3H5OA

The crystal structure of transcription regulator gntr from chromobacterium violaceum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
RTVLVLIPSLANTVFLETLTGIETVLDAAGYQMLIGNSHYDAGQELQLLRAYLQHRPDGVLITGLSHAEPFERILSQHALPVVYMMDLADDGRCCVGFSQEDAGAAITRHLLSRGKRRIGFLGAQLDERVMKRLDGYRAALDAADCRDAGLEWLDPQPSSMQMGADMLDRALAERPDCDALFCCNDDLAIGALARSQQLGIAVPERLAIAGFNDLQPAAWCTPPLTTVATPRRDIGVHAAKALLQLIDGEEPASRRADLGFRLMLRRSSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator GntR
publication title The crystal structure of transcription regulator GntR from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Transcription regulator
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA01
1KMIY 3D8UA 2V0NA 8ABPA 4Y9TA 1PUXA 3GL9A 2VUIB 3CHYA 2H0AA 1LBHA 2QV0A 4OTZA 4H3HB 3H5WA 3LUDA 4Q6BA 3JTEA 2AYXA 1DBWA 1U8TA 5FBHA 4S04A 1OXKB 3BRQA 5FWXB 4PEVA 4XXHA 1RPJA 3ILYA 3RVMA 1NXWA 3LOPA 1H9CA 3M6MD 4HYEA 3HZHA 2JRLA 1DBQA 4L4UA 1HEYA 3NNNA 4KK4A 5JNSA 3Q41A 1RNLA 5KQPA 2QW1A 3B2NA 3EGCA 4P98A 4WXMA 3RH0A 5HQJA 1NY5A 5B3JA 4ZMRA 1JX6A 2O20A 5TQ0B 1GCGA 3H5VA 4YV7A 3H5IA 4JASB 1Y1LA 3SY8A 2PJUA 5D2CA 4YLEA 4ZPJA 4OG2A 1Z15A 1T34A 4MPTA 4EYGA 2F8TA 1PEAA 3HSYA 4RY8A 5T3YA 3QLVA 4RK4A 1QQAA 2MSKA 2JVIA 1L5ZA 2HJ9A 4O1IA 5TPWA 3CKMA 2HQOA 1TVMA 4W5TA 2VYCA 1JFTA 3F7NA 5HM6A 1I3CA 4RZSA 4WWHA 2NT4A 2ID9A 3TX6A 3JY6A 1M5UA 1K66A 3BREA 2QZJA 4N03A 2WY2D 2M98A 3OO1A 4L85A 3FDFA 3NHZA 3LUJA 4JOQA 1F51E 5TPZA 4MRMA 5C5EA 4MQEB 1GUDA 2R47A 4N0PA 4PYRA 5KQLA 1MB3A 5JNVA 2F8SA 2W42A 2E4UA 1JYEA 2LIVA 1ISSA 3KTOA 2R48A 3JS5A 2IOYA 2FLKA 3KLNA 4MS3B 5EWMA 4YCSA 4ZYLA 2QVCA 3N0WA 4EVSA 4PZ0A 5IULC 3DLBA 2FEPA 2HSGA 4UHJA 5TQ2B 4Z4CA 1NATA 4MR8A 3LUFA 1NXSA 1DC7A 3Q15C 4OBBA 3JVIA 4TN5A 2JBAB 3MYYA 1NXVA 2FSPA 2JK1A 1XWWA 2A9RA 4YP9A 3UK0A 2PAFA 1JDPA 3SQNA 2WWVD 2LBPA 1YTUA 2JB9A 2GWRA 1EWTA 1BDHA 4ETIA 2Q5CA 4F11A 4O1HA 5JNWA 2IPMA 2FQXA 1Z17A 4LE2A 4WT7A 1MB0A 2YHBA 5IBQA 5ABPA 4N0QA 3DBIA 3F6PA 3N6VA 4NV3A 3H75A 2ID7A 5TQJA 1KRXA 1U2QA 1URPA 1ZDMA 3RVKA 4IRXA 3LKBA 1P2FA 2FEWB 2CHFA 2E4VA 2FMIA 3OLZA 4RSMA 1JF8A 3O1JC 4MR7B 1M2EA 3HDVA 4MS4A 5FWYA 3EQ2A 2XDYA 1DCKA 1ZGZA 3BRSA 1GLGA 3C3WA 4Q6WA 4Z9AA 4F12A 2P9HA 3LTEA 5E3JA 3IP9A 4OLAA 3TD9A 2E4ZA 3KKEA 3IPCA 3W9SA 4F3TA 2MSLA 2RJOA 1ZAYA 4HNQA 1EWKA 4F8JA 1DCFA 4MS1B 3LMKA 3T38A 2PMCA 3RVSA 1APBA 2M1ZA 4PE5B 5PNTA 3HM9A 2E4WA 2WRZA 3RVLA 3H6GA 1E6MA 3C3MA 4IGAA 4MLCA 2HQBA 4KV7A 2PUFA 1MVOA 2RGYA 4MYRA 1FFGA 1NXTA 5BR1A 1JYFA 4MAAA 4KPYA 1MAVA 4H3KB 2LP4Y 2JVJA 3I45A 1UDRA 3MIZA 1C4WA 1SD5A 3MM4A 4G0YA 2L18A 1AB6A 5DGCA 3Q7TA 3EODA 2A9QA 4LDZA 4TMYA 4RV5A 3GBPA 1AB5A 4RWEA 5TPZD 2PUEA 4WXEA 4MR9B 5FWXA 1EAYA 2FW0A 2OQRA 4UHKA 4JP1A 1A0OA 1DP4A 4EYKA 1KGSA 4RY9A 5BRJA 4W5OA 3GWGA 1E6KA 3I42A 4KNYA 4KREA 3KCNA 2DRIA 9ABPA 1K68A 3T95A 3L49A 4RS3A 4RKQA 4G0OA 1S8NA 3GT7A 5TQ0A 3CNBA 3N8IA 3JPYA 1BDJA 3QX9A 2PKXA 5EWLA 4N41A 2YHAA 1NXPA 2N9UA 4W5RA 3G1WA 2QXYA 3H5LA 3T6KA 2TMYA 3O1IC 4RXMA 1SXGA 5GOTA 4W5NA 1XHFA 4LX8A 3O2SB 2MSWA 2P4UA 3S99A 3L6UA 6CHYA 3NBMA 5JNUA 4RK7A 3RVOA 3RVQA 1U2PA 2WB4A 1QPZA 1Z26A 2CWDA 5KQMA 4EGSA 3OQOA 1Z18A 3O75A 4IF4A 3Q7RA 2KYRA 4KFCA 4QICA 3CFYA 1PEYA 1ZH2A 5DTEA 3GRCA 4Z4EA 3DGEC 1VLZA 4LE0A 3HEBA 2FXIA 3KHTA 1ZY2A 4RXUA 4HNSA 4XARA 2MYPA 2MYUA 1SXIA 4RK5A 3N0RA 3FMVA 4QYMA 3GBVA 2GBPA 1USIA 1W25A 5KQGA 2I6FA 2ZAYA 3OO0A 3HJFA 2PL1A 3KSMA 2FLWA 2WJWA 5CNMA 3NHMA 5B3JC 5EWJA 5IX8A 1U04A 3FFWA 4JA2A 4M88A 4TLLB 4MS3A 3LUKA 3FGZA 2IPLA 3HK2A 4MQFA 3EQZA 2NUBA 3I09A 1QO0D 3QELB 5T7BA 5TQ2A 1DZ3A 1P8AA 1D1QA 1P6QA 4LE1A 4E7PA 3QEMB 2IPNA 3QEKA 4QYWA 3SAJA 2E4XA 2JBAA 3A0RB 1DRJA 3QLVC 1SXHA 5TPWB 1Z12A 3RVPA 1JL3A 3O21A 1EHCA 1EWVA 3OMXA 1LJUA 2PUBA 4ML3A 3OM0A 3OMWA 4IMJB 4ETMA 3HUTA 1BVHA 2NT3A 4KMRA 1YMVA 1ABEA 3E3MA 4EVRA 3A0UA 2MYNA 3MMNA 3UUGA 5KC8A 3DLHA 5HSGA 1E2BA 4Z99A 4MR7A 4XASA 3JVDA 4OLBA 4D74A 2RJNA 4O5AA 4Z4HA 2R4QA 2FN8A 2FTKE 4YR7A 1TM2A 2QVGA 3H5TA 5I4CA 3GYBA 3BBLA 4EY3A 2L2QA 1FQWA 3Q9SA 3EJWA 5JNTA 2IYNA 1TJYA 3IPAA 4G0PA 4MR8B 1MIHA 3QLUA 4KQ9A 1PNRA 1B00A 3F6CA 1QP4A 5C5CA 3F73A 4JB2A 4F06A 1YMUA 2BGGA 3KJXA 3RVRA 3IP6A 3JPWA 4DADA 5HKOA 5JNRA 4KZKA 3URMA 1QP7A 2J48A 2FQYA 5CHYA 3IDOA 3EDCA 1QO0A 2JVKA 1RZRA 1DRKA 1YVUA 3CG4A 3LUCA 4IMIB 4Z0NA 2B4AA 5IC5A 2MYTA 3H1GA 5CNIA 5DCLA 1TMYA 3DZDA 2IDMA 4YWHA 1YS7A 1PNTA 3VNBA 4GNRA 1QP0A 5BRAA 1NTRA 4DN6A 4MR9A 1QQBA 4MS4B 2WJAA 1YK1A 4KVFA 3BILA 3C6QA 2QR3A 4P1ZA 4RK1A 5KI6A 3FFXA 1ISRA 2PUAA 4KQCA 1FSPA 3M9WA 1JFSA 2LPMA 1BA2A 3CLKA 3D02A 1JLKA 2FMHA 3UKJA 1DC8A 2X7XA 3LUHA 4H60A 3CZ5A 1NXOA 4HNRA 5TE9A 3SNKA 3CG0A 3IP7A 4EUKA 4D6YA 2FQWA 5F64A 3MQ4A 4Z9BA 3A10A 3RVJA 5IEJA 3RQIA 3HO1A 3HDGA 4NCAA 3EAFA 1EFAA 3GV0A 2GI4A 3MA0A 2A9PA 2FKAA 2GKGA 3N53A 2B1JA 1D2AA 5JS2A 3N0XA 4ETNA 3OQNA 4DQDA 4IILA 1GUBA 3DGFC 3H1EA 2QU7A 4G97A 2ZWMA 5IUKC 5IEBA 1OXBB 3HS3A 4E7OA 3H1FA 4Z4FA 4JB0A 3A3KA 2OENG 4Z4GA 4YRZA 4ZMSA 3H5OA 3C3KA 1QMPA 3KS9A 1R8JA 3EULA 5BQ3A 4RU1A 1YK0A 4WUTA 4B09A 4G0ZA 3NNDA 3ROTA 3TB6A 3CTPA 1DJMA 2FN9A 3P9YA 1BAPA 