3H5OA

The crystal structure of transcription regulator gntr from chromobacterium violaceum
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
RTVLVLIPSLANTVFLETLTGIETVLDAAGYQMLIGNSHYDAGQELQLLRAYLQHRPDGVLITGLSHAEPFERILSQHALPVVYMMDLADDGRCCVGFSQEDAGAAITRHLLSRGKRRIGFLGAQLDERVMKRLDGYRAALDAADCRDAGLEWLDPQPSSMQMGADMLDRALAERPDCDALFCCNDDLAIGALARSQQLGIAVPERLAIAGFNDLQPAAWCTPPLTTVATPRRDIGVHAAKALLQLIDGEEPASRRADLGFRLMLRRSSEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transcription regulator GntR from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Transcription regulator
molecule keywords Transcriptional regulator GntR
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h5oA01
1DBPA 3DGEC 3P9YA 3VNAA 4OTZA 3I5AA 4MR8B 2CD7A 5BR1A 4CBVA 1LK0A 1JX6A 3LUDA 5DCLA 1USIA 1W25A 3H5OA 2WRZA 1C4WA 3CKMA 3GT7A 2FLWA 2FEWB 1FFSA 2LP4Y 4GPAA 4RK0A 1PEAA 1Z16A 4JAVC 5BRJA 4YRZA 3KKEA 3KTOA 3FFTA 3A10A 4PYRA 3ILHA 1Y1LA 1YK0A 3Q7TA 3K4HA 3DLBA 2FVYA 3I09A 4Z4EA 2PKXA 1F51E 3CZ5A 2E4ZA 4XLTA 4ZPJA 1ZVVA 5IX8A 2X7XA 4RK6A 1JBEA 3MYYA 4IRXA 1ZHHA 4MR7A 4TMYA 2H0AA 3HEBA 1JF8A 3C6QA 5IEJA 1YMUA 1M2FA 3SM9A 1I3CA 4B09A 4G0XA 3HO1A 1QPZA 1NXSA 1R8JA 3LFTA 3I42A 4DADA 4EVSA 4KMRA 1Z18A 4JB0A 2OQRA 4O1HA 3LUKA 2WB4A 4MS1B 1EHCA 5HKOA 2A9QA 1C0EA 5JS2A 1DRJA 1WETA 1USGA 4L85A 1YK1A 3OO1A 1RXEA 1NXTA 3GA5A 3JS5A 3Q15C 4MS1A 4EYKA 4YR7A 3MMNA 2WJAA 5CNKA 5C5CA 3C3MA 3KG2A 1JWLA 1PNTA 1U2PA 4PEVA 2FEPA 1ZESA 3H1EA 3GYBA 4RY9A 3LUCA 3UUGA 4IMIB 1USKA 1GUDA 2FMHA 5EWJB 4ZYLA 2HQBA 2JVKA 4EYQA 2RGYA 1H9CA 3RVLA 3N75A 4Z4FA 3CG4A 3Q7RA 3FFWA 2JVJA 3HZHA 2YHBA 3LMKA 3M9XA 4Y9TA 1ZAYA 4W5QA 3IDOA 2BGGA 1EWTA 1QMPA 3O2QB 3HVRA 1ISSA 5JNVA 2R25B 3MQ4A 4Q6WA 1JFTA 3IP5A 2L19A 2V0NA 3NNSA 3CG0A 3TO5A 4E7PA 4N0QA 1U04A 4P1ZA 1FSPA 1NXVA 1TMYA 3UKJA 1PHRA 5KI6A 1AB5A 3A0RB 3DZDA 2FQWA 1Z17A 1NY5A 2IOYA 5IUJC 3GWGA 1E6KA 1ZDMA 1ABFA 3H1GA 4MRMA 3SG0A 4S05A 4N41A 3NBMA 1TLFA 4KK4A 5EWLB 2ZWMA 3DBIA 4GNRA 2MSLA 5FBHA 4IMJB 4G0YA 4RKQA 4D6YA 4XFKA 1NXPA 1DCFA 3EGCA 4YV7A 3LKVA 1S8NA 4Q7EA 1JH9A 2HSGA 3JTEA 5IUKC 1JL3A 3EDCA 1ZGGA 4W5RA 4LDAA 3NHMA 3H5IA 2O20A 1Z12A 3CTPA 5CNJA 2OENG 3EQ2A 3OM0A 4W5NA 1ISRA 2QV0A 2M1ZA 1BVHA 4MR9A 1QO0A 2GX6A 5GOTA 1JFSA 2PUFA 1KMIY 2E4XA 2PL9A 3IPCA 3HK2A 3OMXA 3O75A 3ROFA 4YWHA 5IC5A 3E61A 1EWVA 2IYNA 2FTKE 4EY3A 2PMCA 4W5TA 3QEMA 1KGSA 2FKAA 2N9UA 3FFXA 5TQ2B 1QNLA 3EAFA 4MRMB 2QVCA 1A2OA 3BRSA 3Q7SA 1ZGZA 1P8AA 5HQJA 1U2QA 3GV0A 4EGSA 2NZUG 3H1FA 1TJYA 2B4AA 4KV7A 3NHZA 5FWXB 1Z25A 3O2SB 3CHYA 4WUTA 4WZZA 1JYEA 3KS9A 4MR9B 1J56A 4RY0A 1ZY2A 3CFYA 3N0WA 4IILA 4TLMB 4WXEA 2JK1A 2W42A 5HSGA 4KZKA 5PNTA 3RVKA 4HYEA 4RK4A 4RKRA 4Q6BA 1Z2EA 1CYEA 1ZN2A 1L5YA 1PNRA 2PUEA 3OQOA 3RQIA 3JY6A 3QEKA 6CHYA 1QQAA 1ZH4A 4F11A 4LRQA 4KVFA 1XHEA 4ZJPA 3DGFC 2WY2D 5DTEA 4NICA 1MB3A 2A9RA 2VK2A 