4RXMA 4MPTA 4Z9AA 4MR7A 3QLVC 3QELA 4RU1A 3VNBA 3IPCA 2E4XA 8ABPA 3OQNA 5EWJA 4F8JA 3FMVA 2NZUG 2OENG
chains in the Genus database with same CATH superfamily
4RTKA 1T5HX 2EBHX 5KOJB 1E96A 2AUTA 4AKTA 1CUVA 3KYDA 5DYIA 3KSUA 1TZBA 1H2FA 1QV6A 1RZVA 2C2ZA 1UKVY 4ISCA 4JLNA 2JGMA 5AKJA 2RAUA 5A4JA 1AUXA 4D8TA 3KFXA 2DBYA 4ZZ3A 3NR2A 4G65A 1V37A 3WRYC 4YT8A 4EPVA 1SKMA 5ALDA 3JSAA 1A9OA 2GPAA 2BFOA 2NUTB 1NAIA 2Y1KA 3A1CA 3QTLA 3SFTA 3IT0A 1WE2A 3NEJA 2QF7A 2FEOA 13PKA 2WYUA 1NLMA 1BMFA 2A4MA 2HADA 3CGGA 1OFIA 3F67A 1Z34A 1GUYA 1PJ2A 3DS8A 2JF0A 5FBZA 3SICE 4D4IA 2J5XA 3H83A 3OLZA 4EENA 3CUKA 2CJYA 3QG1A 1M7HA 1HFJA 1WTCA 3ECCA 3EG5A 4LYGA 5FBLB 4Z4GA 4WEQA 2OBYA 3R0ZA 4HNQA 1NTRA 3H9CA 1PL8A 2EQBA 5CG2A 1MPXA 2E49A 1PTJC 5F1YA 5BORA 1A96A 2XMRA 2DZDA 2VQDA 4AULA 4JJIA 1XRPA 3M4NA 4IIYA 4OXYA 3TZKA 1I94B 1QGAA 3OD1A 2FMTA 2EW8A 3F8TA 3L79A 3DSRA 1N3BA 5JBIA 2QV7A 2V4ZA 1WW3A 2APJA 5L53A 2R6HA 2X4DA 1OXUA 5IZCC 4WFKA 2ODQA 1WOYA 1I4TD 3ZGZA 4YJKA 4LF8B 5IVPA 2NXJA 2PZEA 1VPEA 3A06A 1ECBA 3BAFA 1W85A 1WHTA 3AR2A 3U17A 3PR2B 1GKUB 1OWOA 1PNOA 2BDTA 2PTGA 3BGWA 1Z2OX 1FUUA 3D7NA 4P83A 5D3MA 3WNBA 1JVBA 1G4AE 1HQCA 4YFYA 1TF5A 2GN2A 3E70C 5LWHA 4OG2A 3RI3A 1A5TA 1TAHA 3KOXA 1VE7A 4EQ6B 3R6WA 3ITDA 2VHWA 2NU9B 2POQX 3VBCA 1FVOA 1U2QA 1P18A 2JJ1A 1B00A 3MW8A 4N49A 2WV9A 3G7NA 4LY0A 4MLDA 1W5TA 4XJVA 2YN0A 3AM1A 3V55A 4MYDA 2GZDA 1XD2A 1DBRA 3TVTA 4ZV7A 3DONA 5LLSA 3ZHTA 5HJ5A 1TRHA 2ERYA 1VLZA 1QCZA 1X8XA 2Q99A 2QD2A 3IP5A 3SZOA 3DV2A 2OV2A 1MW8X 4R2WA 3KZ1E 4A9AA 4J0GA 4KAAA 4QBHA 3AJRA 5IDQA 3ZJVA 1N1DA 1R16A 1SB8A 4NG4A 2WKSA 3KD2A 1VCHA 3IQXA 5TJ9A 1D0VA 4BASA 3H11A 1T0UA 5P21A 2ZG6A 4W9NC 1C30A 3JVIA 1W4CA 3O4HA 3G79A 4X8MA 2WQ6A 4EVQA 1FFXB 1JU3A 1SQGA 4MKIA 5ENZA 4AQYB 4WI1A 5NULA 4D9CA 3OJFA 4N7RA 2ATEA 4O4HA 4CUZA 3V2GA 2JKYA 3B2EA 2OXEA 5A3JA 3Q3VA 4KLNA 2R6JA 3O8DA 4LZOA 1E2JA 1Y3IA 2YXDA 3UAZA 1CYDA 4C0LA 3A0RB 1ST3A 4DT1A 4EY6A 4BYMA 1U0RA 2FN7A 4FYKA 2YHAA 2OZKA 2C3MA 4MUJA 3NIFB 5FP0A 4I5FA 3B12A 1YACA 2GD2A 4PHGA 3PLAE 3FTPA 1UBMS 4GGOA 1TAQA 1UC4B 1MVLA 2YMMA 1WLYA 2J31A 1ZMBA 4MVJH 4B84A 1J2YA 2P4EA 3WADA 4GEGA 1R0ZA 3GLHE 3NTXA 1IHXA 4HWTA 5BQ5A 5KNBA 4WK0B 4ARVA 3H8SA 5JCOC 1J25A 1CUXA 4UZFA 4EAQA 1PW7A 1OXVA 2CMHA 3C5VA 1IJFA 1RCTE 2WI8A 1O6BA 3GRRA 3DZBA 2Q7DA 1LKZA 4IS3A 4YMUA 1BW9A 3U9LA 1GN8A 5BYJA 4YGYA 3RS8A 1NDQA 3LT0A 4QODA 3QKSB 5D51S 3KZKA 1IULA 2J33A 2BFNA 2PU5A 3ZHOA 3QZUA 3KJQA 5YASA 4F3YA 4MWZA 1XTSA 3VR4H 3W1VA 4H2DA 4K9QA 4MRVA 2WAMA 2G82A 1YUNA 2HMYB 3ZHVA 4FDMA 1O1YA 4YR7A 4KB5A 1B8VA 3N2GA 3BF7A 4I50A 1Y7HA 3GFFA 4UXIA 2X7XA 5DASA 1KVUA 4KYVA 4OXXA 3ZCUA 1VMDA 4YJGB 3UMGA 4ZMRA 3I5UA 2P41A 2ECOA 1TQHA 2X0NA 3G8BA 4HI0E 4EELA 1CEYA 2R1ZA 1F51E 3W5HA 4IIDA 3NOXA 4FFRA 2GXAA 5HFJA 3OMWA 1QHIA 2RC5A 4H4DA 1KEPA 4HDOB 1G18A 3MAGA 4NRDA 2ZKIA 5A3SA 3NLLA 4MMZB 1LW6E 4DUYB 4PR0A 3T38A 1I2BA 5KHLB 2QD5A 4NZNA 5LPNA 1QS0B 5EHNA 4FFLA 2QW1A 3AR9A 2NO6A 4MLPA 4X8HA 3BD6A 1L7MA 1WU8A 4EHAA 1T4BA 1TLTA 3I2JA 4CKCB 2O3JA 1ILWA 1YFKA 1QQBA 2MDTA 2Q28A 2QSUA 3VZDA 3WSVA 1PQYA 4NOJA 1N3YA 2OBMA 3AW9A 1VLQA 1H42A 3JRNA 1MO4A 1OILA 1P17A 4W6QA 3P71T 2P6UA 3R3YA 3VYVA 5M5BA 4CR8A 2BEUB 1YBVA 1FS6A 2ACVA 4RA9A 1A8IA 2BL4A 3IIKA 4Z51A 1BHQ1 3ZZTA 1OBOA 4B6PA 2J8ZA 2QVCA 1NNLA 1XROA 1Y34E 2FSGA 2VWGA 2XNDA 2QL9A 2VTKA 2ZSJA 3DUFA 3QENA 4WNCA 3WZ2A 1OJ7A 4BTVA 4PN3A 4HC4A 1E2IA 5H68A 4YV0A 1I33A 3JW8A 4CM1A 3SR4A 1HEIA 4LDZA 4LZJA 4MVXA 1DRJA 4ND8A 1NQVA 2Z2KA 3PGMA 4YC7A 4GU5A 2W2LA 3Q7TA 3HE3A 5B57C 1KQGA 3HBLA 3ENQA 3AFOA 1P7YA 3D31A 3JVVA 3INTA 2IPLA 1FSFA 1XZDA 5GTDA 1JE0A 3OPNA 3NHUA 4EW1A 3GFTA 3S2EA 1UJNA 3NJ8A 5FBWB 1NWCA 3DTVA 3EXEA 3VU3A 4QFMA 4CF3A 3DEKA 4DRXB 2B4AA 1JBQA 1MEJA 3HCFA 3CV3A 2H7VA 4JJKA 4PGGA 1KA9H 2QN2A 4MB6A 4MPRA 2GT1A 4P35A 2FPGB 1I3OA 2WE7A 5DNWA 1W46A 4AG5A 4AMYA 1TZCA 4XTCS 2PGJA 5C1PA 2ADOA 5IS2A 3VO1A 1QP0A 4ZN6A 1G21E 2CLHB 1FP4B 3JWHA 3N0WA 1NVWQ 4W9RA 1E66A 4K5QA 4LG1A 1YR2A 2H29A 1V7QA 1KJYA 4FCCA 2NU8B 2Q0HA 1M73E 5DISB 2H1VA 3FGZA 2P68A 4H7FA 4UBOA 1ONNA 2O7SA 2GTIA 1JEYA 1Y0BA 4UNRA 3JPWA 4IDFA 4JBLA 2XUIA 4BMPB 3HA7A 1EE9A 1CR1A 1R88A 1QP7A 4QOHA 4K6OA 5J9FA 2I99A 2P79A 2GBLC 2OHIA 3GT3A 5FWYB 3IXQA 1IQRA 1R2QA 4Y2YA 2BUBA 4OHBA 4U7WA 2O52A 3T7RA 