3H5OA

The crystal structure of transcription regulator gntr from chromobacterium violaceum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
RTVLVLIPSLANTVFLETLTGIETVLDAAGYQMLIGNSHYDAGQELQLLRAYLQHRPDGVLITGLSHAEPFERILSQHALPVVYMMDLADDGRCCVGFSQEDAGAAITRHLLSRGKRRIGFLGAQLDERVMKRLDGYRAALDAADCRDAGLEWLDPQPSSMQMGADMLDRALAERPDCDALFCCNDDLAIGALARSQQLGIAVPERLAIAGFNDLQPAAWCTPPLTTVATPRRDIGVHAAKALLQLIDGEEPASRRADLGFRLMLRRSSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator GntR
publication title The crystal structure of transcription regulator GntR from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Transcription regulator
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA01
3F6PA 5EWMB 3OM0A 3JPWA 4QYMA 3ROFA 3N0WA 2IKSA 2MYNA 2R48A 3M9XA 4RXUA 1ZGZA 4N41A 2WRZA 3N0XA 4CBVA 5JNWA 2PUAA 2PUCA 2JVIA 5FWXB 1YS6A 3IPCA 3O75A 4KQ9A 2IPAB 5F64A 3RVLA 1USIA 1MIHA 3KJXA 3H5VA 3O21A 4F8JA 4MS4B 2F8TA 3IPAA 3KSMA 3SY8A 4EYOA 2JK1A 5TPZD 4YGXB 3NNNA 3LKVA 5JNRA 2E4UA 3C6QA 3C3WA 3T8YA 4Z4FA 5T7BA 5KC8A 2LIVA 5E3JA 1YS7A 3FMVA 3KHTA 3CZCA 2CHEA 3L49A 3H5LA 3M6MD 4YO7A 4MR7B 3O2JA 4ML3A 1QNLA 4YR7A 1M5UA 3F73A 1Z18A 2TMYA 4RK6A 1ZH2A 5ABPA 1VPWA 4NCBA 4YLEA 1KGSA 2VUHB 2JRLA 3R0JA 3SG0A 4MLCA 3RH0A 2PLNA 4W5OA 1Z15A 4Z4GA 3GL9A 1CEYA 1FSPA 2IPLA 2P9HA 4LE2A 4MQEA 4Z4IA 1ISRA 5TPZA 2NZUG 4OG2A 4PICA 1MAVA 4KV7A 1JH9A 3OM1A 2B4AA 4S05A 1U8TA 1LBHA 3IP5A 5T3YA 4TLMB 4KPYA 3OLZA 1M2EA 1JX6A 1JDPA 1ABEA 4MS3A 5FBHA 2WWVD 1Z17A 7ABPA 2OQRA 3LKBA 3NNSA 4XASA 3CS3A 3HM9A 4MR8A 2FMIA 3N6VA 4G0PA 3UUGA 1DBQA 4RDCA 4HNSA 5BQ3A 2GKGA 2L19A 2QVGA 4UHJA 1NXXA 2VUIB 1JWLA 4W5NA 1ZN2A 4JAVC 1TLFA 1NY5A 5EWLA 1ZVVA 2DRIA 3OLYA 2LPMA 3EAFA 4RV5A 3SAJA 3RVSA 1L5YA 3H6HA 3TD9A 3F7NA 1JYFA 3TX6A 4KNYA 1YK1A 4GPAA 4D6YA 1DBPA 3QX8A 2HSGA 2L18A 4JB2A 4MRMB 4ZPJA 3SQNA 4RU1A 1SXGA 1M2FA 2H3HA 4ETNA 4G0XA 4EYQA 3IDOA 3HEBA 4YRZA 3CU5A 2N9UA 5IEBA 1C0EA 3Q7SA 4ZMRA 1BDIA 1BDJA 4YP9A 2ZAYA 4G0MA 3A3KA 3FGZA 3S99A 4O1IA 2WJWA 4M88A 2JBAB 2MSWA 3GYBA 1DCFA 4B09A 5DLEA 2JB9A 2GI4A 3JVIA 3KTOA 4L4UA 3HVRA 2IDMA 1YK0A 1WETA 4LZLA 3A0RB 3O1IC 2FN8A 5EWMA 4E7PA 2PUBA 2R4QA 4OBBA 1DC7A 5JNVA 3NHZA 2I6FA 5B3JA 4HYEA 1P6QA 5CHYA 3MA0A 4Q7EA 3EQ2A 3KLOA 3MQ4A 4MQFB 4N47A 3QLUC 3QEMB 1GUDA 1Z2DA 2MYPA 1KRXA 2E4ZA 1QP7A 1GCGA 4D6XA 3HUTA 1H9CA 3B2NA 3P9YA 4RK0A 5PNTA 3VNAA 5DTEA 1CYEA 4DADA 2WJAA 3UKJA 2AYXA 3LUGA 1NXPA 1EFAA 2FSPA 1QO0D 3QLVC 2GWRA 4EVSA 3DGEC 1NXTA 2PAFA 3H1EA 3O1JC 4LDZA 3I5AA 4D74A 1APBA 5C5CA 2A9RA 2L17A 2QVCA 4OATA 2FLWA 4Z9AA 3W9SA 4E7OA 3O2SB 4F06A 3LMKA 1LJLA 1FFGA 4MR7A 4RK7A 1C4WA 3QELA 1OXBB 1U0SY 2AYZA 3N53A 1PNTA 4YS6A 3E61A 1ZHHA 4MLDA 4DQDA 3DLBA 1W9HA 1DC8A 3GBVA 4KZKA 3LTEA 3FFTA 3LUHA 4WUTA 1U2QA 2QV0A 3O2QB 5KI6A 5KQLA 3RVPA 2B1JA 3E3MA 3LOPA 2FQYA 5CNIA 3JY6A 5D2CA 1ABFA 4Z0NA 4LE1A 2HQBA 4PZ0A 3KKEA 1NATA 3GWGA 3JTEA 3K9CA 4ZJPA 4RSMA 5BRJA 1ZGGA 5KQPA 1QO0A 1JHZA 2IPNA 3Q7TA 1EWVA 4XXHA 4Z4HA 3CFYA 1D2AA 1IIBA 1DG9A 2QSJA 3T6KA 3BREA 5ED4A 4KQCA 3SM9A 1GUBA 4JB0A 4UHKA 1ZAYA 4ETIA 4G0ZA 1JL3A 1YVUA 3EDCA 3NBMA 1DRJA 2FN9A 5DKFA 3GA5A 4RKQA 2HJ9A 4MS1B 2H0AA 1E2BA 5TQ2A 2VYCA 2RDMA 4RK4A 4TN5A 5IUKC 1EWKA 3N0RA 4N76A 3H75A 3IP7A 1URPA 1XHEA 4L85A 3OMXA 3EJWA 3H5TA 3BRSA 3MIZA 3G1WA 4XFKA 2OENG 4PEVA 2NT3A 3IP9A 4ETMA 4G97A 4EYKA 4OTZA 3HK2A 3NNDA 1L5ZA 4WZZA 2QW1A 2WMYA 2PUDA 4MRMA 2LP4Y 4G0YA 1M5TA 4PE5B 1TM2A 3BILA 3K4HA 1XWWA 1DRKA 1JFTA 5TPWB 1P8AA 5EWJB 3O74A 3LUCA 3TO5A 3IP6A 4EVRA 1I3CA 2MSKA 3CTPA 3FFXA 1DJMA 2L2QA 2KYRA 3JS5A 2VK2A 1QP0A 4IMIB 1FQWA 3GRCA 3HZHA 4HNQA 2JBAA 2FMHA 2MYTA 3H5IA 1ZITA 1RNLA 4RY8A 1PHRA 5HKOA 3CG4A 3OLVA 2W42A 1YMUA 1P2FA 3HV2A 1TJYA 3MYYA 4QPJC 4RKRA 4IMJB 1BDHA 5HM6A 3T38A 2CHFA 3QLTA 4NV3A 5FWYA 3A0UA 2FQWA 4GNRA 1SXHA 1Z13A 4XLTA 2JVKA 4MQFA 4YCSA 3QEMA 4F3TA 2NUBA 4EVQA 3GV0A 4WT7A 3HCWA 5I4CA 3SNKA 2CWDA 1JF8A 1RPJA 1ZDMA 3CLKA 1B00A 8ABPA 1ZY2A 3F6CA 1U2PA 3HDGA 4N0QA 2PJUA 1D1QA 2LBPA 4NCAA 4LX8A 2A9OA 2FEWB 3CHYA 4KMRA 4KVFA 2GBPA 4MR9A 2NT4A 2WY2D 5KC9A 1EAYA 5JNUA 2FMFA 3JVDA 2FQXA 4Z99A 4YV7A 1DZ3A 4RXTA 3DBIA 3RVJA 5FWXA 4EYGA 4JA2A 1A2OA 1E6LA 3C3MA 5IC5A 3OQOA 4MGEA 2E4WA 3ILHA 4MS4A 1SD5A 1JYEA 4Z9BA 1AB6A 1NXSA 1QMPA 2RGYA 3DZDA 1USGA 4N03A 3RVRA 5EWLB 2PMCA 2MYUA 2PUEA 1TVMA 2PUFA 3KG2A 1LK0A 2HQOA 3EGCA 4FE4A 1T34A 1SXIA 3D02A 3NHMA 4MAAA 1VKRA 4QICA 3HXMA 2O20A 2X7XA 1QP4A 1KRWA 2E4VA 1SRRA 5JNTA 4XAQA 1F4VA 2QR3A 3H1FA 4IRXA 1DCMA 2V0NA 1RXIA 2QZJA 3Q41A 3HS3A 5IEJA 5TQ0B 4F12A 4TLLB 1NXWA 2QU7A 1PNRA 4EUKA 2ID7A 2ID9A 1PUXA 2E4XA 4LE0A 1PEAA 3C97A 4EY3A 1K68A 1NTRA 1JLKA 2FKAA 4KK3A 3LUAA 4NQRA 1DCKA 4IILA 2PUGA 2M1ZA 4H3HB 1D5WA 4Y9TA 5IUJC 2M98A 3OMWA 3HSYA 3TMYA 1VLZA 2A9PA 4KRFA 2JCGA 5BR1A 1Z25A 2IYNA 3HJFA 1R8JA 2PKXA 2XDYA 5TQJA 3LUKA 4TMYA 1BAPA 2J48A 4FE7A 4IF4A 1TMYA 3TB6A 3VNBA 2YHBA 1W25A 4RK1A 5BRAA 5TPWA 3OQMA 3LFTA 5EWJA 4Q6BA 4QYWA 5CNKA 5CNJA 3KYJB 1UDRA 1QPZA 4KREA 2P4UA 1RZRD 1EWTA 3H1GA 1QKKA 2RJOA 2BGGA 3KS9A 1ISSA 1MB0A 1S8NA 3FDFA 3CG0A 3H5OA 4RWEA 3URMA 5B3JC 2FEPA 4DN6A 