3KLNA 4XAQA 2P9HA 1CHNA 6ABPA 4OLAA 3KCNA 4DQDA 3QLUA 3IP6A 2DRIA 2PE5A 4ML3A 4RSMA 5ABPA 3O1HB 3EJWA 4HNSA 3HDVA 4MQFB 4MLCA 4QICA 4N0PA 4QYMA 5FWYB 1LBHA 1SXIA 3LKBA 3OLXA 5TPWA 3HV2A 1URPA 4EYOA 1QP7A 5DKFA 2JB9A 2JCGA 1T34A 1EAYA 1K68A 2F8SA 1BA2A 5IUNC 3QEMB 4MYRA 4RXMA 9ABPA 5GQSA 3QLUC 2NT3A 4TLLB 3JVIA 3NNDA 3M6MD 4HNRA 1JLKA 5TPZA 5KC8A 3N6VA 4PZ0A 5F64A 4Z4CA 3LUHA 2QVGA 4O1IA 5BQ3A 2PJUA 3HS3A 3M9WA 2RDMA 4M88A 4MS3B 4MLDA 2PUAA 4OLBA 2L17A 4JASB 4RS3A 3T38A 4F12A 1EFAA 2VYCA 1P6QA 4KFCA 1D1PA 2M98A 1M5TA 4LZLA 3N53A 1Z2DA 4JP1A 1TVMA 2GKGA 4L4UA 2PL1A 3BBLA 3H5TA 2E4UA 3OQMA 1RZRA 4G0QA 2QR3A 4OBBA 1B00A 2MYNA 3JPWA 2FN9A 3OMWA 3OO0A 3TX6A 4ZMSA 4W5OA 4N76A 3E3MA 2PUBA 5KQGA 1D5WA 1XWWA 5D2CA 2IPLA 4MR8A 1U8TA 5T3YA 2PLNA 5CHYA 3IP7A 5IULC 1SXGA 3MA0A 4RXTA 2R4QA 3RVSA 4G0OA 1DC7A 2MSKA 4FE7A 4XARA 5TQJA 3OQNA 3TD9A 4E7OA 4UHKA 4KREA 2J48A 1DJMA 3H5LA 1YMVA 1HEYA 1JHZA 2JVIA 2QU7A 3GRCA 2Q5CA 2PUDA 1OXBB 3O2JA 1QO0D 3B2NA 1CEYA 5CNIA 1APBA 4QYWA 4RV5A 3F7NA 3RVOA 1A04A 1ZITA 3QX8A 1IIBA 2WWVD 3O1JC 3OLWA 4WWHA 3LUGA 3N8IA 3T95A 4MS3A 1FFGA 2GWRA 1DBQA 3KYIB 3QLVC 1YTUA 3OM1A 4QPJC 2R47A 2RJNA 3FMVA 4RK1A 5IBQA 5KQMA 1D2AA 5KQPA 5KQLA 3HUUA 4HNQA 3H5VA 1JDNA 3LUJA 5EWJA 4O5AA 1E6LA 1PUXA 2HQOA 1MVOA 2AYZA 4Z4IA 1VKRA 4LE0A 3T6KA 2XDYA 4DN6A 3RVQA 8ABPA 2FXIA 2MYPA 3H6GA 3QK7A 4RWEA 4P98A 4LX8A 4Z4GA 1OXKB 2LPMA 4JA2A 3SAJA 1RPJA 3OLZA 2IKSA 4S04A 1FFWA 1Z15A 1UDRA 2WMYA 1JDPA 3FGZA 4FB4A 4KNYA 4YGXB 1JYFA 3MIZA 3DLHA 2ID7A 1MB0A 2FMIA 2FW0A 2JBAA 4Z0NA 5I4CA 4Z99A 5TQ0B 2ID9A 2FLKA 4IGAA 3SNKA 3CZCA 3QLVA 3KLOA 4KPYA 3BRQA 1QQBA 1GUBA 2YHAA 4OG2A 2P4UA 4NQRA 5EWMA 4YP9A 2PUGA 4YO7A 3SQNA 1NXWA 1GCGA 2FEKA 2HPHA 4Z4HA 4ZMRA 1DC8A 4WT7A 5JNTA 2MSWA 1QP4A 2PUCA 4F3TA 3RVJA 3RVPA 2NUBA 4LE1A 1YVUA 4NV3A 1W9HA 3C3WA 1VRVA 3HDGA 2KYRA 1DZ3A 3F6CA 4RK5A 5TPZD 4RK7A 2IDMA 3OLVA 3MM4A 2WJWA 3A3KA 2CHEA 1AB6A 1A0OA 2L2QA 4KQCA 2JRLA 3N0XA 2ZAYA 3T8YA 5HM6A 1BDHA 2CHFA 2HJ9A 2TMYA 4Z9BA 2NT4A 2JBAB 3W9SA 3SY8A 5TQ0A 5DGCA 4MAAA 4EYGA 4MGEA 3EULA 1U0SY 1Z26A 3HUTA 3D8UA 3F6PA 5JNUA 4MQFA 3TB6A 1GLGA 1NTRA 3H75A 3CS3A 3L6UA 1NXOA 7ABPA 1L5ZA 4MS4A 4MPTA 4ETMA 5C5EA 4IF4A 4H60A 3TMYA 3O74A 5JNSA 1E2BA 3CU5A 4OATA 1VLZA 1YS7A 2E4YA 1D1QA 3K9CA 4ETNA 4LE2A 4NCAA 4MS4B 3JVDA 3VNBA 2A9OA 2GI4A 2LUOA 4FE4A 4JOQA 4ETIA 4NCBA 1Z13A 4TN5A 1E6MA 4G0PA 5EWLA 3G1WA 3BREA 2NZVG 3G85A 1DG9A 3GBPA 3IPAA 4RXUA 1LJUA 3KSMA 4F8JA 3H5WA 5B3JC 3LOPA 3HSYA 1MIHA 4D74A 5FWXA 3LUAA 5DLEA 1D4ZA 1JFVA 2FN8A 1M2EA 3Q9SA 3LUFA 3QX9A 4KK3A 1NXXA 1P2FA 1SRRA 3LTEA 3QELA 4Z9AA 1M5UA 3F73A 1KRXA 2MYTA 5KC9A 5EWMB 4KQ9A 2F8TA 4XXHA 3URMA 1EWKA 1SD5A 3I45A 3HJFA 2QW1A 3EODA 4G0ZA 2QSJA 3OLYA 2QXYA 3IP9A 3QLTA 3GBVA 2HQRA 3H6HA 5FWYA 3O21A 1LJLA 4KRFA 3ILYA 5TPWB 1RXIA 4EVQA 1ZH2A 2FSPA 2VUHB 2AYXA 1YS6A 