1MJHA 3RV4A 3GPIA 2IYAA 3FWYA 1QGDA 4QAJA 3KLNA 2QYHA 5JAIA 1PK8A 4MITA 4J9VA 1JVSA 1NKVA 2VJMA 1QHHA 2VYQA 3TI9A 4LGMA 1ECFA 3BHMA 1PCXA 2OOKA 3A25A 2WOOA 3AJ8A 4YRJA 4WXYB 1DPGA 1GQFA 1TT7A 4KRYA 1IBRA 1NR1A 3VC1A 4CI0B 2BD0A 1JP7A 3PVCA 3GO4A 3GLHA 4RIHA 1L7QA 4RWEA 1JHOA 2B35A 4RF3A 1SVWA 2YJTD 4Q3OA 4EX6A 5L3QA 4GSLA 4PGFA 4KMRA 2BTEA 2P11A 1ZGAA 1FOEB 1BE1A 1VI5A 2YJGA 3BM5A 3EWAA 4PSAA 4B8YA 2HTFA 2VPPA 1KO4A 3OZEA 4ZOLF 3LHDA 4YRPA 1EVYA 1TZMA 2ERCA 3DL7A 4JUFA 5A7GA 4I55B 4O59O 1D9ZA 3DXFA 1QO0A 3U5TA 2JD0A 2H16A 3D6FA 3M4XA 4HY3A 4MTCA 3ILVA 4D74A 5CB6A 2PY6A 4HEQA 4R5HA 5HBRA 4ENPA 5LLDA 2ORWA 1XO1A 2HFKA 1R64A 3OSZA 1M54A 5EZSA 1UBRS 3MBOA 3GA5A 5FL7D 1ISFA 4RVGA 1JG6A 2IS4A 5ANRB 3RR2A 2Y6VA 3RNLA 1FP6A 4G2NA 1QYDA 2IT1A 4BP9A 5JJIA 4H18A 5B64A 3FI9A 3MELA 5C7OO 3KQMA 1EWTA 2C61A 3AILA 5JSKA 4CM4A 3CSUA 3N7AA 1CRQA 1NG1A 1P2FA 4ND7A 4P5DA 3MJDA 1YSCA 3JWEA 4BNHA 2FUCA 3GVHA 1Z33A 2ZVPX 4M1KA 2BE7A 3GPLA 5KB3A 1WD5A 1VG1A 2JBHA 2XTAA 3CW9A 1XVLA 1R8SA 5KNBD 2YIVX 3HJBA 5KOJA 5AI9A 2YWGA 3MT9A 4OQEA 1RD4A 4HATA 2FU5C 4RD0A 4DR1B 2WIGA 3K53A 4HAIA 4D4MA 2R5FA 1WXQA 1PJLA 1D03A 5GM2A 1EZZA 2X14A 1GPH1 1KQOA 4XSVA 4MINA 2F4VB 1UPBA 5ELLA 4C06A 1KYTA 1IUKA 3O7MA 4HRYA 4LGCA 2PUDA 2HCTA 3ULKA 5JCOA 5AVYA 3QVLA 1PYOA 3U44A 3QVTA 3KWFA 4HP8A 5EWLA 1USWA 4LOKA 1AGYA 4O63O 1D0SA 3Q7RA 5K8UA 2XTJA 3HEAA 3RBZA 1JR2A 3GGSA 1Q74A 4AJKA 1GTL1 1M1XB 1SVSA 2WSSD 2OGZA 5JPCA 4XIJA 5FBRB 3H87A 2Q5LA 5ITZA 3EGIA 2PSFA 3GMIA 2UVPA 1NOIA 1C4WA 2HSWA 3NETA 3BCRA 1Z62A 4FMBB 4INZA 3UJ9A 3AM4A 3NDPA 4TSFA 2C0PA 2CBZA 3SBXA 2DLDA 2R7NA 4DV2B 3NTVA 4MVYA 4H1HA 3RLIA 2ODTX 4K03A 3ZOKA 4PZ9A 3QMMA 3UWOA 2CD7A 4E2YA 4I4TA 3COVA 2AOUB 3NZEA 4ZQCB 1I3LA 1H0SA 2VPZA 1SIOA 4K9NA 1W73A 4S2EA 3M4ZA 4Q37A 5AKGA 2HPVA 2C42A 2I2AA 2W90A 4HX9A 3RBXA 1JHRA 4FMDF 4V0NA 1J0BA 5FL7A 1JEYB 4AJLA 1FRQA 4B7AA 2FAXA 4IILA 1DRWA 2XB4A 4EG5A 5FLXA 3L07A 4GXRA 4EUKA 3CE6A 1ZXXA 2YXNA 3V1KA 5DMHA 1S4QA 1D2RA 4D4JA 1L4YA 2FY8A 2QUIA 4F9GA 4RD3A 2QPLA 2YFYA 3A4IA 1MGPA 1TZKA 2OCIA 2ES4A 3QVSA 4GPIB 4KFSA 4QRHA 3DWGA 1NF9A 2ZXUA 1SKUA 1S2MA 1N5RA 1VZ2A 2PCLA 3GJZA 1VA4A 3IQGX 3K1ZA 1XQ9A 1AGNA 3PFNA 4YIKA 1MQ9A 2PYIA 2E0IA 1L5QA 1W19A 2HHLA 4Z8XA 5GONA 4JLBA 2D7DA 4D2IA 4I4LA 3E8MA 2QJOA 3PXDA 3NT5A 3B3AA 1BXRB 4M7OA 3U1TA 2DTEA 3O82A 2H9AA 1Z8HA 1BYIA 2EFJA 2YICA 2WWHA 1T2DA 4JSYA 5KOHB 3FHJA 1TVCA 2QGFA 4M53A 4Q01A 2BE9A 4M8KA 1RM0A 2O2GA 2X5KO 1EFVB 1US8A 3LUHA 1BOFA 3SYRA 1CS0A 2FW1A 2OG2A 1DLIA 4W8GA 5L3ZA 3ICCA 2VXOA 4BNJA 1P4HA 5JTUA 3QEMA 1E60A 2HGSA 5F7ZA 1EP3B 5NLLA 1IM2A 3U3XA 2A33A 4C7KA 5A5GA 4GRIA 1T9HA 2AJBA 5JS8A 5HA5A 4XSGA 2WVAA 4ZVRA 1SXJA 2YV5A 3MCUA 4IDQA 4KX5A 2UYOA 5MFPA 2R2GA 1I2ZA 2PSJA 1EDDA 4RFSA 3OZVA 5BSWA 4BKOA 1U5BB 2Y71A 2EFEB 3OPMA 3DDZX 4QLBA 5FV4A 4X66B 1QF6A 4E33A 4WBXC 1P0CA 1W1UA 3NFYA 5EUBA 4MVJM 5BW5A 5JBQA 1POXA 3ZQJA 2IEDA 5JUWA 4F2HA 3OIUA 2PH1A 4QXMA 2N47A 3QLVC 2P2ZA 4ZO8A 4JC4A 4ZVKA 2FH5B 2GPNA 1H2EA 1NW8A 3CNQS 3KP1A 3PJGA 4KQ2A 3KTAB 4AX8A 4E2XA 5JJLA 4UTVA 3TMAA 2CNWA 1LJ8A 1JN0A 2EL9A 1PR4A 4U7PB 1O95C 4E32A 5TVKA 4EF4A 4I1UA 5C3MA 2AOWA 1AS2A 3H4MA 3DXXA 2WJYA 2QRZA 3K8YA 3ZX4A 1H94A 3OX4A 2V7EA 3DFFA 1OFUA 1AC5A 4OQFA 1PZNA 1YQXA 3BAZA 2P77A 4YYEA 3PXGA 4LMAA 1JA1A 3PHJA 3UXYA 3H0KA 3GRPA 3VZSA 3VISA 3G2MA 4P4SB 5IAEA 2FUNB 4HGPA 4XJXA 3W4JA 2QW8A 4TYPA 1EU1A 1N0UA 3OMLA 1JAIA 4RCZA 3OBBA 3DD1A 5TPZD 1JXQA 1Z88A 2FDRA 3K09C 4B6QA 3QFRA 3R09A 4EG4A 5MN5A 3ZDFA 2Q4EA 3HH8A 2KLBA 1M7GA 3KE8A 3ROPA 3TTSA 4XEUA 2YZKA 4NQRA 3SZRA 4KR9A 2O3RA 4NZMA 3LX5A 3O38A 4X90A 4QM7A 1KBQA 2LD4A 4B3HA 2XA2A 4C1BA 4D42A 5LSAA 1NW3A 3DFUA 5GVRA 2WZDA 2I71A 2OKGA 3P4XA 3U7QB 4YRMA 4ER7A 4HJXA 3O0DA 3PQEA 1EP1B 2G6TA 3QEBZ 1MTOA 4C04A 4ID3A 2XGOA 3BL5A 2WTXA 5FWNA 3FM9A 3U7JA 2XQFA 3ISJA 4X00A 3U19A 1TO2E 4BS9A 4LYEA 4UE6A 1ML3A 4RD1A 4Q9LA 2BSAA 4UM9D 1BE0A 3KTOA 2EHJA 2ZI6A 3DM9B 1ZBDA 4DLTA 5AVXA 1ENOA 3IODA 1ZUHA 4LK3A 3RVNA 2CYAA 3TL6A 3WB0A 3DE3X 2Z4SA 3MTJA 2HK7A 3OZ7A 5HF9A 3KKLA 2QE7A 2R0QC 3D6HA 1KF0A 1NLUA 2OFXA 2ZIEA 3C3MA 4B0OA 1LNZA 1T5DX 1C9KA 4ZA2A 3AG6A 3P8ZA 1G38A 4E22A 5JQGA 2I8CA 3KWLA 4QX6A 5F7OA 3F5QA 4BFYA 4M9CA 5AR1A 4DIDA 4HQ6A 2GPTA 4LE0A 1T35A 4Y7DA 2QRVA 1TGVA 2ZE8A 4ZDWA 4MNTA 4Q24A 