1JFSA 2WB4A 3EODA 1YMVA 3BBLA 4W5TA 3I09A 3EQZA 4G0QA 4WXEA 3DGFC 3RVOA 2IOYA 4OLBA 1NXOA 3QELB 3RQIA 1KMIY 2R25B 3RVQA 3GBPA 2ZWMA 1P6UA 1E6KA 1F51E 3DLHA 3I45A 1Y1LA 1ZESA 2FMKA 3HDVA 3GT7A 3D8UA 2PE5A 3EULA 4JP1A 2PL9A 3H5WA 3OO1A 5IULC 3QLUA 2RJNA 1RZRA 1Z2EA 1U04A 3FFWA 3OLXA 4RS3A 3RVNA 4JOQA 4YWHA 1JDNA 2R47A 1CHNA 3JPYA 1Z26A 3O1HB 1BA2A 3HO1A 1RXEA 4WWHA 3QLVA 4O1HA 3QX9A 1DP4A 2HQRA 4PYRA 1EHCA 1YTUA 3A10A 2FEKA 3CKMA 2FTKE 2Q5CA 1FFSA 3N8IA 4LDAA 4P1ZA 4Z4CA 3RVKA 4G86A 4HNRA 1HEYA 1LBIA 3MM4A 5TQ2B 3L6UA 4ZMSA 2MSLA 2FXIA 1ZH4A 5KQGA 3HUUA 4MQEB 1AB5A 2F8SA 1NXVA 2LUOA 3BRQA 4JASB 4W5RA 1QQBA 5JS1A 3MF4A 4MPTA 4NICA 5IX8A 3LUFA 5FBKA 5TE9A 1A0OA 4EGSA 5DCLA 2NZVG 2JVJA 6ABPA 2YHAA 4MS3B 5TQ0A 3OQNA 4H60A 1A04A 3OO0A 9ABPA 4F11A 3CNBA 5HSGA 5IBQA 4RY9A 3LUDA 3T95A 1BVHA 4MR8B 1GLGA 1J56A 1OXKB 3ILYA 4H3KB 1Z16A 4KK4A 3QEKA 4RZSA 3MMNA 3LUJA 3I42A 3G85A 1GCAA 5C5EA 1D1PA 1FFWA 1E6MA 2HPHA 5IUNC 3KLNA 3QK7A 4RY0A 4MYRA 5FWYB 2GX6A 3Q9SA 5KQMA 4RXMA 1VRVA 4OLAA 3C3KA 5HQJA 2IPMA 2E4YA 1JFVA 3RVMA 3CRNA 1JBEA 4P98A 5GQSA 4XARA 1K66A 2QXYA 1USKA 1LJUA 4O5AA 2FW0A 4W5QA 1Z12A 3Q7RA 5CNMA 5GOTA 1MB3A 3KCNA 5JS2A 4N0PA 3N75A 4Q6WA 3Q15C 6CHYA 5KWSA 1D4ZA 1DBWA 3ROTA 2A9QA 4WXMA 3UK0A 1XHFA 4S04A 1QQAA 4ZYLA 1PEYA 4IGAA 1MVOA 3CZ5A 4MS1A 4RK5A 2CD7A 4G0OA 2FLKA 3M9WA 4FB4A 2PL1A 3OLWA 3KYIB 1YIOA 4LRQA 5DGCA 4MR9B 4KFCA 5JNSA 4Z4EA 2FVYA 3H6GA
chains in the Genus database with same CATH superfamily
4H4DA 5DNWA 1FSGA 5EWMB 1UJMA 3KKOA 1KIFA 1G8KA 1N7HA 2FN3A 1Q22A 3A25A 5C7YA 5L3QA 1PZFA 4DIDA 1Z7GA 3EEBA 2R48A 5FOWA 4N41A 4XB1A 2BONA 2ZBEA 2WWYA 1I1QB 4WI1A 2PUCA 1T9AA 1CZUA 1K75A 2E82A 4DWOA 3BD7A 3MD9A 3SXUB 1FYXA 3ZK8A 1ETHA 4L02A 4ZI7A 5BSGA 1JBKA 3J81A 1W59A 1KQ3A 3RVLA 3H1AA 3BD8A 3UCEA 3O03A 4IDFA 1UKVY 1ISPA 3M9LA 4FGSA 3V4LA 1SZPA 3OEYA 4J3JA 2XLCA 2P9QA 3G49A 3KZNA 3PFBA 2XXAA 1NBMD 3FYDA 3PF9A 1G6HA 1RIFA 3IESA 2KMLA 3SSMA 4HBGA 1YRLA 4HCJA 3EVZA 4BO8A 1M54A 1CDZA 5BW8A 2PX6A 5EIXA 4MWCA 1HH4A 3IBFA 3ZU5A 4F1JA 3FWNA 2B30A 3U13A 3BTVA 2C57A 3PXDA 3I2FA 3DE3X 3ABSB 3ONFA 1DARA 1ZD1A 3LWNA 2QVXX 3FLAA 3PEFA 4U8GA 2G25A 2HW8A 3ZE6A 1X9HA 5J2TA 2AIRA 1V7QA 1ZKMA 3A1UA 3E0QA 2FWJA 3OPYB 4H59A 5DHFA 1AUPA 3K94A 3Q6NA 4Q3CA 4C1NA 3NM4A 3WJ1A 1LBEA 4FYMA 2PX3A 3BTSA 1BQ3A 2JLXA 4Z4IA 1PX2A 1OWLA 2GHRA 5TMBA 3QMWA 2Q6KA 1U2ZA 4RL6A 3UK2A 4Q02A 1GAQA 1RQ7A 4DZRA 4DIMA 2D1YA 2ZUTA 2XCSB 1UPTA 4DY4A 2QZ9A 4PO9A 3SHQA 2IITA 1EDOA 3CVXA 4IHAA 4ZVSA 2J9XB 3IP5A 5BVHA 1JJBA 2ZUBA 3ZOKA 4EY6A 1FFDA 5JAIA 3U9TA 1RFGE 1LPBB 3W05A 5REQA 1TEXA 4QBIA 4ZRMA 1FFYA 4ND4A 2WWVD 1Z17A 5ULLA 1DIRA 3UWKA 1W1IA 1R3DA 5LZ2A 3HP7A 4RZ3A 4S1OA 4AJHA 4CHGA 3W5VA 5EJIA 3U3JA 3H6KA 4CF4A 4K05A 2WHPB 5I9SA 4RDCA 1HG0A 3ZHXA 1V6SA 3C5VA 1MF7A 4GHWA 4BLPA 1VGVA 5LKAA 2GM3A 1SM4A 4YT5A 1IWOA 1Y3CE 4RETA 1IULA 4ZOBA 2YKGA 4WOJA 5F4BA 3ABZA 4JP5A 3HYRA 3IFSA 2AOUB 4LCJA 1Q5PA 2F2TA 4LWPA 4J07A 1L5LA 4BMSA 4EGAA 1DQPA 1NQUA 1YK1A 1VXRA 2WG2A 3TSZA 1DBPA 2QG6A 1OR8A 2NX2A 4DLLA 3QU9A 2HSGA 2DUWA 1G20B 4RU1A 4ETNA 1TK2A 1P4HA 1IM5A 2OILA 1OH5A 3LBFA 2KW5A 3GRPA 3ZWOA 4ZMRA 5LQDA 2B34A 3NCTA 3HYSA 2ZAYA 4KIFA 2WTBA 1UADA 2BDUA 1GQRA 3JCZA 2IA5A 2C0PA 4MV8A 3FBWA 3U1VA 3CPEA 5TRTA 2CFTA 3MBKA 2MSWA 3GYBA 4B6RA 5FUWA 4HDRB 5G0WA 3PTLA 1P19A 2M6LA 4HADA 1VPTA 1KEUA 4YPOA 1J2JA 1EB9A 1W7AA 1WZCA 2RKBA 3PS9A 4TV8B 4ZCMA 3E7XA 2BISA 4C76A 2ZQ5A 3B1WA 4CIVA 3ISVA 4TKUB 5CEEA 3A9VA 1I0LA 1UBSB 1P7VA 2I6FA 1D4OA 4DLVA 1FTSA 5CHYA 4KNWA 3CONA 2PKRA 5T5QA 1UDAA 5AK4A 4MW4A 5BSKA 1GDTA 5C3MA 1VJ1A 1WZUA 3PRKE 3BCUA 4Y7DA 1GCGA 5C8YF 1E2KA 1A7AA 2JGEA 2N1BA 3X1YA 1OI7A 4GLLA 5DTEA 3OQ6A 4KODA 1IPFA 3E70C 1ZN8A 1JQJC 1P77A 4GYJA 1J0AA 1DV2A 1EUCB 4TWBA 1HSOA 4AIRA 4R41A 1NQXA 1XQYA 4QXRA 1K7CA 3BOSA 1HC7A 3RSHA 4E2XA 3I1IA 5LVAA 3FROA 3E1SA 3OPMA 4P84A 3T34A 4BMPB 1C1DA 3U2QA 2IU6A 2IYWA 5JU6A 2HX1A 4C7BA 3ZGXA 2P2YA 4OHBA 5CM8B 1W4ZA 5HF5A 1O1YA 1YZKA 1E77A 4BFZA 5FPTA 1HXHA 3G0CA 3LY8A 3PXBA 4MLDA 4UNQA 2NU8B 5AW2A 3EG5A 4MYCA 4H0CA 4HEA6 5GWXA 1DC8A 2I4OA 2JFWA 1BWRA 2PGJA 3IDZA 1T1IA 1L1QA 4AJ2A 5D2CA 5JZ9A 3B9BA 3VR3A 4J0IA 3UG7A 4PG5A 2YMPA 4I3GA 5CD9A 2JAOA 1ESZA 2IH5A 3PDHA 1H4TA 2UAGA 3TVTA 1YQDA 2FN4A 1QO0A 3LX5A 4GRDA 2WJHA 3Q5GA 3VNVA 3KPYA 4TMZA 4YXFA 1LSUA 4EJSC 3IELA 3TBHA 1DTWA 1Z35A 3A2LA 3CFYA 4WY2A 4QJ3A 5BN3B 4GWLA 2VH1A 3TQTA 3O9VA 4B82A 2A5DA 3CM0A 4REQA 2Z8XA 3UB4A 3RD5A 4D57A 1IVSA 5AKXA 2V59A 1DPGA 2H9IA 3AF4A 2O54A 3DR5A 1US8A 3QHQA 4MJ7A 4P33A 2ZBRA 1ZOIA 1EFPB 1GSIA 3VUEA 4TXLA 3NIBA 2HDNB 1CZLA 2QRUA 3BXGA 3RTBA 4LV5B 4JCCA 4BP1A 3AVXA 1STOA 1E8MA 4U39A 1EGHA 4I1YA 3G79A 3H2HA 4BQNA 1U7ZA 2BKXA 2CJYA 4LHEA 4URZR 4A0SA 3AKEA 5E3IA 2A1UA 4ZQGA 1I80A 4L85A 3GGJA 3OX2A 2X7HA 4EFNA 2OENG 1B16A 2V5VA 3M89A 3P27A 6REQA 1E4OA 1Y8QB 4HGNA 2JGIA 4J7UA 3LGAA 1NXQA 1CUWA 3UAOA 3OQ1A 1GGMA 2OCBA 4FKMA 4JI6B 2VJCA 1UM9B 2HTFA 2QSYA 1GRRA 2YX1A 3BHNA 4FMPA 4M1OA 4E12A 1VG8A 5BWBA 5I4IA 5KYTA 1NLYA 1NW6A 3B3FA 3JZFA 5CTJA 3WNBA 4EO7A 4TSFD 1JFTA 1Q0PA 2B7LA 4DANA 1JRLA 3UOAB 