3H5LA

Crystal structure of a putative branched-chain amino acid abc transporter from silicibacter pomeroyi
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
397
structure length
397
Chain Sequence
b'DPVVIGCPAPLTGIVAADGIEFQRGIQMAADEINAVGGILGRPIELVFADTQSKGVDVVIQSAQRLIDRDNASALIAGYNLENGTALHDVAADAGVIAMHANTVAVHDEMVKSDPDRYWGTFQYDPPETLYGGGFLKFLKDIEDNGEFSRPNNKIAIITGPGIYSVNIANAIRDGAGEYGYDVSLFETVAIPVSDWGPTLAKLRADPPAVIVVTHFYPQDQALFMNQFMTDPTNSLVYLQYGASLAAFRDIAGDNSVGVTYATVLGTLQDEMGDAFAKAYKERYGDLSSTASGCQTYSALYAYSIAAALAGGPGAPYDDVQNKAVADRLRSLIFRGPVGTMRFHADTQSAWSYPTETNDPSLGMPHIFSQIFDKAEDGVLIAPAPYKKAGFKMPPWM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Branched-chain amino acid ABC transporter
publication title Crystal structure of a putative branched-chain amino acid ABC transporter from Silicibacter pomeroyi
rcsb
source organism Ruegeria pomeroyi
molecule tags Transport protein
total genus 154
structure length 397
sequence length 397
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5lA01
5BRJA 4KK4A 4W5QA 4OLBA 4IILA 3CG4A 3HO1A 2LBPA 5KC9A 5BRAA 1QQBA 3MA0A 1Z26A 3KHTA 4O1IA 1DCKA 4G0ZA 1JDPA 1LJLA 5EWLA 1JHZA 1ZESA 2GKGA 3OLXA 4MR9A 2MYUA 3H5TA 4MQFB 3QLUA 5IBQA 4N03A 4KQ9A 4HNSA 5FWXB 5TPZD 2JB9A 3GA5A 4G86A 4L85A 1DZ3A 1TLFA 3LUHA 5IC5A 3O1IC 3L49A 1SRRA 4EVQA 1U0SY 4RSMA 1NXXA 4MQFA 3MF4A 2FQWA 1RXIA 3BBLA 1JF8A 3F6PA 3IP5A 5FWXA 4S04A 4W5RA 4FB4A 2JVKA 2QU7A 4WWHA 3VNAA 4G0YA 3O1JC 2IPAB 3HUTA 4CBVA 3OM0A 2WRZA 2FXIA 3O74A 3KJXA 4ML3A 3OLZA 3N75A 5D2CA 4EYQA 3HDGA 2PE5A 4MS4B 2F8SA 2HQOA 5PNTA 1VLZA 4G0OA 4JP1A 4RXMA 2A9RA 3T8YA 4H60A 1DBQA 4RDCA 4RU1A 3G1WA 4UHKA 3W9SA 3CRNA 4MS4A 3GBPA 5CNMA 2PL9A 1D5WA 1D4ZA 3O21A 3OMXA 3OO1A 3ILYA 5C5CA 4JB0A 3M6MD 3OO0A 5JNVA 4KPYA 5TQ0B 2FMIA 2A9OA 3EULA 4IRXA 3KYIB 4OLAA 3URMA 3DGFC 2NUBA 3HDVA 1DCMA 3H75A 1LJUA 3IDOA 3SG0A 2QW1A 3D02A 5I4CA 3UKJA 2E4WA 4TN5A 3TD9A 1KRWA 4OATA 5TQ0A 3LUDA 2L18A 2YHBA 4G97A 1C0EA 1PNTA 2CHEA 5EWJB 3GBVA 4ZMSA 1BVHA 2P9HA 4JOQA 1K68A 1R8JA 4Z4FA 1JDNA 4W5OA 1GUDA 3I09A 5DTEA 4IGAA 1LBHA 3N8IA 5HM6A 5JNTA 3SM9A 1BAPA 4XARA 3OLWA 3Q41A 3RVQA 5IUJC 1XHFA 4MQEB 2XDYA 5ABPA 3LMKA 2KYRA 4PYRA 3TMYA 3BRQA 2A9PA 3BILA 2Q5CA 2FMHA 1U2PA 1QP7A 4MLCA 4MQEA 2GWRA 4YO7A 1NXOA 1MB3A 8ABPA 3ROTA 3EQZA 4ZJPA 1D2AA 1JLKA 3LUGA 1YS6A 3IP6A 4YS6A 5KI6A 3MMNA 3NHZA 1PUXA 1A2OA 4B09A 2MYPA 3OLVA 4Y9TA 1QKKA 3A0RB 1ZH2A 3O1HB 4Q6WA 2W42A 4KQCA 1AB6A 1JX6A 2VUHB 3CHYA 4G0PA 5F64A 3N6VA 2WY2D 1AB5A 3CS3A 3UUGA 2FEKA 2QZJA 3NHMA 3RVRA 3QELB 2E4XA 1M2FA 2WJAA 2AYZA 4G0QA 4IF4A 3HCWA 4PICA 1H9CA 1KRXA 3H5WA 3KS9A 4LRQA 4N76A 5JS2A 1U8TA 2WJWA 2JK1A 3F73A 1EFAA 2H0AA 4HYEA 1EWVA 2PL1A 5TQ2B 1BDHA 1DC8A 4P1ZA 4D6YA 3RH0A 2E4VA 1QO0A 4W5NA 4E7PA 5IEBA 5IULC 3C6QA 3H5IA 3JS5A 1C4WA 4Z4GA 2FVYA 6ABPA 2WWVD 2IPMA 1JL3A 2WB4A 2QVCA 3QLVA 4JAVC 3B2NA 4KMRA 4RWEA 3DLBA 1TVMA 3Q9SA 3MYYA 5DGCA 2E4YA 3L6UA 5JNWA 1WETA 4P98A 1YS7A 4E7OA 3H6HA 1ISRA 4LE1A 2FKAA 5KC8A 4QYWA 2LUOA 4MLDA 3N0WA 3C3WA 5EWLB 4FE4A 3HZHA 2ZAYA 2OQRA 3GT7A 4JASB 1APBA 4IMJB 1Z17A 2VUIB 4MR9B 1M2EA 4F06A 3CZ5A 2JVIA 4G0XA 3Q7RA 4RY8A 4Z99A 1USIA 3HXMA 3M9WA 3DBIA 3RVJA 1NXWA 1T34A 3UK0A 3O2JA 5IEJA 3I42A 1VRVA 3LUFA 3HVRA 3ILHA 4TLMB 4S05A 1Z2EA 4OG2A 3RVLA 2L2QA 5DCLA 2FMFA 4N41A 2QV0A 3F7NA 3G85A 2P4UA 4YR7A 1NXPA 1FSPA 4MS3A 4Z9AA 1P8AA 4D6XA 3A3KA 3CZCA 1ABFA 1SXGA 4QYMA 1QMPA 1L5ZA 2ID7A 3KSMA 4KNYA 4ZMRA 1J56A 1B00A 4MGEA 5JS1A 3DZDA 3MIZA 1PNRA 2FEWB 3CFYA 4XFKA 1P6QA 2JVJA 4TLLB 5KWSA 4RXTA 2X7XA 3IP9A 3RVNA 3VNBA 3HV2A 1YTUA 3EODA 1RNLA 2FN8A 4KVFA 1VKRA 4MYRA 2R25B 4Z4IA 4YWHA 3QLVC 3FGZA 1L5YA 2MYNA 2JBAB 1ZDMA 4RK0A 5DLEA 2PJUA 3KKEA 4YRZA 2JBAA 3TO5A 2JRLA 2FMKA 3H5LA 5IUNC 4OTZA 4RK1A 1ZITA 2LIVA 3I5AA 3JVDA 3RVSA 3NNDA 4RK7A 1GUBA 2QR3A 3BREA 2PMCA 2H3HA 3CG0A 2HSGA 3LKBA 2QXYA 4H3HB 1YMVA 1PEAA 2DRIA 5KQGA 3LUAA 3O2SB 1F51E 1GCGA 1JBEA 3Q7TA 4Q6BA 5BR1A 2HQBA 2MSKA 1MB0A 2TMYA 4EYKA 3QLUC 4F12A 2PUDA 4PZ0A 1PHRA 3EAFA 3LUCA 9ABPA 2NZUG 3IP7A 4EY3A 2HQRA 4N0PA 3GWGA 1JFVA 3TX6A 5JNSA 5FBKA 4EGSA 3OQNA 2R48A 2PUEA 3HUUA 4PEVA 3JPWA 2VYCA 1RXEA 5IUKC 3QEKA 4RY9A 4MAAA 4JB2A 3JTEA 5E3JA 3MQ4A 1NXVA 2JCGA 2FQXA 3CLKA 3T95A 4Z4HA 1CEYA 1CHNA 1PEYA 2N9UA 3NNNA 1RZRA 2E4UA 3ROFA 2M1ZA 3D8UA 3M9XA 4F3TA 2PAFA 3SNKA 2ZWMA 1YMUA 2FLWA 3E3MA 3HSYA 4PE5B 4RK5A 4Z9BA 3HJFA 5HSGA 1DRKA 2CWDA 5DKFA 1YVUA 1ZGGA 4Q7EA 1DBWA 5HKOA 5ED4A 1Z18A 2FSPA 1XHEA 3RVPA 4ETIA 1NATA 2IOYA 1NXSA 3H1EA 5C5EA 4D74A 3QLTA 2I6FA 2LPMA 3EGCA 4KFCA 1RZRD 1NXTA 3JVIA 3FMVA 2O20A 3MM4A 1NY5A 2BGGA 5GOTA 3O2QB 2AYXA 4Z4EA 5KQMA 3CU5A 1MIHA 4EYOA 2RDMA 1E6LA 2PLNA 1XWWA 3Q7SA 5FWYB 4KK3A 4LE2A 4N0QA 1KGSA 1YK0A 1GCAA 4RV5A 1DBPA 3DLHA 4MS1A 3DGEC 1QO0D 3TB6A 2MSWA 4DN6A 1E6KA 1D1QA 2FTKE 1SD5A 3Q15C 4ZYLA 5FWYA 3R0JA 5KQLA 2MSLA 1U04A 2IPNA 2FW0A 3LTEA 1ZHHA 3IPCA 4FE7A 4LDAA 1ZN2A 3EDCA 5BQ3A 1ZY2A 4MRMA 2J48A 5EWMA 2FEPA 3OMWA 2NT3A 5FBHA 1JFTA 4RZSA 4MR8A 1Z12A 1DCFA 3GL9A 2V0NA 5JNRA 5CHYA 4Z4CA 4MR7A 4LX8A 1CYEA 1HEYA 4WZZA 5TPZA 1TJYA 2PUCA 4MS3B 3GYBA 4YCSA 3OQOA 2HJ9A 3H5VA 5TQJA 1DP4A 