4MQEA 2FQXA 1VPWA 3RVNA 1SXHA 1MAVA 2VUIB 1XHFA 1YIOA 2GBPA 2LIVA 1TM2A 3NNNA 4JB2A 4RY8A 3UK0A 5CNMA 1QP0A 2R48A 4WXMA 4YCSA 4PE5B 1DBWA 3D02A 3KJXA 1DCKA 1FQWA 2LBPA 1P6UA 4XASA 5E3JA 5FBKA 4RZSA 1NATA 5TE9A 2L18A 3HCWA 3R0JA 1DRKA 3HXMA 2MYUA 5B3JA 2E4WA 5ED4A 3L49A 2IPNA 3FDFA 4RDCA 3S99A 2FQYA 2IPMA 4MR7B 3Q41A 3RH0A 3QELB 1KRWA 4N03A 2A9PA 1RZRD 2IPAB 3C97A 4PICA 3HM9A 4EVRA 5IEBA 2QZJA 1ABEA 1DP4A 3CNBA 3C3KA 1K66A 5BRAA 1BDJA 5JNWA 3EQZA 4RU1A 2E4VA 2RJOA 2CWDA 3O1IC 1QKKA 1PEYA 2PAFA 4UHJA 2H3HA 3MF4A 1GCAA 1LBIA 2B1JA 4H3HB 5KWSA 1F4VA 4YLEA 2FMKA 3CLKA 5TQ2A 3RVMA 3ROTA 3CRNA 5T7BA 2FMFA 2I6FA 4YS6A 3KYJB 4G0MA 1RNLA 3JPYA 4LDZA 4G97A 4N47A 4G86A 4H3KB 1BDIA 4MQEB 1BAPA 3GL9A 3RVRA 5JS1A 1DCMA 4EUKA 3A0UA 4D6XA 3KHTA 3N0RA 3BILA 4F06A 5JNRA
chains in the Genus database with same CATH superfamily
2GZ1A 1FNSA 1QH9A 2OHHA 1DIOB 3CNNA 1DC6A 1NKVA 3G8YA 3PC4A 2JKYA 1ZGJA 3U17A 3CO0S 2A7QA 4DMKA 3D0QA 3HBAA 2G77B 1ZXBA 1Q0QA 2BCJQ 2EHJA 4FYPA 4HLDA 4DCGA 2LKDA 3I2GA 1KFEB 3WIEA 4QQ8A 3S7ZA 1YJCA 1B8UA 4DTCA 5AJZA 3PF8A 1FCJA 2WD7A 2R5FA 3E2MA 4F5EA 2J31A 1QU2A 1CTQA 2AFRA 2X3FA 1ZK0A 3OVMA 4IHJA 1YKGA 3TLMA 1CEQA 3TNFA 3VO9A 2C9MA 5LZ2A 1VHDA 2IHJA 4QYIA 3QFCA 3U80A 1J9ZA 2AZDA 4XYEA 2VXCA 4NSNA 4NFLA 3K4HA 4F6CA 2F9MA 2BBSA 3S44A 4AL4A 1I30A 2XIQA 3UAWA 1RPZA 1E2HA 4YLYA 2C7PA 4LS3A 4J3JA 2RAPA 4ZPJA 1JXAA 2PCLA 3RC8A 2HWWA 2J9RA 3SZGA 1OFUA 3U9LA 1DX4A 2FJ0A 1OXUA 2FHSA 2H0AA 3R9WA 1KEEB 1JF8A 1F5SA 1UKCA 3KCQA 3P2KA 4UASA 3FTQA 3MJFA 1P4GA 1YMUA 1NVDA 3ETGA 5FOSA 1OUMA 1YR6A 3AF3A 3VYUB 2FR8A 3PE6A 4B09A 2QJWA 4L8FA 3HFSA 4D25A 3JD4A 5CVDA 3IT2A 2V7PA 2X8WA 1GRVA 3H6KA 5T8KC 4QE3A 4GKAA 2E82A 1Z73A 4DM7A 1L7AA 3NHYA 4NG4A 2XIJA 1VHWA 2WB4A 3PUZA 3QIVA 3ZD6A 4LF4B 1XZBA 2IUSA 3JASA 2C2YA 3ZNNA 1N5KA 1C80A 4BLPA 2XTMA 2GN8A 3AT1A 3URKA 1E9RA 4JEHA 2PU7A 2JI7A 1J90A 1Y3HA 4RTLA 2FEPA 1T91A 1RYHA 1TIKA 1W93A 3GYBA 1HORA 4YCLA 3CW9A 2CEKA 2I4LA 2C78A 1ZK2A 3FBGA 4OLJA 4QD3A 2W2NA 2R84A 3E81A 3FTEA 2YWFA 1K4MA 4MGYR 2GKSA 1SC4A 1KJ8A 2GAOA 2ZIFA 4DM4A 2JKZA 3WDSA 4YQYA 2QBYA 1SCJA 3DEHA 3BERA 1EWTA 3OBBA 1CUDA 3HNOA 1OVMA 4WXRA 2WYOA 2IHKA 4AJLA 1VKJA 3GN1A 4Y6OA 3TQFA 5JDIC 5AHRA 3IV9A 3OQJA 5EVCA 1CJKC 2V0NA 4P84A 2A57A 3K72B 4W1QA 1I24A 3LZDA 4BHTA 3NJ8A 3AEZA 3GEBA 3MLBA 4LV5B 1SJ9A 3DP7A 4X7PA 3KJIA 3TVDA 5KI6A 5AVZA 4M0MA 2GDJA 3QEAZ 2HK6A 3B20A 3L0SA 1TLTA 4KQHA 1CIJA 2KX7A 3IJPA 4HYQA 4RY2A 1L6IA 3OHSX 4ZANA 4S35A 4FYJA 3EYWA 1ZDMA 3OD1A 3D3EA 1HMPA 2ACVA 5CRIA 4I5FA 5G0WA 4CKBA 1ORIA 3KQKA 2YY5A 1WPRA 5BSUA 4TYYA 2XXAA 3WBFA 3HJAA 2B1GA 1KWKA 2PANA 1GZHB 5KJ6A 3OCJA 5I7VA 3THXB 1SCAA 1SXPA 3AETA 2I4OA 5DBIA 2Y9PB 3H0KA 5LBTA 4FEGA 4AZWA 1KI6A 1XB2A 1DT3A 1JH9A 3KDPA 2D0IA 4UE6A 5JC1A 3QVUA 1C0LA 3L2OB 1LQUA 1ZIXA 4NVRA 4DR3B 3GMTA 3AKZA 4UMDA 1PL0A 1N33B 2Z08A 