4B0PA 2JAXA 4OP3A 4ALIA 4CLDA 4YDHB 1C0KA 3IURA 1BJRE 2VTKA 3ZY3A 3NHSA 5ALKA 2Z98A 4IIJA 4JELA 4E2YA 1M8FA 3Q2IA 3WLEA 3SQXA 1NMZA 2ONCA 3MYYA 1BDHA 4IMJB 1KPIA 1VMKA 5BUCA 1FU7A 2DECA 5FI3A 1FNMA 3DDSA 3FAKA 4KL8S 1LC3A 4F9FA 3PLAE 3NEYA 2WQ7A 1KJNA 3NTQA 3QWFA 3RS7A 5P8WA 4UMVA 3DWIA 2JVKA 3K9WA 1Z4NA 2GBFA 3DKIA 1GA6A 4LZAA 4YCSA 4W8OA 4JJKA 1T0PA 2COKA 4OMFG 3PYLA 4TT8A 1UC5B 4IG9A 3M6UA 5JTUA 3RRBA 1JF8A 3PI7A 3LIPA 5J63A 4GOJA 3OY7A 1GNPA 1PV2A 2AEJA 1EUZA 1JYSA 3DSRA 4XWTA 5HDQA 4X66B 1W2HA 3IB6A 2YQ5A 1XZFA 4KGVA 4LNAA 4Q1BA 2QSUA 5TY0A 3U60B 4F4CA 1KNQA 1GNSA 3QKRB 3ZW7A 4CKEB 5HR5A 4GR9A 1BEEA 4HWKA 4S1VA 5IXYA 1B0PA 2O3SA 4RD3A 5KC9A 1ZOOA 1T25A 3M2PA 3Q7IA 4HX5A 4EZBA 1VKNA 1VPVA 4FKZA 3NMUF 4FILA 3PX3A 3S6JA 4F4FA 1NUAA 2J3IA 4II2A 4EI2A 4HH1A 3DP9A 5T64A 1K5DA 1DZ3A 5F5XA 4M1SA 3NVKI 1VBKA 4PG6A 4YJ2B 2GPWA 2QG4A 3QVUA 3ICEA 1M1YA 5G0UA 1RSZA 3ILHA 2IZZA 4XUEA 3MWFA 1OU4A 3ME5A 2ACWA 3GG9A 4U6QA 1R6UA 2C5AA 4M55A 3HVUA 2J0VA 3HJHA 2IYFA 3EARA 4UFOA 3LF1A 4ENUA 1ZR2A 2HADA 5BO5A 3NHMA 2ZJBA 1FW6A 1M0EA 1H2XA 1DFHA 1WXXA 4JR1A 3Q8MA 3H9JA 2O2GA 3M34A 4HLDA 3X1WA 4TSKA 1F4VA 3A8TA 1EFHA 1RXIA 2H08A 4JVMA 2C5HA 5TQ0B 5AI5A 1GA4A 1RRGA 4IDCA 1SOWA 1I1OA 3LYAA 3ONDA 1VZ3A 2QZ4A 1QIKA 1XAJA 3RU7A 2OG1A 3OF3A 4JXJA 1TQ4A 3C7CB 4FBGA 4JWKA 1HT0A 3VFDA 3PFHA 2W70A 1D4AA 1D09A 1JLHA 2V6JA 3BF7A 4YIKA 5EUMA 4K9KA 3TAHA 1XQVA 1SAYA 3H19A 1O0CA 3PUJA 1W4CA 2FR8C 3S0JA 2AX4A 1HV8A 1V2HE 2ZI6A 4KO8A 4CM8B 2M98A 4OBWA 1FXUA 5JH7B 2BGWA 3M49A 1GEEA 2XCLA 4V24A 5B30A 5JFOA 1OC2A 2AQ8A 5LA6B 3QWBA 2ESRA 5H4HA 5EE9A 2CMHA 1DINA 1Z25A 4G89A 5L4LA 1VYVA 3T7CA 3G2IA 1V5FA 3LG2A 4IJ6A 3FHTA 3LW8A 2BI7A 5I7EA 3FRIA 3VMFA 2W5UA 4AU1A 4HDCA 1FDSA 4I36A 1ULBA 1DMSA 5TPWA 4BO4A 3KXLA 4RHYA 4B6GA 1PS9A 1JEDA 3LCJA 4ZQIA 5IXJA 3P9QA 4H3VA 5EP2A 1AXGA 1ECGA 1Z2PX 2CFSA 3NOOA 4H17A 3T3PB 5CITA 5IG2A 5JECA 1AKTA 2VXOA 1F0YA 1HE4A 3IO3A 4PBSA 3C5EA 3WAJA 3AEKB 1LWOA 2HDHA 2HB6A 2IBMA 4KQFA 4IMRA 4LBWA 4PPYA 3L7MA 3O8QA 4CMIA 1NVFA 1ZI6A 1V9CA 4PR0A 3VR2D 1P0MA 4OHPA 4FW8A 6LDHA 1OREA 1SURA 1TEZA 5DHSA 3T3OA 3BBLA 3EXFA 1B8NA 4N12A 4R3WA 1WPGA 2P67A 4DM4A 2VA8A 4PU0A 4NATA 2X1HA 3HFGA 3PWZA 4HDSB 3WKDA 1Z4PX 3TR0A 4DHWA 2GZ3A 2ZJZA 4PC3A 3GEEA 2MINB 3QUAA 3V00A 3GBPA 2IYUA 1U3TA 3D8NA 2P11A 1U8YA 5HJ7A 2XE8A 2QK4A 3VZRA 3T35A 4E4YA 1JDUA 2PRJA 4KQIA 3A1DA 5HMMA 2LKCA 2FMKA 4YRAA 1DAOA 1JIVA 1PZHA 5AW7A 1G5QA 1R6VA 3PA6A 3DUFB 4FYIA 3D54D 4JVLA 4V3BA 4IXTA 2B5VA 1WPQA 2R6DA 5CA0B 5EINA 2Y92A 4YQZA 1B8PA 2IEZA 4NBVA 2AZXA 1XZEA 4GBGA 4JROA 2C8KA 5A1TA 2P79A 4HQLA 5BN4B 3K9HA 4A8HA 2R8EA 5I47A 2IXBA 1BHSA 5FYDA 1FUEA 5ED0A 4NY1A 4CKXA 2WJJA 1U1CA 4CIBA 2Z8ZA 1JEQB 4Q3KA 4L4SA 2EL7A 2E55A 3UWOA 3RTCA 1ZM9A 1VI6A 2TSYB 2YWRA 3AFMA 3IQEA 1Y5RA 1HDOA 1SXJB 4EL5A 3E15A 2QU8A 5EVJA 4DF3A 1Y89A 2A78A 4RNDB 4BKPA 3EXEB 3NC0C 3C87A 4RFSB 1ZG3A 3ZQUA 4YA6A 3WQRA 3NX4A 5DNUA 2QTZA 5KX5F 2PUWA 3HO8A 1YQ9A 4FMDF 4Q3EA 2ARKA 4RMNA 1ZN7A 5ALJA 4DM7A 4XVUA 4Z54A 5ENVA 1ONSA 3M1IA 5F98A 2NZVG 2GJ8A 4EGQA 2OO7A 3TMAA 4NR0A 3D9QX 3WL6A 1BRTA 3IUBA 2OCAA 3A6HA 2YXPX 3A3NA 3LUDA 5IABA 4MR8B 2AE1A 1N5JA 4L73A 2DWUA 2HF9A 1U0HC 3S2YA 4H1TA 4EJSA 3FA2A 4NFYA 1GPDG 2ADOA 3UMSA 1N36B 2V9ZA 3H99A 1VE9A 1FFCA 1P74A 3ABQB 3D4BA 4ZJUA 1XTZA 1DB3A 1XEWX 3H11A 4TS3A 3MRXA 4R2JA 2BN4A 1DDIA 1VRVA 3NALA 3QPCA 3F0TA 4WESB 3HCEA 4WZ6A 4DMRA 4XLZA 2PGXA 2VF7A 1ZXLA 4B7XA 1DJLA 1MAUA 4HAIA 4MVXA 1RE0A 4KSBA 3QKTA 4QSMA 3Q8LA 2EP5A 1FCJA 1YKFA 5KDOA 3EA0A 4MW5A 3A9UA 2J3HA 4H7HA 2P2SA 1BGWA 2IOQA 1BS9A 4LRSB 2W8BA 3DL0A 4W5QA 3SQWA 2OBBA 3KUKA 4RW0A 4COKA 3FNIA 3CSDA 6GPBA 4AY3A 4BVGA 4DB4A 1H2EA 4B7AA 1TO6A 3G5MA 3MFQA 1O9GA 3H42B 2CD7A 3H4TA 3P2IA 4KR9A 3U17A 2Q4TA 2RGBA 1ORIA 3ZV4A 5MN4A 1NR1A 3WC4A 5MN6A 5K7SA 3G9UA 1N2GA 3QX7A 1YQTA 4EF5A 2VLBA 3X3HA 2OBLA 3EBPA 3A1VA 2F3UA 4KR0A 1FJHA 1JEJA 2ECFA 1NRIA 4L0CA 4NCHA 4MMZB 1L7NA 4LJSA 4LZZA 1NHWA 2G28A 3O3NB 3E9YA 1RJGA 1XMPA 3CV3A 3QF4B 4BWVA 4M1KA 2WR8A 2BW0A 2FMXA 4B7CA 2ZUUA 1ZHOA 4W6ZA 5AHOA 2YNMC 3O21A 4PCLA 4NJOA 1WDTA 1ZCZA 5EIAA 3TZ6A 4UDOA 3VR6A 1TVCA 4L08A 1IJEA 3VTAA 4EJFA 2QD3A 3EPLA 1BOFA 3TJMA 1N2EA 4LYJA 1M74A 1WDKA 5CLIA 3QITA 3S2SA 2PX5A 3C15C 3CLUC 3UHJA 5AK3A 1SKQA 4B7UA 1U7TA 4PNEA 1UP4A 4O4JA 3ZEAA 4IP0A 1LNSA 2O0JA 1NG1A 1JHOA 2QR2A 3BCRA 1KMQA 3FMVA 4FS3A 4N7JA 4M1MA 5CK4A 5ER9A 4C30A 2BSQA 3BE5A 5NLLA 1NVKA 1XDSA 2VPYA 1YRAA 1NPDA 3EEIA 2AOTA 3NTUA 3UT5A 1SHJA 3EPKA 3E82A 2G6BA 4MR7B 1ZUWA 3PNYA 2CXXA 2APJA 1WZ2A 1E5LA 1GZVA 4UBKA 1M5UA 4QPNA 1W0JA 4XX0B 4B48A 2QP3A 5CXUA 4NCBA 1Z28A 4INJA 4UEWA 5LQSA 4KO2S 2Z2YA 1ZL2A 1SVNA 1QV9A 4A8JB 3B1FA 1QIHA 4D8WA 3HDHA 3GL9A 4J43A 1F48A 2H1VA 2B69A 1Y3BE 4OXNA 5H3CA 4ZGWA 4HWGA 2OXCA 2PEZA 3HB4X 1PR0A 1AKNA 2BKAA 2Q3EA 3ULKA 4M9UA 4KV7A 1ITZA 3D8SA 2AWNA 3VH2A 2WZCA 3ZY6A 3AEUA 3K0AA 4A0GA 4PAWA 1U7UA 1MC4A 4UZSA 2C42A 1Y98A 1ABEA 2IZ6A 1JSLA 3Q3CA 1PP4A 1RBMA 2ZEJA 1IHDA 4GYKA 4CM6A 1D04A 2W6QA 3KLMX 4LHSA 5FA5A 5B7PA 3NNSA 1M1ZA 3NUQA 2P4QA 4LMRA 4RDHA 5EZYA 4YUZA 4PC2A 5H9WA 4C3ZA 2ZP1A 