4FE4A 5GQSA 1M5TA 3G85A 2FEKA 5EWLB 1D5WA 1DG9A 4JAVC 5JS1A 4MQEA 1VKRA 1ZITA 2PUGA 3HUUA 3LKVA 3QX8A 4EVQA 4ZJPA 1D4ZA 3QELA 1KRWA 1P6UA 5CNKA 1Z2DA 3ILHA 1FFWA 3C97A 2VUHB 3Q7SA 3KYIB 2HQRA 3QEMA 4TLMB 3OQMA 3O2JA 1ZVVA 4YO7A 3OLWA 3LUGA 4GPAA 3M9XA 4LZLA 3QLTA 4G86A 4MLDA 2RDMA 4EYOA 2L19A 4S05A 1RZRD 2FMFA 4FB4A 4W5QA 1DBPA 1YIOA 1ABFA 3OLXA 1ZESA 4RXTA 1JDNA 1JWLA 3TMYA 2IKSA 2E4YA 4G0QA 3FFTA 4WZZA 3GA5A 4RK6A 1JH9A 1SRRA 2PLNA 2R25B 3KYJB 3IP5A 1Z16A 1LK0A 3CZCA 1IIBA 3I5AA 3N75A 4MGEA 3SG0A 4D6XA 1BDIA 3QK7A 4KK3A 1PHRA 2QSJA 3O1HB 5IUNC 1A2OA 3CRNA 3K4HA 3HVRA 4XLTA 2VK2A 4NICA 3OLYA 2FMKA 3K9CA 1DCMA 1LBIA 1NXXA 5DLEA 5EWJB 5KC9A 1CHNA 4MRMB 4G0XA 1RXIA 5FBKA 1L5YA 1VPWA 2LUOA 3O2QB 4MQFB 1U0SY 4FE7A 2A9OA 7ABPA 1VRVA 4XAQA 4KRFA 3LUAA 5EWMB 5ED4A 1QNLA 4LRQA 5IUJC 4OATA 4Z4IA 2L17A 1USKA 2HPHA 3KLOA 2JCGA 2NZUG 3O74A 4QPJC 1J56A 1Z25A 5KWSA 2NZVG 1ZGGA 1M2FA 3E61A 4MS1A 3TO5A 4N76A 2AYZA 1JHZA 4RK0A 2PUCA 2GX6A 3OLVA 4EYQA 1FFSA 1ZN2A 4LDAA 3H6HA 1JBEA 3LFTA 4YGXB 4RDCA 3RVNA 1USGA 5DKFA 1A04A 6ABPA 1E6LA 1F4VA 2H3HA 3CS3A 3CU5A 1WETA 2PUDA 2PL9A 3HCWA 3OM1A 4RY0A 3T8YA 3MF4A 4G0MA 1QKKA 4CBVA 4Q7EA 3HXMA 4NQRA 1C0EA 2CHEA 2FVYA 5FWYB 2CD7A 1Z13A 2WMYA 1CYEA 1RXEA 1ZH4A 3ROFA 1ZHHA 1D1PA 4N47A 1W9HA 3QLUC 3VNAA 1JFVA 1Z2EA 1LJLA 4RKRA 4PICA 1YS6A 3SM9A 4NCBA 1CEYA 1XHEA 1TLFA 3HV2A 3KG2A 4XFKA 1GCAA 3R0JA 2PE5A 4YS6A 3NNSA 2IPAB 5CNJA
chains in the Genus database with same CATH superfamily
3RUCA 3AJAA 1N5OX 1EFUA 1W93A 4HEQA 1VB5A 4DMLA 1J5EB 3ZU6A 3QYFA 1YZHA 2X40A 3UC9A 2V7TA 3HKEB 3IFSA 4GR4A 4Z0PA 3V4SA 2AZXA 3R1IA 1SIUA 2NVUB 1Z6ZA 4L7QA 1KOGA 3TNLA 2X3YA 4LWQA 2QJOA 4RSHA 2FJUA 1YZYA 1U2RA 2RHGB 1F2TA 1VBMA 1NT2A 4CI0B 2ZIWB 1ZJ4A 4BX8A 4JLJA 2P78A 3GLRA 3NIDB 1R37A 4OP2A 3HA5A 3JAKB 2F48A 2GZRA 1O6CA 1KDVA 2BEVB 1OH6A 5EJ2A 3H9CA 3KYCA 4Y2JA 3HU1A 1XTUA 5HFNA 3QU9A 1L3CA 1R8YA 3FDXA 4KK4A 2QGFA 3NS7A 4TRRA 4AXXA 2NZJA 2Z2KA 4ZQBA 1QC5B 5KQPA 1XQWA 2X0NA 2XECA 4HVTA 4ZYZA 3JWGA 1C7ZA 5IVPA 1P39A 1T5BA 3GLVA 1CT9A 1JKJA 1UPUA 4LVCA 4RM3A 1QF9A 1VI5A 4P36A 2IY9A 5JWOA 4Q3NA 2ZT7A 4LNUB 1GQQA 3GFQA 1OZAA 2RI0A 1R6BX 4RZIA 1KDPA 1KO7A 3Q10A 4I4LA 3F2VA 4PC3A 3S1LA 3U3JA 1ONSA 4CL8A 5DGIA 3PZRA 4X8OA 1JXAA 2AG5A 3JALA 3RVDA 3H97A 1PSZA 3E7FA 1PBNA 1GP2A 3PC3A 3QLVA 4OQNA 5TVGA 2OBYA 3M2TA 2Z57A 3BE4A 4KXWA 4XIYA 4X00A 1VPWA 4I8DA 4OUDA 4H16A 4FHFA 3MWEA 1NC1A 4MMYB 5HA5A 2XUHA 4F1JA 4F5WA 5KKAA 2HSZA 5P8WA 4QUGA 5HM6A 3LCUA 4BVFA 1UJBA 4ND8A 4WWHA 5G1NA 1MEEA 2HMWA 2JIBA 1M5UA 2HYDA 5JSZA 2Z8YM 1UMKA 5KDLA 1XXHA 1KMQA 3HUDA 2P6MA 3HBLA 3O3OB 4O4JB 4COKA 5DM1A 2ZRJA 5COBA 2A58A 3DXXA 2NUAA 3Q8WA 1VE9A 4QDUA 5TPZA 4DCTA 5B3LA 3LC7O 1FDOA 1Y3HA 3WLIA 1XKTA 2WIAA 3H2IA 3LYUA 3ESRA 5CRIA 4G8DA 4BUJA 1PGNA 1N32B 2PPLA 3GW8A 4EL5A 3R75A 2YNMD 4LW8A 4DGQA 2CHUA 2XUJA 2QHXA 4IGEA 4Q9KA 2DWCA 3JQCA 3PQ2A 3UVEA 4DJFC 3UZUA 4HDKB 1NVKA 1X94A 1SUFA 3LWZA 4KVAA 1R0YA 5FADA 5FLXA 1XHLA 4B7ZA 1I6KA 1NE7A 1H1LB 3QU4A 4PG4A 5L7YA 3DVRX 3PNQA 5F1PA 5AIBA 4P33A 1ZINA 1NLYA 2VYFA 3ABRB 1JDPA 2IYUA 3K9WA 1OFGA 1UMCA 4FSHA 5BN4B 2MSCB 3C14C 3UK2A 4YRQA 7MDHA 4M36A 1A9XA 4Y18A 2HB6A 4M37A 4E2WA 4ZEMA 3L9XA 1YDMA 2VAVA 2FG7C 1XVUA 5EHQA 3LZ6A 5IBQA 1KQGA 2W6JA 4C4ZA 4MXDA 4A7PA 2ID7A 5JQGA 3MGGA 3ADDA 4OJQA 5GIOE 1HPLA 2H1WA 4IRXA 2ZYWX 4IV8A 4JUBA 3T9DA 4U8GA 5CD9A 1GPWB 1UAAA 4OB7A 2XCSB 4QRIA 1CUUA 2YBEA 4YRBA 3PRJA 1K9VF 2CK3D 3O1JC 2BM1A 3PJDA 4R69A 3QYJA 1U2DC 4LOHA 3KYDB 3O8RA 3DBRA 5HKAA 5IZCC 2VAWA 4HV4A 1Z0ZA 2AE1A 4OBWA 3PUYA 3AUUA 3QNUA 5T5QA 1IQRA 1MVLA 4IZHA 5GVRA 2QM0A 2P9HA 1P31A 2NPOA 3PGVA 2HNKA 2RONA 2A67A 4TOIA 4YFYA 3P2OA 1C9JA 2ISSD 2DYKA 4YT4A 3ORQA 2ZIZA 3ENKA 3PWSA 2M1ZA 4Q4HA 1ISFA 4RELA 4F4DA 3B1ZA 1VG1A 4KEAA 1PEDA 2JAHA 2R4TA 1GGJA 3QEJA 3U7FB 1ODTC 5IJWA 3FFBA 5D5PA 4MYRA 1GHTA 3LNCA 3WYEA 3AU9A 3LDGA 4PFSA 2C4MA 4G1MB 5FA6A 3PE3A 5FTWA 3ZHBA 4L4SA 3U3OA 5GVSA 3GLTA 1EBBA 4KRYA 3RREA 3VKUA 2NVUA 5FA5A 4UCXA 5T3UA 2N1MA 5KJCA 1EJBA 1YQ9A 4TMYA 4LFCB 1VL2A 1XD9A 3IIKA 3E23A 1EWYA 1DS6A 3MLBA 4EK9A 2CFRA 3M6IA 2FRVA 4EB0A 4EJ2A 1W34A 1W75A 3Q5DA 4YH1A 4B47A 2PUEA 1EAYA 3JAKA 5H02A 2BEVA 3IDQA 4FQ5A 4YMLA 4B6EA 4F3RA 2DETA 2BGTA 1RJ9B 3E9MA 3M3PA 3JW8A 3GG2A 1WG8A 1RTKA 1QG2A 2Y66A 3KCNA 4J75A 1QGAA 2DFVA 1UPFA 1WMFA 3EIFA 3F4LA 3DEJA 3GQBB 1G16A 2W5UA 3DMNA 3LBAA 3LCMA 1WP9A 4CMHA 4CVNA 1T15A 3EAQA 1EVYA 1WXQA 2N1BA 2W7TA 3DE5X 1KY2A 1RWBA 2XMZA 3Q6MA 1JQAA 4H7EA 4ZEWA 4BFVA 4E30A 1XA4A 2FW9A 3E58A 4AMBA 4LX0A 2HR1A 4K3VA 1AQ6A 2ZIUB 3A1FA 4DF3A 3FOAA 4XVCA 4AJ1A 5JLAA 4JLAA 5K3FA 2P6RA 5I9NA 2A5GA 4OOFA 1OILA 2PZ8A 1RPAA 2C9BA 2IRWA 3FYTA 1YVDA 2X23A 2JGDB 2YDXA 5JNUA 2POCA 1GM5A 1TQ2A 3VYSB 3PPIA 3R3VA 4DIDA 2CWDA 3E27A 4EFNA 3TUIC 5EIBC 1VBNA 2WJIA 1CIPA 2NZWA 2P9CA 1G3RA 5ED0A 3JASA 1K88A 2KYRA 1MDBA 5F1KA 3KQVA 2Q9CA 3M6AA 2B8NA 1O2DA 5EJ9A 4QDKA 2V03A 4D3XA 5GZ3A 2CE2X 3GFVA 1UP7A 3AKZA 3JSXA 5JCZA 3NALA 5BW6B 3AFHA 1KAOA 3W5VA 4RXUA 1WXHA 2HSEA 1KBZA 4TVSA 4N18A 2I0FA 5IAGA 1T3SA 5ALKA 3WADA 4R7TA 2P3OA 3N0RA 3KEFA 1ZM4A 