1R8QA 5CNJA 2OENG 4O4JA 5TLSA 1QGUB 4ZAFA 3RNOA 1GARA 1LBTA 3WJ2A 1DDOA 5FOVA 3H9GA 3JVVA 3T5CA 2FJUA 1HE8B 1UMBB 1XEXA 3PFFA 5K3EA 3ME5A 3AHHA 1Z5UA 4GRIA 1JFSA 2Q99A 1SU4A 1MAHA 2Y99A 3OMXA 1T0JB 1Y6ZA 3SKYA 2D4AA 3LCVB 2P2LA 3Q72A 1PG0A 2BISA 1IY9A 3GCXA 4L5JA 4N8EA 4BMZA 3ONWA 3R3WA 2POQX 5JBNA 1LDYA 2H5EA 4CR6A 2QMUA 3DAYA 3ONVA 5F3WB 4L57A 1EHIA 2QVCA 3LBHA 1M1YE 2BPOA 4RZ2A 1U2QA 5KPDA 1XCOA 1OU0A 2W4MA 3LIPA 2VQDA 4LY6A 1ZI8A 1LB1B 3AEYA 1W5EA 4F5ZA 1SCNE 3LL7A 4AN0A 3AERB 1EFKA 2VSNA 4K88A 5C1OA 5FWXB 4KIGA 3RVBA 4P2BA 3THOA 4KYIB 1C8LA 1AU9A 1G60A 1WP9A 1V26A 4IDDA 1FX1A 3I39X 3NEAA 4BB6A 1VE6A 1CNFA 4W82A 3ONDA 4Q6BA 1OC2A 1HFKA 2IKQA 4MLZA 1Q0HA 1FRFS 4PFJA 4ZVNA 1H6DA 2ZB8A 3KPJA 3T7KA 3CUYA 3I8XA 1SZDA 1VMKA 1XA3A 1FSSA 4RMNA 3GRVA 3K5WA 5L95A 5DJ5A 5SV2A 4NICA 1ZVJA 3HJRA 4QC2A 2VK2A 1E6EA 1C2TA 1XZKA 2O3QA 1QF6A 4WBNA 3ORRA 2WP0A 3II6X 5DYGA 4O4LA 3KQYA 3O3NB 4QVGA 5EIAA 4ZVUA 3SR0A 5I7EA 3C8HA 2UXCB 3FZQA 1CJMA 1WEHA 1T5SA 1E1RA 1Q5PA 3ZCUA 1O95A 5IJ9A 1A8IA 4V1CA 4U7GA 4HWRA 3SQDA 2AMVA 1A8PA 1HWYA 4JUBA 4M0LA 5SICE 5EPOA 1DV2A 2GCEA 4O02B 4C4TA 5E8RA 1Y7HA 3MZ0A 4UULA 4F46A 4BVKA 3H8VA 3DFFA 3ZDDA 3DEIA 4G8DA 5CIYA 2ISSD 3T7SA 1Y9AA 3W4IA 1NLFA 1G4HA 1VE7A 3KVYA 3MTBA 4L6IA 5AUQA 5BSHA 1E4EB 1V9SA 2WOJA 3IX7A 1XAGA 2F3UA 5EJMA 1U2DC 1KZ6A 3VXKA 1ZVMA 1SQ0A 2YHIA 5E4JA 4M1KA 3WIUA 4BQSA 5BURA 4WADA 2PVCA 2KBFA 2QV7A 4FR5A 4ONEA 4ID3A 4QUEA 3OTOB 1MZPA 4UJ5A 2QN8A 2I1VB 4GMDA 1E9EA 3FNBA 2J3IA 2W2MA 4B17A 3H0EA 1W30A 3VVLA 4WJLA 5LIPA 2BTQB 2W58A 3E5HA 4AQYB 2WWGA 3R0QA 1W44A 1XMXA 3IT0A 5ALHA 1HX7A 3WKAA 4UBNA 1XJ5A 2PWBA 3U4QB 3ER8A 1HUQA 1Y98A 1F0YA 1ZGCA 2IPLA 2VLIA 2ZI9A 4OFWA 2CN1A 4PW0A 4D92A 2G5TA 2O54A 3S1SA 3QPDA 4XVQA 1J8MF 4QBIA 1Y80A 5EYPA 2E5WA 4HR7A 2O2SA 2P1DA 5IW8A 3V4LA 3AR2A 3TZBA 2O2JA 5GMOA 1JN0A 2WHQA 5TQJA 3T06B 1SHLA 1T3TA 4JBXA 4RL6A 5A3RA 5HRCA 3TH5A 3ILSA 1LZKA 4NZOA 5L4SA 4R1LA 3CB2A 3FZYA 5CB8A 1DRUA 3UC5A 4CQMB 3GRCA 4PO9A 3MS4A 1KMNA 2CUNA 1J8YF 4LVCA 1CEYA 4GKVA 5IS2A 1X19A 1PL7A 1O0CA 3ESAA 1A82A 1ZITA 3V9AA 4R5MA 1PQUA 1X8JA 3TIFA 2QL7A 2F3RA 2GKOA 4MYTA 1UM9A 4XW2A 3UHPA 1QS0B 1ZJ6A 4D97A 1YA6A 5KKNB 1R0CA 5I51A 5D86A 1KI8A 2VNHA 3ZJUA 1Z0ZA 1KEEA 4CCYA 2ZJ3A 3DFKA 1T4MA 1N2BA 2NN3C 3FMVA 1CZHA 1EFVA 1LK7A 2GTPA 2H0QA 4RD0A 1K4KA 5IN5A 3CEMA 5FV4A 1H2AS 4RHTA 3JAWB 5FUBA 3LA8A 2ZCUA 2H0RA 5EWJA 4JI7B 3PF9A 4GW3A 2ZZKA 5LZ8A 1KSGA 4RESA 3UHFA 3ZHCA 2AYZA 5TX7A 3N7TA 4F9FA 3UPUA 4ADSG 4BKPA 1JA1A 2QR2A 1ZOOA 4G1CA 2FE1A 1ZINA 5IP5A 3RE1A 5B6JA 1X1BA 5IFKA 1ECLA 2P0EA 2H00A 4L4YA 1FW6A 1IC6A 3MWJA 2IU6A 1RYBA 3KVRA 2XQKA 4K7JA 2X9GA 1FTNA 3CTMA 3ROZA 4EMBA 1E5QA 4B48A 4FMBB 4U2EA 1WMDA 2I33A 1QYCA 2QUJA 2JHGA 4QFBA 2K2WA 1Y81A 1K0FA 2ZT6A 5GJBA 3VC7A 4IIDA 4QUIA 3PFGA 2Z1NA 3KLOA 5K09A 1KOJA 1NHWA 3UJNA 5AW8A 3VH2A 1YJ8A 2YHAA 