4LYHA 1NQOA 2RHBA 1Y3AA 3EEQA 4PYNA 3VTKA 4B5KA 1PWZA 4NU5A 3A7DA 2DFTA 2PMEA 4EKYA 4FSDA 2YJNA 4H16A 5EFOA 4Y2RA 4HWOA 4ZAGA 1KY3A 1RAAA 4LMBA 2HSZA 3HVIA 4ZYXA 1U3DA 2WW8A 1PSWA 5TGTA 3COWA 1E0JA 1QH8A 1NQ5A 2G1KA 3PYMA 3UJ9A 1QU2A 2HJGA 3I34X 1RLJA 2ECKA 1D7OA 1RHRA 1XV5A 3GDOA 4MW9A 1JMYA 2FR8A 3RCBA 1H1DA 1EDBA 4N0EA 3ZZNA 4MDEA 4KZPA 2R6ZA 4ZAZA 1MMFB 5JR3A 1WZNA 1NW3A 5KNLA 4CM4A 5J2UF 3ZDYB 3ORYA 1YUMA 2VDWB 5KDLA 1PS0A 1WSAA 3ZCQA 4C14A 2P5UA 1OYOA 2HSWA 3AWDA 2OV4A 4ZPXA 5KINB 2ZR7A 5F1PA 3OQIA 4CCYA 1YC2A 1W48A 1GV1A 3EAQA 4PHFA 1TJ5A 4QATA 2WJWA 2ZETA 3S99A 4AJIA 1X8JA 1NFRA 3H4VA 3X1ZA 1KEZA 3EGVA 4BZWA 1JAYA 4BRUA 5I45A 1L7BA 1U2SA 3HRKA 4XQ0A 3L1HA 3T0GA 1ZLYA 4OQLA 4AYWA 4LZLA 4RVDA 2Y0BA 3O1IC 1O95D 3UUWA 2ZZNA 1DC7A 1NYRA 1GZSA 1SQ0A 1XQWA 1IBRA 3U6BA 5TEVA 4GBED 4Q03A 3EWAA 3DBRB 1LFAA 2A1TS 1I4TD 1C8KA 2ZTHA 1ULSA 4DQLA 4F4HA 1ZAKA 2Y66A 3IBCA 3MJHA 1PR4A 4C7VA 1NBHA 4Z5XA 4QGAA 4CE6A 4LRYA 2PRKA 2H17A 1II0A 1QFZA 1CUIA 2SKEA 3FDZB 3OY2A 3ICPA 4LQ4A 3DVRX 3L8EA 1XRLA 4PZ9A 5K3AA 3AM4A 4XOUA 4GX5A 4QTYA 3S8MA 4ZD6A 5K0ZA 3ROXA 4DCJA 4L95C 4UJ5A 1MG0A 4PQFA 3WK8A 2ZS8A 4AJJA 1EFAA 1GOTA 2X1LA 1H9BA 2QTFA 1B6GA 4AULA 1YAHA 1O89A 4XWYA 3AH8A 5BUZA 1FUUA 3ADOA 4WE3A 4EPVA 4CIWA 3ICQB 4AJLA 3QVJA 1NVVR 2CL5A 3GRUA 1USWA 3SQDA 3W06A 4WK0B 1KZ6A 2JJMA 2QVBA 2H63A 3LLMA 5F33A 4JLWA 1JQLB 5KNCH 1BH2A 3L8MA 2ZYTX 3VYTB 4EJ2A 3H9UA 5AM5A 4W5JA 3BFXA 3I9KA 2FVXA 1JU4A 1A9QA 2FWMX 4U5QA 3LUHA 2O48X 4K6OA 4A10A 2V7QA 1EJ6A 2VQ3A 3R3HA 5FT9A 4XEUA 5EJGA 3UANA 2VKTA 1JEOA 2QE6A 3IMEA 1QQTA 2HHCA 4Q16A 1SCBA 1NVUQ 1JWAB 4TLDA 1OLSA 3LA6A 7YASA 3ZI7A 5KWVA 1BDBA 4HGPA 2P1RA 3FFAA 4L9RA 3NCHA 5FFNA 3EOAI 2JA1A 3R23A 3HU2A 1ZHFA 1DEKA 2JKVA 4JQSA 1Q0TA 3H9QA 1N34B 4QDTA 3RR2A 3SIXA 1ORTA 1SMKA 2GD6A 1W581 3PT9A 1VZ2A 5IH3A 2VWQA 3PTAA 3BMQB 3G0OA 3EG9A 3HV0A 1SBIA 2CCGA 2Y0PA 1MB4A 3AG5A 4OHWA 5L3SB 3FF4A 2I3GA 4QYSA 3NBMA 4QYIB 4CKBB 4FNOA 3ZZTA 4Y0AA 3KJHA 1PTJC 2FN9A 2P4EA 3QKSA 1DBVO 2IZ7A 3KC2A 4J1TC 4RKQA 2OXTA 1KDRA 4DV6B 4LQCA 1U0RA 3KUDA 1T9GR 4DDTA 3JQ7B 3V8QA 3K8OE 3MS4A 1YR7A 3ON5A 3E9EA 5H82A 1Z4LA 1XHEA 1ZJYA 2OL4A 2FUCA 1O57A 4NYMQ 5M7EA 3W2TA 1HFKA 2VTDA 5ADVA 1QHHB 2IE0A 1SA0B 2CZGA 2ZS7A 1R0ZA 4KQ1A 2BFEB 3UEOA 4ZCQA 3VTZA 5KNBH 3BAZA 4NEQA 3SZMA 4FI3F 2AV6A 1UFQA 2W2LD 4O1MA 1UCFA 1L1FA 1Y48E 5HOEA 1BD4A 1ODLA 3WLKX 4CT4B 5K8IA 4RVCA 1OVGA 1QRAA 1A5ZA 4D4GA 3DM9B 1Z33A 3AR7A 3BZWA 4TKMA 3U4GA 1H5UA 3SJUA 2OGTA 5AO9A 5AHRA 4ZOCA 5BQ5A 1QP0A 3A32A 3JAWB 4IMIB 5F7ZA 4EFMA 2IYZA 5G1PA 1NBAA 3HLYA 1YL6A 1RNLA 3JWEA 5LMNB 4FYHA 4RHFA 1RWWA 4BQQA 4RSHA 1TJYA 1TMKA 3UJ7A 1NZDA 4N8SA 5A3JA 8AT1A 1KWGA 5EA2A 1VPDA 4HAYA 1PT6A 3NT5A 1ZM3A 2DBYA 3KZXA 1RJWA 4B4WA 3BMNA 3SJAA 3A06A 1FS6A 5EUBA 1EK6A 1ZM2A 2P2DA 3HI6A 2FH5B 4CKCB 1GT6A 2A6PA 3QEMA 4IDHA 1ISGA 1ZW6A 3KV3O 1LDYA 4UREA 4Q47A 2V54A 3HCWA 3HLTA 2JEYA 2VZEA 4BIIA 3S81A 1H5QA 2W0MA 4JT2A 3U4AA 3TNFA 1KI6A 4P4SA 1L7AA 1UWVA 1DKQA 2DUJA 1DJPA 3JZIA 1ZIYA 4ZARA 8GPBA 2C04A 4I1OA 1NGSA 2W83A 1XRJA 1Y5IA 4XJXA 3D4IA 5DMHA 4DOMA 4ERXA 1Z7EA 2YNMA 1PJCA 3W9YA 3AF0A 4EPWA 5JRZA 2VT2A 3TQFA 2PGAA 4L07A 2IHVA 3UK1A 4FFDA 1KK3A 5EXSA 3UJ8A 1A2KC 1FYVA 1VL2A 4JUBA 3TDMA 4CM9A 4ZT4A 1YBFA 2QTVB 1G7TA 2BEVB 2PKQO 4YFYA 5E38A 5KCZA 4KFTA 1E1YA 3T1HB 3K31A 3SC2A 1T2CA 5IC5A 1E6LA 1E60A 2C92A 4QPDA 5IJXA 1QYXA 4KPGA 3ZCPA 2RD2A 5FTJA 2BJWA 1GFIA 2CF5A 2QVYX 5EIWA 5E3HA 3KJGA 4RULA 4AZWA 2FWBA 4J0JA 1T1EA 3DZDA 3PE4A 3FSGD 5FRDA 2JCBA 5ALSA 1W85B 2ZRQA 3LT2A 2IYSA 5EWLB 2PUEA 2UZ1B 2VS1A 3HGQA 2PYIA 4PX9A 4TM7A 3M5WA 2EZUA 3KG2A 2DPXA 4N6NA 5IC4A 2ATEA 3EIWA 2FR0A 1DKLA 3D02A 2IOFA 3A1CA 1ZOPA 2BZSA 4M7OA 4UPDA 2GS9A 3ZWDA 1KRWA 1DUSA 2J3EA 2BGLA 4QBTA 4BFWA 3UYLA 3ZHTA 3CPSA 2RONA 4FNGA 4CKZA 1NXWA 3E9DA 4PCUA 3P9XA 4Y2JA 1Q77A 2CJPA 1PJ3A 1Z9BA 1DAEA 2VP4A 3IC5A 4N5LA 4JK3A 5ADHA 2H48A 3L1VA 1PEAA 3K0HA 1MX5A 5KTPA 1W4AA 1ZUNA 1LFDB 2QI9F 3LUAA 5D5PA 4D1YA 1EQ2A 2XMSA 4UHCA 5K2OA 1VIMA 4YJHA 1ZU5A 4ME6A 2EWMA 4MWZA 3ZWAA 3RS3A 3CGGA 1OASA 1FP6A 1RE1A 2NU6A 3GZNA 3L9WA 3N39C 2Y6VA 2VHQA 4X6YA 1NJ8A 4CCSA 1Q14A 1DU4A 4UUQA 4V0ME 1TAQA 4OP2A 2ZITA 4XE5A 4D44A 4LXYA 1Y3HA 3LUKA 1IOZA 1P1RA 1VCOA 1BAPA 2AX3A 2FQ1A 2WD7B 2WK1A 2ZRNA 3E18A 4PRKA 3W3AD 4DCPA 1B74A 3AHJA 3GNSA 4CL0A 1A69A 1JFRA 3AF5A 2RAFA 5TT1A 1ZSYA 1F38A 1C0PA 2XXBA 3U9SA 3AHDA 3E1KA 4QXOA 5FA6A 3UB2A 1YE3A 3AVQA 3PUIA 5F2NA 3FPEA 4IOMA 1NJ1A 1Z36A 3PQ4A 4PYIA 4DIOA 5LIRA 1MRSA 2ZRMA 1GFWA 3DAGA 1GPWB 2ZSUA 3MWEA 5FA8A 1RLOA 3EVCA 4EI7A 1YQEA 3H5OA 1XYYA 3DMPA 1AXRA 4GD3Q 3I8XA 3WMXA 1ZOSA 2WB4A 4O4HB 5AXAA 1UKZA 2IE8A 2WIFA 1ZMOA 3KYCB 4MRAA 5B5SA 3P2EA 3VPHA 2DBQA 2RI6A 1M9NA 2PQ6A 1ZD4A 2G5GX 3TVYA 1PYDA 4MAMA 1F60A 1OPRA 5B2ZA 4F93B 4OLBA 1E5DA 1F3LA 3QELB 3A6FA 4GX0A 3E7FA 4FHGA 1CLUA 2YYZA 3M81A 3AIKA 4G41A 3RVQA 2XE6A 1BHO1 1PS8A 1PJQA 2HU8A 2ZK7A 2WILA 1E1LA 1X42A 2GEVA 2W2KB 2AI1A 4LYYA 1CHDA 1FSZA 2G7ZA 2PSJA 3OJFA 4R1TA 2BLLA 3D7MA 3FX2A 1PK9A 4RPLA 3DLAA 1N0IA 3GT7A 4R6WA 5JHHB 1WV0A 3JXEA 2CUNA 1IWPB 2G17A 2Z1NA 1AKYA 