2IKSA 4HNRA 4OBBA 1EWTA 1ISSA 4QPJC 5T3YA 4RS3A 2PUBA 4KRFA 3KLOA 4EYGA 5CNKA 1MVOA 1F4VA 2CD7A 4YGXB 3T6KA 1VPWA 1URPA 1DG9A 3CTPA 3SAJA 3QX8A 3K4HA 4WXMA 1NTRA 4WT7A 2GX6A 1EAYA 2IPLA 4YLEA 3LUKA 4O5AA 3T38A 1D1PA 4IMIB 5CNIA 1Y1LA 2VK2A 3JPYA 3NNSA 4EUKA 4LE0A 4ZPJA 3EQ2A 1JFSA 4WUTA 4GPAA 4QICA 3KLNA 5IX8A 5CNJA 1QQAA 3H6GA 4GNRA 3O75A 2HPHA 1BDJA 1FFSA 3SY8A 5JNUA 4RY0A 2PUGA 4H3KB 3LUJA 1UDRA 1RPJA 3SQNA 3HM9A 4LDZA 1MAVA 1U2QA 2WMYA 3N53A 3RVMA 2FLKA 4TMYA 4F8JA 2FN9A 2PUFA 1E6MA 2E4ZA 2QVGA 1A04A 4RK4A 3RVKA 2LP4Y 1Z16A 1YIOA 1FQWA 1W25A 4NCBA 5HQJA 3OLYA 1FFGA 5B3JA 1A0OA 1JYFA 4DADA 4RKRA 4YP9A 5KQPA 4KZKA 3CNBA 3CKMA 1QP4A 1IIBA 2B4AA 3JY6A 1JWLA 1S8NA 3LFTA 4N47A 1M5TA 4W5TA 2OENG 3RVOA 1EHCA 4XXHA 1FFWA 1DJMA 7ABPA 3GRCA 1K66A 4HNQA 1JYEA 1Z15A 3S99A 1ZAYA 1EWKA 3N0XA 4NV3A 5EWJA 3OQMA 4NICA 1LBIA 3BRSA 1M5UA 1JH9A 1BDIA 4MPTA 3HS3A 4ETNA 1ZVVA 2QSJA 4JA2A 1QNLA 1TM2A 5TPWB 1SXIA 3C3MA 1SXHA 2MYTA 1KMIY 2PKXA 2CHFA 4RXUA 3E61A 3H1FA 4Z0NA 2YHAA 3HK2A 4L4UA 5GQSA 1GLGA 1P2FA 3C3KA 1ZGZA 5TPWA 4ETMA 4O1HA 4RKQA 6CHYA 3NBMA 2L17A 1Z13A 1TMYA 4EVRA 4NCAA 3F6CA 3QK7A 2NT4A 3GV0A 1E2BA 4F11A 1W9HA 4M88A 2B1JA 4UHJA 2GI4A 3KCNA 3RQIA 1ABEA 2FQYA 2R47A 4WXEA 3A10A 3KG2A 4NQRA 1OXBB 4KV7A 3EJWA 4KREA 4G0MA 2PUAA 3H1GA 1DC7A 3I45A 2IYNA 3FFTA 1LK0A 4MS1B 4LZLA 3A0UA 4XAQA 2NZVG 3N0RA 3QELA 3H5OA 3K9CA 1QP0A 3QX9A 3C97A 3KTOA 2RJOA 2F8TA 4XASA 3P9YA 5B3JC 3FFXA 3FFWA 4MRMB 5EWMB 3QEMB 2RJNA 1QPZA 1Z2DA 1P6UA 1OXKB 4MR8B 1BA2A 4DQDA 1YK1A 5TQ2A 2M98A 5TE9A 4YV7A 3OM1A 2RGYA 4MR7B 3FDFA 1ZH4A 3HEBA 2L19A 3LOPA 3QEMA 4XLTA 3LKVA 2GBPA 3IPAA 5T7BA 2IDMA 2A9QA 1Z25A 2R4QA 3KYJB 2ID9A 1USKA 4EVSA 1DRJA 1USGA 4RK6A 1I3CA
chains in the Genus database with same CATH superfamily
2Z98A 3I9MA 4KK4A 3I6ZA 1FTQA 2V6FA 2R6R1 2Y27A 4DPKA 3T3NA 1OGYA 3K9WA 3D5QA 3W8RA 3HO1A 1G63A 2PJRA 1QOQB 4TL9A 2GB4A 1CZKA 3REQB 1A9XB 1EIWA 1P3DA 1VPTA 1YNOA 3KHTA 2PGLA 3OQ6A 3CNLA 3AJEA 4EO9A 4WKNA 2ZCVA 5IF9A 2VP5A 3CZPA 3OLXA 5E4TA 5CH3A 1BQ3A 4JY7A 4LV5B 4R2HA 1LEHA 5JAOA 2QUBA 1O96B 5LQUA 4NMWA 5ALGA 1TK2A 3D6AA 3ANSA 3MF4A 1AK2A 1IULA 3AESB 3LVFO 1KGDA 1FRVA 3PL1A 2RGNA 3CT4A 5FWXA 5IT4A 1MPXA 4HH4A 1SKQA 2DHQA 2LRHA 2ZYRA 2V1UA 2PCLA 3ZIDA 2ISSD 3F3KA 1GTL1 4GX0A 1ID1A 3I9KA 3STUA 2D8AA 3D59A 3GEEA 2ZAOA 3AHCA 4U5QA 3KXDA 5CYFA 2L82A 5D2CA 3U37A 5JC8A 5K0CA 2GPJA 4Y1EA 1OR8A 4BB5A 5LQAA 4AJ9A 4JXXA 4BMOB 1S7GA 5A4IS 2XZTA 4B2LA 1VLZA 5I4KA 4B46A 1N0IA 4QQNA 4MYDA 3KTFA 4YAKA 2GPNA 3KCQA 3W3AD 1D4ZA 4PZEA 2D3WA 3GOHA 3CR7A 2DFDA 3R6WA 4AZWA 2VCEA 3PPIA 1U1DA 1XOIA 3EK2A 4U7FA 1C5KA 4MVJE 1J39A 5B1IA 1AF7A 2QYOA 3ORHA 4JLNA 4ER3A 1D6NA 3IPLA 3LT0A 4TT3A 3SBEA 3SZOA 1YGPA 2C2OA 2ZE6A 2OORA 3WMEA 1T3TA 3FXAA 3SHOA 2YHBA 1WUYA 1C0EA 1Y3DE 3GFPA 1BVHA 1P2UA 4ZO7A 5CM8B 2MJLA 3HCRA 2BVNA 4HQNA 5DTEA 4G24A 2WUFA 3PPVA 5I9TA 4ZHSA 2QNBA 1RBZA 2CLHB 4ODIA 3EGIA 4K0KB 5KINB 1E2LA 3I52A 2JPDA 1B16A 5DM60 3GJZA 1MABB 4MYHA 2XDYA 2G8LA 3R4CA 5ABPA 1ITZA 1ENOA 1ZISA 2HADA 2ZG6A 3MERA 4PXAA 3OM8A 4PYRA 3SYTA 5KYXB 4BX2A 3BBPA 5REQB 4LY0A 4YJGB 2IDZA 1X9IA 3LY5A 1SH7A 2AG0A 2XE8A 3S2GA 1C0IA 3UQZA 1NVBA 1I4TD 3RSSA 3BOSA 4YMHA 3AV0B 1P7YA 3KYBA 5IDVA 4EG4A 2WU8A 5IWCA 5AR1A 2ODTX 1H8EA 4BUJA 4KO1S 1JKIA 2SKDA 4V24A 1VI5A 4JGIA 5AJTA 1SVKA 3UMCA 2RBGA 3VHLB 2ZJ5A 3HXLA 3IMKA 4GI2A 4J94A 4JJ4A 4CJXA 5EJ8A 1N6PA 2BBWA 3WA7A 1ECFA 3O84A 4RQAA 5G3ZA 5F9HA 4JX8A 4KGXA 3EZXA 1KEWA 4CKYA 4MPJA 5BW8A 1M2FA 1EGMB 3QENA 3HM2A 4BBZA 4EPWA 1Q1ZA 2CCJA 4PVCA 1MR3F 1Q0PA 4N76A 1CHDA 10MHA 1U8EA 4ANFA 2EARA 3SXUB 4IWYA 1U90A 1W6RA 2A78A 3RI3A 2H0AA 5C4MA 2MIIA 4G1BA 2PL1A 4GL4A 4NJMB 1KAQA 2XNKA 3PPYA 1OYVA 2XA1A 2ZWPA 1QO0A 1QHHB 3AHEA 1FIUA 2D5CA 1JG4A 2W93A 5KPDA 2B61A 4PNHA 2X2OA 3IMEA 3AB3A 4WK2B 1U2DA 2O3JA 2ANCA 3A3YA 4LNUB 3W5HA 3W2TA 3WADA 2VRCD 1HR0B 3RRZA 2FCAA 4RWEA 1GAXA 1LC3A 3LP5A 4JKIA 2QTMA 3UK6A 3P9CA 5IKPA 2GHTA 4FI3C 3EEOA 2EERA 1EFLA 2I1QA 2Y1FA 3H6HA 3JATA 4ZOQI 4Q0MA 2I65A 2ZSEA 2C04A 1NJ2A 3EDYA 5E9JA 5KC8A 4COOA 2QRHA 1AUVA 3AUXA 1ZO8A 2DECA 2IZZA 3L4SO 4NOLA 4KWHA 1D3AA 4HCJA 1RQ2A 1XZHA 2NTJA 1DQNA 2HCTA 2R86A 2ZRKA 1BC5A 3BGOS 3KQQA 5DI3A 1EINA 3PC8C 2V5AA 2LW7A 3ELBA 3AKEA 1FUKA 3E7FA 4KO2S 4WK6A 3PDIA 3VR3D 1TVKA 1O5IA 4ZVOA 2O5RA 1Y8QA 1ZJJA 5MDHA 2JLYA 3T4PA 1CUJA 2YX1A 1BVRA 1K5PA 2XMRA 3ECSA 2YYAA 3D1LA 3ITNA 3IKTA 3HKBB 4F4FA 2J4FA 5CJ2A 1O54A 1IZ9A 2GJ8A 3OT1A 4Q9LA 1CDEA 3JQ8A 1MEEA 4V03A 4IDAA 4XGIA 3EHDA 4G5SA 4J7XA 2YRXA 3E1GA 1IIRA 3IDSA 1XV5A 4IJKA 3ILXA 5JJKA 1FBNA 2NUAA 3STXA 2O3UA 1UZNA 4TOIA 3VKHA 1ZD8A 4OYRA 1I5OA 2VDWB 3EAGA 3PJRA 4I08A 1KY3A 4BAZA 4EHAA 5EJGA 1WF6A 1ZONA 5C8VA 1Y8RA 2J3EA 3A3KA 3KWLA 1W44A 2J67A 1M34B 2H31A 1IBCA 4UASA 4Q9JA 3Q2KA 3IVCA 5K8LA 4BWFB 3MOIA 2HU8A 5DN9A 4CLRB 3AINA 1MB9A 4RE5A 1T15A 2O0HA 4X1IB 4DR2B 3ABQB 2VWPA 3CFYA 5KJ6A 1UFQA 1G6Q1 3UAWA 3DE2X 1FDWA 3JD3A 4R1LA 4BNKA 2V45A 1SOUA 4RA6A 4F0JA 1G4AE 1PSDA 2QE7A 4B80A 3LDAA 3Q3CA 2JFUA 3FM9A 5JMPA 3FRHA 3QH4A 3VZQA 3FGZA 1R9NA 3TOXA 2BM0A 1N7HA 1NKSA 1ZD5A 2GD6A 3W5CA 1J20A 3ZCXA 4ID9A 5IMSA 1OBCA 3OE7A 4YRTA 