1OAOC 4I55F 4UFOA 5K3CA 3VNQA 2PKQP 3JY6A 1KAEA 2PIAA 1DI0A 4KMOA 5IJZA 5IM4F 1DB3A 1WHSB 2Z3WA 3ORHA 5GMOA 3U49A 3NP7A 1L5KA 3BCHA 1QK4A 3TSAA 4EL0A 2A78A 2PGAA 4ZP1A 5SY4A 4D8VA 5CAEB 4BNDB 1JLHA 1NPDA 3ZEIA 4DXDA 4C0SA 4E51A 4IXWA 3LWBA 2J9RA 3TDNA 3TZ6A 1JA9A 3ZJ5A 1P2GA 4BGDA 4AURA 3VTAA 2NVUB 3OUZA 3AVPA 3NHKA 3B3GA 4HJRA 4HL6A 4O4JF 1TEHA 3RPEA 3RYHA 5KMGA 4DNXA 1LI7A 1RZ3A 3AINA 2NT4A 1I7LA 1N32B 1AO3A 1QNFA 1G7SA 3BIWA 1O97D 1W76A 3TLAA 5T6MA 4C08A 4P92A 5D3KA 4QPZA 1NM5A 4ZJUA 2WZBA 3CR7A 3REQB 1GCOA 4MQUA 1AIPA 4J91A 4YI5A 3WWYA 1Q19A 5TPZA 4CM6A 1F5SA 5ECDA 3GGCA 3DE7X 3UT5A 4KKXB 3WKDA 3HPQA 4U2BA 3NT2A 3S8YA 3T5AA 1XLWA 2I80A 3O26A 3W7AA 4DQLA 1XDUA 3I1JA 4RV5A 2I8AA 2XTNA 3I0NA 5MFZA 1ZD2P 3O4GA 1D4OA 1DIBA 4DCGA 3NNSA 4L76A 4ENQA 4UPVA 4BJ3A 1M6EX 2COUA 3RV3A 1N2HA 1C7EA 4B3DA 2FLVA 2YJ5A 1K9VF 4UOEA 3W6PA 2ZRDA 3MFYA 3BMCB 1XZCA 3UYLA 4U8GA 2PUFA 2ZT8A 1J8QA 4IFBA 4KO1S 5CXSA 1EWRA 1TPZA 2HHAA 4AK9A 5HF8A 3TIVA 5LQCA 4YAJA 3I92A 4LJYA 3O75A 2WMOB 2PZAA 5HCIA 3LX8A 2EW2A 4DMUB 3DKVA 4DEXA 4BECA 4KPGA 4NU8X 4OU4A 4YJDA 5IW8A 2ZIXA 4V3CA 5TNXA 2J9FB 1A7UA 4YRCA 1JDPA 5CNMA 3MXOA 1J5XA 1HR0B 3BTVA 3F9CA 3AHIA 1TCUA 1ZBQA 1RWXA 2EL7A 4ZV9A 2LKCA 4YREA 1VHDA 1I1NA 2P9CA 3QOXA 3REOA 3AP3A 3TSYA 1ZGZA 4IJKA 4JNKA 3MQ2A 5B1IA 3EASA 1YRLA 3WKCA 3WLNA 3FAKA 4CFSA 3RSGA 4QU0A 3R6DA 3AHEA 1R0KA 2DFVA 3TLMA 2VOJA 3FZQA 3MK31 3OLVA 2D0OB 2WEKA 5GVSA 4S04A 3BICA 4P2BA 3W5VA 4IVQA 1DFHA 1YA6A 3KUCA 2OP0A 3F6EX 2GERA 4MQFA 1NUPA 3AFHA 4IJ5A 4XDGA 1L1QA 1N2CB 3AXSA 3GJ8A 3H3FA 1DBIA 3W2TA 3LBIA 5DX1A 1HFEL 1M3SA 3WG9A 2AF4C 2UUPA 5BWCA 3HK2A 3OKCA 3EQ2A 1Y7LA 5GZ6A 3PNKA 4NJMA 5J23A 4GPTA 4DLKA 1XB2A 3B9QA 1ZL0A 4RH1A 4ENSA 1UADA 2H0RA 3ITNA 3KO8A 2QU8A 4GD3Q 4Q9NA 2QKYA 2WYOA 1HQDA 1NI4B 1IXSB 3MTDA 4OBWA 4R01A 4MK4A 4PAMA 5ES3A 1VBMA 1JYFA 1OD6A 3BWXA 5IBCA 4B4WA 5HHTA 3HB0A 3U3KA 3C3DA 1CV2A 3N8KA 5DGTA 1I51A 4FNMA 1SUAA 1SQ6A 2VF7A 2E4ZA 1JFFA 1KC1A 2AF3C 1B6GA 2H2GA 5KTTA 1UWKA 2AOUA 4PM4A 1YO6A 5FOXA 2B20A 3VTFA 5FWXB 3G6WA 1GTSA 1JAXA 1L0BA 4PLHA 4BVHA 5FNVB 3UC5A 5CA0B 3TJZA 1HQYE 3R8FA 4FC7A 4IMJB 1JR6A 2NPFA 4QU5A 3E9DA 3VH1A 1NULA 2JH3A 3FX2A 4QUIA 3PEYA 1JQEA 1RFGE 5EIWA 4Q7MB 3WMWA 4R51A 1C3OA 4PQFA 2UXDB 1BSVA 1B41A 3ZWBA 4QUJA 3O74A 1WQ3A 4K6GA 4WECA 1CUGA 1KZYC 2CDNA 2VYND 1M2VB 3ZJYA 2WINI 1GEGA 2OV8A 2PGLA 5BQXA 1ZAKA 1F9AA 4KV7A 2V9CA 4LFCB 2YZ7A 1H22A 3IEVA 1P0FA 2B8EA 5L95A 4KBFA 4EM6A 1O6GA 3A9VA 2I2BA 1KS9A 2POCA 1EE2A 1G41A 4J0KA 1HX7A 1Q0LA 2X1MA 3IPXA 4BZPA 4KEAA 4PNHA 2XRFA 3LXRA 2EDAA 3NYWA 4V2UA 3R7AA 4KN9S 4C4AA 1TM5E 2AK3A 4LS3A 3HSKA 2WJ6A 5LFAA 3OQMA 1E2NA 4KXYA 4DEVA 3C3YA 3UENA 4EG7A 1A5SB 1AT1A 2ACWA 2E21A 2UYGA 1YRYE 3BS4A 2OYCA 4D8UA 2XGSA 2M32A 4HWGA 2KS6A 3SHQA 1ONBA 4JK3A 1E2UA 3WXMA 4EKGA 3VVLA 4XX0A 3DMTA 3ETHA 3F6YA 4M0PA 5ICEA 2HV9A 1DVRA 4LHYA 4YMVA 1HTTA 1HA3A 1C9YA 2P9EA 4Q05A 4QUDA 4BGEA 1ZI8A 1AOXA 1P5HA 3QKWA 5EJ6A 3BZWA 2A5DA 1SCDA 1XLVA 3OLYA 1R4MB 3GHHA 3R1IA 4MDYA 5IFLA 1E79D 2ZLBA 2FEXA 2NW6A 3T3IA 4OATA 3ICOA 1PG5A 1CUHA 4NV3A 3MFQA 2GA8A 2VK4A 4O1MA 3WIOA 2CGEA 3RAPR 4AO6A 2G9UA 2R00A 5B3JC 1X3LA 2E5LB 3LKVA 2PSSA 2D2IA 1F1JA 3TK1A 2NOAA 3OPYA 3JQPA 4HQFA 1CW2B 1SXJC 4BU0A 4CWAA 3W9YA 1UP7A 2GZHA 5E6SB 3W8RA 5KQRA 1KE2A 1WUIS 1UPXA 3BZUA 3IQEA 1R5BA 3M9LA 3H11B 5CH5A 3UMYA 2XMGA 4RAQA 3UA3A 3PFBA 4RESA 1RJ9A 2XWJI 3PE3A 1DUVG 2PIDA 5DOZA 1ZESA 3UCFA 4B3FX 1F12A 3N87A 1ZINA 3FPSA 1YHNA 3NGXA 1MR3F 4A73A 1KI4A 2OV3A 3VYRB 1JZQA 1YJXA 1O5IA 2ISQA 5T64A 2KLHA 4BGVA 1AX9A 1WBDA 1II8A 1T2NA 4G23A 4BY9E 3UCXA 1LFAA 3SMQA 2ZWVA 4PTZA 4HCJA 2O3UA 2W2KB 4NSNA 4KDFA 3JATA 2BKVA 1XVUA 2XKAA 4U5XA 3KE9A 2IIVA 1SVIA 4LJKA 4QECA 2ISCA 1L6IA 4GL4A 3EZ7A 1G3UA 4HQOA 3S2SA 4H31A 4IKOA 1F2DA 2GJ9A 5E6UA 2QTRA 1FFCA 5B30A 1PS9A 4M0DA 1PNTA 4OGFA 3MJVA 4QEZA 1OC2A 4YK7A 1TF2A 2X77A 4N0PA 3EVFA 4F0JA 4KXQA 4TWRA 5A0FA 3DAFA 4Q3LA 2W98A 1CZRA 1WZIA 3L4JA 2FI1A 5EUMA 2UZ1B 3VC2A 4EMUA 4DV5B 1A9XB 1NXPA 1BA2A 3A6KA 4GOKA 5BN5B 3PR3A 3TW8A 1A4IA 1CZUA 1G63A 3LQFA 2IEAA 4RK6A 3OOJA 5FI3A 1B3RA 4ZXPA 4X61A 4EHHA 3TE7A 1RXUA 2VIIA 4QXPA 3COZA 4LHEA 4LBVA 4RW0A 2GEKA 5K0NA 1DEAA 1OA1A 1QGUB 2HCBA 3QU9A 4MWOA 4X41A 4YV7A 5JATA 2BZ0A 5EXSA 1X80A 1PP4A 3K9CA 4WLFA 4D9BA 4JBWA 