4NESA 4AWBA 4EA6A 2XT6A 1QMGA 3BXFA 3G9QA 2EIXA 1A27A 4JQOA 4NMMA 3ECSA 3BIXA 4GZ3A 4X63A 5HMLA 1U99A 3D7SA 4PNHA 3JQ9C 3K7EA 1U2DC 2Z2IA 3VKWA 1PKEA 2P27A 4JGBA 2TS1A 1ODCA 3QMMA 5LLDA 4AXBA 4L8WB 1Q15A 2FDRA 1Y3IA 2R1VA 1AKMA 1ZJ5A 1WHSB 1XXHE 1M0SA 4INAA 1QG2A 3MTEA 2PM8A 2FEKA 1YHNA 2JGRA 3MJVA 2PH7A 3MLBA 1R0LA 5HWSA 2VPQA 5KJ6A 3ZW9A 2BFFA 1XOIA 4YUVA 4UQPA 5EJ6A 2H6EA 1QK4A 4MP6A 1NF9A 3L6UA 2JGAA 3K09C 4ZMSA 5KHOC 3DKPA 3DEFA 4XD7A 4EHIA 5AT1A 1Z73A 3HCCA 2F8SA 3NVAA 3IR7A 4RJLA 4GWGA 3AP3A 1UP7A 1W8IA 1KIAA 4PGGA 4TRJA 4ZALA 5FPPA 3VYRB 3A2NA 2VRCD 3EIFA 2PGDA 2REQB 4L8VA 1H3NA 3ONNA 3R7DA 3MCUA 4M83A 2AUTA 3CN7A 5CBPB 1KK2A 1J8YF 2QRZA 1E0AA 1JFFB 3FPSA 4RH3A 2JFYA 3CPHA 1B43A 1GUZA 2KS6A 1OTHA 1GNTA 4ZAFA 1PBTA 2ENWA 1XA3A 2CEAA 2ZREA 1GLGA 4LNUB 5EKTA 5ANRB 3BICA 2YIVX 2WWHA 3P2OA 4RZSA 1M75A 2JAHA 3K6RA 3NAQA 5HTOA 5DX0A 5F5NA 2VNKA 1AN9A 4MA5A 2ZUDA 4QECA 3PDIB 1GM5A 1H2RS 4JEIA 4ILEA 1EUYA 2M6KA 1LW6E 2UU9B 2R60A 3DO5A 4UUBA 3GLQA 4E88A 1ZIPA 3CZ4A 1LK7A 1PTJA 5J40A 2RE8A 2HPZA 4J1TA 4KX3A 2EVWX 4RXMA 4AZ0A 1RWXA 3HBNA 3DOUA 2EFCB 1T8UA 4L6CA 3R0ZA 5BYBA 4Q3BA 1ZJ6A 1RD4A 2QT1A 3MJTA 1N9ZA 1XZBA 2H92A 2XNHA 3JD0A 1QPBA 2I2FA 2JGFA 2Y3IA 1YO6A 3EMDA 4ALKA 4LF4B 1ZBQA 4WN9B 2EBFX 1U0OC 2WDPA 4DGQA 2OD7A 3B89A 2B37A 2R97A 4GZLA 1EXNA 4M46A 3RJTA 1QQAA 3DNMA 1I9CA 1QLHA 1L7PA 2IYQA 4HDKB 4MS1A 1JJIA 2RHLA 3SZRA 4IWYA 2CC2A 1SO8A 4YAFA 4HQ0A 3FPJA 1MJNA 1QWSA 3C43A 5K03A 2C0CA 2FPLA 3B85A 4KQWA 2NSYA 2AFHE 4QHTA 4MUHA 1LX7A 5MHTA 2BMDA 4EG7A 1HQYE 3A26A 5JNWA 2PANA 1HDEA 3WSTA 1MDFA 1JIIA 1T9DA 1GL6A 1TADA 3WLPA 3QY9A 2QLLA 5A4KA 1M2WA 1EVYA 1SXJD 2IPAB 3LRPA 2EYQA 2HRZA 2P2ZA 2Y76A 3GLHB 4UBLA 1MIHA 4YAWA 1T8YA 3OP4A 4OO3A 4Q21A 1QDEA 3THRA 3IPAA 1KI1A 3TE6A 3STVA 4HVAA 2R0QC 4HN9A 4HX2A 1CIVA 1KBOA 2E49A 4RPCA 3GGPA 5D8DA 3BA1A 3V4SA 4E5DA 5GZ3A 3LY9A 5KKNB 2DERA 1WWKA 3KKLA 1OB5A 1DC4A 3SC3A 2DWOA 2O8FB 1XCPA 1RYBA 4EPTA 3BB3A 1P44A 2AG6A 3NI2A 2B2XA 1SXPA 3U7IA 1WY5A 2NVUB 4PIPA 1YR9A 1HTWA 1JSRA 2Q2NA 4ODIA 1C7EA 4Q3DA 4YRJA 4BDTA 1GRNA 1PL6A 1V47A 4B3JA 1E3QA 2ZE7A 1XZ8A 3ODPA 1H4VB 4MTCA 5C81A 4MVJA 1P9WA 1BRMA 1ODKA 2JASA 3T5PA 1QONA 1C7ZA 4EB6B 4JJIA 2VUHB 3ORQA 3GRZA 2EKZA 5TMDA 1G18A 4XVQA 1QB8A 3T7AA 1DV1A 3NKLA 2IHTA 4J4TA 2GR9A 4FZ5A 4D0GA 2ROQA 4MV7A 3C6BA 4O3FA 4KPEC 1SC4A 2COEA 3RUCA 3PXUA 4JJ8A 1YRQA 1YFKA 2FWIA 4PICA 4CUKA 4HRXA 4Z7JA 1JH9A 1A98A 2NSLA 1ZWLA 2O3TA 4IIEA 2BSXA 1M1UA 4BAGA 2FCRA 2AC7A 2WSBA 1IWBB 2VK8A 3AONB 5KSPA 1TT5B 3EUFA 3ROEA 3DDUA 1BE8A 1RJDA 1I2ZA 3LFHA 3UCFA 4BLUA 4C9BA 1PDVA 1RP7A 3IJRA 1DXHA 1VB5A 4LDRA 1L4LA 1KBZA 1NI4B 3N74A 1ZUD1 1KHTA 4XJSA 3LPCA 2W11A 4YUWA 2GJKA 1XYVA 5IVIA 1HNZB 3VKUA 1ENYA 2D54A 4YJ3F 3F6BX 5HG0A 1L5MA 1RWMA 3OBIA 2WD9A 1ZN2A 2V7GA 2JGNA 4KXVA 3VU9B 1RYZA 5F1OA 4G4JA 3TQSA 5F7OA 9LDTA 4AP6A 3IOEA 3VR5H 4HBZA 2DY0A 3QVKA 4R8MA 1KH3A 5EKUA 5KYGA 3CLTC 1Q91A 4DA7A 2GPAA 5I6DA 5KSYA 3VVMA 2VHJA 3TFOA 1SXGA 1GPBA 2XVXA 4XUDA 3WXMA 4DIKA 3S1LA 3SKYA 2WWFA 5IEBA 1GPNA 3K1AB 4BE4A 3VAYA 5JWOA 4M9CA 3IDSA 1OB2A 1MFZA 4WVLA 1KEEA 2IV3A 3IXLA 3BA6A 1M6VB 3ESZA 2JBAB 5EZ6B 3V4RA 1U0LA 2P68A 1WCYA 1E3WA 3QY0A 4GDFA 2JB9A 5HE8A 1QTRA 1WMSA 3I2YX 2E5WA 1JG3A 3PKIA 3T7DA 3MRTA 4B83A 1K9SA 2OYSA 1VLLA 4KU4A 1XTVA 3PPXA 1JHMA 1Q2XA 2G76A 3V4VB 1Y7IA 4Y9DA 2XVMA 4X91A 1AGXA 3FI9A 4ZVOA 1YSCA 3ROGA 4A4DA 1Y42X 2HMYB 2VK4A 3A05A 1UH5A 2DQ4A 2DFDA 2EKQA 3IAAA 1RT9A 4LXQA 4PHTA 1CV2A 2BM8A 1DOAA 2E6UX 3I04A 2X9GA 3ST7A 3PNOA 1YF3A 1SHLA 1A2BA 4W1RA 5DWDA 3E23A 3QPBA 3GIDA 4A0RA 1UAYA 2Q3LA 2YWXA 5ALDA 2FX5A 1E6CA 1KFEB 3B2NA 4K28A 1Z5GA 1Z2NX 3HYLA 4IDQA 3UHAA 3VNAA 1KFKB 4DADA 3QNMA 3UHOA 4Q9DA 1NW9B 4OHXA 4C03A 2AN9A 3UMFA 1G8FA 4MTLA 1YS4A 2ZUWA 4XJTA 2D7DA 1M2OA 3IHKA 3QOWA 2C4WA 4ITRC 3RWBA 4ZVUA 4C06A 4KACA 1U0BB 1I3NA 2QVZX 2JIBA 3WJ2A 2VVTA 2R6FA 1LPPA 2F67A 4G5GA 3ZD7A 1JHVA 1W36D 4KR2A 4ZEOA 1C4WA 1L4NA 2OCPA 4F5YA 4IJUA 3RIYA 1ORRA 4TMKA 5CK5A 3JQ9A 1U2DA 5DULA 3IDQA 4Z0TA 1CRPA 1P0FA 1OWOA 1XCJA 4PGFA 2VF2A 5EYPB 1JIKA 2YMLA 3RHSA 2FZKA 3GGGA 3KVRA 4N82A 4Z0PA 1K27A 1X94A 3JY6A 3KDSE 1ABFA 3NO4A 1Y5MA 2BUBA 2X1MA 5FFFA 2PQ2A 5BUQA 3GLIB 1QQ6A 2FEAA 4HWPA 1SKAA 3NXKA 2OOKA 1M0WA 3MD0A 5LP6C 2Y0DA 4OQNA 1AS0A 2AD5A 2Y9MB 3SVZA 1W36C 3H65A 4WBXC 3D8TA 1KU6A 1CS0B 1WEHA 2Q9AA 5HZKA 4HNTA 1IOLA 3K09A 3LC1O 4GH5A 4QLBA 2PLFA 2GF0A 5A9TA 2OA0A 4Z4HA 2V1UA 1LLFA 4LSGA 4CF3A 3BM5A 4PZZA 4OM8A 4TMWA 2B83A 2P3QA 4FFWA 2I54A 3G3EA 4JJ4A 4M99A 1MO6A 4X7PA 2J4DA 4BLQA 3IP1A 4DCGA 4YB8A 5DM70 3F8WA 1OAKA 2BD0A 2DWPA 2OLEA 3BCHA 4K9NA 4MQUA 1P1FA 1XZDA 4DAEA 3U44A 1H65A 3CUSA 4X90A 1EE1A 2E1RA 1MRNA 5CVCA 4Y0NA 1FTWA 1GZ7A 3VNSA 3CF2A 2GAAA 1GCIA 5FR2A 2VHUA 1T0JB 3IIJA 4HNAB 3OIDA 4NCNA 1QH1B 3TIGA 4DNXA 4D43A 5MGNA 1GVNB 1DBRA 3BL8A 2YXDA 1EK0A 1Z0DA 1KQPA 3IP7A 4ISCA 2QHXA 3L6EA 3OMXA 1Z56C 3LYHA 3ZG6A 2QUBA 4KUHA 2X3FA 1W96A 2P5TB 2RG1A 4LMAA 4XGNA 2AJCA 4UM9B 5TC4A 1DTSA 4K9DA 3KALA 3A2MA 2NSDA 4L4RA 1UODA 1KK1A 2DLNA 1K06A 1SOUA 2KBFA 3P32A 1EEHA 3FYUC 2YY7A 4NPAA 5AW8A 2NVOA 3E9NA 3SIPA 