4CM6A 4YRZA 3NMUF 1UBEA 3GRUA 3I2FA 4V0SA 1IMOA 5C81A 4UVDA 1GZ7A 1VL2A 4DG8A 4FFNA 1YRBA 4BCDA 3FZEA 5IZ4A 1NBIA 3UW3A 1E1KA 1VE3A 2XQJA 4YJHB 1IQUA 1QCZA 1FFXB 2GBLC 1YULA 2WJVA 4IQ8A 1II8A 4F9FA 1R9MA 1FSGA 5JWRA 3L6EA 3LC7O 4Q1CA 3UK1A 5B36A 2MSEB 1I14A 3J80A 1TQDA 4EJSA 3AR8A 2MSKA 4IR7A 1X7XB 5IXYA 2VDQB 3A1TA 5TF4A 1E9BA 1QF7A 3UJ6A 1DBSA 1UZUA 1Z5WA 5ANRB 3HB9A 3DMNA 4H7IA 5DW0A 3QPUA 4G07A 3OD1A 4TUYB 4NONA 3PGKA 3QSGA 1RRKA 2I6QA 3H1AA 3ZWKA 3FUXA 4DR4B 2H2HA 5K8IA 2VYCA 2FUKA 4GMHA 1XT6A 821PA 5ILGA 1JG3A 3EWIA 1FA9A 2AZDA 2IOQA 2VWQA 2NQTA 4H35A 4KFRA 2YTZA 4Q05A 2ZZKA 5F3WB 1PEYA 2O7RA 2VP3A 1SXJA 3E0XA 3NNNA 4NDZA 3QRWA 3JQAA 5IWAB 3HKDB 5EIOA 2JEZA 3ROFA 4OREX 4UTXA 3GXBA 2OA0A 4J7AA 1B6RA 3IMFA 1P0FA 2Z2JA 2C5SA 4UOEA 2UXBB 3ETJA 4UHEA 2V03A 1OTHA 2BV3A 4TQ9A 2B5VA 4H9GA 3TOSA 4P3NA 1CZHA 4MYSA 4KCGA 2GCIA 2FDRA 5EFOA 1E8DA 2XSZD 4TQGA 3RQSA 4BGEA 3TDNA 4Q03A 1CJKC 2BGWA 1E2UA 1G9TA 4L9WA 4I4LA 3SSNA 1OROA 4BJ3A 5JJCA 1HK7A 2OGUA 2GBIA 4P4NA 1HQKA 4BVKA 5JNLA 3ZCRA 4EZBA 3D6HA 1C4XA 2OZLB 4AYTA 2A92A 3NBFA 4LDQA 1MIHA 2B8JA 1VBFA 5AHXA 5AKYA 4Z6KA 4Z5XA 1S3FA 2QL7A 2DFTA 4JJ8A 2QRKA 2R6ZA 2AJTA 3OICA 2X6QA 2PO7A 2ZEJA 3K96A 5CDGA 1J2EA 1CEQA 1FEZA 1QH9A 3EVTA 1OZ0A 1XYVA 3ENZA 1W5SA 3F4BA 3K8QA 1U9IA 3QBJA 4HXEB 2OV4A 5KYUA 4GXRA 5G1OA 1JQ5A 3COZA 1AO3A 3KL2A 1BZYA 2NV0A 1GGJA 4JVSB 4QDKA 4Q24A 2I54A 5K6AC 4FE7A 1XROA 4QYIB 1N2EA 1SXQA 3T4EA 5JXIA 3RSGA 3W90A 1UODA 3OMWA 4IM7A 2EW8A 1JFTA 3GVPA 3GL9A 5TNXA 1F2DA 1T13A 3COVA 3QIAA 1IG3A 4IQFA 1ADGA 2R5WA 5DTRA 3WG9A 1OC4A 1RRCA 4PIVA 4LC1A 1N2IA 4M9SA 3D6VA 3RUAA 3I6BA 3ZY5A 1P1IA 1HG1A 2YS6A 3WIUA 4UAGA 3HVIA 5CXQA 5TQJA 1KFKB 3IEMA 1VLJA 4BO8A 4KDEA 3JALA 4OBBA 1G20A 4R5HA 5HIKA 5JMOA 1EWTA 3AETA 3TIFA 2VFAA 3G3EA 4JYBA 4JOBA 5CURA 3T99A 3GP8A 2QL9A 1SQ6A 3PRKE 5JDCC 1ZKMA 5CLLA 3NTOA 4P4LA 4XX0B 2E5WA 2WWIA 3H0CA 3NTRA 4LK3A 5AOBA 4Q93A 3REQA 2ZI7A 3FMGA 1KSHA 1NTRA 1RYFA 2Q1YA 5A6SA 2C8KA 1C9MA 1NVKA 3LVRE 1CB7A 2IPLA 4H7DA 4PLTA 1UJCA 1Q95A 2ZUUA 5P8WA 5GVSA 1Z4NA 2PVCA 2YVUA 4BN4A 4JUIA 2YMQA 3QOXA 5J43A 1NLYA 2CVHA 4HNAB 5CFZA 2W2TA 3Q0EA 4HFNA 5EY5B 3D3WB 4GM1A 4UMDA 1O96A 3Q3JB 3QPAA 1YZQA 3M6WA 2W2LA 1Y63A 2QSZA 5LA6F 3GP3A 3X44A 4B3SB 2ZIUB 1JSRA 2IXEA 1U1CA 2E2WA 3S28A 4ZVTA 1ODTC 1H1TA 1R4AA 3AIOA 5ENZA 2WMYA 4A36A 4POAA 3D43A 5HCNA 1NR7A 4EPVA 1WB9A 3W8EA 4Q39A 1A04A 1TZ2A 3JQQA 1Z16A 2M6SA 4IKEA 1A9SA 3RM3A 2YW9A 3CJTA 3CB2A 3A4LA 3P9RA 4P3OA 4YT5A 4GKKB 1ZH8A 1Q21A 4LC9A 3EZ6A 3W77A 1FXWA 4LZZA 1FQKA 1EM6A 1SBZA 5FR1A 3EPKA 3FDZB 4H4DA 4AIIA 2G0AA 1VIVA 3KX2A 3NHJA 3PDWA 1DQSA 1NVFA 2RI0A 3TEMA 4AWBA 4KUEA 3UF0A 1E18A 3IIEA 1K6EA 3MUFA 2DC1A 3BUSA 4GS5A 5MHTA 2DTDA 5K4GA 2PS0A 4DBVO 1EDEA 4YUWA 4P33A 4JT9A 4QUEA 3CNHA 4YRQA 1M8GA 5AVTA 1GU7A 1P1KA 1ZMXA 3PR2B 3HZOA 3EVAA 1U0FA 1L7QA 1SBCA 5LZ8A 1ZQ9A 1FNNA 3K30A 5C2JB 3QBTA 2B83A 1F06A 4OI1A 3EMDA 3Q8MA 3G88A 3EAQA 3C3MA 1FW6A 2ZYVX 1SXHA 5KYYB 2O4UX 2GM9A 1E1RD 3PUWA 4F8EA 5ALJA 1XK6A 4UVHA 4YGYA 4BVLA 5JPDA 4KG7A 1ZP6A 5TPWA 5CB8A 1UBTS 3HBNA 2XBUA 5KYXA 3ZDCA 1UC9A 3KZMA 2QV7A 3F6CA 4LSWA 4YJGA 3WL6A 2NT4A 1W5AA 3G2LA 2FW6A 3B7PA 3IXMA 3GEHA 1LKZA 3L8YA 5A9SB 5B1DA 3D7LA 2QKYA 4WGFA 2O6HA 4OUKX 4R2IA 2E87A 2UZ4A 1SQ0A 2A57A 4MMXB 5JG7A 5LIPA 3OI7A 2QN7A 4NQRA 4ESHA 2AKEA 3NT4A 3PKJA 1MP0A 4PVDA 4BCBA 2RH9B 1LRKA 3WQSB 3OY7A 3OT4A 3WIEA 1H4SA 3LO5A 5CB4F 4BNIA 4DYHA 5AUOB 2OM2A 1ND6A 3HFRA 3KETA 3K9CA 1MNAA 3HEAA 4YUVA 1WE2A 2OXFA 5C3MA 2F3QA 4CQMA 4BVEA 3AHIA 2WU4A 1K5GA 1UEXC 2APJA 1SBQA 1FMCA 2YNMA 3A1CA 4JEIA 2CGEA 3HJAA 4MI3A 1GGVA 2V4ZA 3I76A 4P53A 1H6CA 2HDOA 3BMOA 3K6RA 2Z5FA 4GMKA 1QHHA 2VXCA 3E5MA 1YSCA 5JAQA 3OCZA 3FGNA 3U3OA 4UTOA 2WFZA 3QWHA 4QUKA 2WSMA 1OV4A 4YX9A 1G38A 5IDWA 3L0IB 4R1UA 1M0WA 1QE0A 4UM5A 1ZCAA 4TWIA 3FAZA 1WXDA 1SN7A 2H17A 4F9TA 1O7JA 4KIUA 1SOMA 5HIJA 5TXGA 2V9PA 3LJKA 3HJTA 3SYMA 3VX4A 3W0LB 3PSAA 1QHEA 3N05A 4ZOLF 1ZIPA 2B2NA 3ZDZB 3ZVLA 3CX7A 3WBJA 3QVKA 2ZIEA 4TYNA 1VC2A 2AJ8A 2VP6A 1H2RS 4GXQA 3T15A 1MIOB 4M3NA 3UZUA 3H17A 2WPNA 3ZWXA 1Y7LA 2PGDA 4K40A 4MZDA 2Z8XA 4N03A 1XQXA 4ND8A 1O08A 1YCHA 1A5TA 3R0ZA 1P2GA 3L49A 4XGNA 4EVQA 1U0SY 2IU3A 1MUUA 3Q1KA 3T5GA 4E5NA 2G8NA 2RSLA 4P0QB 3KJHA 4M53A 4IYJA 1F1BA 4YRDA 3QV1A 5EZSA 2ODNA 2DY0A 5CT4A 1NQVA 2I55A 4PG4A 5HILA 4P7KA 1S5PA 3OE5A 2N46A 3K94A 3OUZA 3RSFA 4PXSA 1CY2A 1WQ3A 3LLVA 2J3LA 3FPEA 5B3KA 2VDWA 2FPMA 3I04M 1C7ZA 4YP0A 4CM7A 4E6EA 1M75A 3I12A 5ADVA 2QDKA 2HUNA 3UJ8A 4AAYA 2XCOA 5HBGA 5I7HA 1Z8NA 2A9RA 4ND2A 2GCEA 4QQ8A 2ZWOA 3LF1A 3KXKA 1F4PA 1M34A 2QVBA 3DL2A 3STYA 1XEXB 1PNQA 4MS4A 2DBQA 5EQJB 3P4UA 5K3CA 3RASA 3IIJA 2DPYA 1K4YA 4TRRA 4G25A 3FGOA 4ZA2A 3CO0S 2HJGA 3NT5A 1D1TA 2YBEA 4X1IA 4V1CI 5TQ0B 3FTFA 4C0LA 3EULA 2Q1WA 3M5WA 3KYIB 2BI4A 4KVGA 2ZUWA 3DGFC 4BBPA 2BFWA 4KAJA 4MW0A 4ZTBA 1J9ZA 4HAOA 3HDYA 4HMOA 3VJKA 2ZIZA 4FNAA 5BVHB 5JI2E 3OVMA 5EJ5A 2H6EA 1ECPA 1PNTA 4ILKA 1ZSNA 3QPCA 3QFSA 2FPXA 1D9ZA 4GGMX 3WFIA 5AFSA 1SCAA 3QGMA 4FDAA 5C7LO 3RT7A 4CVNA 4DPMA 1N36B 1J2RA 4OQLA 2VQ6A 2E21A 1V11A 5KVSA 1ADJA 2ASEA 3F7OA 3EOBI 4JT8A 2EXXA 2HMSA 4N12A 