4F93B 5HNKA 3MZ0A 2H0AA 1T9BA 1ZPDA 3E03A 2PWYA 1KMQA 4NDZA 5IAOA 5FBHA 2Q21A 3H3XA 1KBOA 3R3VA 4MP8A 3RFVA 5BUCA 3BCUA 1J33A 2GN9A 2XDYA 3ID6C 4IMRA 3MS4A 5C51B 2W8ZA 2GAOA 4E7OA 1SK8A 2DBZA 3FWPA 3KJXA 2EJCA 2YY6A 1HDZA 3KZMA 3ROKA 5EQDA 1RTTA 2C9CA 4PS0A 4Y1GA 1LF5A 4MKGA 1U8AA 3KQUA 1MABB 2OCBA 4N12A 4R3UC 4UMDA 1MU0A 2WICA 4FNOA 5DBIA 4XVRA 3H65A 3ZY5A 5JQGF 4RVHA 1JEQB 4MO2A 3OVMA 1TIPA 3OIFA 3JAMA 3RVSA 4ZRDA 1RHQA 3NBMA 3HY4A 4AO8A 3ANMA 3LFUA 1XZMA 2AX4A 2FPKA 1XTVA 2V0NA 2XUJA 3D3JA 1QTIA 1UM9B 1U90A 1WVGA 3CLVA 2RBGA 4L85A 4XJSA 2I9KA 1H2AS 2O6LA 4YR9A 1BXGA 2PL3A 5DF1A 4EWLA 4B46A 1FMFA 5HRAA 2IELA 4ZYUA 2FSSA 4X3PA 1RLUA 4BLUA 3TQFA 4B7UA 4OP3A 1V48A 4GNKA 1YIOA 4OQLA 3T4XA 3Q8LA 5JQWA 1CP2A 1YCFA 1YS7A 3QUCA 1MC1A 3FHCB 1YZHA 2C83A 3JZAA 1SCAA 3CBGA 3E0QA 1RWVA 4OJKA 4JUBA 1XZIA 1Z22A 1U2DC 2F1HA 3PTZA 3DUFB 1IQUA 1GA6A 1B8OA 3AVXA 3MEQA 4N3GA 1WMFA 3PUYA 3V2HA 2ZE6A 3AEUA 4JODA 3UY4A 4AN0A 2CSUA 1CJKC 3PYXA 5FKJA 2ZYAA 4P54A 2GN6A 1VJCA 1EKXA 5JCZA 5SZJA 1ZM7A 5FB3A 3ELBA 2BRUC 3PQ4A 4GVXA 3AH8A 4HAYA 3TVYA 3H19A 1J0DA 3UMCA 4DIMA 5K6TA 2O1EA 2ZJ1A 1N2XA 2X0RA 1YF3A 4YBZA 3VOTA 3BJRA 4BNLA 3BIXA 3FNQA 2VTEA 4QWMA 4NU0A 3UKDA 4DRXA 5I7SA 4L0MA 2I3AA 2LCIA 3HA3A 1EVKA 1M2OA 2MU1A 2PV0A 1NXVA 2XMPA 1NN3A 2Q6OA 3CUVA 3R23A 3W7VA 2ZUSA 4AFNA 1M67A 2FFQA 5AKZA 3UQZA 3CF4G 3TL3A 1PR3A 2AB0A 3JWPA 4KYUA 3ANSA 3O8QB 1FFSA 3CN9A 5TPWB 3IXLA 1V47A 2VR1A 3UATA 4WN3A 3USZA 1J5PA 2PGIA 1N2IA 4OF4A 1A4UA 1HL7A 2P67A 1ZR4A 4Z4FA 1SC9A 3LWDA 3HCBA 5ERYA 2C5HA 3WB9A 1EK0A 221PA 1CE8A 1RKUA 2C9ZA 2WDPA 4D98A 4C7JA 1YVPA 2FSPA 2HDNB 3EVDA 1C29B 3GJYA 1PFVA 4IIFA 1NVVQ 3PWTA 4H3VA 1HTWA 1JEDA 1MA3A 2HZBA 9MHTA 4C5CA 1C5KA 1JLLB 2W71A 4UEQA 1QJ4A 2F1JA 2DUJA 3UMMA 1NKSA 2O8FA 4IJUA 1AQNA 3I12A 4MMXB 5B7QA 2QT0A 3EEYA 3SLRA 2IYOA 4OX9B 3BQNB 5E9WA 3PEFA 3W9SA 4ND8B 4D25A 1DEHA 2W48A 2CHUA 1NN0A 2CXSA 2GBCA 1CUBA 2I7TA 2VTDA 2FG6C 3OCUA 2JFPA 4G5GA 1E6LA 2DYKA 2OGUA 1M0TA 2BCJQ 3FW1A 4HWKA 4CNQA 2OORA 3G5LA 1P19A 5CIQA 1RYDA 4MR7A 1XRMA 2XWBF 3UKOA 3MMXA 3B20A 1PF7E 4KUEA 4ZQBA 3LT5A 3VBEA 2KBEA 5JT1A 3B8EA 3FMVA 4ND3A 3W8FA 1AB6A 4XOIA 1AHNA 2IY9A 2OVFA 4U2EA 5TARA 4CKBA 4IJQA 5ENVA 2VUHB 2PUEA 4WCFB 4IP0A 3GNSA 2F8MA 1G7RA 1JIXA 4W4TA 1UQRA 5EZ5A 2XDWA 1P44A 4JL6A 4WZBB 1Y33E 1WXHA 2GYWA 2TRSB 2JIQA 4B45A 1LDYA 3EFOB 4I50F 5E95A 3SZ3A 1KQFA 2J9ZB 3H16A 3KWMA 3PIRA 4MQEB 4JOCA 5JNSA 4XDZA 1DGQA 1Y3DE 3PRJA 4QD3A 5LQNA 3MWDA 3GCGA 5JD5A 1I6MA 2PZGA 1RI1A 3UZUA 2GDJA 1Q92A 3FLEA 5EIOA 3OUUA 3Q10A 3GEDA 1ULAA 5I5GA 4MKZA 1C0IA 1JIKA 3HM9A 1J9ZA 1U2RA 5JI2E 2O8EA 2P9TA 1EVEA 1MENA 3NAMA 3K32A 2BN4A 3M3PA 3OJEA 4UEJA 1SM4A 2DY0A 2XQVA 2PAFA 1P3DA 3E3MA 4EO7A 2ODBA 1X1RA 2CCJA 3DH0A 1GD1O 1Y6JA 2UVDA 4ZAFA 1TXGA 5JPIA 4OFXA 4JJ4A 2F55A 3MLEA 4C4ZA 1MAVA 3E48A 5L6LB 1TCBA 4B40A 2PLWA 1A3CA 4WHMA 1L5YA 4J0EA 4HGRA 3U61B 2X40A 4RHFA 1SK9A 3V7NA 1T9CA 2OAP1 2R7KA 1Z25A 2JFHA 2FMFA 3OZFA 3K70D 4DR3B 3UC9A 3D0RA 4FCVA 3GDHA 4FGZA 4KWEA 1B76A 3ICWA 4PRYA 3VJRA 3OKAA 1JG7A 2ID7A 3X2EA 5G4LA 5KVVA 1YB1A 3DTYA 4M7RA 5EKTA 5IBRA 2DX7A 2XMBA 1EA5A 3BMNA 1UPAA 5IWAB 3RVLA 1QKJA 1ZN8A 1GXSA 3DVRX 3KXPA 1LPPA 3OZXA 1T3GA 2FX5A 2QEQA 3FOZA 4BCCA 3EVZA 3I1YA 2HQRA 1M2HA 3FCCA 1XRJA 4IRMA 1MMFB 2PT5A 1CQWA 4IUCS 1UT6A 2ZIVB 3TOXA 3P4UA 2ZPTX 3CURA 2YN2A 3IQWA 4DGQA 5A5EA 2GF9A 4GSKA 2IEZA 2XUGA 2F1RA 4U3JB 1VL5A 3SSOA 2YJZA 4URWR 3IR5A 1EK1A 1GFWA 1M6NA 4A10A 3RYFB 5JSHA 4TMTA 1CJUC 3M6FA 1X15A 4FYWA 5CBPB 3BG5A 3THWA 4JOSA 3O6VA 4KVAA 1M2VA 2HL6A 1N2ZA 1NW5A 2WILA 1QQTA 2VSQA 3ILSA 4MI3A 3T9AA 4HH3C 3WK4A 5JNTA 2HLPA 4P82A 4X9XA 3NDJA 1ZVVA 4XWYA 1GLGA 2RAPA 1A72A 1UCFA 5FLYA 3FR8A 3P0HA 4M0FA 3EGVA 4ZVOA 2BKAA 2LDBA 1C8LA 4LFBB 3A9CA 1CUZA 4KHPB 3QLEA 3RAJA 2ZDQA 3ORQA 4C4SA 1L7XA 1G4HA 4MW9A 3LDUA 3FTNA 4YUWA 2ZSIA 3PNPA 3OEHA 3OT5A 1Z36A 2FWNA 1R7RA 4PW0A 4DTIA 3O47A 5EE0A 5JRZA 3ZW7A 1IHPA 1T5TA 4NE7A 4JC0A 1E5TA 3WL6A 2JAWA 3AF1A 4WMLA 1OXTA 4JYMA 1DELA 4HNUA 4CLDA 3VPDA 1FLVA 5BR1A 1HOTA 2Y93A 2W2TA 3KHSA 2LE0A 3PF9A 4QBTA 4ZPJA 3FE2A 5JWHA 1E9DA 5JNLA 2NX2A 3TAHA 3KXIA 3P52A 4P7JA 3PPWA 1DDIA 4PYKA 5I8ZA 3R3UA 4IQGA 3L7NA 4AY3A 3AF6A 1GDTA 3TTYA 1UAYA 2X9GA 4CGYA 2OD2A 3ONNA 1K63A 5LNK6 5BW8A 4HLDA 5EJAA 4BO8A 4ZRNA 