4DF3A 1ZNYA 2XCOA 1MJHA 1NBEA 3LL4A 1XXHA 5ED0A 3INYA 2PUGA 3KT8A 2X2PA 3BGSA 1UINA 1C7EA 5KYKA 1XMQB 1NPDA 3ABOB 4E14A 1UBTS 1VL6A 4DR6B 4GPEA 4BE9A 3PIIA 2ORED 4BMXA 1E7WA 2O52A 3D8BA 3H83A 2GCOB 3I0MA 4YCDA 3RGGA 3UMSA 1NWHA 3VV3A 1V1MA 4E5SA 2PUCA 2JL1A 2WZDA 2ZI6A 4RORA 2VTVA 4IXMA 2QX4A 3TBHA 1PKEA 2A6PA 3F3KA 4BWGA 4PLWA 3A3KA 3WYGA 3RHFA 1AK2A 7AT1A 1B3RA 5CD9A 2H08A 1BA3A 2XA9A 3GFTA 5H3CA 3KZOA 1FVHA 1QYXA 1ZMTA 3M4JA 2VSFA 2ETXA 4YRJA 3UM9A 2YDYA 3C8DA 5A5GA 3EBPA 2HIHA 5A3SA 5EHXA 5HTOA 4HWKA 1BYIA 3I4CA 3TBKA 3H1PA 3U7QB 1R5OA 1KQPA 2GZ2A 1NYRA 3QKRB 2IYAA 3DZ8A 4QDJA 4EYGA 2YW2A 4MGEA 2VIIA 2EWMA 1NUQA 3F6PA 3OFNA 1GLGA 1AHIA 1HSOA 3WRXC 1JPNA 3BXGA 4S1NA 3I2JA 1W6UA 5CT4A 2LRHA 2R3SA 1RQ2A 1XX6A 3BMOA 2OILA 1II8A 1QAQA 4WINA 4FFVA 4H1UA 3SYLA 3NXSA 3QVMA 3VKUA 4TWRA 3RSSA 4NIMA 1EFHA 1OAOA 1R6UA 1XHLA 3I04M 5AW5A 4DVJA 4NF2A 5IG2A 1YDEA 5DZSA 3OEED 2J3JA 4FE4A 1KVUA 3O4FA 4GEKA 4UEJA 3RTAA 4WVLA 2GETA 2X7JA 3STWA 1WA5A 3HDTA 3GNQA 3JATB 3RHSA 4BNYA 1UPBA 3Q10A 4MVJP 4RXUA 4ZKEA 5B1YA 4C2BA 2XUZA 3ILVA 2PXCA 1U9IC 2WSMA 4HDSB 3DLAA 3M81A 4D99A 4YASA 1AK9A 1SIOA 2Y0BA 1D4ZA 4Z86A 2YFHA 3G8CA 4CM4B 3JD0A 1LWOA 3KB6A 5I9BA 2QTTA 4PCAA 5ARBA 5A04A 5U9CA 3QOFA 3M6AA 4JB8A 3WL3A 3URMA 2P62A 3E3NA 2VYQA 5KYVA 1ZM4A 3DDUA 3QX3A 5GJVC 4B87A 1K2WA 4ZU1X 4ZOLF 1R16A 4B8ZA 2IBSA 2QXYA 2ORVA 3PVSA 1EJ6A 1P2SA 3ODGA 1JHPA 4YP5A 5A2QA 3JQQA 5AESA 3SC3A 2PT9A 4F4FA 3PXBA 3BGIA 5TT1A 3RUHA 1U2SA 1MBZA 4EPVA 5SZHB 1ULBA 1E7YA 2FG7C 4TMWA 3AF2A 2W6PA 5ADUS 4O4LB 3A1WA 2HA0A 2VUIB 3W2FA 2V7QD 4LOIA 1X1DA 4KP7A 2CNDA 3AM3A 2O07A 4GHWA 5AQEA 3SSAA 1GR1A 4WBSA 1NMEA 1UZAA 3MMXA 5KTYA 4QU9A 2CJYA 3WL5A 2JH9A 3A4IA 4GD3Q 5LMUB 3VTFA 3EW9A 4QHTA 3PL5A 1KJWA 4FHCA 3M83A 4BRSA 4B7ZA 2P3OA 3H2SA 4EJ2A 3ESDA 5J2TA 1LSOA 3NBZC 4LMBA 2FQYA 1LNQA 1WBJB 2ALJA 1KRWA 4YROA 3BQ9A 1P2GA 2QJRA 4BNVA 4IDNA 1MTZA 3HM9A 3KSRA 3HCOA 4A8JC 1AKEA 1GGJA 4MDHA 1EA7A 2RI6A 3KAPA 4E4YA 2GGSA 1GTRA 1DJPA 1BDJA 2CXRA 3JQAD 1GIAA 3EQZA 1XCBA 3ICOA 2RJOA 3GRKA 5FWDA 5TMEA 2YMLA 1P9LA 3I01A 1HE1C 2Z9BA 4OCZA 4BTVA 1XD2A 3ZU6A 1XJ0A 4JUAA 5T4BA 1J5EB 2FUKA 1A72A 4KWTA 3WDMA 4TM7A 5ALYA 1T8YA 3VH3A 3NTXA 5A5EA 4ZAYA 3I3OA 1TD1A 1E96A 4M0KA 5JXJA 1A7AA 2PYDA 4J03A 3MJEA 3WLRA 4CEIB 1V3QE 4DANA 3IQDB 4L8GA 2CV2A 2J3DA 1IEXA 1FPMA 2CFIA 3IE0A 3W3ZB 1C7ZA 5DFAA 3INNA 5LIRA 1LSSA 1PBNA 3NHJA 2O2CA 1E3JA 1MRNA 1SFRA 2J9YB 4HEJA 1G2OA 1PJAA 3BXHA 1XTQA 2JG3A 1KI7A 5FUVA 1HDGO 1S3SA 5C5IA 3DQPA 2WIKA 1QIDA 3L6BA 3EXFA 4J1TC 5JFOA 1CEEA 1VE5A 2GJAA 3H5NA 4IGFA 3ICWA 3SC4A 5H3LA 1JQ3A 2VF2A 3A3NA 4OX9Y 4KVZA 5AW0A 2ZATA 4LVNA 1XPRA 5LQRA 2H2HA 5A4MS 4GXRA 1KI3A 4Z3OA 1FRZA 3LHKA 1FFSA 1YNSA 4Z7QB 1T9HA 4AXBA 1YUBA 2PL5A 5CT8A 2C95A 2FPUA 2Q7OE 3T3DA 1SVNA 1PW7A 5DGDA 4C0AC 1OZ0A 1YK0A 2EKPA 2XVAA 4IF6A 3SS8A 3L40A 2WQZA 