3PQ3A 4K6FA 4YJHA 4DDUA 1FFXA 3L9XA 3TH5A 5EE9A 3TS1A 5IJ0A 2JW5A 5JASA 1A4UA 3H87A 3ZU2A 4UBKA 1NBOA 4P6VF 4U02A 1ZG3A 1I1OA 1ZZGA 2OILA 2WFLB 3CGWA 4JX9A 4DSOA 5I7OA 5K0FA 1NU8A 2HLPA 3FCYA 3KXIA 1OWLA 1VHQA 4BO6A 3EVNA 4JR0A 4HDSA 4CF6A 3QSYA 1GR1A 3LLSA 5BO5A 5FB3A 4JODA 4TUYA 2UU9B 1DAKA 3JQBC 3OJCA 1G60A 1E3QA 4LY9A 3AL3A 3CVXA 5TGDA 3PPXA 1DE0A 3OX1A 5C7YA 3MMSA 4WPGA 4MIYA 2FZLA 4F60A 5J4YA 1J8FA 5EHZA 3WL3A 2OCKA 1CJCA 2HSZA 3OP1A 5BVGA 3L1VA 5FEMA 4UBMA 3HKDA 2BI8A 3ZZMA 3UG7A 2FOIA 2VLBA 5HRUA 4HB3A 1GU1A 3S55A 2R1VA 3CZMA 1N75A 3A9WA 2YXLA 4YP1A 2O8FB 1PFKA 4HG2A 4Y2UA 2J5KA 1DHTA 2V8BA 2ORED 1IXRC 1Z5ZA 1CZLA 1J5PA 1TB4A 2FW7A 4MCAA 1QQ5A 3I8OA 3JS5A 1YA6A 5HHTA 2F2TA 3WKAA 2VTKA 4Z7QB 1F9EA 3KOOA 4DDWA 2B3DA 3QLVA 5HOQA 2O8EB 3B2NA 2V5UA 4J76A 1VOTA 4IIDA 3Q9SA 2EG9A 2B99A 4PO3X 4EB8A 3DEJA 5GJBA 4PRYA 1TCBA 1P61B 4CMKA 1HL7A 1GZ4A 2HLDD 1GN9A 3GUHA 3T9CA 5AXDA 3ACDA 4DRZA 1MBZA 2OZLA 3PITA 4RMIA 3B38A 4BRSA 4E7OA 3ZVNA 1RYMA 1EDBA 3HFJA 3MSXA 4G0VA 1V25A 1BX3A 3KV1A 1UK9A 4MROA 4IDNA 4P7BA 4ZEMA 3EC2A 4AKTA 1BCSB 2Q5OA 2NSHA 3C7AA 3R5XA 2ZSFA 4MV6A 3UPDA 3VR1A 5GY7A 5CCDA 1T6YA 5EZYF 1YO6A 4DXDA 1OKKD 1QB8A 2Z4TA 3NRBA 1P18A 1V8ZA 2Q5EA 5HGXA 1GGHA 1TUBA 2IVFA 2OXIA 4TTJA 3TOZA 4L02A 5J4KA 3Q11A 4QYIA 5FWNA 1QXSA 3D5EA 5TVGA 1KMNA 2OG1A 5B6PA 3MLEA 5BRNA 5I6DA 3B6IA 3C1UA 3E0QA 3I0MA 4BYGA 5ISMA 2B7BA 5THXA 3O8QB 1X80A 4P81A 1UJMA 2X0EA 4PX3A 4TMZA 2REXB 3K0EA 3HVJA 2HF2A 3PFIA 1KZ6A 3VMFA 1AVTA 2WKPA 2AD1A 4IIHA 1JHVA 5FBQB 4JU8A 4EX6A 5EPUA 1QPBA 3K9NA 4PQEA 1LZKA 1SC1A 4GX5A 4N9WA 2I66A 5JC1A 1LS1A 2ZTUA 3B8EA 3NWEA 5F3RA 3NW9A 3VKFA 1ABFA 3BB3A 5C1IA 4BUCA 5ILOA 4RLFA 4EHIA 2FUG1 4WBNB 3VQTA 1U2TA 4D7AA 1CQIA 1JDJA 1OSNA 3P0EA 1FP2A 3TTSA 2PMFA 3FCOA 4UHHA 3E5RA 1C9YA 3EIXA 4PPYA 3Q5DA 1PNRA 5H0IA 3ZHQA 3C16C 4MITA 2JVJA 1O94C 3NDRA 4XX0A 4F46A 1B7GO 4M46A 4ZRNA 3TFQA 2IUUA 1S3SA 5LC1A 5G4LA 5IASA 2JJQA 3L84A 1N78A 4EKDA 5A5VA 4Q1AA 1JQ3A 4JA0A 1XNJA 1QKIA 1V39A 1E20A 1JR3D 1XTIA 1YOBA 3D3EA 4X1KA 3WGHA 2UZIR 3UC5A 4HNAA 1M72A 4RPCA 5LZ5A 4FEAA 2MWMA 1P1JA 4KN6A 3RKSA 2AF4C 2QZPA 3LWNA 3WS7A 4ALIA 4V39A 3UA3A 4YRCA 1I33A 2DUJA 2ZCUA 2YHIB 3FTPA 4IH4A 1XVLA 2G0TA 3HDJA 3K2BA 1BX0A 2ARKA 2I3AA 4MW5A 2B7LA 3BJRA 4BQOA 1TQ2A 1NVEA 3VR5H 4RTPA 2CLIB 2Z2KA 2H3HA 2FRDC 2QY9A 1CUEA 3BSFA 4HNGA 1UQRA 2G9RA 1H8HA 4ROSA 5K8UA 2DRIA 2NTVA 3GIWA 2OO3A 3VZSA 3Q7TA 1O6GA 3FHJA 1F20A 2OCPA 4YDRA 4IJ6A 3KQKA 4CKZA 4RPJA 4X00A 3W3ZB 3FJOA 1PG0A 2BR3A 2NX2A 4J75A 1N92A 1ODIA 4NBVA 4IRUB 3RFCA 4IUDS 1L9XA 1O1YA 2GJ9A 5C34B 3M2PA 1B1AA 3QVSA 2EW1A 4Y9RA 1HTTA 1QG2A 2C2YA 2WA1A 3OFKA 2F9LA 3JPWA 1OILA 4K0RA 4YJ3F 4EG7A 5JH7B 1TAQA 3DQZA 2WWYA 1IXZA 2HCBA 4JB2A 2C9OA 3PLAE 4ZEWA 2G25A 1Z0FA 1DT5A 2IRWA 4NE7A 3RTBA 4CRWB 5KZMB 4OI2A 1CU1A 2FH5B 3PZRA 5I9BA 1SC6A 1I7SB 3TECE 4YB8A 4D4MA 4LXGA 4F3KA 2GAIA 4BU0A 5JXWA 2M1ZA 3D8UA 4NU8X 4DDKA 1DKQA 4HSEA 2ZWMA 3DMTC 3C87A 3FDIA 4IEEA 1H4TA 1KARA 2DFKB 4KDCA 2BISA 3X1XA 2V6MA 3NBUA 5BUCA 1IBKB 2P4SA 1H9AA 2QUHA 2W6CX 5JSZB 4I9FA 4YASA 2FSPA 4UUBA 5CP8A 1XHEA 5LBIA 3VO8A 1OAKA 2XY4A 5C5EA 1M2OA 3NWOA 3OIWA 1N8NA 1NN1A 1QH8B 5J1TB 4UM9D 1EJBA 4M0LA 3ZDYB 4UE3S 4DY6A 4D4KA 4MP6A 4II3A 2AJCA 3S44A 5KKCA 4ZICA 1QGOA 1DLJA 1B0PA 5AXBA 2O20A 5A3SA 2XGJA 3T3HA 2OFWA 2PUHA 2DEUA 4GOXA 4E08A 4O2BB 2E82A 3G13A 3FOZA 5AI5A 2R6DA 4Z4EA 4R83A 5A9SA 4NPHA 3GN1A 2O05A 4RETA 1GRVA 5AKLA 1G5RA 1RYNA 1TM7E 4NENA 4D43A 5DGXA 2HT1A 2J5RA 1W76A 2HF8A 2IIVA 3DMFA 3ZWVA 4BFZA 4FCWA 3PZBA 2H1VA 3T7EA 4Q01A 5KYVA 4PFKA 1C9KA 2B1RA 2Y1OA 2XT0A 2UVQA 4FYYA 4BRZA 2W5UA 2MSLA 3TR6A 4I1PA 1VKNA 2HJVA 1XP8A 2J7PD 5ECDA 2ZTVA 4K1XA 4KSYA 2H3EA 1NVUQ 2CB9A 2PHZA 1N2JA 2XCUA 3BIFA 4PFSA 3BFVA 4QOHA 4BS9A 1L1QA 1FYDA 3MAGA 4HXYA 5FOQA 3DMHA 2PXHA 2JG3A 1GZDA 4U2EA 4U2KA 1NVVR 3DXFA 3EXFB 1I2ZA 3IAS6 3LRPA 5CVCA 2JLRA 4X93A 3VPXA 3WDLA 5CG1A 2ZTMA 3IAAA 5DV9A 9ATCA 1M6EX 4RABA 4ZRMA 1YB6A 1DP4A 4G4JA 4IG4A 4JJIA 4CHTA 5G0UA 2F6RA 4EB6B 4L5AA 3GPIA 5LZ7A 1XAIA 4M89A 1XG5A 1AXGA 1FLNA 1OFUX 1UK6A 2GXQA 2EDCA 2O7SA 2FKNA 3ONDA 3PUJA 5SYMA 2VSQA 5AJVB 3LT5A 1XPJA 4ARAA 3P9PA 4J3FA 3QXSA 1C0KA 5K0GA 1H4VB 1R8XA 2EQBA 5J4HA 2VHWA 1EJ0A 2BFFB 1S89A 2I2DA 4WLEA 1FFBA 4NFHA 4PSAA 4E3ZA 3TTVA 2V0GA 2X0DA 3C14C 2IZ6A 1A5AB 4PC2A 1VFPA 2F7SA 1MIOA 1E2MA 4UCXA 5HFJA 1MHTA 1PQYA 3C24A 3IGFA 2IUFA 3QYJA 5IVIA 4Y1GA 4EGCB 3AF6A 1J5XA 4DQVA 2GPYA 3I5MA 1DJOA 3LHIA 3ZE2B 2ZBVA 3ENVA 5DHQA 3BH0A 3HYCA 3TIXB 4LPKA 1Q6ZA 2VSFA 4JBNA 1AY0A 3PD0A 4IJ5A 5JS6A 1PNVA 1HKUA 2FGKA 1M7BA 2PIAA 3T0FA 5FBZA 3EFHA 3S8YA 3OJ0A 3I9JA 5U4XA 1SVSA 2WAXA 3ROEA 4E2FA 1IN7A 5B2ZA 4WL0A 3QA9A 1PV1A 1ULZA 2OZEA 3AR3A 4TMYA 3N8NA 2R4TA 3HI6A 3INTA 4E1BA 3ET5A 2C7OA 4IEIA 1GL3A 1DEHA 3ZXIA 5LP6C 2HBRA 3SIRA 5IVKA 4UTZA 4O1MA 1HA3A 3V4SA 3BQ9A 5HG0A 4UNQA 2EP7A 3VDXA 1XEXA 3MTJA 3KM0A 4PY2A 1YZHA 1E7SA 1IK4A 1MENA 1H23A 1TZBA 1AG9A 1VB5A 4ZZ3A 5KTNA 4JB8A 4MV9A 4EELA 2XGOA 3RADC 2HA3A 4G2TA 3EASA 4UEWA 3D6TB 3DL4A 3EIWA 3OC0A 3TQFA 4BFCA 3I2JA 2OCBA 1YBHA 2GA9A 2ZUFA 2J9RA 3I1FA 4EI7A 1Z15A 2HRBA 2G88A 5B4TA 1HMYA 5BVHA 3R20A 