3CB2A 3EZYA 5CDGA 2XCTB 3N07A 3O74A 2I7CA 2FW9A 3FFXA 2J32A 5K3BA 2LXNA 4AIIA 2HMAA 2ZJ8A 4P7FA 3DC7A 3LTNC 3QBJA 2ZI7A 2ZUCA 4I1UA 2RK4A 4UE2A 5CPFA 2W2OA 2D74A 3EQ9A 3PRJA 3ZZMA 4KHPB 2J7PA 5HKOA 1OFUA 4GPZA 1ZGBA 3B3QA 3LT5A 3PI6A 4NBUA 5DOZA 4C2AA 4EHFA 2ZYWX 1NU6A 4QPJC 3MILA 3KJZA 3QBEA 3R3UA 3UAZA 5CIQA 1KPGA 3SS7X 2JEZA 4A26A 1UBKS 2SECE 4KN8A 3LIIA 3F5DA 3LXMA 3ND8A 4C0WA 2RI1A 2XB6A 3PRYA 1UZLA 4UCXA 4O4LB 1F3OA 3LHKA 4MPDA 1RMQA 1RYYA 4UZEA 4ZP1A 2XDQB 4K03A 4IDAA 4RA9A 2BUCA 4CFYA 5ALLA 1KO8A 1HPLA 1IOWA 1ZK3A 3OCCA 3ZZ0A 4QHSA 3F4KA 4FLFA 1ZY2A 1FL9A 4YP6A 3HDGA 1IJKA 4N0QA 3RVBA 3JQ8A 3ZHBA 4RTPA 2IK8A 2GCGA 2WOOA 3GFQA 4KMRA 5U4XA 2Z6VA 1V4VA 1JUDA 4X8OA 2WIAA 2HXSA 2ET6A 4IEFB 3CF6R 3KQPA 2B3DA 1RBZA 3KVVA 2SCUA 2ZE8A 4BV2A 4D99A 4RDXA 5DM60 1E6WA 1A3CA 1Z22A 4F38A 1XVAA 3FIUA 1EBUA 1H05A 3O8NA 3NJ4A 5FKJA 1QUFA 3OQOA 1PG0A 1IM8A 3GP3A 2WPNA 1XB2A 5IJWA 2HXYA 5CFOA 4BLRA 5I3ZA 2QRNA 3ZXUB 1N4AA 5A0TA 1XC7A 2C8VA 3EIQA 4C0BA 4GKVA 1OU0A 1F8FA 5COBA 3RFCA 3W5CA 4MHTA 2COUA 2G09A 3MT7A 4J91A 5ISMA 2R11A 1S3GA 2ACEA 2NZWA 3BXEA 4KXNA 2FAXA 2X2EA 5DGTA 3UAVA 3FMOB 1AGRA 1SXIA 3WOVA 1QFYA 3U56A 2W2VA 1YT5A 3RTEA 4BYGA 4E09A 4B80A 1PFQA 1RQGA 1T4BA 3JQ6A 2HCRA 4FU0A 4XAQA 1N5MA 1FBTA 3C5WP 3FLBA 3HZRA 3N8NA 2A59A 2EG5A 1DWUA 3RDPA 2X19A 3FYTA 1AQYA 2VXYA 1Y3FE 1QPGA 5CXXA 4FR2A 3SP1A 2FKNA 4EHKA 1NVGA 2VTEA 3DPSA 1KDTA 3C97A 4WCFB 4CL3A 3Q0EA 4BEWA 5JO9A 3C5HA 2GZSA 4R3UC 3JQFC 3VDXA 2NADA 2ZGVA 3AW9A 3JD2A 1CVIA 3E8MA 1CKEA 4IS2A 3UKOA 1PO7A 1CRZA 2C4KA 2WFAA 3EFOB 2B99A 3V8EA 2CXRA 4IWNA 4LJYA 5LZ7A 4BN5A 3ADCA 5HGJA 1IU9A 3NTXA 2FXVA 3WYEA 3OTQA 1QOQB 2JLCA 4N01A 2ODAA 2IHNA 3H17A 3R3XA 3BXHA 2QJWA 4B3RB 2XOKD 2O4CA 3MTJA 2I03A 3PC2A 1WVMA 1TMYA 4QLAA 1VG0B 3GVCA 4WJLA 2OV8A 3P26A 4ABYA 4F60A 4IRUB 2K87A 1N0HA 4G1EB 4AY2A 1C7JA 4GPD1 3RUHA 4EKDA 4J7XA 3KB6A 5BV0A 2Z43A 1LQUA 4HPWA 1P33A 5L40A 2WYOA 5IDWA 2FZ5A 2PZBA 4PZYA 5JARA 2O2XA 4H6XA 1F0KA 1WUIS 2O6LA 3E58A 3PDJA 2F55A 3WGZA 1P2SA 3H0CA 2A30A 4RPJA 2YOGA 3GZJA 4QGBA 4C78A 1EM8A 2FHPA 2GPBA 3RVOA 5LXTA 1MH1A 4IJVA 2NXEA 2OZPA 5FI1B 1NXOA 2FPRA 1MEJA 2HRRA 3DMNA 4UVHA 1FF9A 1NDQA 3JV7A 2NNLD 4B33A 1Q1GA 5EPEA 3V1NA 3ZBTA 5GIOE 4PQGA 1LNQA 5FOTA 1R8XA 4AW9A 2ZIXA 5JZVA 3IEUA 5LL6P 3QXXA 4U9IS 2XXAB 1W5TA 1TO2E 2QLNA 2GBCA 1E7MA 3QMPA 2PL9A 4JP1A 5IK2D 2C3PA 4IF6A 1Z2EA 1HDYA 3GJRA 3GLSA 4OJYA 2H9YA 5BMVA 2H4JA 4OLJA 2SKDA 1M1XB 1FS4A 3QMVA 3ZPXA 5HZHA 2XTNA 3K2QA 3EVNA 4MPRA 2ORWA 2VTVA 4HDNA 3Q0TA 1COZA 4GI3A 2FFRA 1FRQA 1GP2A 1V1MA 3CVJA 1Z7WA 2R7KA 1QWOA 1ZNWA 4LWQA 4I9GA 3TLKA 3WLRA 5K0EA 5LKRA 4Q7QA 3CLRC 1VIAA 3H05A 4M9XA 5J2TB 2C0QA 5CLJA 1HTTA 3IIKA 5A5EA 2D06A 2P4HX 4GU5A 2JLSA 3SNHA 2NU9A 5LN1A 4MUYA 4AQ7A 4L27A 5D1NA 1RXVA 2BC9A 2ODBA 3NBKA 5AHWA 3JSXA 2NMVA 3PQFA 1JAXA 2C9MA 4KH1A 2NU7A 3LM8A 3E22B 3MF4A 1J06A 4MIYA 5EQJB 3NUGA 4F6RA 3ZDBA 1F8GA 3C1AA 5BVHB 3LUFA 2Z2JA 1HL7A 4FCVA 4UOZA 3IA7A 4GECA 5ILOA 4L15A 2R7NA 1GGNA 3WYGA 3L7BA 2YHAA 6ABPA 3M1YA 5LP6A 1W93A 4LEIA 3SMVA 2NZ2A 5C52B 1JHUA 4HDMA 3THSA 1H4SA 2X6TA 3THWA 2PRSA 1XNQB 1U31A 3ENKA 2CLEB 2QJFA 1J56A 4HRVA 4JP8A 5AI0A 2C59A 2CMGA 1D2EA 4DNFA 1E62A 3TLMA 3TFQA 4UBMA 3OWHA 1O4WA 4OI4A 2D6FA 1Q6YA 2PVSA 2JLZA 3V2IA 1UR5A 5B4VA 1XFDA 1RKQA 1KJ8A 1P5JA 3NHWA 3H97A 4N3NA 3PCTA 2XKJE 4RY0A 3ZOZA 5F1KA 3ZWKA 1WKVA 2CVPA 3HNPA 2BBSA 3FKSA 3O0TA 4OK6A 4CFSA 1UOQA 3ANYB 4K86A 2J3DA 1JHQA 3KAJA 4RQAA 1IUNA 2ZTVA 3G2HA 2FQQA 3VJRA 1O0BA 5TS2A 1N2XA 2Y8EA 3OJCA 1N2SA 1TJ4A 3D0KA 4EO9A 4ZYZA 4O4IB 2JGLA 5JS2A 2RIPA 3WDSA 4YI3A 5ALMA 1D4ZA 4UDNA 3IQXA 2QX6A 1IQRA 2UYCA 4FW9A 1OLOA 1P1IA 5IN5A 4HMQA 3FYUA 3KOYA 3CZ5A 4N54A 2OO5C 2ZCUA 3C41J 2AXQA 4DUPA 1G17A 2B61A 4Q4HA 3S1SA 1YIOA 1UMBA 4MX8A 4BE7B 2AKYA 3F1KA 1F8YA 1J97A 1RXCA 2GAFA 4QASA 1IXSB 2G5CA 3NIWA 3WGIA 2ZJ1A 4RJIA 3WQBA 4C7MA 4LZNA 1AKVA 1LTKA 4Q82A 4FWIB 5CM2Z 3MK31 1Y37A 4ZT6A 1A76A 5HFJA 4ES6A 2IUEA 2Q9BA 4LTNA 3IPCA 5C46F 4J7CA 4F4UA 4XFDA 4FJ0A 5EEHA 1EFTA 4MS4B 1HL3A 1SCNE 1UBTS 5J23A 4Q05A 2JW5A 4R31A 4OJNA 2JK1A 4KLRA 4WX2B 3PX2A 2DBZA 1CNFA 2VA9A 3WGYA 1YL5A 2XWSA 2JZCA 4U7WA 5BSMA 1GNQA 2DU8A 2JJ2D 1CRLA 5AXCA 3WMEA 3K0SA 1JKMA 2A0FA 2HA5A 3TZLA 1AQ6A 1U7WA 4F86A 4Z1MD 4JI0B 1TVKA 1Z0IA 3S8YA 4YO7A 3TRIA 3V3TA 3EX7C 1NKVA 1Z5VA 3R3VA 2RI0A 4G9GA 3F73A 4FBLA 2OCIA 1VPWA 1ZH2A 5I7SA 4WLUA 1ICEA 1ODSA 2ERCA 2XMBA 4AJEA 1E2PA 3ZE8A 2OUKA 3RYHA 3RE1A 2YV1A 2VPIA 2BKLA 2WU1A 3WG9A 4C0QC 1Q95A 3HP1A 5DP2A 5HBRA 3UV3A 2QNIA 3NEAA 2C2YA 2R8PA 4DUGD 3GU3A 3DMRA 1OQAA 4QREA 1R6BX 3HUEA 3CCFA 3BQMB 1MJGA 3HXPA 3I8SA 1HOTA 3K6JA 1TW3A 3HKEA 3QNWA 3A1EA 3I37X 4QG7A 2PT7A 4URFA 5A7GA 4QZVA 4JVOA 2OESA 3NPMA 5IF9A 1FFEA 1VCMA 1DTWB 5JLJA 4J49A 1B6SA 2C00A 4MV1A 4YYZA 2MMCA 4JOSA 2W4IA 5I8PA 3DMDA 1DADA 2CWWA 2FWAA 2OQRA 1GTG1 2WP0A 3N8HA 3MT9A 3PC8C 1GXSB 3FOCA 3PITA 4HQFA 4M9QA 4NS4A 4RORA 2PJRA 1US8B 1SR8A 1E3MA 2RBGA 3TSCA 2PBZA 4AMBA 1E1RD 5AJVB 2QE7A 3F46A 2PXCA 4HNSA 2BTQB 2CL7X 3B38A 4UHJA 1QORA 4RHEA 4US0R 3ZD8A 1PWYE 3ZN2A 3PWKA 3QYAA 3SKVA 4CFZA 5JS6A 