4C4PA 2IZOA 3GB9A 4ZV7A 2WHYA 4LRWA 4HUTA 3CLUD 2FLWA 3RFVA 2VA8A 2FWMX 3FFWA 3E8MA 5BV1A 2QYTA 4HDAA 1EVEA 3DKRA 2B34A 4S0XA 3VO9A 1R64A 3N86A 1AO0A 2C8KA 1RMTA 3GGDA 1R6XA 2R7LA 3UBTA 3QEMB 4RIHA 3HXPA 4ZVVA 1CY4A 2QZPA 4FDUA 5JAMA 1OASA 4JSTA 1H1LA 1INLA 2JC3A 1DRJA 3L7DA 1OWOA 2A1TS 1ZU5A 4AIIA 3ZDRA 2H16A 4L76A 4M49A 5KVVA 4I99A 2G1AA 2B0JA 2MINB 3HDQA 5H9WA 3O7WA 2W2NA 3Q9LA 1SG0A 1HMYA 1VKNA 2NADA 2JFVA 2WHQA 1NQVA 3PTZA 3HUTA 4BNTA 1E2UA 3AZPA 3PNBA 1HSOA 1I5OA 4HSEA 3BWBA 3VU9A 4PX3A 1NYLA 3FR7A 3HNOA 4HXFB 4LY9A 3WWZA 4DMFA 3LQFA 2XCIA 4M0DA 1MG0A 4XASA 4UUAA 3THSA 4RJLA 1JHUA 1IVYA 2QPTA 3QKRB 2G09A 1U8YA 3PXEA 1XDZA 3K2BA 3WJAA 1UJ4A 1G64A 1ARZA 3PJFA 1H2EA 3BBLA 3TLXA 2L2QA 4ER6A 2PZJA 5I4KA 3FZQA 3ZWYA 4LDNA 4MR8B 2CLOB 1L5FA 1Z33A 4CLEA 5CU7A 3OH8A 3BJRA 3FKJA 5U4XA 1QO9A 1F8XA 3SSMA 5ALHA 3RVRA 1G5RA 3B5IA 2O3RA 2WM8A 3IP6A 3IUSA 4TQUS 4BMZA 3WYGA 4RVHA 1I7QB 2VYQA 2FQYA 2XSZD 5DT2A 1KTIA 3IXLA 3N39C 1IPFA 1B2RA 3SBDA 1NVXQ 1E2KA 4EPXA 1R9NA 2BTEA 1E2MA 3G2HA 2CXUA 1Q11A 3CM0A 4JC5A 4LTNA 1IJBA 4GLFA 4XM2A 4AJKA 5ALRA 4B6PA 5ILOA 4YWHA 3M2PA 2WE8A 3ONFA 5FA8A 5EHZA 1EFDN 1YJAA 4YP6A 2QT0A 3SJBA 5HK9A 5LQRA 1G291 4YRGA 1IVNA 1NTRA 3HPRA 4R51A 5DYTA 1EIZA 1Z45A 4BP9A 4DN6A 3HP4A 1X1TA 3KBBA 3ZHYA 3IMCA 1BZYA 4I55F 1YK1A 3A28A 4RK1A 5AJTA 4XPIB 1UH5A 2EBFX 4N1AA 5HDQA 3MCUA 2QMOA 3D3JA 3SI7A 2ZUUA 1Q84A 4IKOA 3HKBB 2VJQA 3KXIA 1Q44A 4KUEA 2FMTA 4GHWA 1QE5A 2IHJA 3GQBA 3BHIA 3O6VA 4N12A 4W5JA 5D1HA 3QFHA 3PHHA 5EVCA 3WFIA 4L8FA 1I3NA 2D2IA 2HY7A 3KPWA 3EXIB 1TEVA 1LVHA 3TPCA 1G3QA 4BFZA 4H60A 1TU0A 1XR3A 1JSCA 3N1UA 3FYHA 3JQAD 5FR2A 1ISPA 1JMYA 1M74A 1FZQA 4F9GA 3NT4A 4ZODA 3A10A 3INYA 4EUNA 4AMZA 4OXQA 1K98A 1XGKA 2WG2A 2XIQA 4HLDA 4PR3A 1S96A 1UC4B 1OZGA 2I87A 2JGDA 2FKAA 3EDOA 4QEKA 5G02A 3ZN2A 3UTCA 4UFNA 2B1JA 4DCJA 3TF5A 2B94A 2A9KA 1DINA 1OV4A 1Z68A 4FXPA 1CJCA 3GZTB 1PFUA 2WT9A 1VIYA 4KIFA 2I80A 2P1RA 1HZJA 2DQ4A 1TFUA 1A9OA 1RZVA 3OPNA 4J94A 2JFXA 4CCSA 2NZYA 2ZJAA 4D99A 4MI3A 1SVKA 2HLPA 4PZDA 3UMSA 3LX8A 4IO0A 1YI1A 1C0IA 3RC3A 5A03A 2ZI3A 3WGQA 1HG0A 2QPOA 4DV2B 4BKMA 4CLDA 4IIBA 4EX6A 4OHKA 5K99A 1HLDA 1O9GA 1Z5VA 1JALA 4TYWA 1K5HA 1Z3CA 1XTSA 1OXVA 4OKSA 3PPYA 1JMKC 2GVZC 2Z3ZA 4M0KA 4INZA 5DHAA 2CNBA 5EXXA 5BRNA 1G5IA 1W1IA 1W96A 1YBHA 3THOA 3D8BA 3LKVA 4DM4A 1VCOA 5JXHA 1W94A 2P8SA 1P7WA 1IY1A 1KRWA 4LQ4A 1G2OA 1KMMA 3L3BA 2PMKA 3QEMA 3FPAA 1XJ5A 3FG9A 1NP6A 2B3DA 3FTDA 1A8SA 1JJAA 1SC3A 5BT8A 1ZZGA 3OLWA 1L4BA 1ZRSA 4AY6A 3WLJA 5L45A 1M1UA 2ZR0A 1KP9A 1QR2A 2AD5A 4IO1A 4XGIA 5CDFA 2CYBA 1R3UA 3IDAA 4CT5A 2G6BA 1BQ3A 2CCJA 3Q3CA 1I36A 4XE5A 4B3CA 2E18A 5CX4A 1CEQA 3CEJA 1CQPA 1FNBA 1Y8RB 2XMBA 4CM4A 621PA 1CUBA 1VI6A 2XMQA 5GONB 1UM9B 2QI9F 5I7EA 4JQZA 4OQFA 5GWXA 1JQKA 1G55A 1TK9A 1FX0B 4E11A 1J25A 3PHJA 3KYJB 3OM8A 1E7QA 1EXWA 2EL7A 1ZONA 1F6BA 1I13A 4LVUA 4NJEA 4AP9A 4ND5A 5TNXA 2TMDA 1PHRA 2GVNA 3DKKA 3DT9A 3IAUA 5C35A 2AC2A 2H2GA 3ZJTA 4C4SA 2HF8A 5AHWA 4Z0HO 2GM9A 3IILA 1F9AA 1BH2A 1TKAA 1XT6A 2WF7A 3CZAA 3EG5A 1ZK4A 3EIQA 3NOXA 5EWJB 4MRMB 2GZAA 4FGUA 4G0XA 3QKRA 5BMVB 4LYYA 4QEDA 3FWKA 2PBRA 1KFCB 2IBTA 1O1YA 4UNNA 5C8XA 3LM8A 3CMMA 1R6TA 1GGNA 3JWEA 3PKZA 3TD2A 1G8GA 1C9NA 4JQSA 2DHCA 3EH2A 1W1WA 1DQPA 1P2SA 4FC6A 1VJTA 1A7KA 1XEXA 3WS7A 4DWWA 2KE5A 2AHOA 4FFOA 3RQSA 2V6FA 3EGXB 1LF5A 4O0MA 3B6EA 4IWYA 5LUAA 4XWWA 3E3NA 4R8KA 2Q3EA 1TM1E 2C20A 4JJAA 3E61A 1PL7A 4P86A 2N3ZA 1Q3TA 1I1QB 1JA0A 1PE0A 3R6LA 4V1CA 3U80A 1YI0A 3G0HA 4BE9A 2V5UA 1V26A 2OZVA 2NU8B 5A6VA 1ZM9A 3GHHA 2IXEA 4MP3A 1SZPA 1YGPA 3GGSA 4E5KA 4YGXB 4JWKA 1LZLA 2FN3A 2YQ4A 2QP3A 5AVRA 1QE3A 4F1WA 4ZQFA 5LC1A 3O4HA 4LJRA 3SXUA 2VWHA 4HQOA 4EG5A 3EOBI 3ZU3A 4L9RA 1XZLA 3RF6A 1JT2A 1T6YA 2OHJA 2QJTA 2QTLA 3PD0A 5FLYA 3TB4A 3UB4A 5SV2A 4FEYA 4WCFC 4QT4A 4TSFD 1JHQA 4BO1A 4C2UA 2FV8A 2DLDA 3C5HA 3HKBA 4GKKB 3UCXA 1WB4A 2R8OA 4I9NA 4HXEB 1CBUA 1GL7A 2CLIB 3F90A 4XB6B 5EZ5A 1W9MA 2CEKA 2HWUA 3W5HA 5DHUA 2OV3A 1H0SA 3FROA 4KRGA 3EXIA 4CU2A 3CUKA 4EF5A 4D96A 4KN9S 5FORA 1XRNA 5A9RA 3E82A 4JYCA 4AYWA 1FS4A 4M1KA 5BVHA 5ALTA 1AN0A 3RYFA 4XD7D 1H8ED 4DDTA 3QVUA 4DTIA 4YB8A 4ND2A 1L7PA 4MRSA 4UHDA 1Z75A 1OFUA 3LVRE 5FRDA 3FHLA 2AFHE 2IPAB 3B3QA 5JRJA 3DZHA 5AO9A 1OI2A 1IN1A 4EMUA 1PYOA 1JDVA 2ZRLA 3GDOA 4PN7A 2Q4OA 3AOGA 1KRHA 1NHWA 3FA2A 4GPD1 3ZJYA 2WAAA 5ITZB 1TIPA 4KR7A 3HRIA 2RJ3A 4L5YA 1JU9A 1C4KA 1VMAA 4N3CA 4RLFA 4E0BA 1IXSB 1DXYA 1DJNA 2AYXA 3CEPB 1DBWA 4Q9IA 3SOPA 1MJHA 4EF4A 1GRNA 1RM0A 3NOOA 2CLDX 3MTBA 1G19A 2O3QA 3RVMA 3AF1A 3CRVA 4D9HA 3DEIA 4X60A 5B2EA 3OC0A 2AG0A 4YV0A 3GCXA 4X8LA 5DLYA 4OAQA 4LDRA 2D4HA 1NKSA 1KZ1A 1TO1E 1XZGA 4FSDA 4L3OA 4LXYA 5JNSA 2XBUA 1SRQA 3AKEA 1L7VC 5ADVA 1HR0B 4LMAA 2IZ5A 2EIHA 3RH0A 3DZGA 3S40A 1Z07A 3OJXA 1EZ1A 2XZTA 3IOYA 4DLWA 4JFAA 4YEDA 5GY7A 2I54A 1KJWA 5FF9A 3NDPA 3H5IA 4ZVQA 3LWDA 3MWLA 1XX6A 1NC3A 2ZQYA 4KIUA 2BTQB 3VTFA 2PKWA 4YRIA 3AERA 3T4XA 5IWCA 5KSZA 1GFIA 1CJSA 1S2NA 4RMGA 1G9SA 3VX3A 3BGVA 3QW4B 4KXMA 1JHPA 1YRAA 3KXLA 1T9CA 4GPTA 4HNUA 3IB6A 4IYJA 4MPTA 4R1UA 4BUZA 3DQPA 3JZAA 4Q3KA 5EZ6B 4RDHA 