3CX6A 1P72A 3I72A 3N0XA 5A5FA 3B6ZA 1LTHR 1M5UA 4NHEA 1R10A 5AHOA 4GMDA 3IQHX 3TCXB 3BL8A 4QE3A 1JHAA 1YCFA 3WK6A 4ESOA 3CE6A 4PR3A 2UZAA 4RFLA 4ETNA 4F4DA 3F9IA 4II7A 3ZHUA 3UMRA 6PFKA 2OCDA 4EMBA 3DVRX 4PC6A 5CHEA 5AM5A 1Z74A 5F77A 4J3NA 3OJEA 3AR2A 3NBMA 2BTOA 5TJHA 3TG2A 1Z13A 2EP8A 4NMXB 3R3ZA 1P3JA 4JJ6A 2EGUA 1R6TA 3PXXA 3P0IA 3A32A 2WFLA 1FY2A 1A2KC 2IE0A 3BWVA 4PQFA 1W9HA 4CT0A 1W36C 1K7YA 1YQ9A 2HI0A 3PNLA 3RQIA 3VTAA 3WLJA 4QYSA 1UQTA 2J0UB 5I7FA 1OT3A 2FFJA 2XWQA 3K72B 3T5TA 1VRWA 2P41A 2PA0A 1OXBB 1J00A 3EJWA 3IR5A 4G5XA 3HJUA 4IIUA 4KV7A 1DUSA 4YJKA 3FIJA 1X8XA 5D86A 3EVFA 3ZQ4A 3N5CA 3CRVA 3KB1A 5I4IA 3NHLA 1P9OA 2DU8A 2FR1A 3K9LA 3RUFA 1HLGA 3N0RA 5AJZA 5I51A 5LOVA 2IYVA 3VAAA 2WIKA 2Q1XA 3TLXA 1B3BA 3JZIA 4V0NA 1WTCA 4FFVA 2Q7OE 1SZDA 1D04A 2H07A 4MZXA 2GPSA 4PO9A 3SMQA 5CUQA 1PVDA 2W8BA 3UJHA 6YASA 1GTRA 4Q1BA 1Z2DA 4A2CA 2BBTA 4WZAE 1YK1A 2HO4A 1AUOA 2CLMB 2Q46A 1TZMA 2WTXA 5DM70 1Q22A 2VAVA 4BMNA 1YF3A 1D03A 1TU4A 5EKUA 4DLUA 1OAOC 2D5AA 1VFNA 3X1DA 1L5FA 5TMPA 1O03A 3H2IA 5BN3A 2AG1A 3O47A 2WJYA 4XTCS 2ZE8A 1KQOA 1DRJA 2FWMX 3MWGA 2ZJ4A 4BNGA 4U2BA 3VC7A 1TTPB 2O8EA 2EP5A 4IJUA 5DASA 1N2CE 2ZW9A 1NBHA 3EC7A 4HDKB 5EIEA 4OLBA 1SCDA 5H68A 1K3FA 1BE8A 4LJ4A 1WXWA 1K63A 1LI4A 5AW1A 4EG6A 4GP9A 3MA0A 2DUWA 2NYVA 1SVUA 3AF2A 3N2YA 1Z26A 2L69A 2CYCA 3PP8A 3OJFA 2V98A 1RVV1 4RAOA 4AS3A 4DSZA 1UZLA 2C4UA 3BSWA 2Z95A 4R40A 1D8TA 1BCSA 2DFVA 4LMBA 4CMAA 4F9GA 1JMVA 2F3PA 3HLKA 2QMZA 1T36B 1CIVA 4OB6A 4WOKA 1JMKC 4BLOA 1NW9B 2GN4A 1C80A 2PX8A 2WWHA 1QHIA 3GA5A 2W0MA 2E5FA 3G5LA 5IC5A 4LQ4A 3RV3A 4FWBA 1FYFA 1PGJA 2BN4A 2WSIA 4B0PA 1DX4A 5GMOA 1EZ1A 3P5BA 4HGRA 1AKYA 3OCUA 3PNBA 2A5GA 4FB4A 1RXSA 2DT5A 2ZGVA 5AP9A 3O8QA 3YASA 3ZV6A 4KODA 1MFPA 4WW0A 3EA4A 3VR4D 3BFKA 2K7FA 2I9KA 2XF2A 2B4YA 1X15A 4GE0A 1XZAA 1KQGA 1YD7A 2WT9A 3ZH9B 3I01A 4XDZA 4X66B 1CR2A 1W85B 2O2EA 1C3EA 3PHBE 2VXOA 2JFVA 1NDUA 1XMQB 1SB9A 2D1YA 3V8PA 4UHKA 4YAFA 2F8MA 1W34A 3NM5A 4PO1A 3ZWBA 1F9AA 3B6JA 2BKXA 1W93A 4KH1A 3QUAA 4LSGA 4O4IA 4JB0A 2QAGC 1NV8A 2MHCA 4K2HA 5MFPA 2P68A 2XUQA 4MDEA 1XDUA 2JAUA 5I7AA 2VDOB 2BDUA 5K3EA 3AFOA 2Y76A 4DIEA 1ZU4A 2AOUB 4QFCA 5I4CA 3A8TA 2UYQA 3ADOA 3TD9A 3V7YA 1DDIA 5KNDA 4Y2JA 3JD4A 3I3SR 4IXDA 3HDTA 4ZQIA 3UOGA 4FD3A 3GLUA 3LC0A 5DFAA 4GOOD 2P9HA 4KIWA 1Z5PA 1K68A 1JEDA 2X3FA 2NU9B 4N82A 4U3JA 1A5ZA 5HJ5A 1Y4DE 4E5KA 5HM6A 4OYLA 3AW8A 3MAAC 4RHXA 4YO8A 3RYHA 1XELA 4OAQA 4XR4A 2VA9A 3Q41A 3KSZO 5IYZB 2ODWA 3MOGA 1JG7A 2J6BA 4ZOAA 5MGNA 4JJKA 4LF5B 3A2MA 1ACMA 2BLNA 1P1RA 1RLTA 1A96A 3S8MA 1PR2A 2C9DA 3SGLA 4JLPA 4ALJA 5CB0A 1AV6A 3KVVA 2HIHA 3G9QA 1FJGB 2HJHA 2VNIA 2W4IA 4I1SA 2ERCA 5JROA 4IIYA 5I9IA 1JEYB 4EY5A 2R8OA 1WZCA 2C4HA 1IN8A 3DXZA 4MB6A 5ECWA 4D9MA 4ZJYA 3JV7A 4DQ0A 4D5GA 1HSZA 2PSSA 2DR2A 1V2GA 2P79A 3L6BA 1UMDB 4EHLA 4MUYA 4Q3LA 2LCQA 4PV7A 5CM9C 2C3OA 2AKYA 4GI1A 4BC1A 2EQAA 1JVBA 3EMBA 1MX3A 4MV1A 2D4HA 1NUPA 2BMJA 2QZJA 1U7UA 4KX5A 4RKFA 2Q0QA 1FFDA 4C43A 1FU7A 1O2DA 5IJZA 2WJAA 5K20A 4MVJH 1IUNA 3MWKA 3P9IA 1XXLA 3LYLA 5FADA 4F2PA 4BE7B 5AUPB 1RQNA 4FEEA 3GRFA 2BFDB 3HMKA 2JIPA 4FSDA 5DOVA 3HJHA 3HFGA 2OUIA 1I32A 3RCBA 5JHHB 1L5KA 1H8ED 2XA2A 1N5LA 1GQFA 3D7NA 3VBEA 4DLSA 2O7NA 5JQWA 2Z5VA 2QPAA 1RJ9A 5JSZA 3HWSA 2C2KA 3DWGA 4V0LA 3FZGA 2GNPA 3KELA 3SFTA 1HLFA 4Y9UA 3FI9A 2Q7XA 3R40A 4FMBB 1QH8A 2CNWA 4B4KA 4RVDA 5CVDA 1VE6A 3WYBA 2VJKA 3EJ6A 4XDHA 4EA7A 5K0TA 3QHAA 1TVMA 4QECA 3AR4A 4OQQA 3FKSA 4OXNA 1XTVA 4YP5A 3UHJA 3OOYA 4C7JA 4BVAA 5CCEA 1Y5MA 2VDUE 5C0OE 2Z57A 4O2BA 1OX5A 3PQDA 3EWSA 1F0YA 3BHMA 3E84A 4OHZA 5E1OA 3RBVA 4DC1A 4P35A 1AUQA 3FPCA 3S2ZA 3FIUA 2C8JA 1F14A 1U9CA 2VK4A 2IYPA 4LF4B 4KXUA 1US8B 1UT8A 2PZ8A 3AY3A 3A4TA 4BNJA 1VMIA 1QZUA 2J9FB 5ETJA 4IRMA 1KJIA 1APBA 5CA0F 1U31A 2Q6IA 3NQ41 3CZ5A 3CEJA 3OU7A 4OFZA 3RU7A 8AT1A 4X62B 2IV7A 2KHZA 4MV5A 4QOJA 4XTRA 1OFVA 1RJWA 3BC1A 3KR2A 1KH3A 2HMUA 4V3BA 4XDYA 1IEQA 6LDHA 4EA8A 2C5BA 4MP3A 1ECBA 1XAJA 3Q10A 2HMVA 2MOKA 5IHPA 3U5ZB 2V9CA 2VHUA 2TS1A 2VPQA 4MA5A 2ZJZA 3HTXA 3CLUC 4KQFA 1RRVA 2RGBA 3MTAA 4HK4A 4BFTA 3U09A 3EXFA 1DDOA 1XMOB 4N41A 1WCXA 4JC5A 4L74A 2OB2A 2P4UA 2QE6A 1NXPA 3BJMA 3CZRA 2AOVA 1YVDA 4Z9AA 1X7HA 4LJAA 1ISMA 1M1YB 3KZOA 3RG8A 4EB6A 3RSZA 1GDTA 1QMPA 3OQ1A 4P36A 1HQYE 1N1MA 2UUOA 1X9HA 4B8WA 2UXDB 1V16B 3I2KA 4IH9A 1KZGB 4GT1A 1U7WA 3KIPA 1PZHA 1V5FA 2HA5A 2I8LA 3EIFA 4MLPA 5FF9A 3FYHA 3RUPA 2OBLA 1J9GA 5K0JA 4HDMA 4NZPA 4WZ6A 2BFFA 3N3AC 4XEUA 3AB7A 3N2LA 4MYRA 1DBIA 1Z7GA 4YQFA 3QWFA 1ISPA 2JBAB 5ADHA 3THYB 1HOXA 3E6AA 2XKBA 3G2QA 5M2QA 4GZLA 5BSEA 4NG4A 1UZMA 1HBJA 4IDBA 5ALXA 5ERXA 2XTZA 3S3TA 3DT8A 4AD8A 9LDBA 3RAEC 1DIRA 1NV9A 4TQAA 1VJ0A 3SPXA 3ZDDA 3LT4A 3R74A 3QP9A 3VYWA 1W7AA 1HE4A 2WK1A 3PUHA 4NBSA 2LIVA 5KMGA 4FHGA 4DDTA 2QE7D 3FWKA 3I9NA 3BFPA 1Q0HA 1CSEE 1L5RA 1S3GA 3IAEA 5EI5A 8OHMA 3PWZA 1RAGA 4KPUB 3H9CA 3V00A 3GJ0A 2BGUA 3MGAA 2DZDA 2HQBA 3C1OA 3FYSA 3BWEA 4DCMA 4JOSA 4OM7A 4X71A 3OE7D 2QN9A 3P2OA 1FUIA 5DMHA 1XN4A 2P62A 2OV2A 4AY3A 2CNDA 1BS9A 1UOQA 1ZGAA 1QG0A 4U5XA 5JBNA 4C0KA 3ZD6A 3AVYA 1OUMA 3UICA 2QLJA 1ZCZA 3PIDA 4H27A 1AJEA 3H83A 5JNSA 5DZSA 