2XNKA 3G2QA 1NR5A 4CM9D 5LZ5A 3OPYB 2IF2A 4AT1A 2WAOA 5AVRA 3SBOA 3AHCA 5EJGA 3TI7A 4KWCA 5I3ZA 2Q8QA 1E6MA 1GZSA 4OLBA 4GPBA 4RHUA 1JJIA 3I30X 3QSGA 3URKA 4QPPA 2AMFA 3NMUF 1FYWA 2HWYA 4LDNA 1E1NA 3B3FA 5EXXA 2XQGA 2IDKA 4KQIA 4L4SA 5IJXA 5TXGA 3DHYA 2I87A 4RH0A 3NHZA 5D6NA 1KGDA 4TVBA 4JN6B 4X60A 3EPPA 5KC9A 5EMNA 2IFTA 2VI5A 3VYSB 1KKUA 3EOAI 4ZVNA 5BUQA 1KSGA 3LHSA 1F17A 5K3FB 1ZX1A 3SYLA 2ZZKA 5A4IS 3RGGA 3T3OA 2XDAA 3RFCA 2C2OA 1WXGA 1QYRA 3EDCA 4IIXA 3LKBA 4M36A 4QRDA 5JAPA 3IBFA 3D6JA 3CZPA 3F7NA 3S99A 2Y1XA 3IAUA 1SKQA 3I01M 1QCCA 1XTUA 1RT9A 2UKDA 3JZMA 4OBBA 4UC0A 3S2GA 1YR9A 5WRFA 5A1JA 3WL4A 1I1HA 2AN9A 2HI0A 1ZUIA 2Y0CA 4L3OA 4L50A 4LXIA 3DZFA 3PEVA 1ZU5A 4Z0HO 5FR1A 1CY8A 5IC4A 1J1UA 4ARZA 5KKNB 2FQXA 3OIGA 1I30A 1V8OA 1UWCA 4RPCA 1Z5GA 2JFWA 1BRTA 3OZGA 4G1VA 4N40A 3C3EA 4B32A 1Y1QA 3ZBTA 2PTHA 4D8WA 1LNQA 2CLDX 3GFPA 2DH6A 4HDKB 1EUCA 4O1IA 3EMKA 1A76A 1CSEE 4ETNA 3NTLA 1CY7A 3CLTC 5EMMA 1XG5A 2Z58A 3EA0A 2RHWA 4BNZA 4DQXA 3MJTA 5KSPA 2O2CA 5EHXA 1XTPA 5IC6A 4RL4A 4FYYA 3TQSA 4C2UA 3OOEA 3GY0A 4RF4A 3E81A 4GQAA 1FTSA 1H65A 4WZBE 4BB0A 1O0CA 3FMPB 2LNDA 4KLZA 4I46A 2P69A 4M0LA 1OUMA 1E9VA 3FYTA 3P1JA 1TC2A 1X1DA 3MJSA 4LDRA 3IQZA 1OIXA 3BFVA 5F2NA 1W0KA 1GGMA 2JVJA 3RTGA 3DOOA 4LSWA 5DEIA 1UXKA 4G1CA 3W3ZB 721PA 3TNDA 4LNHA 3FPJA 4Z4HA 2Y1CA 4N5NA 3T7SA 4Z99A 2WM3A 4CMJA 4INPA 1YOVA 2GEDA 4ODIA 4NBTA 2GQ0A 4FUQA 1U2DA 2BGRA 1SPXA 3QWHA 4S1TA 5BY2A 2QG6A 3K9QO 5FUQA 3FKSD 3ESZA 1BVHA 1GDHA 2ZR9A 2AFHB 1HZZC 2PBRA 1UPTA 2PVCA 5CYOA 3I1IA 5JTTA 2FW0A 3S5JA 3HVHA 1W4AA 5IUNC 4B3RB 1MQ8B 1MUUA 2Q45A 3OECA 4FDVA 4IIHA 4CHTA 1P73A 3DTNA 3KYIB 3PNQA 4BO3A 1ESNA 1RZUA 3JWGA 3IURA 3S4YA 4JUCA 4TPKA 5M29A 4HD8A 2ATCA 3KG2A 1UBSB 1UXGA 1X0VA 3IESA 4L8WB 2HJRA 4N9WA 5FTJA 3W2GA 4R3WA 2OGSA 5JECA 1G3RA 4YCLA 3HLTA 3SXJA 3FPKA 4XVCA 1BHJA 2J6BA 3ANXA 1ST2A 1YB7A 3FCAA 3FOCA 3OU2A 3PHGA 5IU6A 2NV2B 3UUWA 4B31A 4KQCA 3OEWA 1RAHA 1DMSA 2BKXA 1QMPA 3GJQA 3CLUD 4CM5A 5EUQB 1MB4A 3CH5A 4OQZA 3W5IA 3VJKA 3QFHA 3ZUPA 2FZCA 4A8HA 2P40A 5JJ5A 3BXHA 1K7CA 1X7HA 2JD2A 3SIXA 2ZDGA 3N86A 3E2MA 2WLSA 1XZBA 1TYAE 2IVFA 3MRVA 1NFRA 1QYVA 2C95A 2VRCD 2DSTA 1PR0A 1NE7A 3GEGA 3M6IA 4QUKA 3X2SA 4UPEA 1NBIA 2QRQA 4KMSA 3T7DA 3A9UA 3SIRA 4DCJA 2AK2A 3OFKA 1BU5A 1SO8A 1DQZA 4FFOA 4WD3A 2WSYB 3T5MA 2FPWA 1Y42X 1N2SA 4EECA 5CA1F 4DB4A 1KMMA 4FNGA 4MZXA 4CETA 5KQLA 1IOLA 4B6EA 4W6ZA 1MJFA 2BHTA 2R4UA 2JEOA 3PNYA 4K9MA 4Q4AB 2VP6A 4OA8A 4TN1A 3JTEA 3L1HA 3PEUA 3NIWA 1A9ZA 2EC5A 3N59A 5CR9A 5E7QA 3GU3A 1MRZA 2DBRA 4ENVA 3NVAA 2X1HA 1CWUA 3V97A 4DV7B 2BYTA 3F78A 5H9VA 1PVOA 4NG5A 3F96A 2RGBA 1JMKC 4KDEA 4J8PA 3Q9NA 3B3QA 2Y0DA 3K4QA 4A8TA 4ZYXA 4E1VA 2QNIA 1UFQA 3CNBA 1QANA 3FGOA 2ZTVA 4JCCA 3CW8X 4IWNA 3ZHBA 2L19A 3DF7A 5CFNA 3EH2A 1U7UA 4FM9A 3PCRB 2NSHA 3F5FA 3M89A 3SSAA 4V39A 4CUKA 2XMSA 1ZJ6A 3MIIA 1IY1A 2UUCB 1ZQ9A 1COZA 1SG0A 1X2BA 4I7EA 5C0OE 5FI1B 2GSDA 3GUCA 1WW8A 1RHJA 1H2RS 4BNWA 2DR2A 5ALVA 2VJBA 1T8RA 4QDJA 2BRUA 3CISA 3HKDA 5FOQA 3W8DA 1F2TB 4B4VA 3DVLA 2F48A 1Z06A 1Z3CA 3A1NA 3E7PA 3R6TA 1YJ5A 4GPZA 4L8GA 2IPXA 3WAKA 5DJ5A 3FDXA 3NBUA 1X86B 4Q7LA 3NKVA 5DIZA 4HV4A 5I8WA 1OGIA 1Z9BA 3BRCA 2YOGA 3LC1O 3SQWA 1YL7A 3MMZA 3Q5EA 5T8KC 3BK2A 3NFRA 3EZLA 1ID8A 1GCGA 4RKRA 1FLNA 2PMKA 2C82A 4F86A 1PFQA 1U7OA 3V1LA 4FOOA 4D96A 3LBYA 2YMQA 3AWIA 4YJ2A 4C4PA 4JU8A 3MGAA 4O25A 3PX3A 3ABOB 3F74A 2GILA 4M0KA 4P4SA 2RCYA 3QYFA 5IC5A 4MHTA 4Z9XA 4D92A 4PFQA 3A1WA 1YRAA 4REQA 3OE1A 4Q00A 1U9JA 1PZEA 5FPSA 3PJEA 1YMUA 3OO0A 2GVDC 5AJZA 4QARA 3UV7A 4LJ9A 2FPSA 1RDFA 1XTKA 2F43B 3A7EA 3ET5A 3C15C 4DBVO 2C58A 4QUAA 1E7YA 3DA8A 2A1UB 2GCOA 1FYEA 4QVGA 2BPOA 1ODFA 3ZW9A 1ZHOA 3FR7A 3HWWA 1YZNA 2WU3A 2PJDA 3C45A 1WY7A 3NRBA 2FZ4A 4MR9B 4R9UC 4WUVA 1O03A 3ZDXB 2JI8A 3OJCA 4JVLA 1JXOA 3CNOA 1G21A 1WHSA 1QIHA 3AWDA 1QGYA 3GH3A 4QTZA 1QH1B 1RC8A 2VDPB 2PD4A 2R5NA 2YNMC 1JT9A 5KYGA 2D1RA 4KO2S 2Q6IA 2EU8A 3ZHQA 1U99A 4I2VA 3PLNA 4GMKA 1JECA 4P5EA 4Z9FA 1MOPA 2Q7OE 1K5GA 3U80A 3PUXA 1L3IA 4YMHA 1U0TA 4LUCA 2QD4A 1OIVA 1HTBA 4L7QA 3TJMA 5L3VA 1CIVA 3GLHB 3HXTA 3QKRB 5LZ7A 1JIUA 3AVUA 1Y8CA 3H9UA 2IS2A 8ATCA 2WSMA 3H5AA 4TQ9A 1JYEA 4XRGA 1U2TA 2BEVB 3K0FA 3V3KA 4F91B 4R16A 3PZRA 2FK8A 1GRRA 4BKQA 1TU0A 1HUQA 3II6X 1CB7A 1YQEA 3OQVA 4YCJA 1BMDA 