5LBTA 4K26A 2E89A 5HRAA 1SHKA 4HWPA 5GONA 1FFYA 1UM9A 2FZLA 2DFLA 3A6PC 3A6KA 4HAWA 5F21A 5T4HA 1KPHA 3C8DA 3UATA 3UK1A 1IBRA 1I3CA 1N5MA 5AVXA 3E22B 4FDAA 4BHTA 3HNRA 1E69A 3QMPA 3TVYA 1UBCA 2JFHA 1ZNYA 2CVOA 3NHZA 2FEAA 4BV8A 4MRMA 5K8UA 4S1OA 3ZDQA 1GUDA 5BMVA 5JWHA 5CA1B 1HI9A 4LBVA 3S2FA 5CXXA 1WVGA 3QU2A 4CMEA 5H1YA 4L0MA 4L2IA 4NMHA 4JSRA 4CF3A 2KB0A 4O33A 4E5PA 2DR0A 3L0IB 5E0OA 2Z8ZA 1OB5A 5HJ5A 3NHRA 2OCKA 1OZ0A 4JGBA 1V1JA 2OORC 4UAVA 2C82A 5AK0A 3UB2A 3RIEA 2XIJA 1V3UA 3AFIA 3AV0B 3WGIA 2O4UX 2V9CA 1WZIA 3PQ3A 4OHOA 4TLDA 4ESHA 1J0DA 3IC5A 9MHTA 3LXMA 2JIPA 2PU5A 4C6TB 5AW2A 3R9KA 2G4VA 3Q15C 4EG1A 3AUXA 1ZICA 3LLVA 2J9RA 4ZO8A 3COVA 2CUNA 2GYYA 3BM5A 2ONJA 2OO5C 3BTUA 4GGPA 4S3MA 4P3KA 4YJHB 4EA8A 4EHNA 3K0AB 4RD2A 1EESA 1NULA 2OKCA 4MVJE 4RPHA 2PLFA 2WU0A 5GJCA 4DKJA 2JB9A 5FUMA 1Z8HA 2MMCA 1LC3A 3BL8A 4MUYA 4EY4A 2Z1DA 3O03A 1Q1GA 2XQFA 4J0KA 4PYOA 5KTTA 1U2ZA 1Z7WA 3HJTA 1FCJA 4PIPA 1PT9A 4R98A 5FO1A 3S3TA 4ACAA 1UT8A 1Z4MA 1RJDA 5KNDA 1KRXA 4PHFA 1WX1A 3N2LA 3MINB 1S7CA 4WN3A 1RI3A 2GPAA 3QF4B 2H2DA 3ZDFA 5IVHA 4L8LA 5ES3A 5JCXA 4FFPA 3N76A 1RI5A 2A86A 5CLHA 1M2EA 4G2NA 5KVQA 2KW5A 2CLEB 2VHWA 4LKOA 3IRUA 4C0LA 2I1VB 3USES 3VI4B 3ZE7A 3E3AA 2GRAA 1U0GA 1DC6A 1YZFA 2D74A 4OLJA 5FOTA 1NI3A 3VVMA 5LZ7A 1FMJA 4QOJA 4OLAA 1RLIA 3ZGZA 4AP6A 4HATA 4KGXA 2JHFA 2ZT6A 2IYYA 3DXYA 4AO8A 3U7QA 4HTFA 1AXRA 2GYUA 1MC8A 2QN1A 2C4UA 3AY0A 3V7YA 2I4MA 3L4SO 4A82A 4CM9D 5DNWA 1TQ4A 2FP3A 4U1RA 1MIOA 1MO2A 3OWXA 4V3BA 3R76A 2HQBA 4KV7A 5EFZA 3ZXYA 5M04A 3RRMA 3E1GA 3FLMA 1NXTA 2ZE8A 3H83A 5DH9A 2QY9A 3WMXA 3EIXA 4OQLA 4L51A 1TW2A 3W2HA 3TJRA 1N5JA 3MIZA 3HG7A 4G0YA 4IFIA 4YQEA 1R5JA 3SJZA 1MO5A 2Q5IA 1R0CA 1V8DA 3ZH9B 4EHDA 1CUSA 3AVQA 4P4GA 1HF3A 5LZ9A 1YS2X 4GEKA 1FP2A 5CVJA 1Q0SA 3OJCA 4UFOA 4LYGA 5M2QA 3MHTA 2OFXA 4TXHA 2E0IA 3WMWA 2CT8A 3L8FA 4WXEA 4XQ0A 1E62A 1MB4A 2XA9A 3ZIDA 1UBNA 3I04M 1H42A 3PDJA 3UWSA 2YVKA 3AJDA 1KGSA 5TR9A 3GWGA 4HWGA 4EPTA 4NNJA 2DRIA 1K68A 3IPXA 2H2FA 3H2KA 1AUQA 2W71A 5JAIA 2GJKA 2GFQA 1VJCA 2DU8A 2IUSA 3B12A 4W1PA 4EW1A 3B1KA 2P3QA 3VYUB 2P2CA 2YS7A 2YJGA 1UC8A 3TLMA 2QGNA 3G7NA 3SEQA 3G1WA 2ISCA 3EOAI 5BOSB 3ELUA 5C1DA 4NS1A 2V8BA 2DH5A 5LQUA 5COQA 4BNZA 4Q9LA 4RLSA 2IEBA 3DC7A 2RGNC 4KLNA 5DLPA 4JROA 1WY7A 3BEDA 5DHTA 3WGZA 3WK4A 2L42A 4D46A 2WB4A 2V0CA 4EHFA 1RYEA 2IQIA 3NRJA 4K81B 3X2SA 4C5CA 3I61A 3IJPA 4X45A 1JTVA 4IF4A 5KQSA 1UFVA 4QFMA 1P1BA 4P53A 5HWSA 2Q3DA 1ZD2P 4BO7A 2GSDA 2TSYB 5B58T 1F0PA 1ZXBA 2J41A 4JP2A 2ZYDA 5L3QB 5ITSA 3DTVB 5KOHB 1R5BA 4CCWA 5AWFC 4BV3A 2HEIA 3FF4A 1NUPA 2BEWB 3P19A 4D9IA 2XWBF 5ITWA 3D4PA 1MV8A 4PZAA 3TD6A 1BDMA 1D4OA 1RYFA 4FUQA 4JITA 5LB2A 1NMXA 1I8TA 2RGBA 1IEXA 4JZYA 1IJFA 3VV3A 4DCSA 4DY6A 3K70D 5JS7A 1IYZA 4NX2A 1LV8A 2WU8A 2R4UA 3TNFA 2P90A 2IHZA 2WUFA 3CRQA 3NVMB 3Q8KA 2DG2A 3VHLB 3G7SA 3UV7A 2Z83A 3Q72A 1ZD8A 3MB8A 4BMDA 5I3ZA 4GKVA 1B93A 3RR2A 4C6TA 1U0TA 3PITA 3H7AA 2EJWA 2XYGA 4N7MA 4RH0A 4CN8A 4O4LB 1GG5A 4RMHA 4A91A 4F5ZA 3KZKA 1P5RA 4GAEA 1WXGA 4E6EA 1X7GA 3HLTA 3M9LA 4YJHA 1BJRE 2ZJ2A 3K0AA 1YQXA 3V7NA 4BGIA 3PR3A 4D9FA 2ASEA 2J4CA 1FC0A 1DUIA 4PX5A 1F5SA 3PIIA 5DBIA 4E5YA 1BE0A 1O87A 3OLCX 1ZW6A 2YR0A 2QLMA 1JTEA 3O38A 4RTOA 3B1FA 4DQKA 3BWDD 1YQUA 4IG9A 1E5QA 1BO6A 1SOVA 1Z4NA 3JQFC 4ETMA 2OFFA 2UKDA 5J40A 1QCYA 3MINA 3TZ6A 1VLVA 3EZYA 2MYNA 3GQVA 5EN4A 3ZHXA 4OFXA 4UOEA 4X62B 2PSFA 1BKDR 4HP8A 1E2BA 3HR4A 2ZPAA 2R4QA 4TWZA 2DSTA 4RVFA 1Z5OA 4CG2A 5AVZA 4E12A 3K0KA 1UFQA 1XJCA 4M38A 3RRBA 1A5BB 2Z9BA 4RD3A 3ZWKA 4MVJD 2HCJB 4AVYA 4BXOB 3C3DA 2I99A 4TTPA 3AX6A 2EFJA 3JVUA 1B26A 1N5LA 3TOVA 3GLHA 2YJ5A 2YDYA 4Q19A 2REOA 4C03A 1I2MA 1IBSA 2B8EA 2ZSAA 4LSGA 1EBFA 4RC9A 5H9VA 3WO1A 2HA3A 3AIKA 5AW4A 1PEKE 1SHJA 2HPZA 1SBTA 1N8SA 2F1OA 4RLHA 1KU6A 3KEOA 4ZMBA 4KZKA 1WF6A 1EG2A 3URMA 2BTOA 3BERA 4Z2YA 4DLXA 2YXDA 3GNSA 2M32A 2PBLA 3HYTA 2EJUA 2P9BA 4X84A 3RVBA 1G9XA 4ZCRA 3BJIC 4QQFA 4PTYA 4IMIB 3SZMA 4XIFA 3TQIA 4E5VA 4ZYWA 3EGDA 1ZK0A 2FPMA 3H1GA 5DCLA 3W8EA 2QTVB 1VA5A 3I72A 1XEAA 1HLFA 5HGXA 2O07A 1PNTA 2Z8YA 4LHVA 5IF3A 2IY8A 4TUYB 2FF5A 3QRWA 4MWZA 3EZXA 3PI6A 2CF6A 2PT7A 1XMQB 2HRDA 5K3AA 1CF2O 1KYTA 2DAPA 3LPDA 3IIJA 1O97D 3QE3A 4W9NC 5BPFA 2EFCB 1JKMA 1OBHA 1DNPA 5EQFA 1U94A 3AKDA 3CX4A 1PGJA 2XMGA 1RT9A 1BA2A 4GI1A 1PNVA 4UBKA 1EVJA 2I2FA 2IZ1A 1M6WA 2VHYA 5ECYA 2RSLA 2AG1A 2FP4B 2HM7A 3U7GA 1NDHA 4A0RA 4XDHA 2JFQA 3B89A 4EG6A 2C0QA 3DDCA 1R8QA 4IH4A 4R8RA 4MUHA 3LK7A 2A2ZA 1DXHA 3M0EA 3SHOA 2INGX 2H31A 2WNHA 1J1IA 1SC1A 1V96A 4HDNA 3TZEA 2GI4A 4B7CA 5A4JA 4HEA6 4OHFA 1X77A 4C01A 3OZFA 3ASVA 5EP4A 5ER9A 1EUZA 2XE7A 2AKAB 4W4TA 1IVSA 4AJPA 4RF5A 3DMHA 1HNXB 2SCUB 2O50A 3H05A 4V1CI 2GO7A 4B3FX 5AM2A 2B4TO 1Z4LA 1N92A 4F4IA 1E3TA 4JB0A 2VOJA 2NXCA 1AKMA 2RG1A 3BD8A 3DE7X 3MRXA 2O0LA 1BA3A 3H5OA 4GKAA 3Q12A 5LNK1 5L3QA 2PSEA 3DTVA 5B6IA 5IZ4A 2NNWB 1M9NA 3GJ5A 3O9VA 4RANA 4CKCA 2FPOA 2BD0A 3U1TA 2BEWA 4NBKA 1CQXA 1WOYA 5GQSA 2PBFA 2H1LA 5LQSA 4MGZR 2DBVO 3C7DB 1Z36A 4OQDA 4EVQA 2PRZA 2ZUSA 3ZWQA 2QD4A 4H4EA 4YJ3F 4W82A 4TRMA 2PGNA 1PFGA 4BKPA 1FP6A 5ALQA 