5C1PA 4CE6A 4FD2A 2EEZA 5JWHA 3ZJ5A 2PCJA 1L5HB 2PUEA 3HUUA 1SUSA 1YQXA 3OZRA 5LQSA 1I5EA 1Z88A 4UC0A 1U65A 1KKMA 3PUIA 3QI7A 5JD3A 2J5BA 2QPOA 4LMAA 4KLZA 5DSTA 3RK1A 1QO7A 2JCGA 1G8FA 3TQOA 4YYZA 2N9UA 1WMSA 2HHCA 1NQXA 1U0TA 5D00A 2C5GA 1C8LA 2G70A 2PY6A 4C03A 4BTLA 3NONA 4I1OA 2OYCA 4X97A 2VHCA 1YMUA 4Y2GA 3HJFA 1Z0SA 5EFZA 3IIKA 2YWXA 4Q7EA 1A72A 1RJDA 4ZCLA 1Z18A 4RXMA 3K4QA 1JUDA 4DW8A 4BO0A 4PCAA 1R3DA 4D9GA 1FFCA 1SKAA 4NP6A 4EY7A 1DJLA 1PJAA 2CJXA 3DB2A 3OZIA 3QLTA 5IDXA 2D13A 2HK9A 3QVMA 4IHQA 5DWQA 4DY4A 4OHYA 1NXTA 1SXJD 1Y9JA 3TIGA 3JQAD 1NVXQ 1SQSA 3OQVA 4V02A 1M6YA 2I6SA 1MOSA 3SS7X 5ER6A 1JZSA 2AOWA 4J07A 2FZGA 4H0FA 3VHXB 4ZZ1A 4I5FA 3FVTA 4IHJF 4Q19A 4RH1A 1Z6QA 2NYUA 2VAPA 3GFFA 4LXXA 2WMDA 4LV8B 4LSZA 4NZMA 4WINA 3VPSA 4ER0A 2JLXA 1E6LA 4RLHA 2PKCA 3KVRA 3TXAA 2NV2B 1DTEA 1N0HA 3IJPA 1UQUA 4MXDA 3STWA 1I24A 4N0QA 2VJCA 1KGSA 3WI7A 1FFYA 3ZLBA 1XMXA 4NYIR 2H9IA 5AW3A 2PRKA 3KAQA 4MUMA 3H6KA 3C5HA 1DVRA 1UWKA 4IDEA 4EW3A 4LDAA 1P9NA 3QFFA 4G5RA 4P3YA 2Z6VA 1FXSA 4WXRA 3E82A 5FX2A 3D0OA 3QE3A 3KD3A 4MEBA 4RTSA 1YBAA 3HKCB 5AT1A 3Q0IA 1QFXA 1QF6A 3KKLA 2HEGA 2TMKA 4UUQA 1QG4A 4XIIA 1CDDA 2IV3A 3K9GA 1NMZA 2VCYA 1KI2A 4BVHA 5DBIA 1B6SA 3JQFC 4A10A 2JI6A 3H2KA 1M2VB 1TJYA 4U9IS 1NY6A 2BEUB 3F8SA 3GYBA 4LHZA 4YCSA 1CW2B 3OQOA 4RENA 1L7VC 2WZCA 3J81k 4KTTE 3EXIB 1G8AA 2FSHA 1R88A 3ET4A 5HTOA 1F0NA 2IFTA 3OOJA 5DW3A 1P9LA 1J21A 1JFFA 4G65A 5GONB 4WZBB 4EJMA 2GKOA 1LDBA 9MHTA 2JBHA 4HDKA 4LOHA 1I9CA 4JMPA 2C57A 4LZWA 2DPGA 3MJDA 3WRVA 3MFYA 1XTTA 2C3MA 1TOAA 4IX9A 2ZWIA 2FK8A 3RF7A 4AY4A 1RU3A 1ML4A 1D8AA 1E8MA 3DEIA 1ZVKA 3SQXA 4AKSA 1G0OA 1FQJA 2P7HA 4L8VA 4TTQA 3HFSA 3RW9A 2O7VA 1D1PA 2FE4A 1NN5A 5CR9A 3SBDA 5KHLB 5A9RA 2RHGB 4QUJA 4RFSA 3ORRA 4KB5A 3FZNA 3V5NA 1QJCA 3NEAA 4EUKA 3WGOA 4BJ1A 4LE0A 1GVNB 2VZ0A 3Q3HA 3UUEA 5IX8A 1RMQA 2C9ZA 3QE2A 4NMMA 3FCXA 5JSYA 1TDJA 4GBMA 1FPQA 1G1MA 1DPGA 1BGVA 1G66A 2AXEA 4DV1B 4HX5A 1E3MA 1VHDA 2OXCA 3IE1A 2G04A 1UDRA 1ETUA 2FSIA 1DEXA 4LQLA 1RWVA 1TA4A 5FIUA 2PUFA 1XRNA 2PX0A 1W85A 3QFCA 1XYGA 2VJQA 4WHMA 5AOVA 3RAJA 4MUFA 5LXTF 1QQ6A 3B48A 3U26A 2EGHA 3OLYA 2CYAA 3FETA 2B37A 3BAZA 3OJXA 3SSMA 2WFAA 3ZZNA 4AJKA 5D1HA 1XZ8A 2W2LD 4TM7A 4RWZA 3EHEA 2EL9A 2X22A 1ZNXA 3KYCB 5AK4A 1HO3A 1LJ8A 5LMZA 1M74A 1W2WB 3C3EA 4MUEA 1JWLA 1X7ZB 3UENA 1X9GA 3C7DB 1YI0A 3V2HA 3VHQA 2AOUA 4WKCA 2NLOA 3GRCA 1NFQA 1S7CA 2Y2UA 1ZAYA 3B3QA 3ZVRA 2AQ8A 2C3UA 4PTYA 1ANKA 1I4DD 4OX9Y 4QVGA 4FFBB 3SLGA 3FPHA 1LBIA 3GLIE 3IAM6 2XRZA 3RYCB 1WZ2A 2J7KA 5DNAA 4CTKA 5KNCH 4ITVA 3T1HB 5G0TA 1U2RA 2NU9A 3H2YA 1R9JA 4AJPA 1XWIA 3F3YA 3E7PA 3LD9A 2GEKA 3UANA 2QQEA 2C2HA 2EZ8A 2PWYA 1YFZA 3PCTA 4FC6A 1KYYA 1RW4A 4K6CA 3HNOA 3WKEA 4F3RA 3VA7A 4ZTZB 3AY0A 2PV0A 3CBGA 1G2QA 5GQSA 3O8BA 1RVDA 4LGCA 4QRHA 3TW4A 2ZS9A 4OQFA 1GLGA 2BP7B 4EJFA 2FSSA 5EKXA 4BP8A 1C0LA 2VHTA 1P81A 3WRYC 2PXAA 3PVZA 4NCAA 2WHPB 4E07A 5JAUA 3NGMA 1SIUA 3GEBA 2NYAA 5KQRA 1FSZA 4OXYA 3VJRA 2EBHX 3ZJYA 3FLEA 3B51X 1E3TA 2VJMB 3KBBA 2GI4A 3U4IA 2NG1A 4L2IB 1H85A 1Z0AA 2X6TA 1JECA 3IUMA 4LC0A 1Q44A 2FRXA 2NTEA 1G42A 4C2TA 2ZRCA 1SU7A 4MS1B 3RHTA 3OPQA 2W7TA 2YWCA 3MGBA 1G3IA 2H1CA 5KSWB 5IFLA 2RFLA 1EXVA 3H9GA 1E1LA 2E89A 2Z58A 3DVSX 3TVDA 4YR9A 5K7SA 4N0DA 1YS2X 3GJ3A 3KVOA 4MGHA 3V9AA 5ER9A 1J5EB 4NX2A 1RACA 2BFDA 3DLTA 2XTAA 3QXCA 2A59A 4UM8B 4IDGA 4U9HS 4YV7A 3JARB 3A7EA 1ZH4A 1E7QA 2VEOA 5A2QA 4P3KA 3ZG6A 4PWZA 3PU6A 5HRAA 3C2QA 2B92A 3LKVA 4MRRA 4WJZA 4XLTA 5E2BA 3W5AA 1EHYA 4NYJR 2Y66A 3DBLB 1VMEA 1NMYA 3CW8X 4QPDA 4UARA 4RESA 4XWYA 5FBLB 1QK4A 2OSBA 5CLJA 1OLUB 4RPHA 4A8JC 4DBLE 1G8PA 1ONSA 4HB0A 4Q9HA 5D1NA 2QR2A 3NAQA 4RK6A 3HA5A 3GH3A 4CQMD 5INTA 5AW7A 1UK7A 2YNMD 3JQDA 4EP1A 1GDDA 4M54A 1DKMA 3GY0A 3M1AA 4DNOA 5KC9A 4Q3NA 3HB5X 1I94B 2J08A 1RM0A 3SDZA 4EB3A 1RZ3A 4DWVA 5AKXA 3KDAA 4AZVA 1KQ3A 2JKZA 2PGIA 4DCPA 2J9FA 3RGWS 3OAAD 3KRTA 4MQFB 2QS9A 2ZDHA 1AGNA 2NWQA 1DWQA 1YJXA 2ZI9A 3ENKA 3K8ZA 1UZAA 2FFAA 4OQEA 4LBYA 5EIWA 1E2BA 2VPTA 1JQEA 1ATZA 5TPZD 3NI2A 1LLUA 4L9RA 1A9YA 2BI7A 4J1TC 3RS0A 4BE9A 1TC2A 2WVJA 3EC1A 3EMVA 4KXNA 3NFYA 1FOEB 4S3MA 1IVSA 3SYLA 6AT1A 4B82A 4TV8F 1CBUA 1JF8A 1OYOA 1RHRA 1JPVA 4W6ZA 4YACA 3W5SA 4JI3B 1KQNA 2ZRFA 5KTTA 3ON5A 1JHUA 1JHMA 2WRZA 1GAJA 1YQWA 1Y33E 1WRBA 4MI9A 1QPGA 1AUXA 4J0DA 3V7NA 4B48A 3ETHA 2JHAA 3U3JA 3ZI7A 3ZXYA 3RBXA 4RZUA 1M1YA 4DA0A 1YDWA 1ZNZA 3GUCA 1OFTA 3OHSX 4FOLA 3B5EA 4H60A 2FZKA 2TECE 4JU9A 2D5LA 5DE3A 1KDPA 2O57A 3B13B 1D5WA 2PRIA 3QWIA 4N8SA 4R1TA 4PHHA 1KYWA 1A8UA 1RR6A 2QD3A 5AI6A 1P5RA 2ALJA 3D6JA 3W8DA 3QPWA 3R76A 2DJIA 2FYTA 3D7MA 3LHKA 1I8TA 4TSKA 1GCIA 4G5GA 4MI1A 4DYVA 1B74A 5T5QA 3HYSA 4B83A 1PWZA 1BDBA 1J1IA 2XNDA 5BSHA 3THYA 3O4RA 1TU3A 2QUAA 2WU0A 4QGHA 3LC1O 2EFHB 1NW5A 3PNVA 4JGGA 4LWOA 2JFGA 4D42A 2R8EA 3FOCA 2Q29A 1Q0SA 2BEWA 3M1IA 5E4YA 4K3UA 2E7ZA 3SZRA 2J0EA 4BO2A 3RGGA 1V5GA 3WK8A 4LKRA 4E46A 1H3FA 4GPEA 1IAVA 1Y9AA 3K0BA 1N2ZA 1W581 3MUOA 2CVQA 4GXNA 2J3IA 4UNSA 1D6JA 4YN3A 3WGVA 3WB9A 5JEEA 1IL0A 2Y2VA 1YZKA 3DKIA 3V42A 3WV5A 1F3OA 5K8TA 4A73A 3TMYA 1MO5A 2A1IA 3WLEA 3NHRA 1NA5A 1E92A 1L3BA 5HDQA 4KPUA 2GXUA 