1N1GA 3C7DB 4FB5A 5F98A 2EFHB 3ZZ0A 3A4YA 3JD3A 5LDHA 2Z5VA 4I55A 2YQ5A 5M04A 1GG8A 2WOJA 4YCSA 3MC1A 4FK8A 3MGKA 2WFZA 2VSYA 5KREA 1ZUNB 2XDQA 1S9DA 3GC6A 2NYVA 2QJTA 4XCXA 1IBLB 1GNPA 3BGOS 3AVTA 1ZHFA 3G8YA 4ZO4A 2BKUA 4M55A 1OREA 2R751 2O8BB 4DR4B 1VDZA 4R84A 2ACKA 2GRJA 3IULA 4S1VA 4EF6A 4UXJA 5ADUS 5ECYA 1B8UA 5JCJD 4M88A 3UT0A 4RV9A 3U9TA 3U4GA 5TS3A 1FQWA 4B7XA 4DWVA 3BWBA 2Y77A 3A04A 4E4TA 2OESA 3MA0A 1Z35A 1JDBB 2GWHA 3DL2A 3UW3A 3OESA 3OEYA 5DLQC 1N78A 3A1TA 5HX7A 3IHKA 4WNAB 2WB4A 4DT1B 1FLDA 4F04A 4PSCA 1DO2A 3AI1A 4TL6A 1T3TA 2QT1A 1DCKA 3ABQB 4JZYA 4MARA 4G25A 3ZEAA 3C6QA 1KHTA 4YJFB 1E1CB 4DA4A 4X6LA 4L0DA 1Z4KA 2GK7A 3ZV4A 4UBKA 3ZDBA 2SKDA 2FZVA 1Y3AA 1FDRA 1J39A 3MN1A 1T1SA 5KAMA 1VOTA 2A5GA 2HK6A 4LWQA 4JI6B 1NPYA 3IP6A 3EF3A 1EJ6A 4MWTA 1HLPA 4HKTA 1KOLA 2GLXA 3E7WA 3L6CA 1JALA 1VB3A 4TT8A 5E6RB 1IU9A 4ZGGA 3KQTA 1K06A 2A0XA 4FYXA 3IAFA 2ADFA 4PZ0A 1E2DA 4XUEA 1NKTA 3V7YA 4AD8A 4CDRA 1MC4A 2OCKA 1SY7A 2DR0A 1BW9B 1SKAA 2V59A 2YC4C 4GM4A 3HP7A 2G40A 1XZQA 2WTAA 1A2BA 3N2KA 5J4HA 1HNNA 2NQ8A 2VT3A 5EHIA 3ROXA 5M2QA 3R9XA 2VRBA 5JD4A 1UKAA 4CEIA 2H57A 4RJJA 1SWVA 3RHFA 1UBEA 3RAGA 2BFFB 4C4XA 3K1AA 2QDKA 3GRAA 4JGGA 3GBVA 3MB8A 1J09A 2J6CA 5DI3B 1XA3A 4ZEOA 3A1FA 4J4HA 3A6GA 5E9QA 1ADYA 4AS3A 2W37A 2XF2A 5H59A 3LTEA 1M6YA 3NW9A 3C3JA 1MX9A 4RE6A 5AW0A 1NRXA 3RSLA 1A2OA 3R4VA 4K6FA 4EPWA 3AXTA 2BTOA 1D1QA 2FSVA 3IOBA 2RHJA 1HV8A 1W1WA 2FSHA 4E12A 3LUBA 4OBEA 2BI8A 4B4OA 3IAEA 1NSYA 3UWSA 1E9SA 5B5SA 4K9RA 1X38A 4Z5XA 3U1VA 1M0SA 3W78A 1NC3A 1MIOB 4EKDA 1VHWA 2GZRA 3RU2A 2QN3A 3OFVA 3N2KB 3WNDA 3JRXA 3ZK8A 2G4VA 1D04A 2QVGA 2GBIA 3GN1A 1E2MA 3LLVA 1UQTA 4MIOA 2O2DA 4O0MA 2NZXA 1BO6A 3HEMA 3VV3A 1PHRA 4ZT5A 2JJQA 2PH5A 1SD5A 4YYZA 5ITWA 4TMZA 5C46F 3VR1A 2O05A 4JC5A 5AW8A 4QBGB 1GQOA 3JQEA 4JX8A 2CVHA 5DM1A 4G63A 3KKKA 1NC1A 2PX6A 2Q07A 5CYFA 5DGCA 3KQSA 1JJAA 1QRDA 3W6ZA 1FYXA 1F6DA 3E5RA 3ESAA 4BNMA 5CLFA 3W2EA 2BSQA 2HWUA 3BD7A 1NRIA 1ZD5A 3GEBA 4M1YA 1XAHA 5DCUA 4AG3A 4I1OA 2GXUA 3GQBA 3HB9A 2DFTA 2JAUA 2VG8A 2W7TA 2J0EA 2P75A 5CA1B 5JYEA 2WMYA 1GPNA 4P1ZA 1SXQA 1TJ5A 1XYYA 3LDGA 4KR0A 1CFZA 2ZWMA 5AVSA 2Y76A 2QRVB 1K92A 1LH0A 1CEXA 3M6XA 3OJXA 1C1HA 4KI7A 2CBXA 3HCPA 4K9LA 3TZCA 5KTNA 4BEVA 3O8CA 3DLAA 4MV1A 1SVLA 2GA9A 5JS1A 5CNIA 1P9WA 3LIPA 3COWA 2JHPA 5HTOA 3GD5A 4K46A 1E59A 4MAAA 4ZVSA 1FXSA 5EHZA 2ZBFA 5K4AA 4ZCIA 3A3KA 3PL5A 1II9A 2IHKA 5CLLA 1X7DA 4HRVA 1GZUA 1Z5VA 1TECE 2PSEA 2Q5EA 3UFXB 2ZCJA 1RLOA 3ZU5A 2EGUA 3L93A 5A2GA 4DSNA 3UUGA 4FDUA 2G06A 5COQA 1H6BA 2QMYA 2VZLA 2PVPA 4DIEA 4BFXA 2FPXA 4QBKA 1MG0A 3AY3A 2A6PA 2VUSA 3ANTA 1C3EA 1V71A 2YYSA 3AKZA 4WW0A 3OJLA 1UKCA 3HZRA 1B8PA 3UWDA 3Q1LA 1LK5A 3IC5A 4JLJA 2W2QA 4OA5A 5HZGA 1ZIDA 3CF6R 2ZYIA 3SMVA 3GP8A 1MQSA 1ESEA 3VKHA 2NSLA 3DBVO 4HGQA 3SC2B 5KPJA 2A9JA 3IBTA 4IMIB 5J40A 3MOGA 5CTJA 4UAVA 3VV2A 2I5PO 3GP3A 3W1EA 4B3CA 4K40A 3FBTA 5FX2A 1QR2A 1Z0DA 1KPIA 3G3EA 5CT6A 4QQKA 1ISRA 3WFJA 3LGAA 3OD5A 5EIAA 5GGXA 1OVMA 4YQFA 4HDQB 2GESA 1BWPA 1Q0TA 4DLYA 4RVUA 4BC1A 3ZWPA 1G5PA 3N7TA 1L4BA 2OLKA 2ZSUA 3T1OA 1U2EA 1QC5A 3EXFB 4I6EA 5KEIA 1XTIA 2ZROA 2JAPA 2IXAA 4GFDA 3J81k 1DHRA 2QD3A 3A9TA 3O4VA 3OA0A 2MSDB 3OPYI 4JT2A 4RY9A 5IVIA 1F2TA 3I83A 3V7WA 1W5AA 1HYQA 2AMVA 3C39A 2H7CA 3O8QA 3E1SA 3EZFA 1FYFA 1M33A 1G20E 1XCBA 3OT1B 1TTQB 2Y99A 1BEZA 3UJDA 2J87A 3SY8A 3FUXA 4N3NA 3ZYZA 1M6WA 2AG8A 4O4HB 4Q21A 4Q4AA 4KN5A 3K05A 1JJ7A 1K4MA 2C92A 2Z6AA 2PZBA 4QOFA 3K4PA 1PZMA 3GA7A 2BM0A 3TF5A 3UM9A 1KH2A 5DW3A 5IT5A 3TFWA 4B2PA 3I9MA 3F6BX 5C1DA 5DCWA 2GK4A 8OHMA 4W9NA 1IBKB 4RLFA 3LCVB 5REQA 4MJ7A 1GCUA 2C0QA 3V9AA 4R0NA 2I0FA 2CUKA 5FLKA 4I5EA 4N7MA 5IG2A 2X1VA 1E0JA 1GTJ1 4PX3A 3TE6A 4QGHA 3VI4B 3WA6A 1QM5A 1XTBA 4DPKA 3RWMB 4EFKA 1L5HB 2CNKA 2XAUA 2A4KA 5CH8A 1YL5A 1MA0A 1XX6A 2YWCA 1WULS 3BA1A 2Q2VA 3FPHA 3HYNA 3O1HB 3ORYA 1C1DA 1XHLA 2IIPA 4R2KA 4WRRA 4HTAA 1Z13A 3MGBA 5KDLA 1G5FA 3B3JA 5DHRA 3OFJA 4Z7OB 2BIFA 4TWBA 3ETCA 3EXEB 4DGSA 1YMVA 5FTWA 1NI4A 3KT3A 3NEAA 4L3VA 1S01A 3K96A 2XCIA 4KSCA 5E1DA 4WBSA 2VJQA 4DIKA 5LYJB 2UZ3A 1JDVA 1LPSA 4NJOA 3QA9A 4FBLA 3RVKA 1GAWA 5EP1A 2F1OA 2P4HX 3QK7A 2DRIA 3E4CA 2B83A 4FHGA 4LMBA 1NXQA 2NO4A 3JX9A 3GRFA 1NYTA 3I9V1 2ZJ4A 3MWFA 3ML1A 1OCEA 3DO6A 4OP1A 4XX1A 4DDKA 3QRWA 3SCZA 2E9SA 