5M2QA 2YWBA 4W8HA 3ULKA 2EG5A 3JALB 3D3KA 3D54D 1OY1A 4G01B 3HWWA 2QVBA 1KI1A 1C4OA 2R6HA 1ZISA 2PLRA 1V11B 1PRYA 1RXUA 3AQ4A 4H17A 5F3DA 4EM6A 4GAEA 4KN5A 2IL1A 4YJ3F 4YY3B 1X6VA 3W7BA 5JWRA 1W0CA 3A27A 1YIDA 4J0QA 4P38A 2HMYB 3FBTA 4ZVSA 2IHVA 4N1AA 1W47A 4MP8A 1G9TA 1VFPA 1Z3CA 1J7KA 1M1UA 1S2MA 3OQVA 3Q98A 1Z18A 4JB0A 4JJEA 4II7A 4REMA 1JJ7A 5J9FA 3TQHA 5AHXA 2CVZA 1LW7A 3ZX4A 1WU8A 2XTNA 3KR0A 1EIWA 3QI7A 2V7QA 3QW2A 2FPRA 1JSRA 1JWAB 3GA5A 3GG9A 4O4IF 2EFEB 2VPPA 4UUOA 3SXJA 3UXMA 3LY7A 4AO6A 1LUAA 4DY6A 1VIVA 1WDLA 2ZBRA 3TJRA 1TYDE 5DM0A 2OP0A 5F12A 3M3HA 4K3UA 3M33A 1Q20A 1PWHA 4C3UA 2WWHA 2RB4A 4MUKA 4OMCA 3U7FB 1GLVA 1ZJ4A 4DAEA 4EJMA 1GKLA 4A8JB 2YBDA 4W5QA 3B2QA 5HZKA 1E3SA 2W70A 4ZZIA 1UC9A 2PUAA 2Z9CA 2Q49A 2R25B 1L8QA 3R3SA 3DV9A 3EFHA 1BW9A 3IP5A 1EJBA 5DP2A 3W06A 1VRWA 4E5PA 4IDFA 5J59A 4JEIA 3NNSA 2CNWD 3T99A 3EVCA 4BBZA 3F7MA 3X44A 1E4EA 1OYVA 3CX3A 3MJRA 5A9SB 4HAOA 1FSPA 2RKOA 3MHTA 1AB5A 3ZQ6A 4OSPA 3IBTA 1NC1A 1NY5A 5CT9A 2C2GA 5LXTF 2CDRA 3OPQA 2AZXA 1IZ9A 1LWNA 3RIGA 6GPBA 4CG2A 1S7CA 2JNWA 4N41A 2OBYA 4DIDA 1QG0A 2QTAA 1FYFA 1NBME 1UEJA 4QGGA 5EJ5A 4ZTBA 3VDRA 3C3DA 1FP7A 4MQLA 2O0LA 3KJHA 4R40A 2ZYRA 4ZO7A 4BNJA 5L45A 4IUDS 4R2HA 2V3VA 3CJQA 4LCJA 1NXPA 1E1KA 5DYNA 1QRDA 2KBEA 2Y9MB 3KWLA 3TYXA 3OIUA 3PITA 1IQUA 1JQBA 1TO6A 5HRAA 4RPKA 3MJ4A 5BN1A 4HDNA 5G0VA 4D9CA 3NDPA 2V6FA 3FWKA 1XD9A 4K6HA 2O8BA 5JDIA 1QCYA 5JH7F 4CM8A 1FYWA 1SUWA 3LGSA 1LSUA 3DKKA 5AHOA 5IFLA 1ISRA 2CY0A 2VBGA 3AO0B 4Q1VA 2YJ4A 5D3MA 1J2YA 2IEBA 2I29A 3LM8A 2XUPA 4WDQA 4EP1A 1MG5A 4BMOB 1C1XA 3CVYA 1JLMA 3KQUA 4GOKA 4KMMA 1EA5A 2AOVA 1AV6A 1XVUA 2G9UA 1UWLA 3RT9A 3PKJA 1HR0B 1MAWA 2WT4A 2EJCA 5KYUA 3GGGA 4BMNA 3IKJA 4YP7A 1SHTX 4O4HA 1M5RA 4TSRA 5ITWA 2PNFA 2QPOA 4LC1A 1EI9A 4OMFG 1E3TA 3F47A 2D62A 1DBRA 4RZXA 1ESNA 4OJNA 3VO1A 4CQJA 5LA6B 4ETWA 2V4UA 2ZAOA 4LGCA 4EA9A 3FMFA 2PRZA 5LYJA 1U7OA 1LCIA 3BWEA 2ASEA 4WZZA 5ENZA 3ZWMA 1SH7A 1ZCBA 2VH5R 4LXQA 4RQUA 4Q47A 2WTNA 1QCCA 4ZRDA 5K6RA 4TLMB 1H6AA 2J9FA 2LCIA 2YWJA 3NWBA 5E1BA 4HYEA 1K92A 4FI3F 1EXMA 4IZOA 4PHCA 2UYOA 4I4NA 1RT9A 3AG5A 3D6NB 1CFZA 4B2LA 3OQOA 3NI2A 1V9CA 3OF3A 2DPLA 2PXAA 2R7LA 4MDEA 1WXFA 2CV1A 3WGIA 2QLNA 2DULA 5HKKA 1LDGA 4DLPA 2QTWB 3E1KA 5AW6A 2J32A 2PH1A 2OO3A 2Q6LA 1DADA 2NZ2A 2VPYA 2XWJI 3C3EA 3GXBA 1V1RB 3M7IA 2YZ7A 1GFSA 2DUNA 1SHZA 3HB5X 3LQFA 1M1ZA 4CQLB 2YJZA 3H9QA 4CTMA 1GGHA 4IR7A 1XTIA 4PX9A 3WHPA 4LFAB 1XP5A 4U7DA 1FK8A 2WMDA 5AKEA 1U7UA 3VOAA 1F0KA 2N1BA 1ID1A 2Q1XA 3VDMA 5FUQA 2COUA 4DSOA 2DPMA 5DH9A 1CQPA 4BBAA 3W2TA 4LOHA 2OQIA 2W2LD 4JGBA 2C2BA 3F6BX 4UCXA 4EYOA 4G8CA 1H2BA 1OFHA 4L5IA 1VJDA 3DVSX 2JCGA 4UNRA 2R8OA 2HK9A 2GN4A 1ATZA 2IZ1A 2F8SA 3X2SA 3FHCB 4MCJA 4HADA 2WAAA 4NENB 1PFQA 3FWZA 4J7CA 3SC2A 3HTXA 2ZROA 5B7PA 4H6XA 4HQOA 1YRYE 2QVGA 3B5JA 3AVYA 1UKEA 4YNBA 4OQNA 2ZTHA 4WCFA 