1BH6A 3C7CB 3EPPA 4FT4A 3EISA 4QVKA 1AH2A 5ALSA 2CXTA 3BGDA 4PAGA 2GFHA 4X0EA 4HDNB 4LA4A 3AU9A 1W59A 5FL7A 4ZJPA 1YS6A 2GZAA 2WFMA 4JP5A 2Q2OA 4OU5A 1MTZA 5THQA 2XOXA 1N6KA 2I3GA 2WUGA 4G09A 2WIFA 3QTTA 4X7RA 4UXHA 3OZUA 2YY6A 3IQZA 3AK4A 3R4VA 1L5HA 4A0GA 2VJPA 4ZCTA 1AQNA 4WZAA 3BJZA 1U8UA 3GJ8A 1AB5A 1BXRB 3CS3A 5DT9A 3ZGYA 4JL8A 4OOEA 1FMTA 4PQGA 1K75A 4C0WA 2PKQO 4LHXA 3T52A 3T5MA 4HPXB 5DX8A 5L7YA 1NHGA 2XUPA 1P7WA 1EPUA 1YU6A 3OZGA 4NCHA 4EW2A 4JVNA 3VVLA 2JFFA 4W5NA 3ICEA 4DNFA 2NIPA 2QOEA 4Q4JA 4QYTA 2J9GA 4TMWA 3H86A 2HMTA 4UBIA 1GPJA 2QN1A 1NF9A 4PSDA 2Z9DA 4RVHA 2MINA 1ADBA 3CTMA 5KAPA 4YRBA 1OREA 4CV2A 2QQ5A 4PPNA 2AW5A 2JFBA 4H7EA 1TZCA 4ARZB 4QJIA 3VU0A 1H2YA 2WB4A 2BFNA 2GF9A 3HBFA 2AE1A 4O2AB 1IJEA 3FI0A 4QTUB 4B0OA 3PKZA 4RZIA 2Z43A 1QOZA 3KNZA 4TS3A 4DIMA 5TRTA 1YFJA 4RPKA 2VK1A 3CE9A 2GWHA 3PQ7A 4Y2RA 4X3PA 2D54A 4TZTA 2WVHA 2I5PO 1HDOA 3G0IA 3R44A 3HXPA 4UZEA 3DEAA 3N0WA 5FCDA 4CV0A 4K9KA 1XPOA 2C8LA 3WLPA 4REOA 3V1MA 4BEBA 1LXCA 2CHQA 4JASB 3CNEA 3TE6A 3WLTA 2EJCA 2JIZA 1AXEA 3DV0B 1EH5A 3IRUA 5JECA 4GLBA 5LVAA 2PYDA 1MJNA 2ZRPA 3T3GA 4BWVA 1JDZA 1L4EA 2Y1KA 5DJ5A 1E3EA 5LJIA 3MQ2A 4UNRA 4DBLC 1BS1A 1NZDA 2CHUA 4QOIA 3WXMA 1M8PA 1CF4A 1I4EB 2CBGA 4EPRA 3BMQA 4FMCB 3NBXX 2JC3A 1NBME 1KEKA 1ZU5A 3EEQA 2I1VB 3ZHOA 1J49A 1JMYA 1JIVA 1HG0A 1UMCB 4OG2A 4F8YA 221PA 2IV2X 3WNDA 1OAAA 3HKCA 5E4FA 4AN0A 1M6VB 1KC3A 1A95A 1QIJA 1V7QA 3JYNA 3F7NA 5ALDA 5FH9A 4X5OA 1NN0A 1TO2E 1YQEA 1QH0A 1M2VA 3CIFA 3AMVA 3H1BA 1P2VA 1N6IA 5B7QA 2BEUA 3TMKA 4BMDA 3LKZA 4KQHA 3B6KA 4UUOA 4L7VA 3V48A 3EXIA 1ORHA 5AJUA 4IP0A 1K8ZB 3VSDA 4FTWA 1T1SA 4Z1MA 3A4VA 5C4GB 2O19A 5GONA 1R0RE 1Q0QA 3C8DA 1CE8A 3FZQA 3H4TA 4EHBA 1FU4A 3FWPA 2B30A 4EABA 4AKHA 3BN3A 4L1KA 4YDQA 5LP6F 5CM2Z 3TM5A 3U7QB 3LBYA 1HNXB 3WDKA 1M6WA 3IDZA 8MHTA 4YWHA 5DLQC 3L46A 2H0RA 4QDTA 1UEJA 3LU1A 3L41A 5DLEA 1RJGA 1A9PA 4RL6A 2AN1A 3QQ5A 1BU5A 4WOBA 1E5VA 5JQGB 1I7DA 3ANYB 2NP7A 1VKZA 3SC4A 1VJCA 1E77A 5BW6B 3P2KA 1C2TA 5D5HA 4ZI7B 2CVFA 2PLAA 3BD7A 5JYEA 1C3JA 4GZ6A 2AN4A 4PGHA 5LYJF 2V65A 4R6WA 1QH1B 2XCQA 4CV3A 2DQSA 2D7DA 4C4XA 2VWGA 4DCGA 1ZOPA 1WL8A 2J3DA 2O1WA 1KKUA 1EE9A 1RAEA 3TSAA 3RBZA 3ZE9A 2BGTA 2AC7A 1BXGA 3CWZA 4K87A 5JTUA 1IXYA 3S4YA 3C6BA 1GZUA 4W5HA 3ND5A 3FWZA 1CS0B 3L8EA 1MT3A 4QUHA 5K4AA 3ILVA 1MO2A 4UPVA 2C9YA 4UZSA 2GO7A 4KE9A 2GZMA 1RXEA 1KVQA 2R8XA 1Y0BA 2VQSA 4FYWA 4ZAGA 2EJTA 2HF9A 2KX7A 3SM3A 4BL5A 1CRPA 3AH8A 1H8HD 1VHJA 2ZR9A 3K5PA 2J0VA 1CJSA 3KQNA 4Z4HA 1CHNA 1KXZA 1JFLA 1YDMA 2AUMA 1ZI6A 3DZJA 2CFOA 4HS4A 4X3CA 2I99A 3BZBA 4QATA 4QPNA 2VQ3A 4XWTA 2X9GA 4ZOLB 5CDFE 4D0NA 4F3TA 1E4EB 1R66A 3NATA 1LFDB 1BHO1 1PP4A 1S2NA 1UL1X 1J6UA 1WBJB 2JZNA 3AEKA 4M98A 2VHQA 4WY2A 4EOGA 3USZA 4G26A 4ZJUA 3U81A 1T4BA 1ZOOA 1IXSB 4HWTA 5DIZA 2HBYA 4QG3A 4RPLA 4W9NC 3D4PA 3T0GA 1TAGA 3CNOA 3WO0A 4D74A 1M10A 2GCGA 2RC5A 3TBKA 2ZRBA 3HJCA 1DKRA 1DB3A 4NH0A 1MX9A 1OA1A 1ZMOA 2NQ2C 3N8HA 4M0KA 5JJLA 1K0FA 2EKLA 2WHPA 2R60A 2GD2A 4Z2YA 3NWJA 2AYXA 3Q8LA 2X0IA 2WF5A 4NI5A 3BK2A 2VVTA 1RHQA 3OPXA 5LQKA 2CNBA 4O5OA 1DADA 3GG2A 4XJVA 4CIBA 1I7NA 4ZAYA 3QKRB 3TSWA 3FDXA 1DC4A 3ZIAD 1GTJ1 5CK5A 1BFDA 3V4PB 2G4LA 2W00A 2HCJB 4D99A 2QYSA 3HPRA 2JIRA 3TVYA 3TTWA 1CQXA 4YFYA 4MS1A 1PLJA 3LRXA 1EK2A 3IQFA 4EKNB 4DN6A 4XWKA 2FFHA 1CRWG 1FE8A 2FTKE 4PYMA 4X90A 1QYCA 3R0JA 5FWYA 1H0KA 4MWSA 3O03A 5BWCA 3NHKA 3RUIA 2VNKA 3IQDB 4N49A 2BRUA 3AOEA 3WOVA 1VG8A 4BPRA 1K8YB 8GPBA 2ZR8A 3WWZA 2VOJA 3WWDA 3AF5A 4FGWA 4LPSA 1NX9A 4R2KA 4RZSA 2OBNA 1Z12A 3ZW8A 3TUZC 2C2MA 5BPHA 1YR7A 3GXOA 5CHYA 3JARA 2FDCA 5K1ZA 4WKOA 5FNZA 4B74A 5IG2A 1U8AA 3BA6A 1JDSA 4MVWA 4ER5A 3CJRA 3H2JA 3DJFA 3ZUPA 1ZN9A 1SBTA 2OCLA 3DBLA 3DOHA 3PQCA 3QJYA 1E7YA 1T3HA 2F1OA 3DE1X 4HWPA 5GJCA 1OLUA 4ZDIA 1J1UA 1SHJA 3B1VA 3I1YA 5D3QA 1CUWA 3RU3A 3G8DA 2Z9BA 3N2IA 1O89A 4TXHA 3H19A 4PZYA 4RFVA 4BKMA 4DIDA 4D0SA 3A2KA 3JVVA 2FR0A 1VL5A 2D1TA 1MOZA 1Y7IA 2W22A 3EXG1 3VU8A 5E8RA 3ZHSA 4RTMA 3BGSA 5JO0A 3IEUA 1RQGA 2AN5A 2C1ZA 3AU8A 3RTCA 3R6LA 3V4FA 2Y3IA 1DG9A 2A5LA 1MZPA 4ND4A 2X19A 3A1WA 5C7IO 4DA8A 3U44B 5EEHA 3PDCA 3V33A 1D7AA 5KKAA 2PANA 2GA8A 1VI6A 4X8MA 1KI6B 4EKGA 4W63A 4NBKA 1OB5A 2ZSIA 1DV2A 2ZPUA 1E9DA 2W2QA 5E7IA 2PZLA 2JKYA 3ANLA 3OZ7A 4RACA 5CNJA 4GQBA 3TKYA 4OHBA 2I7VA 3WGLA 4Z4QA 3ESCA 4RL4A 1BJRE 5HCIA 4MDYA 3ZHTA 5LD2C 2J41A 1I80A 3F67A 1U2GC 16PKA 3BIXA 1T5SA 3OFNA 5HUJA 4HVCA 3ESBA 4OHOA 4NYIQ 5DMXA 4HDOB 3RODA 4WNYA 2B1IA 3O4GA 4KQ6A 3OOEA 3VC2A 3ZJ4A 3C6ZA 1IVYA 3U4HA 5BSGA 5LMNB 1QGUB 2PTHA 4D46A 4OYHA 4BFUA 3HP7A 1AN9A 4QBHA 3U9LA 4DLRA 3MWDB 3WISA 1NRWA 1PK7A 1E64A 1BHJA 1YKFA 2B6NA 2P8JA 3ZY2A 3QEJA 2MT9A 1D0SA 1ZZEA 4E5PA 2VF4X 3AFIA 4P82A 4Q9KA 4TTIA 2OO7A 2H92A 4X65B 4C3VA 1TLTA 4OQMA 1MAWA 1BTOA 1I3KA 2B9EA 1TEHA 3E4CA 4MW7A 1V1RB 2JFWA 1PFGA 3PNKA 3DS8A 4FSHA 2AFIE 5GGYA 2EHDA 4QGBA 2ZM6B 4P0PB 2A9KA 4YAJA 1A27A 2XGSA 4EHNA 5TT0A 2G5PA 1NN3A 5JXGA 5JHGB 4EMSA 3HO6A 1XRMA 3RS8A 4C6RA 3DA8A 5EZYB 1XMPA 4WA8A 1Z5UA 1XVUA 2Y92A 4JSYA 2QIOA 1GNRA 2BDEA 3P9SA 3PE4A 2PKXA 3QG1A 4L8FA 1ULUA 3KPJA 3MCUA 3VI3B 4PONA 2YHAA 4G84A 1M66A 2BFEB 1ZW6A 4ZYYA 