5D3MB 4DAEA 4C2BA 4XWGA 9ATCA 1TLTA 2OQVA 5DIFA 3OBBA 3VI3B 2XCRB 1N6NA 2CVPA 5FUWA 1OREA 1CY0A 2FE1A 3NJ8A 1YUNA 2QRHA 4RYDA 1H3EA 2IKSA 2Y6VA 5JADA 5E1BA 3PGJA 2Q28A 5EIOA 4EGJA 5JXGA 3IQZA 4ARAA 5IXSA 4RK6A 1DIRA 5DYYA 7GPBA 2O5EA 2V4UA 2PYIA 4RHEA 1IB6A 3SG0A 3DNFA 1XWFA 1IMOA 1R1DA 2HADA 3F6YA 1M54A 1PUJA 2P3LA 2D3WA 2JFOA 2YBDA 2GTPA 2J5KA 3BAFA 5CK4A 1PWEA 3OU7A 2IV2X 3Q8MA 1SUBA 3L6CA 1Y48E 5SZKB 3UYLA 2IW1A 3GY0A 5AK5A 2K4MA 2VJYA 4N5MA 3F4BA 3VO1A 2CMFA 2G8LA 2R7AA 2RHWA 3ZH2A 4E4YA 1M8PA 4CCYA 4UE2A 1KQNA 5I9LA 2QIOA 5J1SB 2EJVA 4QBIA 4EH1A 4DCVA 3NASA 4R41A 5CDTA 1U9ZA 4L5IA 2OBBA 1Z0KA 2QLNA 3FJYA 2OHGA 4LEIA 2QZZA 1ZSNA 4G0NA 1RWQA 4RIGA 2I3AA 2JCGA 5KX5B 1NM5C 2BMVA 3BEOA 2PZAA 1MX3A 2IE0A 1LNQA 4J0EA 1H2RS 3PK0A 3H9BA 2QORA 4P9NA 1AMOA 1JJFA 3NHSA 2J9FB 1T36A 1J1ZA 1GT91 4P31A 3LFTA 4Z9XA 2NU6A 1V41E 2QTVA 5K1ZA 3GGOA 4OI4A 1NAIA 3MAAC 4GOOD 3RVNA 3VPGA 1TTPB 4TSKA 2VXCA 5FL7D 4CUZA 3DEKA 2H3HA 3CS3A 4FMCB 2IC5A 3BUSA 4ZN6A 1A95A 2PMDA 2HU2A 3VR2D 2QS9A 4TL6A 3WLSA 3TW8B 4ZGBA 4R5MA 1NF8A 2WJYA 1CWUA 2ZSEA 3ANYB 4M1SA 3P2YA 4OFWA 3T1VA 3KVOA 4Z51A 2BFOA 2X8JB 2CL5A 3EZ6A 3C4JA 3ODGA 1XWIA 3X1DA 3MJFA 2DHRA 4DVJA 4F96A 3OE7A 5AVUA 3QMMA 3NC0C 1ZA1A 4UVGA 1D4AA 1S4QA 3H5RA 3HBMA 3QLUC 1XP5A 2R6ZA 2TMGA 3SM9A 4ZFNA 1YACA 2D7CA 3K72B 3D3KA 3V2HA 1POXA 1OTYA 3PCRB 2L0XA 1UCFA 2LGJA 4D8YA 1ECCA 5L3VA 2WICA 1BJTA 5GOZA 3I9V6 1DLJA 5B1DA 1HTTA 4JCCA 1E7WA 5J5CA 3EMDA 4JBNA 4UM9D 4RL4A 5EYPB 2I62A 1QHHA 1QFJA 1TCAA 2YHIB 5FWDA 5JJCA 2PSDA 2H59A 3JWHA 3LYAA 1JG4A 3I4LA 2ZI4A 4V02A 2DR3A 2AMVA 2SCUA 2V5VA 4MQMA 3RFCA 4CGYA 3E5HA 3C0KA 2ZDHA 4LQCA 5DCWA 4LF6B 2ZB2A 2YN4A 4DT1B 1ISGA 1OV6A 3HUFA 4RF2A 4DLZA 3GUHA 4ZREA 3A2KA 3QHQA 2HDWA 4PIMA 1GOTA 4PCAA 2QQEA 1LEHA 2IUYA 2JS7A 2QG4A 3V4FA 2A1IA 4MIOA 2D1QA 3ZD8A 4XDZA 1CUIA 1CVIA 3MBIA 2H1OA 3M70A 1TVEA 1QIDA 3FYUC 4C4XA 2MTBA 3E84A 4Q4AB 3SHVA 2FB9A 1XZIA 1XBTA 4HJXA 1JX6A 3AB7A 3OC6A 1H6BA 1V8ZA 4XYMA 3SR3A 3W5SA 1OWMA 1QJCA 3H5VA 4Y1RA 3NR2A 1O7JA 5D3MA 1C30B 2CBXA 1E99A 2HJWA 4C7VA 2H5LA 1R4AA 2KM1A 5K0CA 4HYTA 4E31A 4TXMA 1V8FA 4X91A 1U6KA 1PK9A 3VYWA 3BXOA 3CVJA 4NHOA 4IFEA 4EHHA 3ZBTA 4GZ5A 2VIIA 2HDOA 1PEAA 3EF1A 4RY8A 4TVKA 1N8KA 4QVIA 4LJAA 1MP0A 1U4SA 2EZ4A 4BP1A 2HJ9A 3BA6A 4HAVA 1QK3A 1X9GA 2QG6A 4O1IA 4X95A 5TPWA 3O94A 3GLFB 4KR0A 1KYVA 3KWFA 4JYPA 4M54A 5A62A 4AKGA 5FPHA 1FTSA 1R4MB 5I4IA 3GEMA 4QODA 1G8AA 3NHJA 3TQSA 2V5AA 1BVRA 1U5BB 2QD2A 1I80A 2V97A 3CZ4A 4QU9A 1MGOA 4EZIA 1W4AA 1SK8A 4MW9A 1YB5A 3I5XA 1VHLA 4CKBA 3KKPA 3VMMA 5C18A 4HLUA 3RS9A 2W0SA 2O8BA 1CIJA 5E7MA 3K2QA 1V5FA 1XLTA 3BIXA 3P9NA 4LV8B 4B73A 4YUZA 4LF9B 1GZ3A 3CRRA 4XTCS 2WUWE 3B1VA 5FAKA 1XAGA 4TS3A 4P2BA 3G6KA 4CIBA 1V9SA 1R0BA 1Y8CA 2ZJBA 4QHTA 2ZZNA 2R48A 5DNCA 2IOYA 2PWPA 3KLNA 1GUFA 1XPJA 4B4WA 4EVSA 1OBFO 3CSUA 1E3WB 3QG1A 4C7JA 1JRLA 1U28A 2C61A 1KERA 2QTWB 4BCDA 3G1TA 5FNVF 3FNIA 1QVWA 5KX5A 4M60A 4EFLA 1P4SA 4X3OA 2ZWOA 1L5RA 2ATVA 5C1PA 1T6ZA 4MEJA 1OFVA 1YBMA 1QBGA 2A1UB 2I6UA 2IX9A 2RIPA 3AFGA 3B2EA 2Q3FA 1U9IA 2XUKA 2P7IA 3HSKA 3IE0A 3OX4A 4JUAA 1IZ0A 4DA0A 1N0IA 4BEJA 4JEHA 4X44A 3ZDCA 4WERA 1PT7A 2J9FA 1EFLA 5F7XA 2XGGA 2C5AA 3AY3A 2QRJA 3CBGA 1MJGM 3LA8A 3UK6A 2Q41A 4YUAA 2FR8A 1MOQA 1RHKA 3G8YA 2R6AA 3GT3A 3UAYA 2IXGA 1ISJA 3Q1KA 4DAOA 4NPCA 4RNCA 1ZDMA 2R8RA 3A3NA 4YJFB 4ZTZB 3ITNA 3OKPA 1DWPA 3EFHA 2JF0A 3TW8A 1M34B 4O4IA 1J4AA 3KB2A 1N7JA 1EAMA 3ESXA 3KOMA 5WRFA 1N2XA 4I5IA 3HDVA 4OXYA 1RYMA 3BWYA 4TZ0A 3R24A 3RJ5A 3H0KA 4K9MA 2AOVA 3T7CA 2VZ9A 4C22A 4F2DA 4US0R 4X3PA 2YZMA 5DXJA 3ZXXA 1Z6PA 3M4XA 2BGIA 4H3VA 1O8CA 3N70A 4XTRA 1XZAA 1I9GA 1A3CA 2IHUA 3PICA 4JUIA 3IHWA 4P3NA 1A2QA 1RQXA 3DPUA 4E6PA 1HYEA 1V3QE 421PA 2NYUA 4O4HB 1G8JA 1QX3A 3X0DA 4F2WA 4JEIA 5J4YA 1E6MA 3ZCXA 1U1FA 4O8ZA 4X61A 4HH1A 1SQ5A 4LKRA 3D6NB 4CM6A 2FUCA 1UC9A 1W0JD 3JQQA 2LTAA 2PS3A 2JCXA 3TQHA 2QD1A 4B34A 4MI6A 1AB6A 1YO6A 4LCJA 2XCOA 2R5NA 1E0KA 4DT1A 1YJ5A 5IG2A 3ANLA 1I4WA 3AWIA 1JGTA 3SQMA 4M1OA 3L7LA 2VDRB 3CLRC 2FDCA 3EVEA 2W2XA 2GO1A 5AR1A 1L1FA 3AR5A 4I4TF 2QMYA 1CVRA 5CH8A 5JZBA 2O2HA 4DCUA 2QYSA 4E70A 4CNBA 3L8CA 3MCTA 1DUVG 3PXUA 4K6OA 4NH0A 2AI3A 3ZTYA 4CBVA 4ENQA 3GJ7A 5FI5A 3RAEC 3DMPA 3T95A 1KSFX 1U0RA 4WX2B 2QY6A 1Q1ZA 3DOCA 4Q4AA 4OSOA 3W8FA 3UM9A 3VU8A 4ZALA 2OGWA 1PRYA 2EKPA 3LPMA 4IPTA 2GK6A 3TIGA 4UNRA 4DBVO 5KNBD 4J0DA 2VH2A 1E96A 4YVFA 1WLSA 4PQYA 4OH7A 3BIJA 3EMBA 1KR2A 1NXPA 3E53A 5C4GB 1QQ6A 2HA0A 2R1VB 1C30A 5KYUB 4KCGA 3OESA 1E2GA 3IE2A 3QA3E 3KQQA 1D2EA 3T6KA 5EIEA 1SXGA 1YJCA 3O8LA 3ZZUA 4B85A 1PR1A 2B7LA 3MTAA 3JD4A 5LYJF 3F9RA 4Q3CA 5MGNA 1FQJA 3GEEA 3GROA 1UODA 1KMHA 4HBGA 3T7RA 4GVXA 1RVDA 3AH8A 1RFGE 2CLHB 4YAEA 1AKVA 3N6RA 5M29A 3GLFA 1Z18A 4D43A 5AJWA 5JS6A 4IXTA 1R4MA 5A0FA 5KYGA 4XCVA 3ILVA 3KKZA 4Q37A 2AHRA 4Z4EA 1CR2A 3MILA 3HN7A 3RHSA 4LJYA 2FXIA 5LDDC 1ZY2A 4D25A 2H85A 1QRAA 1EG7A 1XYGA 2CSUA 4FNMA 4GW3A 4J7XA 1SC6A 3H17A 3U7EB 4XJTA 3PTAA 3K92A 3VV2A 3NQ41 3ZWMA 2B5WA 3W05A 2FJPA 4E2FA 2RHRA 1CUVA 2W48A 3FTQA 3QKUA 1HY3A 2HUPA 3HQ4O 3NFRA 4GWLA 3NHMA 7YASA 5JSFA 1R16A 