2A1UB 2GCEA 2Q5FA 4BLWA 3BXOA 1MUUA 3DHWC 3NFYA 1KDOA 4IJWA 4CIYA 2BMAA 5DYNA 3K5WA 4A2PA 3JQFA 4BQOA 4ASUA 4DREA 3PWSA 1FNSA 1P9OA 4NCIA 4BAZA 2XUKA 1TAGA 2AI3A 4L8LA 4GPBA 4BMVA 3TM4A 1LDEA 4HJRA 3ZKAA 3ELUA 2OP1A 4HUJA 3RARA 3IDOA 2VJPA 4A6DA 2W2TA 4YGYA 2VRNA 1WB4A 4TVBA 5E6UB 3VHXA 1I7DA 1N8NA 1JTFA 2J4CA 4BQSA 1CFJA 4M98A 1YB4A 3Q1KA 2GARA 4LK3A 4L5BA 5LDGA 3K1JA 2H4YA 5EE0A 4FZVA 1FQOA 2H52A 4MWEA 1NVDA 2QSZA 2RC5A 4X7BA 3TZKA 1Q1QA 4TTAA 5K0JA 3BJEA 1X1AA 4CQNA 4B09A 3B5IA 1GTRA 4IIJB 2XF2A 4FHDA 4ATNA 2IF2A 1Y7TA 1NYLA 1U7DA 2GI4A 3AR9A 2WKPA 4GEGA 1UJNA 4P3NA 4CN8A 4F7DA 1P0QA 4GG1A 4UEKA 5A4JA 1JJAA 1L7MA 3L0IB 1RXSA 2FPIA 2P41A 4HGYA 5BSHA 1OJ7A 5D7NA 3F3YA 1E1MA 3RT9A 3H84A 2J41A 1X7DA 4PN7A 3KU4A 4R1UA 4XRGA 5A0VA 1TCBA 1J20A 3C3AA 5A4MS 3OZUA 3TJZA 1MJ5A 1IEQA 3P9RA 4NPCA 3UJPA 2DTEA 2FB9A 1HMPA 3NOVA 4EJ6A 1TYDE 3PIIA 5C7IO 3V9AA 1NYTA 5CCEA 1TU0A 2XVAA 2HD4A 1HGXA 2Q49A 1S5PA 1KAMA 5KVVA 2YWDA 3G0GA 4DA9A 2B4QA 1AV6A 3W9SA 5DM0A 5DPMA 5BRNA 4YMUA 2V7BA 4UMFA 3LPNA 1QHYA 1TW2A 2P2GA 4NNPA 1U0SY 2PS3A 4ESHA 3THYA 1AQJA 1XDBA 4YCMA 5ICEA 2NQ8A 3VHQA 1ADJA 1Y9ZA 2F64A 4WHMA 9MHTA 1TT7A 4RKYA 1ZMTA 3PGXA 4MUEA 1M1YB 2HLDA 2V7WA 4LKOA 4TUYF 4W1SA 1YJXA 5EHIA 3O8BA 2HPAA 3ZQ6A 5LNK6 4EJMA 1F0PA 3WKBA 1YIDA 1PUJA 1ONPA 2AZ4A 2GHQA 5CB4A 4ZAXA 2M2IA 3QJGA 2XQGA 2QN6A 1JN0A 3LLUA 3M6XA 4IZHA 5TT0A 3VU0A 1KY5A 1J6UA 2GZ1A 2HWKA 1GTVA 2AQKA 2IVZA 1VI5A 1L5SA 1Z0JA 2WHYA 2XYVA 1ZCAA 3EMKA 4HEA1 5LSAA 2R5FA 3K9FC 1I5OA 1SU6A 1N7JA 1Y7PA 4I55A 2VSNA 1ZONA 1FUKA 1LQ2A 3A6DA 4FHCA 1GV0A 1LLDA 1LWNA 5CX4A 5B4TA 1D2AA 1EJBA 2BJVA 2I6XA 2IYXA 3D5TA 4RVOA 3BRWA 3FIJA 4BNUA 2HHAA 3PR3A 5HA5A 4KUEA 4PXSA 1JL3A 5EXXA 2XMRA 1G64A 1W1WA 2Q1SA 3FYHA 3VZQA 2YY5A 2VDOB 1AK1A 3I9V6 3L6DA 1TNDA 1UQRA 4Q00A 3GJ7A 3N2EA 4AVYA 1FMJA 3ZIAD 3AJEA 1NRWA 2CHQA 2JFVA 3QA3E 1FRVA 1HDZA 1NMSA 1T3LA 2PX4A 2X0DA 1DOZA 3C6YA 3CUYA 2HFJA 2V6GA 2ONJA 4D0LB 4F56A 2E21A 2V4MA 1YI1A 1VLQA 2XB8A 3KUXA 3NNDA 4HDQB 2WMYA 5AI9A 1TDJA 1Z06A 1TMGE 4K46A 2EG9A 3ZWYA 4RTRA 5AH0A 2Z3VA 4X20A 4NBLA 4HNHA 3NONA 5TPWB 8ATCA 3BX1A 4DWWA 3LUCA 4I1IA 5GP1A 4MVJP 4RIIA 1C7IA 2O8BB 2NQTA 1ZQ1A 1IATA 2EV9A 2KYRA 5F35A 4EHJA 5A4FS 5JJ5A 3D64A 4P7JA 2GHTA 2QT0A 3U0VA 5K8CA 1I10A 1XA0A 4MVJM 4GZ6A 3LSTA 5K0LA 4P93A 5FDFA 3FOWA 2AMJA 2HEIA 1XZLA 4DMCA 4EUSA 5ILGA 1G3IA 2ZYIA 1WBDA 1DAKA 4M7RA 4NVRA 5CW2A 3HK2A 3EJ6A 5AW5A 2WTEA 2IP4A 1C1HA 1PZMA 3EXFB 3HPQA 2P6UA 4NV3A 1W30A 2BE7A 1U3VA 3UT6A 2OO5A 5JWHA 4BMNA 1YBHA 1Z5WA 4B6PA 5I5GA 4EVIA 3TIFA 3TG8A 3PGKA 4BVJA 4QDOA 1PDOA 2GRUA 4WT7A 2O5EA 2XRZA 2CWDA 4Q37A 4XSHA 1VKJA 3C1TA 1S2OA 3CLKA 3QVMA 4AJOA 3M4NA 1SHTX 2PZEA 4I3HA 2PJUA 4RGQA 1NVBA 3U19A 2JHGA 3DDWA 1CUJA 1DQNA 1OAOC 4FBMA 4M0UA 4NU6A 4PZUA 4NOKA 1ZVMA 2AEFA 4UNSA 3GJYA 3IPYA 2XA1A 2E7ZA 4P58A 2V7UA 1VI2A 1AG9A 5EJ5A 3JVDA 2GLUA 4DLYA 2JFGA 2ECPA 2JIPA 3ENVA 2IHUA 1WM1A 3F3KA 4HWRA 4M8LA 1VHQA 1PJLA 2M1XA 3OFKA 1XU9A 3PHJA 1GKKA 2EF1A 1BGVA 4P4GA 3U7RA 3M4XA 3WFIA 2YHIB 4Q18A 2FW1A 1P2BA 3FCCA 3RIXA 3VO9A 4MGEA 2OQIA 2HYIC 2E4WA 1H2ZA 1L1RA 3TLCA 4CMKA 3ED1A 4Z9BA 1JSZA 2XCUA 4Q66C 3WNQA 4INZA 2PMCA 3WSVA 2IPXA 4WADA 2F1KA 4AUNA 4BGEA 4LXTA 4UM9D 3DL7A 1F12A 1HDRA 4ZT5A 5J1SB 1JHPA 5D3KA 1N8KA 5K3OA 1AD2A 3AR4A 4KXUA 4RESA 5E2AA 3KWLA 1RYNA 2YOFA 4C4TA 2IEGA 3CNHA 2V0NA 2VJYA 5ICSA 5IN4A 3FZYA 1TYCA 2H1OA 1FYWA 2X8BA 4BP8A 3SZ3A 2CXPA 4EUKA 2ZZMA 2YXBA 1MR3F 1G6OA 5JY6A 1FP7A 4GUAA 4JBYA 4MB0A 1NTRA 5DBIA 3HKCA 2B8JA 2MR5A 3BWMA 1Q1BA 4FOPA 3KJQA 3PC8A 5FLXA 2ZWOA 3ETHA 1G8PA 3H11B 2PNFA 2F9FA 1MVNA 1PEKE 5EFZA 5FLYA 4ZI7F 5F9HA 1NMXA 2A9PA 4EEKA 2RGGA 2X9QA 3L7JA 4HAUA 4RVHA 1LD3A 1XBTA 4CPDA 3WRVA 5DB4A 4FX5A 4YDQA 1Q0RA 2QW8A 1J0XO 1LH0A 3BN3A 5FB3A 4HUTA 4MQMA 3MFYA 3NWPA 4E30A 2BL4A 3ZIUA 5F78A 4M1ZA 2WSSD 4G5YA 3KYJB 1YVRA 3FUUA 3RS8A 4ZKDA 5DI3A 5DK6A 3D3JA 3P0JA 4HXEB 4CT0A 2VP0A 2BGGA 1ODJA 2P6PA 3FSJX 2ATIA 1KI4A 4MGYR 2Z09A 3ESXA 3MC1A 4TX1A 4US1R 4ZOEA 1PNVA 2QD5A 2GFIA 2HH9A 5L6MB 3KE8A 2POQX 4I9HA 1UMCA 4IYJA 4Q39A 3RC9A 5IJ9B 1PGOA 1XWIA 4FHEA 3KCQA 3A11A 4QDXA 3OUTA 3DCJA 3ZLJA 2CSXA 3K1YA 2GK7A 1K88A 3B5EA 3MMPA 1SC1A 3TBFA 3E3LA 3EGEA 3F9RA 2EFDB 2G63A 3P0RA 4I8IA 4G8BA 2VDPB 1GYPA 1PL8A 1SQGA 1T5TA 3DA8A 4S1WA 4A3SA 2DSNA 1EDDA 1ZMRA 3GYGA 4HG2A 2GB4A 3KT0A 3TXAA 3KJIA 4EUEA 4UBJA 3ID6C 4EK9A 1Y81A 1KFCB 3MJ4A 2OK8A 4P82A 2VP6A 1OHHA 1S4MA 2ZSBA 4RS3A 4V02A 5FOSA 2C77A 1XMVA 3SZLA 4O4JB 2BLNA 2C2OA 3T7TA 2R8ZA 4EQZA 2ZYGA 1FDOA 4JD5A 5IYZF 5K8VA 1BA2A 1E79A 1S2IA 1LI7A 1WSDA 5KNDD 2X4GA 2AOTB 3DL2A 4UHDA 1ODTC 3K70C 4D8YA 5B7GA 5JSYA 1XEAA 3BVPA 5D6NA 3Q4GA 3OEEA 1BEZA 3WL7A 3OZBA 1P1CA 2O2CA 5BVGA 4YRNA 2ZRBA 1IJBA 1A50B 5FAXA 2BZ1A 4BDSA 1QZXA 7GPBA 1A9XB 1IFXA 3AIMA 5TSDA 2G9ZA 1PR6A 1HYQA 4W5RA 3AVTA 1D8TA 1KNXA 5KVSA 2ZUVA 5THKA 1U2EA 4MPTA 2AZMA 5AIBA 1QHEA 5JMOA 1FTYA 2ZSEA 3AEUB 3K0AB 4WDRA 5CA1A 5L3RA 3EXIA 4OFZA 1Z75A 4QT4A 4I5DA 3K0EA 4F46A 4CGZA 2HNBA 1A04A 4YP0A 1DQZA 1KO7A 2X3UA 2J5RA 3CB4A 3IS3A 4FYVA 4UCQA 4HVCA 5JYCA 4A03A 1V6CA 1PYGA 4U9UA 4ZV7A 4ARVA 