4PBSA 3T0GA 4GXTA 3MWYW 2AB0A 3NASA 4HUTA 1KZ4A 5JQGA 2HF9A 2WILA 1GY8A 1L7PA 1M5TA 4KXNA 5BP7A 1TVMA 1RSZA 3DUFA 2WJZB 1P4JA 3H5TA 4LZNA 5HPYB 1RZRA 1PEKE 3KYDA 4GLLA 2GBLC 4MI9A 4TL6A 2PUBA 1MX9A 4OU5A 1TEZA 4X1OA 1FTYA 4KBGA 1WZCA 2PGDA 2H1IA 3GIWA 5A0VA 3S68A 1EVYA 2WM8A 1GXSA 2OHOA 5DT9A 3WXMA 3G1TA 3ZIDA 3BMOB 2B0JA 2OLEA 3COZA 2GBIA 4PQEA 3MWDB 5AOCA 2AUTA 4TVOA 2RKWA 3GD7A 4TYMA 3SQMA 4ZCMA 1SOMA 2POCA 4XI9A 1HMYA 1PG2A 4PSUA 2AEEA 2BHTA 3QSGA 1QSGA 1DG1G 1VG0B 3LC0A 2XAAA 3MIIA 1APBA 3CY6A 3QYAA 2XZPA 2FZWA 4LNAA 3RVOA 4H1HA 4BLSA 3PCTA 1CLUA 4K6FA 2DVMA 3WLQA 4U63A 3T3IA 1P4RA 3HI4A 2AN1A 1NUPA 1DAFA 3GP5A 4FFBA 4BJ6A 4H77A 4DREA 5JSFA 2CNBA 3JZDA 1RKQA 2HN9A 1EXVA 3NAZA 4U7HA 3MFQA 4URVR 2C96A 4PG8A 5CA0B 1YQDA 4LRXA 3NYWA 3Q85A 1YRQA 3AUKA 3OQBA 3H2ZA 3H5VA 3HXLA 4KTVE 5E9QA 4AO7A 4DJJA 3PXGA 1XDZA 1N36B 4TKUA 5DM2A 1A7KA 2Q9UA 2KQUA 4OXIA 4LE0A 4DN6A 4WQMA 1T8UA 2XNHA 2NGRA 4I1OA 4CMKA 3V6MA 1EKXA 4M60A 1VL0A 1PG5A 2A5FA 1M2OA 1QGAA 1OXKB 2ZPTX 2QLBA 1GN9A 4PLPA 5BQ5A 1OTYA 3DF9A 5AVVA 4ESOA 1JQDA 3EDOA 3HMKA 2J7PD 1HDOA 1XEXB 1F2TB 3A1EA 2HK8A 3LX8A 4EUNA 2AJLI 4EEZA 4NJEA 3SC6A 1GPDG 4PNZA 5IT9A 4OYRA 1GDDA 1RWMA 5KQRA 3Q3JB 2AEJA 2XQJA 5FO1A 2QUHA 1Q50A 4JC5A 1XK6A 2RGNA 1X3SA 1SVLA 2FPXA 4AO8A 4A16A 3WYFA 3RAEC 2O8CB 4MGZR 2CLOB 1N5IA 1JDSA 4UXJA 4K26A 4HGZA 1S0UA 1JSXA 1RRPA 1VGQA 1ZOPA 2PRJA 5JJBA 1GZ3A 4JV5B 3ITEA 4NONA 2CCJA 4GBED 4KRXA 2RD2A 3T3OA 4FONA 1T6YA 4GOMD 2AWOA 4WT7A 5TVGA 2VDUE 3C3CA 4N40A 1E5VA 1G6OA 4KMOA 5DPMA 4UM5A 4AWXA 4Z1MA 2GFIA 1WD5A 2PA0A 4LJ9A 4YH1A 5KYXB 1KEKA 1YQ9A 3KELA 3CIOA 3TF5A 4KKVA 4CZ2A 3N3BC 3OZWA 3OLVA 1OU4A 2Z6AA 1IU9A 4GI1A 3ANXA 4OQLA 3H7AA 4G81A 4WZBA 4GSKA 3W9BA 4D79A 4RJ2A 1T4CB 5DX0A 1FSFA 2QMYA 4I5EA 3SZMA 1NG1A 5ER6A 3R20A 3LC7O 5BSGA 1JFRA 2H1LA 3IVMA 2XB9A 1W76A 4BKRA 2NSLA 1X92A 4JLOA 4XWKA 1K88A 4N8DA 4Q66C 3NJ4A 1H5QA 4RJJA 3I83A 2HHCA 4I3GA 4EW1A 2I91A 3BZUA 4NCKA 4N6NA 1NV8A 1G7TA 7ABPA 1KDPA 1L5ZA 1RI4A 1O96B 1E9CA 1L0BA 3RS8A 5FADA 5JAUA 5K6AA 3ELBA 2FKNA 4IF4A 4QDOA 2BSAA 1FLDA 4QHSA 4HAUA 2IF0A 3GLSA 2ENWA 1IY2A 1TKAA 3E2IA 3K9NA 3MINB 1YDGA 4ETNA 2XMPA 1XLWA 2AIRA 4UE2A 3HNRA 2WU1A 5CG2A 1H1DA 4I6JA 2C83A 3RC7A 1X80B 4GO1A 5ESWA 3S2IA 1UEXC 3U0BA 5ES3A 1ZU5A 3SDSA 121PA 1XZFA 4Q3EA 5FR2A 2QN9A 2VBIA 2YIDA 1CJSA 4UOEA 2VHQA 1HE2A 1RRFA 1RQXA 2AI3A 3M3PA 3ZD8A 5LYJB 2A9KA 3I52A 4DVGA 3R9KA 4HX9A 1VFNA 4QGSA 4HAVA 1QB8A 1OXSC 3U40A 4D9JA 4NAHA 1SK8A 1EM8B 3W05A 3C1TA 2WHYA 4C7MA 1I3MA 2D3TA 1HLFA 4IJKA 1Q0LA 1RFLA 2QF7A 2PZBA 2W2KA 2B37A 5K0LA 1SIUA 1X9GA 2C7GA 3X43A 5FTMA 5I8WA 1DAMA 2X58A 3KFVA 2BZSA 5DHUA 3C5HA 5BQFA 4RTPA 1YRBA 2DCMA 4G37A 4Q9HA 1OI2A 1VSVA 2AQKA 1QFSA 3ROEA 3WRXA 1Z47A 3FMOB 4LWZA 1CZLA 1BG6A 3PEWA 2VDMB 3OQPA 1SHKA 4MI6A 2PX0A 2WYHA 3DT9A 3L18A 3VR4D 1P7ZA 1JAZA 2OB1A 2P6UA 