2ZE6A 5CEFA 2CJWB 4JA2A 1OU4A 4GWGA 3QPDA 4Y2HA 3TDNA 3B6MA 3BE5A 4XB1A 1Q22A 2QX9A 1E3WA 5CT8A 2ZRQA 5K2OA 3H9QA 3UAZA 1P62B 4D0RA 1A8HA 1U1EA 4GP9A 4NJMA 4AWAA 4Q18A 1U9JA 2AG8A 3WAJA 1AY0A 2X14A 1G4HA 4QXRA 2VSFA 3AI7A 5A7HA 2QVZX 1E2FA 2P4SA 2VPTA 3IH5A 2E4XA 5I51A 2WJZB 3CWQA 1QMGA 3ROPA 2EL9A 3T12A 2C84A 4ZXPA 4ZKDA 3B3AA 4HUJA 4EM6A 2D62A 1B42A 1EHCA 1TM3E 1EWVA 1C0PA 3OMXA 4E3ZA 2B6HA 1A4XA 2NQ8A 4MV9A 2R87A 2FDRA 3IALA 3QOXA 3VR3A 3VVLA 3HE3A 4D44A 3SX0A 4B82A 3OMWA 3N74A 5FQNA 1XMVA 2GK7A 1BIFA 1L3BA 4JHXA 2GJ8A 2P7HA 3VDMA 3DBLB 5LOVB 2FPWA 2ZITA 4ECAA 1JPVA 1UXKA 1M34A 4OA8A 3ZQJA 4I50A 2FR0A 3K9NA 4LHWA 4O2RA 3QSYA 4O2BF 1LPAB 4YDHB 5E2IA 1VRWA 1NFRA 5CPBA 4BLUA 1OY1A 4DPKA 3GPLA 4XI9A 2GAJA 2VG8A 4K9LA 5KYWB 5KNCD 1NZJA 5JNTA 2IYNA 3PSAA 2CEAA 3AF3A 4WVFA 3PDIA 1A82A 1TA0A 4N7RA 2J5QA 2A33A 4AIRA 3U56A 5KYXA 1B00A 5JBNA 5I47A 5FLKA 4G24A 1ZMOA 7REQB 3C3JA 1Y6JA 1K0FA 3S1SA 3V7FA 3LCVB 1Y4SA 1D03A 2GCOA 1BD3A 2H57A 4OA5A 3JPWA 5CFNA 5HKOA 5HJ7A 4PVCA 4UVEA 3F9CA 5CHYA 5KHLB 2Z6QA 3IDOA 5INTA 1ZZEA 1JQDA 2G04A 3HXQA 3CG4A 4RTKA 1Q7TA 3DKVA 1TMYA 1DU4A 1YVEI 3H9JA 4MYUA 4H4DA 4RADA 5ALLA 3W6OA 4BZPA 5LP6F 1HETA 1F6WA 4JL8A 1EINA 1GITA 4COOA 3LF1A 3ZVMA 4MS4B 1FSZA 2ODBA 4RJKA 2R60A 4MI1A 3QVMA 4I4IA 1JR3E 1WABA 3PWKA 1MO3A 4L3VA 5IABA 3THXB 2MWMA 2XYRA 1XDUA 3FFXA 3AJRA 2PH5A 3TPFA 5AW3A 1P0FA 3FMIA 5HBGA 5U1PA 4K9RA 1FSPA 3ES9A 5HIMA 2AWNA 1UJ5A 1VLJA 1QTRA 1TKBA 4QTXA 1C80A 2XY4A 1O89A 2GHTA 2QYHA 2AIRA 2ZYHA 4DDUA 5HUJA 1U9CA 3FPCA 3K0FB 4YBRA 3VH3A 5CM8B 5GGYA 4B2YA 1YZQA 3OQPA 3IP7A 4QUHA 1LPPA 1R6UA 3C6YA 3IA2A 2VDPB 4FBMA 3K9BA 3M5CA 3L43A 5B12A 3E4CA 1F1BA 4QM6A 5I9TA 2G28A 3FPHA 2NZXA 4KWIA 4YXWA 1SBQA 1NMZA 1T9HA 3PX3A 4DC0A 2GKGA 3DOFA 3H19A 4FHCA 3L4JA 4M1WA 5EMNA 1H2BA 3VX4A 4I8IA 5HRCA 5E6UB 4ETNA 4K9SA 2H9YA 1WAMA 4KI7A 4G56A 5FUXA 4R4JA 3IB3A 1BCSA 2VYVD 4BNJA 2PVSA 1OC2A 1PQUA 2QB5A 4R2IA 2A59A 3BIOA 4ABYA 2ZYIA 5J9FA 3ZWAA 1B6SA 1E3MA 3R3ZA 4KQKA 4I1OA 4ZHQA 1LI5A 4F91B 3G82C 5IH7A 4W7HA 4YPFA 1V7QA 1Y0BA 5JCJA 3C5EA 1HNZB 4PHCA 2YW2A 1KI6B 2TRSB 2BHSA 1UM8A 3OTGA 3G85A 2Z5GA 1Q2UA 2H2AA 2X22A 4ZCPA 4RZXA 1FMLA 5AW1A 3M34A 3MJDA 5CJPA 4JAVC 5EA2A 1QYWA 2CJWA 1UWVA 2HDNB 1I4TD 1TQ8A 3D43A 3T99A 4UTRA 3QX8A 5BWOA 1KEEA 5KNDH 1QRSA 5TT1A 2R96A 5IASA 3E9EA 3KPYA 5BQXA 5FYQA 1M2OB 2D0PB 2Z30A 4XEUA 3LVFO 5IFKA 3ZK7A 3O8CA 4AMGA 1JILA 2NU7A 4I5FA 2GEKA 3V8MA 4EA9A 4EDHA 3R20A 1LLUA 4TLMB 3L0YA 1ZVVA 2Q7XA 3RTCA 3V1LA 1RJFA 3M9XA 1Q1BA 3SDSA 4F6RA 1JIKA 4ZIRB 1YIOA 3ZE1B 1B6GA 3WOHA 2IUEA 2W83A 4N0EA 1DX6A 5F4ZA 4B81A 3R7SA 3GA5A 4MQLA 4TS4A 2GKOA 5H4GA 4EKDA 3VGPA 3A7EA 1NFFA 2B4YA 2EV9A 1IIBA 2PEZA 3C45A 1UZUA 5LOVA 1QG4A 3DSRA 1ULAA 2AE2A 3ZGOA 3O1HB 1IRXA 1SOWA 2VJMB 3I04A 1OAKA 4YUWA 1K08A 1F9EA 3BN3A 2O2ZA 2LV8A 2FMKA 2GBIA 1DAOA 4KQWA 1EDEA 3UYKA 2EBUA 2QF7A 4BTLA 2QGZA 5BQFA 2XRYA 1N36B 4KIGA 2LUOA 4YRNA 1WMAA 2A9OA 3CC8A 3ZG6A 1YXMA 3FTFA 4YJKA 3KM0A 3PIRA 2OXIA 3X2EA 1GQRA 3LT5A 2VWGA 4XSVA 2VKTA 1E79D 3OWOA 1BN6A 4R83A 4Z4IA 4KXNA 3A26A 3CT4A 3FPBA 5SY6A 2L17A 1JIJA 1USKA 3SFZA 2P1DA 2ZFUA 4MPDA 3RYIB 3U3ZA 3MTEA 1XNHA 1E2NA 2FZWA 4P7BA 2YC2C 4HX9A 4MVJM 9LDTA 4JXXA 4Q93A 3ST7A 1EVKA 3COYA 1ZGGA 1ZVMA 1A7UA 2BLLA 3KJQA 2CYAA 3KXPA 3CISA 4MS1A 1EUYA 2XVYA 5FJIA 3STVA 1QOQB 4GVPA 4HMPA 1YBAA 4C21A 3MWJA 2AN3A 1I2ZA 4IUDS 1YONA 2X4IA 1KFEB 4BNFA 3NHUA 2DJ5A 3I34X 4OY3A 2Q21A 4V0OA 3WLPA 2H4ZA 1KHTA 1UKZA 4TYMA 5I4BA 2JFBA 2UVQA 6ABPA 4RH1A 4BV9A 4Y7CA 2IYVA 4G5GA 4AECA 4AQYB 3HMKA 3IR6A 1RRGA 1Y9EA 2PUDA 4AKIA 4UE3S 2ON6A 2FFHA 2EOAA 4D98A 2H4FA 3OQ1A 4Q3EA 3U81A 4LRYA 3ZVKA 2NVBA 2G4LA 4DMGA 1C7QA 4IM7A 2J3KA 1G7SA 3OIWA 1E1QD 2BFAA 3HLKA 1JUDA 2BLNA 2HMAA 3ROFA 4PSDA 2IU4A 2QZSA 3A2NA 1D1PA 3FPEA 3TCXB 2CKDA 5J2TB 2WWGA 2I65A 3GG9A 2ZBPA 4Y6OA 4MQUA 4EY8A 4B3MB 4S1VA 1KMCA 1BNCA 1GPUA 3HA3A 3K0FA 1XHEA 2YOHA 4MV7A 2Q5FA 4JYBA 3R74A 3UAOA 1XD2B 1YR6A 1P77A 4GR9A 3HCAA 1Z8DA 3S7ZA 1FXWF 4MW0A 3KOWA 4NFLA 4YACA 2FQ1A 1GCAA 2RHMA 4UC0A 1V37A 5EP2A 4D9JA 1TM4E 5EJ8A 5JS8A 3FH0A 4KYTA 2HXSA 1SKBA 3FPLA 3D8UA 4G25A 4ZC8A 1GTZA 4GPIB 4WOBA 2CWWA 3REQB 2GEUA 1XTVA 2C57A 2Y1CA 4M7OA 4MRAA 5FOSA 3SZRA 2AK3A 2XOEA 4YX9A 1CU1A 1Y98A 1EVIA 1KA9H 2B2NA 3CHYA 4LJ9A 5AT1A 5BV7A 3ABQB 3C7TA 2X2FA 1Z0AA 3JTEA 3FNHA 4EZBA 1G59A 3P0IA 2G9RA 3K30A 1W2WB 5FBHA 5BWMA 5EHIA 5CLJA 1SQFA 3LVBA 1KVTA 1Z37A 3A1VA 3OEHD 2IH2A 1FB5A 5SYNA 3C6XA 3FUCA 3HZHA 5DEOA 4LXTA 1AJEA 2PK3A 1N2CA 2Q5QA 4RORA 3O4RA 3RB8A 3NNNA 3WFJA 3TGPA 2CK3A 3P2MA 2COEA 4BWFB 1BGWA 1RWMA 1JHRA 3SC6A 3PFFA 4A73A 1NY5A 4EKYA 2O20A 3ORRA 5A1TA 3LX4A 3LSYA 4DLRA 3Q8LA 2ZETA 1AOXA 4JASB 4UBJA 5LQDA 2EHDA 3JQBA 4M9XA 1U2EA 1Z8NA 2VJCA 3NDIA 2W6OA 3I6IA 2I6XA 4IAOA 3G2MA 1KZGB 3DS8A 3ER9A 3PHGA 3KQSA 4Q34A 3AG5A 1BEUB 4Y0NA 4ZPJA 1GSHA 3UBMA 3V1UA 3SYKA 5LMZA 2IEDA 3O26A 4AS3A 2ACVA 1Q7EA 1U1CA 4B2IA 4ZIRA 5T3YA 4BMCA 4JC4A 1R9JA 4K9KA 5HW0A 1Q14A 4WZAB 3CJRA 2ZBVA 5AK3A 1KI8A 3MG9A 1JS1X 2BEUB 5I6DA 3FM9A 1QOPB 5C1OA 3A6JA 2C9OA 3CCBA 1DBRA 3I1IA 1NVVQ 4WK4B 3FTPA 4J1SA 