1WTAA 1TCCA 3EG9A 3HYCA 1GL3A 4RA9B 4XPIB 2CZGA 3HGMA 3V4VB 4A8JA 1GUDA 4J0JA 2V0GA 3RE1A 3GARA 1Q7RA 4LY6A 4CW7A 5IXYA 1OB5A 1PJ3A 1U6IA 2E85A 4ZT7A 1J5EB 1ZGHA 2VAVA 4IJVA 3DC2A 4QG3A 2JW5A 4IRXA 4DV4B 2CB0A 2ZYHA 1E6EA 4V1CI 1DIRA 4J0CA 5FF9A 3R3XA 1JIIA 3EIUA 4JWKA 4XJTA 1GSIA 1U0OC 1LX7A 1ZCZA 3NTRA 3IV6A 4JBHA 4D9JA 1YIAA 5CT8A 1UZNA 3NBXX 4KR7A 1QK5A 3EGWA 4P7KA 1MKYA 1XYVA 1BS1A 1JX6A 1E79A 2MTBA 2OCPA 3G8DA 3GYBA 3N58A 5ARBA 4TV9F 4U6QA 4HT3B 1THGA 1O08A 3DMTC 4NONA 2WTUA 2D3WA 2DBVO 3PFHA 1C8VB 1EK2A 2DFKB 1ZDMA 2NTJA 3DOJA 3ONVA 1XCJA 4IYJA 3L6DA 3QWBA 4E1BA 2YFKA 1CD5A 3KVYA 5AW9A 3UMJA 2BOVA 2FW7A 4CMAA 5GIPE 2ZB4A 4Q4HA 5AW1A 2OR3A 4S1NA 4REMA 2IUYA 2QS9A 3HPRA 1M2WA 1TUEA 4J43A 4GX0A 3KKQA 4RADA 2B4TO 1N77A 2JHFA 3LPMA 4CKYA 2JI9A 1G8JA 2B4QA 2PLRA 2BLLA 2WW8A 3HY3A 3K20A 1E2LA 4Q3DA 4F5DA 2P90A 3PIIA 2VHJA 4HH1A 5MDHA 3GNLA 1M6HA 2X7JA 2VDJA 2AC2A 3D6NB 1KJQA 4DV0B 2I6TA 3RARA 3WGUA 4JJ7A 2V6GA 3WGTA 5A06A 4NPCA 4F8YA 3HA5A 5F12A 5AFSA 2IUFA 5A4KA 2OAQ1 1EHYA 5F5LA 2GD0A 2YN4A 1UODA 4Y6LA 1PX0A 3MTIA 1V1JA 4PIPA 4QAQA 3TWOA 1IL0A 1QPGA 4RPGA 5FT9A 3CG4A 3V1UA 4OM7A 3E3OA 4RZ3A 4YUAA 4P31A 2IYNA 4KVZA 3EF0A 1E1QA 2V97A 5IAKA 3SK0A 1M5RA 5DHTA 3T3MB 4C6SA 3ND7A 1JZTA 4R4JA 2Q4BA 4WERA 1GJRA 2W83A 1Q7CA 2WHQA 3RU9A 3EGOA 1MJGA 5E8RA 2IEIA 2IZZA 1MIHA 4MVJG 1U8TA 1EZ4A 3K35A 1U7TA 2DVMA 3LNTA 4UDYX 1QFJA 3SAJA 3TIGA 5J1SB 3OSUA 4TL9A 1FFBA 2RGYA 1Z6TA 2GZAA 3QNUA 4PZDA 1E6UA 3DYVA 3CM0A 4TLEA 2V7WA 4RY0A 1FZQA 1DKQA 1PQ4A 5K0LA 3X2FA 2FJUA 1SOWA 3LU1A 1Q7TA 3QE0A 4QOSA 3WK9A 4AJ1A 1QG6A 1Z39A 2QGNA 2ZI4A 3N75A 5ALPA 1U7ZA 1TPYA 3C1AA 5BNWA 1KYWA 3L3BA 5F77A 3WL3A 1ZAYA 4M8SA 4D9HA 4N76A 4JI2B 2NO9A 2VF5X 2N1BA 2VK8A 2AR7A 2BMVA 1I0LA 2QQ5A 4QDOA 3KDSE 2H1WA 5EWJB 4DW8A 3OLQA 2OYSA 1Y6GA 1E63A 4BFCA 1RQ2A 1J07A 2E4YA 1TAGA 3Q85A 2H4ZA 2XGJA 5ALEA 1TB4A 4H16A 4YASA 4QYTA 3IUJA 2YWFA 2W9XA 5F7JA 3T0IA 3IBYA 4CEIB 3CONA 1FSSA 3ESCA 3JAKB 5DIFA 2I7DA 5F9MA 4Z7QB 4IG9A 2MWMA 4CLEA 5DWVA 4C7VA 4RVSA 4LGVA 3RRYA 3VNUA 1I2CA 3KCQA 3L7OA 1I7SB 3RUIA 1WUYA 5T41A 3J7TA 3R75A 2LRHA 3VPXA 2PLAA 2RJNA 3RT7A 4NCAA 2CXQA 2W43A 2DPGA 4NULA 3PNMA 3RT9A 2DP4E 3E58A 4MDEA 1U0JA 2EOAA 3D1JA 3DP9A 3GJTA 3IPLA 3LXMA 3MJ4A 3WGKA 4DBLE 1MAAA 1MX1A 5A3VA 4U3JA 521PA 1OA0A 4KMMA 5HK8A 2I8LA 3TPCA 4J29A 2XOKD 3NX4A 3HBJA 2VJCA 3ED1A 4ZC1A 2J0VA 2QTZA 3K4HA 3N0RA 2NXWA 3B1YA 1E5XA 1GT91 2BP7B 4WLVA 4Z1MD 1M2EA 4KH1A 3RJTA 2PR7A 3DLHA 3ONFA 1CNMA 1FNBA 2WMNB 4HAZA 5EP4A 4FN4A 3FPGA 5KO2A 2GD1O 1EP9A 2WJJA 3GMDA 2DC1A 4U2CA 2DKNA 4TTSA 1Y5IA 2ZYDA 5AM4A 4CQMA 2JBAB 1M6VB 1B6SA 2RB4A 1IOWA 3HBFA 4RKEA 4R98A 2XTMA 5K0FA 1V25A 4HQ0A 3V8NA 4EJMA 3P7MA 1JEOA 1W85B 1VMKA 1WHTB 5FEMA 4JQSA 4GYKA 1TYDE 3QVGA 4IHJA 2OPHA 4AW9A 2M98A 4QOGA 1IAQA 1VI2A 2A9PA 1GPBA 3DZCA 3STVA 3GLFB 2H92A 2AT1A 2JATA 2R8PA 3GNQA 3NOVA 4Q4HB 4EW3A 1AKVA 2E87A 2CL5A 2YR0A 3CUTA 4TTQA 2CJFA 5DGHA 5DV9A 1BMFD 5TQVA 4EB6B 5DNYB 1LLFA 1E32A 1RI4A 2C07A 2R8ZA 4L08A 2G83A 3DHEA 3SSNA 4TMYA 1EINA 5DXAA 3DFIA 5FUBA 1OZFA 2EAUA 2PZMA 3Q3JB 3CO0S 4RPLA 3S3TA 3VH2A 1N0WA 3NHSA 2FDCA 3FKQA 5E0OA 3HDJA 3CPSA 1PEKE 2QRPA 4L0CA 4LMRA 4NF2A 5THXA 3IDOA 4PYIA 4XI9A 5ILOA 4HWOA 1OPRA 4MA0A 4OHPA 3U5ZB 2HZ7A 2YVAA 4K6MA 2ZYUX 4M9QA 5TPWA 2ZWOA 5C18A 3K9GA 2QLLA 3VH4A 1T24A 1FNMA 5DM0A 1SC6A 2XKBA 4JL5A 3M8KA 2HKIA 1P45A 5IWCA 3VUEA 4CF5A 3KYCA 4RA6B 3V4SA 3DD5A 3OQBA 1YHZA 1EUYA 4HDMA 3EOBI 1VP9A 3MAJA 3CEJA 1G2IA 2IX9A 4FOTA 3DOFA 4HADA 5CEEA 1R5NA 1SVMA 2VJYA 3JZDA 2W4IA 4RZSA 1T3HA 2WP8J 2DQ4A 2DE0X 1RXYA 2TECE 4XM1A 3WSTA 1G3MA 5LVAA 3BSFA 3MUOA 2GAIA 4B5LA 3W79A 2VAPA 3QIAA 3IS3A 3FNIA 2YV3A 1CHNA 1TEZA 3PQFA 4GX5A 2AG1A 1EFDN 1ZI9A 3ZKAA 4J0QA 2RIPA 4MPDA 5HZHA 5JWRA 4HH0A 1HDIA 2G3YA 4NEQA 2AQKA 5LP6B 4QYIB 4MYUA 1YK0A 2ZR0A 4ZIRA 1SXJB 3UG7A 1GKLA 2RKBA 5KNCD 1BCRB 1CY2A 1MB2A 4JCOA 2ZJAA 3V1TC 1ZM3A 4TN5A 1S1MA 1VMIA 3DNMA 1SEVA 4PLTA 4RSGA 1FU4A 4P3PA 1VIMA 3ZV7A 1PFWA 4BNKA 4PFKA 1E9RA 3K09A 1Y7TA 3RYHB 3L92A 5EFZA 3VTKA 5BR7A 5E7IA 3VNBA 1AQIA 1RADA 2LCFA 3NVDA 4CU2A 1T9GR 2CVPA 2VHCA 2QENA 2TMDA 1NBWB 3NH6A 1VJ0A 4IL5A 3WGYA 1JBEA 2XXJA 3ZWAA 4ZI3A 1IEXA 4IH4A 1RPTA 1KRXA 1TI7A 1LLCA 1WKBA 1PL6A 2A84A 2RH4A 5KHAA 7REQA 3MYYA 1ZH4A 1XPRA 1MD9A 3SP1A 