1Z16A 2G1JA 3QEKA 1WE2A 1R27A 2X5JO 4P3OA 1UC8A 1YA8A 2GASA 1DUVG 3PQCA 4IH1A 3VC1A 3L7YA 5IT9A 1Q3HA 4XB6B 1KSFX 1GTL1 3C4JA 1M8PA 3VU3A 1Q19A 3MAGA 4FFSA 3U7JA 3DFZA 3BZBA 3KJNA 2HHHB 1Z6QA 1XDDA 2PYZA 3QK7A 4QLOA 1BX3A 5TX7A 3IAFA 3EZ6A 3LCUA 5IDVA 4K6HA 5KQMA 2B4KA 4FI3C 4FFOA 1TJNA 1AHHA 2OB1A 3AKZA 4JU9A 4QJBA 2GUGA 2Q3JA 2EQ5A 3P9SA 3VU1A 2RHWA 3PRHA 4CM4B 1P7PA 2VT6A 4R6XA 5JD5A 1VE1A 3H7IA 3ROQA 4G23A 2F43A 3Q5DA 3E48A 3LVRE 3OQIB 4CCYB 1NPTO 3MAAC 3FWHA 4F1WA 4WJZA 3U6KA 5EAIA 1P61B 3NTOA 3U4HA 1JI3A 1KA9H 2J09A 4I50A 4B45A 5EJ9A 1DKOA 1FU4A 1G55A 1T9HA 1IZYA 1UXKA 3CIFA 5DGCA 2B0JA 2VZ9A 3GEGA 1FXWF 4MVYA 4DV2B 3S2UA 5EIEA 2YZNA 4C4YA 3K35A 1G2PA 3BORA 5FNZA 5LOVB 3K2IA 3N0WA 4YUXA 3HJUA 1UDBA 2QZZA 4PVCA 1E20A 1MX9A 1UEIA 2EWWA 2RMKA 3QI7A 1JIJA 4NYMR 2NUTA 3UXHA 1ORVA 5GV8A 1QIJA 2WUFA 5FWXB 3EXG2 2GF9A 5CG1A 1B0ZA 1NW7A 3AKDA 1V95A 3I28A 2W6ZA 2W6PA 3O26A 4CLOA 1XNRB 4C0LA 3EH1A 4EA9A 1BS1A 3CW8X 1M2VA 4NU8X 1J0DA 1GSHA 3PKZA 4UUPA 1XRSB 3OPVA 3OKAA 5BQXA 1YCDA 5HK9A 5LMZA 1NJFA 1SNYA 4JJGA 2ZYAA 2R5WA 5CAEA 4AXXA 1YZGA 2HN9A 3BWXA 3U5TA 1IEXA 3STXA 1R50A 1NVAA 4CKWA 1YS7A 4W1PA 3Q9LA 5TARA 2G06A 3HI4A 2VSYA 3L49A 2FGJA 1OAOA 1V11B 3B1XA 3FZEA 4LUCA 3ETGA 3P2JA 2XZOA 4DXHA 4GI2A 1V9SA 4UAGA 3BL5A 2XBUA 3L3BA 4LZWA 5EZQA 2QMQA 3DNPA 4NHOA 4ZVPA 1NR7A 2JH8A 5DNEA 2WVAA 1CWUA 4FS8A 3OE4A 3AUSA 1E6UA 4CNBA 1WOYA 4HV4A 4TWIA 5ERYA 3CINA 3TCKA 5MDHA 2C5BA 1Z15A 2NOAA 4NAHA 5KJ1A 4M0PA 4NFSA 3UOWA 5KYWA 3THXB 1FSPA 1BMTA 1E2QA 5HZGA 5EE1A 1V7PC 2V4UA 1WKBA 1OLSB 2X5OA 1MAAA 4AK9A 4FUTA 1SKYE 3ZE7A 1JT2A 1S1MA 3ABOB 3VAAA 1HZZC 3GGDA 3GZTB 4U2FA 2G07A 3JARB 2HDOA 4ENWA 1R10A 4I19A 4FP9A 2B8EA 1CQPA 1XTBA 2OHFA 3JU3A 4CXMA 3EG9B 3P9PA 1N3IA 4FYWA 1GPKA 3T54A 1Q1EA 4AX4A 2ON6A 1MABA 3BH7A 2GD1O 3S29A 4XWOA 1ESDA 4WINA 3CRMA 3I05A 1H93A 1LPNA 1ATZA 3TOCA 1X14A 1DBQA 4CL2A 1X74A 3QKSB 3K71B 3B82A 4C29A 3NWJA 1SIWA 4BV3A 1WXGA 2I6UA 4J0FA 4N1AA 4TRMA 3VDNB 3U40A 2OM2A 1KZ4A 3U26A 2O2JA 4ZHQA 1LS1A 3SYMA 3CUEF 1S1CA 1TI7A 3DF9A 4OXQA 3Q12A 4GOLD 1JVNA 4NBTA 1MVLA 3C3YA 2W71A 5B1SA 4X6LA 3HNOA 1KYQA 4O29A 3ICOA 4K0RA 1NJ6A 3LX6A 3R09A 1TAUA 2C2XA 2JHFA 2AS0A 3B9QA 4QQKA 1B15A 3UPDA 4KXLA 5BOSB 3KHSA 2J6BA 1SGWA 1NF2A 4WPGA 3HEBA 4KGDA 1NBME 3JD1A 4RD2A 5GV7A 3ND6A 3S27A 4N49A 3V34A 1L3BA 2HUPA 1K92A 4BQIA 3ER9A 3TX2A 1C0EA 4WLVA 4U7PB 2H1IA 3NBZC 1BDIA 3HO6A 2VYVA 3L93A 4Y9UA 3M4YA 3TTUA 1N33B 4BQPA 4HQNA 2EF0A 4OU5A 3ETEA 3GEPA 1BH6A 2HJSA 2I66A 5J2UA 1R0YA 3HNRA 5KTOA 3QENA 4RZQA 1TCVA 2JFOA 2QRMA 4FLEA 3SEAA 4DLUA 3GG2A 1KQGA 3WGLA 2V3CC 4B85A 1N2BA 1C4OA 1YQWA 7ADHA 3N2NA 3EUAA 1E3IA 2XEXA 3SHWA 2PV0A 5C31A 4QQRA 1RYEA 3LT1A 3G6WA 2ZWIA 3T3HA 4G65A 3BMNB 1R9MA 2HU5A 4OSPA 2O2ZA 1P6QA 2QTWB 3F74A 2HR1A 5LP1A 2V5UA 1JIQA 1YZTA 1E2IA 2XBLA 3BAFA 2XWJI 3QEMB 3CRW1 4OOEA 3U9LA 2YH2A 1GQQA 5G1OA 5BWLA 5J4VA 1AJEA 1E7RA 2P35A 1QVRA 2B21A 4B9AA 3A9SA 3VR3D 1UMDB 2P6MA 3B3JA 3MS7A 4Q5IA 3IR5A 4RH1A 4JIMA 5ALWA 5CLLA 3BE6A 1NXPA 3C48A 4BBAA 2FSPA 1QO0D 1R6DA 1RRCA 3OI7A 3QTTA 3FTPA 4PHCA 2X5XA 1VYHA 2BGMA 5JCXA 4NEGA 2H5LA 2I2AA 1UXIA 4UASA 3UUFA 1L5OA 2VC2B 3I5AA 3IAUA 4HUQA 5GVRA 3OVMA 5T8KC 4BNLA 1UK7A 3W77A 4HLQB 4J16C 5GONF 4DARA 3CJRA 1DLJA 1N2CB 1XVTA 2ZANA 5CLGA 3WJAA 1OXBB 4JY7A 4W82A 4ONEA 5A3VA 1K98A 1XPRA 2R85A 4MULA 3V42A 2OOSA 1VHLA 4B74A 4ZZ0A 5EPUA 5LB4A 2B1JA 3SGLA 2BHRA 1MXFA 1N6PA 2RKOA 4A9AA 2F1IA 1A5TA 4BCDA 4KWIA 2WFMA 1HFWA 2MCFA 1T4CA 1KP9A 3C3EA 2RGAA 3WGJA 4NX2A 4D45A 1XRPA 4EKGA 1JHZA 4PW0A 4G2NA 5CPBA 4WKOA 5LLSA 2D0IA 1M34E 5I8ZA 5I7WA 2CLLB 1KDYA 1ULTA 3R3WA 5GTDA 5DYIA 5KNCA 1GUBA 3INTA 4JB0A 3BTOA 5CFMA 2HTEA 3GFGA 3WAGA 2HUNA 4L28A 3ZNQA 5ALXA 1RQNA 3A6EA 1U4NA 1VOTA 2AJLI 3AZPA 1ZUNB 3KBBA 3NFRA 4K3VA 2ZYVX 4KQ6A 4I99A 1QHGA 2QGZA 2Y1OA 2YINC 2ZI3A 4YJHB 3N0RA 4R69A 1H6AA 3PA8A 3LXUX 4N76A 3KNZA 1CUVA 3JAKB 4P32A 2BEJA 3T1VA 1E9BA 1M2KA 1P7WA 2FY8A 4PFSA 4WTOA 2NU6B 4P5EA 1RVDA 2VJOA 3GZNB 4L8FA 3E2PA 4WZBA 3HA7A 4QFCA 3VM6A 4OTZA 1U9CA 4FWTA 2CNWA 4M1WA 1XQ6A 2CBGA 1XXLA 3G89A 3V8BA 1JSXA 2JIQA 3CNEA 1OIXA 1JE0A 2TYSB 2D5BA 3FFBA 3FPHA 1OWMA 4GI5A 4M0EA 3RSQA 4YV0A 4JI8B 3DZIA 1VLMA 3ZR4B 3IEVA 4INOA 2J3QA 2CHVA 2OXFA 2X86A 3IXQA 4NE2A 3IP6A 1UBCA 4C20A 2GK3A 1DX4A 1W1UA 1GPJA 4A8TA 4C6SA 4ZK6A 5K4GA 4NOMA 1PD1A 2NZJA 4HGQA 4MW7A 4BNMA 5JYEA 4Z51A 5CFPA 2F1JA 1IYZA 4FDTA 3NDPA 1Y1KE 3IMGA 1MP0A 2AYYA 5J1TB 3HV2A 4RKRA 3HZZA 4LJ6A 2HGSA 1C8LA 3PIDA 3A4IA 5JIBA 2QTTA 5JC1A 2OFOA 4YNBA 2ONKA 4KQXA 1KI7A 2R8RA 1U1IA 5IU6A 5K20A 5KNBA 4PTYA 4Q1CA 3EVFA 5HKBA 3R3JA 5SYMA 3HUDA 4YVFA 4ZVTA 1NLUA 1D9XA 1L5RA 3GEHA 1A8IA 4AS2A 5F2OA 1OGJA 1ZDMA 2XUAA 3UQYS 1ETUA 4FFNA 1XMXA 3ZDRA 1M0TA 2QM8A 1XI2A 1OFHA 4HYTA 3I8OA 4NF2A 1F6DA 1YHZA 1Q16A 2EARA 2LNDA 1YS2X 3NYWA 1V71A 1L8OA 4AUEA 2GEFA 4H7PA 1DRVA 2Y0EA 1XKTA 1J07A 2B2CA 3C70A 3DZGA 3AJDA 1MKYA 4HH4A 4IXMA 3P71T 4L8YA 5AKGA 4GOKA 1P7ZA 1SUSA 2R1VB 1SVKA 4GO1A 2CZQA 1PZGA 2Z2ZA 4UVIA 3V1LA 3KQMA 2IPOA 4RFLA 1A9PA 1N9GA 1A2OA 4RMIA 2ZPUA 5FOQA 1TQ6A 2C3MA 2H3EA 2HLPA 4RTOA 3E