1SAYA 3C3KA 3GCWA 1ZNWA 3ONEA 1Y5IA 3IELA 2YZ2A 1PAUA 4FQ8A 4G5QA 4JENA 4RKQA 2IH2A 1PK9A 1BMFA 2F48A 2WJIA 1L9KA 4D9JA 4INJA 3W5IA 4CN8A 2CLEB 1P77A 2X58A 1XD2B 3NX4A 4BNZA 2DUUA 4QTZA 1YJBA 1WXEA 3H11B 3IT3A 1E9EA 2XVAA 5DP2A 2ZYDA 1C1DB 1RFLA 3A10A 1Y8ZA 2OAGA 3N0VA 1WUHS 3FYCA 3A6PC 1KAOA 3NDJA 3IB6A 3H2GA 2M6KA 1PBNA 3ESQA 3MQFA 3EXG2 5EP3A 4BE4A 3O3MB 5B1EA 2J5XA 2V7WA 2QMQA 3KKQA 1BXRA 1FDOA 2IYRA 5AHKA 4DM3A 4E4RA 1LW6E 3T5CA 2BFBA 3CPEA 2YN4A 4G41A 4P2GA 4XVCA 3HHPA 3GZNA 2F8TA 3BYZA 1Y82A 3MMXA 3O90A 4TZ6A 4B4WA 5BN5A 5CDTA 2MSCB 2QTTA 3OY2A 1Z82A 3DWFA 3THXA 2IZ1A 2XRYA 4LKOA 4L7QA 3VDRA 3JR7A 1E4VA 1U6JA 4K26A 3GELA 2L19A 3LOPA 5K51A 1Z4OA 2D3TA 5IT5A 4KN9S 1Z5GA 2OLKA 2F64A 3WYNA 4RVOA 5KTMA 1Q74A 1W88B 4TV9F 1MLDA 4YTEA 2FHPA 1WB5A 4IIEA 2AZ4A 3QXHA 5CVVA 1ECGA 4IW3B 4ARZA 3R9XA 3JASB 3SYRA 5AM4A 4O2AA 1SEPA 3FHCB 1OIWA 2G4VA 4K8RB 4QBFA 1PJLA 3FD8A 3R5HA 4M7PA 1KDYA 3QVXA 2RGWA 5AQEA 3TXXA 2HHAA 4GZMA 3MILA 3DZIA 3KSAC 7YASA 2FZ4A 1DCKA 2YMLA 2X5NA 4US1R 3WL4A 4ZI3A 3JZDA 1GUZA 2X8AA 2GKGA 1TJ5A 1RBYA 2W43A 4HGZA 3ZE7A 4CR8A 1YJ5A 1Z36A 3DV0A 4E0BA 3UB4A 4HGOA 3A6HA 4HNSA 1FL9A 2DB3A 4UREA 2ZIXB 2CMDA 2RH8A 4CEHA 4I4TF 2R751 4LXYA 1ZOIA 1Q5PA 4LF8B 4EUEA 1U7HA 2BFCB 2M32A 3OQHA 4HRXA 2E18A 5FI5A 2W2NA 1YC2A 4R7ZA 2PRJA 2V6BA 4G0YA 4LOIA 5JZBA 2WJ4A 3F4LA 3ZXUB 2J0QA 1M6VA 5JPCA 2JGAA 3IURA 4EF4A 1XUOA 3ICCA 2R7KA 1GUYA 2PE5A 2VJNA 5BURA 3ZGNA 4ID3A 1HNNA 3GDOA 5B58T 5D7BA 4PIPA 4C20A 1RAFA 1LNSA 3BG5A 3HY6A 1RYEA 3VAZA 2PUTA 5DNCA 3U39A 2V7GA 4NU6A 8ADHA 3IE2A 3C3AA 4CFZA 1DAFA 1FTNA 5CDYA 3O4JA 4I9GA 3DYIA 3PRJA 1FNDA 1BNCA 1K6JA 1WNTA 1A3CA 1ZUHA 3I3OA 4KU4A 4OBEA 2HR1A 3U7QA 4E30A 2BMEA 2TSYB 5FWDA 1VMAA 4NYJQ 3E9ZA 3JZMA 4BNHA 1H1DA 4B6FA 1TM5E 2JD2A 5EE0A 5EHGA 3A9TA 4ZT5A 3GBVA 5IDQA 3DDOA 2RHWA 3WGNA 3FVQA 4TL8A 3Q6NA 1IPEA 5JQGA 3AIIA 1SIBE 1SC3A 2F43B 2VHZA 4O63O 2O2IA 5JNTA 3T7RA 3O83A 2OKCA 2SNIE 3VOBA 4L0QA 4WLOA 2JGDA 3WB0A 5CB4A 2ZJOA 1JIKA 4M1TA 2Y93A 2XCRB 1QH1A 1RLOA 1CDOA 4JZKA 4MQEB 3SXJA 5IUJC 1FC0A 2PL5A 3PXDA 1WU8A 1X2BA 3CH4B 3LMKA 3PJEA 4AJIA 5CIYA 1JBKA 4I9NA 4DZTA 5KNDD 2ORWA 3ROKA 2OBBA 3BILA 2J3MA 1ODLA 4AJ2A 2GLTA 4WOCA 1ZSVA 4M9QA 3G9UA 4QLBA 4RTOA 1B4DA 1N34B 4ILEA 4WNAB 1ONOA 1LU9A 3IVGA 3FYUA 3I5UA 5K99A 5AO9A 2Q1UA 3RTAA 2FEOA 1CS0A 3P2JA 2XHZA 3WK5A 3EZYA 4F1JA 1GM5A 3N0TA 1LPPA 1EXWA 1G7SA 5H5JA 5DHRA 1GGMA 4FNGA 5CH5A 2VSXA 3T1VA 2PX3A 1GQRA 4YJ2F 5BY2A 5HZHA 2X1MA 4CDRA 2WOJA 4C08A 3W5BA 4KAXA 1UPXA 3S29A 4E12A 3E03A 2CL5A 5BSWA 4NULA 1H6DA 2IELA 3OWOA 4ZIRB 3DULA 2AYZA 3IESA 3PF9A 3B1WA 1JKFA 1GQYA 4LRUA 3N1UA 3L0CA 3TKAA 2GPAA 4ZCMA 1BN6A 4YLGA 1U8TA 3OBIA 4ZOLA 1E4EA 2HC9A 4HLNA 2P3OA 2V6JA 3GLHB 3JWGA 3O8CA 5J5AA 1ILWA 3U61B 2UVDA 1A98A 1SZPA 3GIDA 4O4LF 4RH0A 5D8DA 3F6RA 1YR8A 5EIFA 3UT5A 1KVTA 4GF5A 4OHPA 4TMVA 1CUVA 3HJNA 5HF9A 2Y1XA 4J3JA 4EW6A 4M1KA 2NM0A 1PR3A 1XLTC 2FPLA 1U9JA 1ECLA 2XBLA 1HURA 1GAWA 4IJWA 2VIIA 4CMEC 2EOAA 2I33A 5CXUA 4Z4GA 4AUNA 2CK3D 3V3KA 2WWVD 2QLMA 3LF2A 3LCCA 4L08A 4BHTA 4LJ6A 4N3NA 3MINB 2Q9AA 4OHRA 3TGWA 5BP7A 1U63A 1K6IA 3G2PA 1NQ5A 5KU7A 5EUQB 1O6CA 1QGYA 2CVZA 2EKBA 3LKDA 2BGJA 3MELA 3ESXA 4C4PA 4CN9A 5HKLA 2H1HA 3ESZA 2NUTA 3UOAB 1U0HC 1EMDA 4ITUA 3UN1A 3TIIA 2O8BB 3QKRA 4CEIB 3OA0A 3EPJA 2ZZMA 3OCWA 1KYQA 2G7MC 1ZD9A 2XMPA 5EWLB 1Y48E 1NI3A 1UMBB 2B25A 1XVTA 4GH5A 1GL6A 3OWXA 4L5JA 3WWCA 4NOMA 1UINA 1BRMA 1GYRA 1KRHA 1E1YA 4OMDA 2Y99A 4QUAA 3L7IA 3LIPA 3LCVB 3IX7A 3HXMA 4IL5A 1WV0A 5FA5A 1SU4A 3NIDB 3QW2A 5A7HA 1L8OA 3L7NA 1DJPA 2BKLA 1AQ6A 4EEZA 2VXYA 1JWBB 5GV7A 4RNDB 1E9SA 3Q3VA 2GOYA 4O4HF 2H57A 3EYWA 5AQ1A 1XTUA 4OSEA 1V8FA 1R6AA 3EVGA 5HUQA 1CETA 2AN9A 4JUAA 1QIIA 5FTKA 4D3YA 5HKBA 1DFIA 1QONA 3U60B 3EXHA 5B7PA 5GJWC 3SI7A 3MOSA 3F5SA 4B3BA 1K06A 13PKA 2EL7A 1U3WA 1EB8A 2OAQ1 1HYQA 2A0WA 2D2VA 3ANMA 4FVTA 4UDYX 3VPHA 1VCNA 3IEXA 3PX7A 3C45A 4XCXA 1GD1O 5FLYA 2JLQA 2VAWA 4XFKA 3ANTA 1UM9B 1HQDA 4KWIA 2OB1A 4ARBA 1QYDA 2X0NA 2X5JO 3W78A 3B1JA 2EKDA 3QVTA 2F3UA 4HUQB 5JWOA 3U44A 1JQLB 4KE6A 4CGYA 3GPDG 4IJQA 4NK5A 3LQRA 4GEGA 2PFGA 4U7GA 5IK2A 1E0JA 3G0HA 3LLUA 1GV1A 1JBQA 3CPJB 3HBJA 3HVUA 4ZXPA 3EIEA 2DOKA 3Q40A 1DTSA 3T4XA 1Z62A 3SDBA 421PA 3IODA 1WP4A 1YI8A 3LQKA 4UEKA 4AJEA 3IAS1 5KNBD 3L7LA 3OPYI 2G5GX 5JATA 5IBCA 1HYHA 3B2QA 4R41A 1S2GA 1CULC 1XD9A 5A06A 4NXNB 3D8HA 1QYWA 2OPHA 4XIYA 1EE1A 1ODSA 4BFWA 3ECAA 4DLZA 1MB0A 5CFMA 1Q0TA 1CNMA 3G8BA 1PVOA 1Y3IA 4ETWA 4N6NA 3LA8A 2YQ5A 4D4HA 2XUJA 4ZN6A 1MQAA 2BZGA 6REQA 1QGUA 2PQ0A 4QJBA 3R6TA 5J47A 5DH9A 1E62A 3MWDA 3UXEA 5LNK6 1K9SA 3DP7A 1AS3A 2VRWA 3IOEA 1IBSA 4JT2A 1L8LA 2QSYA 1ESEA 1ISIA 5EESA 2H8GA 2Y1GA 3PNYA 1Q7RA 4BZWA 2EATA 1ZA2A 1TC1A 1V1RA 2ODQA 3F0TA 4HS9A 2VP9A 1QCDA 4Y1FA 3R9XB 4XQ0A 2XQGA 1I13A 2AHOA 2I3BA 2Z6AA 1RABA 1WVGA 3DQPA 4BECA 1VPDA 5DK6A 1QC5B 4G1EB 3JYOA 1XCGB 4C6TB 4PE5B 3V55A 4Q66C 3GFBA 3NOOA 1DRKA 4CLEA 2W6ID 3INGA 2CMFA 3R8XA 5EZYA 3BCSA 3RO7A 3VH2A 2YY7A 1FVOA 2WUVA 1EGHA 4U4AA 4Y6LA 3O8OB 1HUQA 3H1EA 4H0NA 3IEVA 2C31A 1IZYA 2BFEA 3M5CA 1XRSB 2QVYX 4YA6A 1EHIA 3AHGA 1K5DA 5CAEB 1A4XA 4MQUA 1N5DA 2NU6B