2YXPX 3IDFA 1B6RA 3P0RA 2HLNA 4LY9A 2NUBA 4NCJA 5EE3A 5FHRA 121PA 1C7JA 4M9RA 2CYBA 3ADCA 2G7MC 3IYLW 3RSSA 3PXBA 3FTEA 4TSRA 3IEMA 3F6SA 1YA4A 4F1WA 3C5EA 2V45A 5E6UB 3WWZA 4OQPA 4I4TF 2HLDA 4P32A 1F8FA 1FB5A 1SD1A 2XMZA 4J6EA 4FIZA 4CMBA 4DRYA 1HT3A 2A92A 1YZUA 1PR2A 1RYBA 2W6JD 5FOWA 1ZGCA 4A16A 2COEA 1HI9A 2ETXA 4ZJYA 4TKUA 1PNQA 4FX5A 1QVAA 1C7IA 2WM2A 2VSNA 3K0CA 3TGWA 3EPLA 4FBMA 2ZYWX 3O1IC 3EEQA 3PNOA 1JKJB 3T1VA 4C29A 3W4IA 1E5LA 3R3WA 1XC7A 4G5XA 5FQNA 3CLTD 1IZZA 4A6EA 2PBZA 4DLPA 1SB9A 2AL7A 1W9HA 2PJRA 2Z2YA 3BX1A 1KO8A 4X1KB 3EQ6A 2AR9A 2CDAA 4J1QA 3ZCQA 5IRCD 2R8OA 3TRIA 2CFOA 1DLJA 1SQ5A 2BZGA 2OUKA 2GAFA 4XR9A 4C4YA 5KOYA 4AS1A 4TTJA 3LCMA 2VF2A 1FMCA 5FJJA 3K0AA 3SZMA 4QZVA 3EBOA 5HQ3A 3QV2A 4QO7A 2HJWA 1KIAA 1Y3FE 2QIOA 5LL6P 4JJAA 3LPDA 4IHAA 1SUFA 3IALA 4COOA 1M1NA 2D8MA 3SDSA 1ODLA 2GHTA 5L3RA 5K6AA 2JIDA 2CKMA 3B13B 3HVKA 3OOWA 4MQ6A 3HA2A 4QHTA 1R9MA 1L5WA 2LBPA 1JDSA 1VRVA 3ZCRA 2JS7A 3KLPX 2FPUA 1W75A 4IOLA 1PGPA 1KZ7B 2QQ0A 4HZGA 1FQKA 7ABPA 5ALLA 1WSAA 2XCLA 3NHWA 2ODNA 4HWPA 5ICSA 3CRW1 4YCAA 3VPGA 5EJ5A 4QL3A 2Q0XA 2QMQA 1DQSA 4OV6B 1E3IA 2KJQA 4P58A 4KPYA 3ZY4A 1CB0A 3JV7A 1XCPA 1CUEA 2PQ6A 1GZ3A 2DPXA 3LHFA 5FULA 4BDSA 4B76A 5AUOB 5FLEX 4R1NA 5K1ZA 5D1HA 2AN3A 1SIWA 4RC9A 1KFKB 2ZSBA 3OUTA 3Q40A 4RHYA 4A1OA 1QU3A 3KJIA 4X3CA 2BBTA 3I6BA 3GBSA 1IWBB 5G0TA 4E88A 1KEEA 4R0VA 3HQ4O 3SEQA 5F3WB 4UQPA 1L4GA 2BTQA 2VK2A 3DKKA 1X13A 4IO1A 5DTMA 5AXAA 4IIVA 2Q2QA 2PUJA 3PI7A 4UHFA 3NXKA 2XUQA 1X87A 2XOEA 3AR6A 4LISA 4M1ZA 4R5MA 5J59A 4DAEA 3ZLJA 1P6QA 1UUFA 4GH5A 4GP7A 2Z1MA 4DV3B 1FP1D 4H1UA 4TQUS 2MR5A 4PG7A 4UTXA 2F9FA 4FLMA 5LMUB 1G0NA 1I01A 3QWFA 5H5JA 3CF0A 1VKZA 2WY2D 4ZZIA 4QSHA 2X86A 4M22A 3RC8A 3TX6A 5EOVA 4K0RA 2HDWA 4NV0A 3NB0A 1R4MA 1Q12A 2H4HA 1QOQB 1E4EB 1DL5A 3DYIA 4FYHA 4HWRA 5DGDA 4ZU1X 2WT9A 1Y8QB 3NVKI 4MKRA 4BO9A 2WHPA 2MSWA 2ZYGA 2EEPA 3TUZC 3M4JA 3C6YA 2NVOA 4HGZA 4WH0A 5B2ZA 1Z6ZA 4R1UA 2ZPAA 2G6BA 2Q5OA 3KM0A 3GCWA 3K72B 3MWDB 4GPAA 4OJQA 2C78A 1RJGA 1CU1A 3ONEA 3STXA 4NMXB 4I5GA 4BQQA 2Q2NA 3GRUA 3O4JA 3RRMA 2D1QA 4Q47A 1AUPA 1Y3HA 4XWOA 4PLZA 2HU8A 2YINC 3EIWA 3Q98A 5CLQA 5C80A 3ONWA 4RZHA 5JFGA 4X65B 4CV3A 4NNPA 1NT4A 3EWNA 1J06A 1E3WA 4AYXA 3SC4A 2CE7A 3LUFA 2NO5A 3DB2A 1PLLA 4NDNE 2IW3A 1IC6A 4QM6A 1LX6A 1W5FA 1UJBA 3EZ9A 5ESDA 1KEWA 4WZZA 4QPJC 2GKGA 1Q0ZA 3L6UA 3ZZNA 1XRNA 4AWXA 5HCNA 5ESRA 4N8EA 2W6NA 1NRWA 4FZ3A 3M81A 3KFVA 4WXPA 2F9LA 2FR0A 1DRKA 1V5EA 2IZ6A 1XCOA 2K7ZA 2PM8A 4JWTA 1OJLA 1QLJA 1TM1E 2P4QA 5CNKA 5H70A 3UN1A 3AFNA 1E2QA 3ACCA 4LXHA 4JY7A 4G1MB 1NMXA 4LIPD 2XECA 5D5HA 4YA6A 4YUVA 1OZ0A 1SKYE 1DTWA 3CWQA 3JQDA 2X6RA 4ISBA 2NP6A 5K51A 2IPAB 2H85A 3RHZA 3WTCA 4P84A 5B55A 5ITZB 1KP3A 3E23A 2JIZD 3T34A 2PN1A 4C9BA 2B82A 3THSA 4LXGA 5LC1A 1RR6A 2V7UA 3UT6A 5TV2A 4DCUA 4Q4CA 2CFSA 4V0KA 2I7CA 4DJAA 3WDLA 3EIFA 3OLXA 4U7HA 3LX6A 3RANA 2PO5A 3DKPA 4JMPA 4X97A 4UU1A 3NXSA 4BBJA 4ZVMA 4DCOA 1UP6A 2ZRLA 1P72A 4IFTA 2XSZD 1O6FA 1XDDA 4QASA 1JI0A 2F9MA 3AY0A 3E5HA 4KGXA 3EARA 5IFKA 1TA4A 1XBTA 2VEOA 2Y1LA 3WLIA 2H4XA 3MB5A 4ZODA 3GLGE 3E5NA 2JBAA 4Z9YA 2I9PA 1GGFA 2D06A 4IO0A 2FPIB 3RFXA 1NBMA 3O1LA 4PCUA 1OYWA 4M54A 2I4RA 2WABA 3ZQ6A 1NW4A 3HI4A 3RQIA 2WD8A 1M1YB 1NHGA 3COYA 2ZJ5A 2IZ5A 1ORVA 1RRGA 3A36A 1I3NA 1MX5A 3VSDA 1TCAA 4FLEA 3GLGA 4JDPA 4FFDA 1T6NA 1ORWA 2ZBDA 4L0QA 4MV4A 3UK6A 5KSWB 3STTA 2ZRFA 1D1SA 2OB2A 4OY3A 1SCIA 5ADHA 1JG1A 3D7SA 2PUWA 3LUJA 3V9PA 2OY0A 1QDLB 1UBHS 4QXAA 5AJUA 2GFIA 2G5CA 5H3HA 4BFWA 3WGIA 2AMYA 1QHYA 3WQHA 2VNSA 1BKYA 4B4UA 4PCVA 2Y8EA 3G5UA 1DHTA 2ENUA 1SVUA 3K8OE 1A7JA 2BBWA 1EE1A 1GLVA 3H1TA 3R6LA 4LRUA 4GI5A 5ER9A 2OILA 5IDYA 1RWMA 5CG1A 2Z3VA 2RAFA 4Z1MA 3OWXA 2Q3CA 2HIAA 3WLHA 1P1RA 3QBTA 1AO0A 5HF6A 5LKAA 4B6JA 3WB1A 3QPVA 2VRCA 2HD4A 1DV1A 2R6FA 4BV3A 2WFLB 3P27A 5EVCA 4B6GA 1RAEA 4WKBA 3GFBA 4BVJA 4CIYA 1Z5OA 1OXSC 4F5YA 2VDRB 4COKA 2X4IA 2F3TA 4OD0A 2OGWA 4LN1A 1WBBA 4QXRA 2VDKB 4XDHA 3HBMA 3ZHRA 3F3KA 1RZRA 2AG6A 3IVMA 4DADA 2ZWIA 3QQPA 4OLHA 4X1YB 4ECEA 5K0EA 4KQWA 2CYCA 4KE9A 2DETA 5A5DA 1UFVA 5DB4A 4DQKA 3ROZA 1YJAA 1ZUNA 2JIZA 1W35A 5CPFA 3T4PA 3VU0A 2W6CX 3H1GA 5KSYA 1EUQA 3FPAA 4I9NA 3U7FB 4IPTA 2P6MA 1UM9A 1IATA 3LBFA 5FORA 3JR7A 4ZFNA 4V38A 3I4CA 3U0VA 5JC8A 5KX5F 1KGSA 1YVDA 3OIYA 1SQ0A