2BKLA 4PTLA 4YQZA 5C34B 3PT5A 2VJMA 2IODA 2P6NA 2VRCA 1EVZA 2AF4C 2M98A 2OHFA 2WY2D 3TPZA 5EUMA 1ZEJA 3TGLA 4DARA 1QR6A 3UHJA 4LCBA 2FFRA 4X1KA 2C3MA 3EVTA 4KO2S 2AEFA 1KK2A 3HSSA 4RQUA 4DABA 5CEEA 3Q2OA 2XUIA 4LRTB 4Y9RA 4N3AA 3TOXA 3E7WA 4E2ZA 4O59O 1SBYA 2Q3HA 4ZT6A 4I66A 2OP1A 4LYAA 5JALA 1QYVA 2W4QA 1QFSA 3O83A 2VL7A 2ODQA 3OU6A 1Z4PX 4XWAA 2FCRA 4CIXA 1M0EA 1W88B 2YXPX 3AF2A 4FGSA 3RLFA 4KACA 2A0XA 2JPDA 1DT5A 1YIDA 1CY2A 3FTEA 3QOYA 1M7HA 3RFXA 1MGPA 3K8YA 4F1KA 2P2GA 3RYHB 1J2RA 5F2OA 3L79A 3JQAB 1HDRA 3VR4D 1YJQA 5AVJA 4UHBA 3WTCA 4QLOA 3K6SB 1M8GA 4WFIA 1V11A 1WB6A 2ZJ4A 3G9XA 4MB2A 3DDHA 4ZU1X 3KU1A 3RG8A 2PX0A 3GLQA 3WWPA 3IOEA 4UE6A 1IY8A 4FS8A 2PZBA 5ABPA 2WDPA 3F6PA 2EWVA 3PP8A 2PUTA 1RBQA 1U2QA 2CLFB 4KL8S 3LP8A 3QZUA 4WXPA 5BWLA 3R8FA 2VAXA 1KEPA 2GCNA 3ZV7A 1WB5A 2FEWB 3ZEAA 1W36D 1MJFA 4OM7A 1FFXB 1O4VA 1T0UA 3VPHA 4BVEA 9LDBA 2ODNA 3ZKAA 1RYNA 4QL3A 5JQGF 1SFRA 1B6TA 1RM5A 1A9ZA 2VQSA 5AH0A 1U0NA 4ZAGA 1EX7A 2Y68A 3F3KA 2CNNA 1WNFA 1JJVA 1B0ZA 3NEJA 2ECKA 3QV1A 4XX0A 5JHHB 3B85A 5J2TA 2Y05A 5B37A 1LF0A 2OXCA 4GGOA 3W9SA 2HPVA 1NPTO 4R2KA 3KOZA 2XKKA 5JFOA 1XD2A 1M75A 3ZHTA 3LMKA 5D6NA 4DCNA 3KQUA 1QIGA 1QU3A 3A8TA 3P2EA 4QATA 3TLCA 2GBLA 5HZMA 3WI7A 3LD9A 5LQAA 2P91A 1O95C 2X77A 4YAFA 4UAJA 4DNOA 4AY3A 3JARB 4ZP1A 3HXKA 2X42A 3GUYA 5A3VA 4QGAA 4YUXA 1NIPA 2VDJA 4MGYR 5DNEA 2P1ZA 1D9ZA 1LBTA 1SVIA 2A35A 2V7QD 3BCHA 4K3UA 4QQKA 1J2UA 4UTVA 3AXSA 3EMVA 3EODA 4PLWA 1TVKB 1NSYA 2P6UA 3AL2A 2OAEA 1H2WA 1G1AA 1WSAA 2FWJA 4IEFB 3D59A 4J3JA 2OD7A 3OIYA 1QHEA 3RWOA 1S3SA 3G9QA 4LYFA 2OQRA 4JYMA 4K40A 4DM3A 4UHKA 1F1JA 2XX3A 3X3HA 1A0OA 2XNSA 5DBEX 2V4MA 3AUFA 1OH8A 5CYFA 9ABPA 2SKEA 4MZDA 5CEJA 3L49A 4EAQA 5LLTA 3HDYA 1UKVY 3QPCA 2YY5A 2WOJA 3K2EA 4XJVA 2DPGA 1JHYA 4S1WA 1E2QA 2LE0A 2N9UA 3IXMA 4DYVA 1YULA 4IQ4A 3RSFA 2BJWA 1PZEA 4IKEA 4C0QC 4F60A 1NWCA 2C7PA 4IQ0A 2AFIB 2C3OA 4YYEA 5CXQA 1EGHA 2NP6A 3NBXX 1SQGA 3KEGA 5JQWA 4BPBA 4HPWA 1XTPA 4NK5A 2SKDA 4QWMA 3FCUB 1QH1B 3V1NA 1ZJYA 3EZ2A 4EB6B 2BEUA 4YC7A 5LKRA 4R1TA 2XSZA 2IHVA 1NE2A 3AVPA 3D3WB 3B36A 3G2PA 3A9RA 3LY9A 3TKYA 4QOGA 5K3CA 4GL2A 3T7DA 1GNSA 3SC4A 3T3IA 4JEMA 3SLRA 4YDRA 2W6PA 4ZRMA 1RWXA 1ZUHA 2W6ID 2Z4TA 2IYXA 4UDYX 3EGWA 1JW9B 4UXHA 4RK5A 2C2MA 4AO7A 2GBPA 1BS2A 1YJ8A 3ABOB 3L0ZA 4JX9A 4YRFA 3U5ZB 1W4BA 3OO0A 3HJFA 4FMPA 5A1JA 4CIVA 1G6KA 2JGMA 2X1HA 4LGCA 2W6CX 5I8PA 1PZFA 4OJMX 4AUNA 1XMOB 3WHKA 3ZZ1A 2G8NA 4U2FA 2Q4EA 1CKEA 5G1OA 1D1QA 2WC1A 1CQZA 2PKYX 3TCKA 1ZLXA 1GAXA 4KH0A 2HREA 4IZ6A 1U3VA 4IZIA 4RUKA 1TU3A 4PXAA 3JQAA 3QUSA 5DNUA 2C99A 1GCOA 3A0RB 3Q40A 3QVGB 5AM1A 3H5AA 2IV7A 3N07A 1EXMA 4NYJQ 3K6SA 1P44A 4HYYA 2IT1A 1SC4A 1NMQA 4Q7LA 4XQCA 1HT0A 5AXDA 1VCNA 1NQ5A 2PUBA 5IKOA 2ZIGA 4GYYA 4X54A 2WWRA 3LLSA 3LYLA 3VR5D 2BDEA 4EJSB 3B6ZA 2JFGA 3ONWA 1VLQA 4HGYA 3OCXA 3OM0A 4PSUA 4WINA 3I8OA 5JSQA 1XU9A 5DGDA 1NOKA 1BVHA 3ZY6A 2KBFA 2EX1A 4RGVA 4WKOA 5DBOA 5JO0A 3G88A 2WFLB 2YRWA 2HCTA 1FFXA 4UM7A 5HSGA 4PXYA 5HTOA 3JVDA 1P4JA 4I6JA 4J07A 3F3SA 2XTNA 1GCUA 2ZSJA 3OT1B 1Q50A 4MYDA 1TA4A 2FETA 5I3CA 1LPSA 3EZ7A 2HEGA 1R15A 3C74A 5EKTA 2BMAA 2ASVA 3L6DA 4UUPA 3C7KA 3MFYA 4JL5A 2ETXA 3PXXA 4UEQA 1LC0A 3A11A 2QN3A 4CR7A 1X39A 3RJZA 2EBWA 3BORA 3C98A 4UBNA 3UK7A 1IUPA 1B23P 2VC2B 4F06A 3IUBA 2DWUA 5IBRA 1E5TA 3BPSA 4WW0A 4RZHA 5B3AA 4LXHA 1CE8B 2ZR7A 3C5VA 3KR9A 5J63A 1MX1A 2FSHA 1L5MA 3JARA 4M2LA 2WWFA 1HZZA 1CW2B 1QPGA 1ZO8A 4R7GA 1G5FA 4CDRA 3II6X 3W1EA 2IYAA 1DAHA 1PU2A 3EDCA 4E4TA 2EKBA 3T5AA 3A06A 2C2OA 1L8AA 5JU6A 2OCPA 1EJ2A 3M8KA 4Q3BA 2MYTA 3AHFA 5CNIA 1CPYA 2B3TA 5L9AA 1ISIA 3Q7IA 4ARBA 3LXUX 1TK3A 3H9UA 3IOMA 5DWVA 5F52A 5ADUS 1F0NA 1EK5A 2C2BA 2GCPA 1M10A 1BWQA 3ESCA 3KWLA 1KZHA 5BRAA 4ISCA 1QFXA 3U1BA 3ZCVA 1H2ZA 4X71A 2OG1A 5ER6A 2J3LA 5EXEA 2XMCA 1MFPA 3ZXUB 2H08A 1H1DA 2AF3C 2E9SA 4G84A 4BNKA 2P27A 3FZNA 3LA6A 1T3ZA 1K86A 2VDNB 3V97A 5KUTA 2FDXA 1W5TA 1F0KA 3CLKA 1XPOA 3L1UA 2FMHA 2O2CA 5I8WA 1CJBA 1K7FB 3KT8A 2POQX 4HSGA 4LBZA 3TTTA 3HCPA 5EJ4A 4HNRA 1KI9A 3EGIA 3Q2KA 3ZHQA 4KR3A 4FFBA 2QM3A 1PNQA 1PD1A 1U8ZA 3AESB 2AFIA 2YNMC 3DCJA 3IO5A 5EEGA 1RDFA 2CV2A 1IM8A 1AZSC 5CYPA 5C5DA 4MDYA 3MRSA 4Z3KA 3DG9A 1GL6A 1DQRA 1M1YB 1V0JA 2BISA 3LO8A 4EB6A 1Z34A 3N0XA 1NJ6A 4CDNA 4KPEC 1GWNA 1MJGA 2FSIA 3BHNA 2C2WA 4IILA 2YKGA 1SVNA 2HWKA 3S6JA 1OUMA 3KZXA 3AHHA 1I0LA 1SQSA 3P9IA 4O6VA 3K94A 3G2OA 3GCGA 5BV2P 2O2JA 3AONB 3G2NA 4JR2A 1JH8A 4LC0A 4FYXA 2FHPA 1DTSA 3AUKA 4QNRA 3GBSA 3Q3GE 4PGMA 2X4DA 1GN8A 4MH0R 1VHTA 2JCYA 3B9QA 3G1UA 3IKLA 1YK0A 4CLOB 1VIVA 4XUEA 1O0BA 3LWNA 1MU0A 3VMFA 3OHSX 2B61A 4JHLA 3GPDG 1LUAA 5IH3A 1VCMA 3ZQ4A 3F5MA 2YZ2A 1ST2A 3WBKA 4BNNA 4TSFA 1JFFB 2IGBA 2ODEA 4LA4A 2VHQA 4M3NA 2ZT8A 2RBKA 4UARA 5TVKA 1D1TA 2ZWAA 2FSGA 3HCFA 2CNWD 1M33A 1P1CA 2PD3A 2WU3A 4WNYA 3LHSA 4AQ7A 3ITEA 1UWLA 1Z8FA 1SQ6A 2PQ0A 1KDRA 2QL5A 3C97A 4IJQA 4X0EA 4R3UC 3KD2A 1MUUA 1RXCA 3OQMA 4KE8A 1NQUA 1B15A 3HU5A 3QVGA 3LUGA 4OB8A 2WK1A 1G8FA 4QBTA 4XW2A 4DOMA 4HVCA 5ALDA 1YNOA 1IHUA 1PTJA 1H8EA 4XD7A 4YP1A 5FD8A 4L22A 3O92A 1EDDA 3UJAA 1ZGCA 1ZESA 2VNHA 3P9ZA 1QH0A 1RAEA 4XIJA 3OMLA 4URXR 3UHPA 2AXEA 3RROA 4EJSA 1QRRA 3OTHA 4LRXA 5CURA 2OV4A 2DB3A 1Z5GA 4JJFA 3ENQA 2CHGA 2GLUA 3UTDA 2CXQA 3R9XA 3VU3A 3V4PB 3B9RA 4TN1A 1ORWA 2X1MA 4HMOA 4XCXA 5J59A 4BGUA 3EVFA 2VFAA 2WFLA 1KEVA 4GI2A 1A77A 1CK4A 3K4HA 3KWJA 4MI9A 5CGQB 3TIIA 1EWQA 1LX7A 1FJXA 4KFTA 4YAGA 1X1DA 4I7EA 2FZ4A 1PR2A 1CHNA 4MYSA 2PS9A 3NCTA 1CLUA 4MQFB 3VVCA 3KSAC 1C2TA 1Q0PA 2O8DB 1R0WA 4RTMA 3V2IA 1GTRA 3IUQA 2AXQA 5I5GA 5JG7A 3MXOA 2O4CA 4BQPA 4WXRA 4F5YA 4KQFA 2IYRA 3A6HA 1QCZA 5FHQA 3SBXA 4GMXA 1M8FA 4R1LA 3FMGA 1XRSB 3BE8A 3F6SA 3KPUA 1P9LA 2HPHA 1NSFA 1U3GA 1ZRMA 2IBMA 2VEDA 2O8VA 2WWWA 3EQ6A 1H6CA 7ADHA 1CE8A 1M6HA 3U4MA 2GKSA 2W8BA 1G0NA 3LZDA 1NX6A 4N76A 4ENVA 2AMYA 3EW9A 2AYZA 1U8FO 5G0TA 2Q5LA 2M6KA 4KUGA 1N4AA 5EHXA 4G26A 1L9XA 1T5DX 1RKVA 4HX5A 1E61A 1TXGA 2I4RA 1U8UA 3GRYA 1ZRHA 2NVOA 3C3PA 3D3EA 4FYIA 3W5IA 4MIKA 2O3TA 1PL8A 3DFUA 1KZ4A 4I81A 1U4OA 4YCBA 3GOQA 1Y1KE 4YRTA 2WSIA 2QN8A 4BJ3A 4JI7B 4IJUA 1AG9A 1D3AA 4C76A 1ZHFA 1SU8A 2QL6A 5K3BA 1E6LA 4ZO4A 4NBNA 1SPBS 1OYVA 4CR6A 3UW1A 4ALNA 2WWXA 4M9CA 5DE3A 1O58A 3T8YA 3U3XA 2AKEA 3ACCA 3I3SR 4L08A 4TXJA 2I4TA 2QX6A 4OHBA 4YO8A 3DVSX 3T7SA 3VJMA 5A7FA 3NW9A 1AXEA 2XLCA 1YCHA 3MBOA 4W5WA 5IYZA 1RXEA 1U1IA 5HF6A 4OQZA 1VDZA 3CR8A 1MEOA 3LX5A 2CUTA 4AL4A 3QU5A 5L7TA 1ZS9A 1JFVA 1NVBA 2DWOA 2RAFA 3DBHB 3G5TA 4OJTA 4C0WA 3U4QA 2Y1KA 1GZ7A 1AUOA 2Y9MB 3C8UA 3UMYA 1XMSA 5G4KB 3STUA 3K70B 1X19A 3R0VA 3U0BA 3ELDA 5I9MA 4XFKA 5MFZA 2J0SA 1G5QA 3L7MA 3CQ9A 4TYYA 4RFSB 3WVNA 1F12A 1G18A 2D2FA 2V0NA 3M6VA 1A4IA 1M1YA 3R3SA 5C8ZA 4U0JA 4BMYA 3TR0A 1I3OA 2QRNA 1BFDA 2VP2A 3DVAA 3X1ZA 4DXDA 4PCVA 3PVZA 2CHQA 2XYPA 3KQHA 4DR2B 1A69A 4FOPA 1V6SA 3H3XA 4HGOA 1BHJA 2P5TB 1QFMA 4L78A 2JW5A 5T8KC 3BIWA 4Q6BA 4J29A 3AM5A 4JJ7A 1SA0B 2ZCUA 3S55A 4BMNA 3M6WA 3DE3X 4CLOA 4S04A 5E6SA 4L72A 3K53A 2VJDA 3NTUA 3T0IA 4RVDA 2XW6A 3JQ7B 2OCGA 3KP1A 3R4VA 4XDYA 5CB8A 1PFWA 3MCWA 3MVEA 1F4PA 2LRHA 1Y82A 3H3JA 3PNMA 4LWZA 4JJZA 4QOEA 3SNHA 1SC9A 2PT9A 2HA5A 5FBLB 1UMBB 4MW4A 5JR3A 4KHPB 4P98A 2O3UA 4U00A 3R23A 4DLKA 5IBPA 1DXOA 1NV9A 3I2FA 2NO7A 3ZD7A 1HMPA 1R5NA 1ZM2A 2C5EA 4FX5A 5K0LA 3E9QA 1V8PA 4MQ4A 4KBYA 5L51A 1E18A 2PJUA 5BOVA 2VF4X 4IRUB 1PDOA 3T7TA 2ZB7A 4ND1A 4OK6A 4Q12A 4B17A 3WLNA 4CM9A 1TAHA 5C0OE 1IK6A 5DWDA 1QQAA 1DQSA 4GFDA 5HR5A 1I0IA 1M1NB 3NIGB 4I1RA 2HBZA 4RGYA 4URHA 3EFEA 3VZDA 1OAAA 1R27A 1WPQA 2X0KA 5K4AA 4C08A 4RTJA 3VUEA 5AD1A 3DM5A 1EGVB 3LG2A 3TRIA 1PN3A 1Y80A 4QBHA 5JAPA 5DB4A 1G20B 2IOQA 4N82A 4PS0A 1EE1A 4C05A 5GONF 2QZJA 4JJ6A 4I9FA 4IDBA 3W8RA 4CI9A 2Z08A 3G89A 1TKCA 2FFAA 4UM8B 2VUTA 5IC6A 2B92A 4YJGA 1AE1A 1QH9A 2R8YA 5AKIA 4BB6A 4EX7A 1Z56C 5LD2B 2O8DA 1WVIA 2X9LA 3FDZB 2Y0PA 4B8WA 3QXJA 4BCBA 4NARA 2E4UA 3ZY4A 1XCPA 5AMXA 1CRWG 4H0CA 1I24A 1KIFA 1G98A 2QVCA 5BMVF 1ABBA 3LI2A 2NO4A 1A8UA 1KZ7B 3GEGA 4UHJA 4DLPA 1LNSA 1JN0A 4HH3C 2ZTSA 1HO3A 1X1QA 2XOKD 3VJRA 4M53A 1TD9A 3JVIA 4LOLA 4XB2A 4F72A 5TGDA 4C2TA 1NXVA 2JK1A 2WWHA 5HKLA 1OXXK 2BDTA 2OY0A 3P9QA 4MIYA 5CYOA 4NR0A 5FUYA 3WYAA 1QZZA 2O1XA 2XQGA 1BDHA 3OM9A 4NU8X 4FBGA 1JFLA 4XSHA 2DT5A 2X6QA 4B5LA 4M4SA 1J33A 5F78A 4IVRA 2FWPA 3HM2A 5DHRA 5A0TA 3BULA 3QI2A 5HEKA 3FX2A 2Y1WA 1URPA 3TECE 2MDTA 1QRTA 3A4VA 4A4DA 4PYJA 3WBFA 2PZKA 5JATA 2DOKA 1SM4A 2IZ7A 4LZOA 3ECCA 3NBAA 3SZ3A 3EBPA 4RENA 3TTSA 2OCLA 2V96A 3MJSA 2B1GA 4HPXB 1H2HA 5AI5A 1UKEA 3ZDAA 2IP2A 2VQ6A 4HAUA 2QIPA 5EHGA 3IVAA 5IPFA 4F12A 1XRQA 2H52A 1U0BB 2WILA 3ZCRA 3D7NA 2GN1A 2I1LA 3ANNA 5DYIA 1SUPA 1VIDA 1UMDB 3KKEA 2JFFA 4OUKX 4INPA 5G4KA 2RJOA 2GMWA 1VGVA 4CHTA 1HE5A 2P35A 4HNQA 3VPAA 1QM5A 3F78A 4HB3A 4NU5A 4OI1A 2D6FA 3H4MA 2V1UA 4KMSA 5DW0A 3HGTA 4DDWA 1L5OA 2ZRGA 4LOJA 3RVLA 2BYTA 1J5XA 5JXJA 4ZQCB 5IAAA 4IRMA 1SCUB 3AUYA 3IBCA 4RFSA 3VTKA 3WRXC 4BMOB 3SQXA 4NXMB 1WTAA 1AUXA 1KYZA 5CDUA 2ZZMA 1S8OA 3DBOB 4R2MA 2IE8A 2C7VA 3EDQA 4OYHA 1WW2A 3H0CA 4YNBA 3P0HA 4TL9A 3WL6A 1Z82A 2IYOA 4FHZA 3HKCA 2HRCA 4IOJA 2E82A 4JXZA 1BU5A 1K63A 1GEGA 1T0JB 1D07A 3WWEA 3ZWVA 3I9JA 4QAJA 5BWCA 1G7RA 1N1GA 2XDWA 3CPSA 1G8PA 2IYZA 1V6AA 3OEYA 3O5AA 2ACWA 4HDQB 4YECA 3EIUA 4NTZA 1NVFA 1G21B 2GXSA 2HT6A 1MRSA 3EVNA 4GG1A 3AEQB 3JQ7A 2GZ3A 2EX4A 2ZRBA 1L3IA 4TTJA 1G17A 1YV9A 1UMBA 2IU3A 3KSZO 4MTLA 1OX5A 4RS3A 3IOCA 3FF1A 1JG3A 4OYLA 2P11A 3CUVA 2ZQ5A 5LQKA 1YHZA 1GEEA 3GCWA 1GNLA 3OT5A 3JWIA 1W35A 2YJNA 3ONVA 5HUHA 2R44A 4FGKA 2I78A 4MVJA 1CUEA 3FWNA 4MMZB 4R16A 3QPBA 3V1KA 5G1PA 3G68A 1ODIA 1XHFA 1SO8A 3ZVNA 1HSZA 3NGXA 5DN6D 4R01A 4IGIA 2HK6A 3V55A 4N4AA 1ZOLA 4M0EA 4P34A 2WT8A 2GF2A 1JHOA 4XSGA 5H68A 4B9EA 4C06A 4DMMA 3WIVA 3R3UA 5FPPA 4LF7B 1JKXA 2PT5A 5EMHA 3WGMA 2P9EA 2X5XA 3FMPB 1HLGA 1U7PA 3OPXA 4RACA 5TJ9A 5FPYA 1MA3A 4KVZA 2CL7X 2PMFA 1ZC3A 1OF1A 3HNPA 3KJGA 3PQ6A 2J0VA 3OY7A 5TS2A 1A9RA 1Y8AA 3UY4A 4YRAA 2A0YA 3EARA 4HZIA 2OLKA 5ALFA 3HYCA 3MJ4A 4DIEA 3KHTA 1K75A 1T1JA 4HNSA 1OGIA 1Z3IX 5IJXA 2CMKA 1JQLB 1R50A 5FV7A 2RKOA 1USIA 1UDWA 3L1JA 1C9KA 1K6IA 1W2HA 3JU3A 3HCCA 2BZGA 5DI3B 2OVFA 3RDPA 3B48A 1G7TA 2N46A 2I4LA 4WPGA 4HDSB 2AQHA 4QRHA 3OQIB 1BXGA 3M33A 4OIMA 5ARBA 1N