1N0UA 2FWJA 2XB4A 4CR7A 5FTLA 1XMVA 5LZ9A 1ZOIA 2HJHA 2A33A 2ZXEA 4ZU6X 4MXDA 2GXAA 2Y4OA 4WXMA 4XR4A 1XBTA 1DBWA 4W9RA 1DCKA 1V6CA 2VT7A 3DP9A 3IH5A 2ZRIA 1X8XA 3MOGA 4WLNA 3K0CC 1NFQA 1Y5LA 1SA0A 4DDUA 1NATA 2ZE6A 3R0JA 3ZUGA 1XA4A 4KH0A 3U4AA 1T5DX 5L3SB 2FUNB 4MIOA 1WX1A 1EB9A 1M73E 1DWPA 4OIMA 1ZJWA 3NRCA 3QELB 3AHDA 4KRGA 1PZNA 4GR9A 5ENDA 3CNOA 5KSOA 1XUOA 2HT6A 2OGUA 3ZK9A 1TQ6A 1Z83A 5C8ZA 4KE8A 1LLDA 1FE8A 5BRAA 3GU3A 4N9QA 2C0PA 4DJDC 2WINI 4Z1MD 5JQGB 4Q02A 3VR5D 4DEYA 4R1TA 3NS7A 4P22A 1QKKA 3RRBA 1PEYA 4XB1A 1SU8A 3FCAA 1FP4B 2C61A 1TB4A 4IFEA 3R8CA 4I14A 3UHJA 3FSJX 5EUMA 2PX4A 1P9WA 3OPXA 2BZ0A 2IWRA 2XWQA 4BVBA 2KW5A 1PT9A 5U4XA 1MIOB 2OXRA 4DEVA 1XDBA 2GH1A 3RIEA 1UK6A 1T4BA 5FOWA 3IR5A 1JEOA 4ZT2A 2FMFA 3R9IA 3KYJB 4D0GA 5D5PA 3KB2A 1EXDA 4R84A 4G86A 4PZLA 3I0ZA 2F59A 1WB9A 2ZREA 1AKWA 1Z7WA 1BAPA 1RPTA 1RYYA 4KQEA 1QIFA 1LNZA 3DMTC 3OU7A 2QROA 4J9VA 3TW4A 4W7SA 3PKIA 1KVTA 2B1QA 2X8BA 3ZQ4A 3FFAA 2A0YA 4P0QB 1GYPA 3HRKA 4B3DA 1KAHA 8LDHA 2C97A 5F98A 4IO0A 1QJ4A 1W94A 1KRHA 1VG1A 2CFSA 1VL8A 1M0TA 2EKBA 2J7KA 1CRWG 3PC7A 1CQIA 1T2CA 4MWOA 4PX3A 1O6BA 2NTJA 2VDJA 2EQ5A 3ET5A 1JLSA 4GPBA 4PLYA 4CFSA 2QZZA 3VKVA 3FFTA 5FF9A 3SLGA 2VJCA 3SOPA 1Y1LA 2C2ZA 2J7PA 1WHSB 2WSIA 2FVYA 3OY7A 1BZYA 1ZD5A 4IJUA 1NN5A 2WAOA 5AKIA 1CY8A 1R9GA 3GARA 4CJXA 5AJHA 3E03A 1ZVVA 1U7WA 2ECKA 1S2OA 2ZG6A 1RWKA 2DQKA 2X7XA 1UPCA 2G9RA 2Y1KA 1X8LA 1JBEA 2L42A 1JGTA 3BB1A 3F6SA 1G3MA 3M2TA 3JAKB 3PZBA 3BN3A 4LDJA 5REQB 4WFJA 1KDRA 3QY0A 5IH7A 5JS6A 5HS4A 5JHGB 2W0MA 4DJEC 3KE9A 1JB1A 1M2FA 2NV6A 2JIBA 4MX8A 5HDBB 3MD9A 5GZ1A 1NDUA 4P08A 5L4LA 1JZSA 3DHVA 1F7VA 1R8JA 5K3FB 2MSNA 3FYSA 5CTAA 4B6JA 4M9CA 3EPPA 1HZZC 2QTFA 2Z04A 4FMDF 4MAMA 2OAGA 4FZRA 3AW8A 1PTKA 1H6CA 1HO3A 2OSBA 3IELA 4MS1B 4R8LA 5C46F 3TFOA 1SCDA 3E84A 4OJMX 3PNPA 3U4MA 4ZDKA 1PKXA 4Q4AB 4DE5A 3H9UA 3D8TA 1L7MA 1QV7A 4UKDA 5EQDA 4MVWA 4EL5A 3DBRA 1BFDA 3FAKA 3EFBA 5D87A 4IIEA 1J2RA 1PNTA 4EPXA 1GKKA 2H59A 4QTYA 5K7SA 3TK1A 1RADA 2EJTA 1R8YA 1KDZA 3MGKA 2JJ2A 2G40A 2IUUA 4H6WA 2VAMA 3GGDA 3KPYA 3RDPA 3GIDA 4PVCA 3CT4A 3K70D 3K15A 3JXEA 1KI6B 1SKBA 3AJ9A 1WW8A 1RWQA 1FX0A 2OMKA 2JVJA 2W6OA 5IJAA 4YAGA 3A9WA 4F6LA 5BW5A 5ETJA 2AG6A 4YQFA 1YF3A 3A4VA 1G20A 3GUVA 3LYUA 1BXRA 1YU9A 1Q95A 2ZI4A 3O2QB 5HK8A 3RS7A 4B34A 3HBLA 1U90A 5KJEA 4XYBA 1K5GA 4P81A 4RDHA 5AI5A 1U0LA 1G8YA 1L4EA 2JGJA 2Q2WA 3SE0A 1E4YA 3WLTA 5THQA 2VK8A 3D2AA 4KWIA 4R9NA 4TV8A 5FNVA 3WWOA 4BE7B 4Y0AA 2R79A 2H4HA 3W1WA 4R8MA 2I6XA 1J70A 4B6GA 5KVCA 4JCOA 3LZ6A 4XGKA 3RG8A 4YYZA 5BMVF 2R9VA 3IAFA 1XU4A 3UFXB 3BE5A 1P5HA 4EF4A 3IUBA 4YHHB 4YJ2A 1VBMA 3QVOA 3GUUA 3WSTA 4RSGA 1O96A 1EEHA 2G07A 5DF1A 4G0YA 3BWBA 3ZZNA 4L7VA 3ZC3A 4X3OA 5HJ7A 3AINA 4KR9A 1GL7A 4Y7CA 2B8WA 2C7OA 4AICA 3OTIA 4RFSB 3NWPA 3H11B 3R09A 3WFJA 1DRVA 4YALA 4LJSA 4W5RA 3OTQA 4V0SA 5ECDA 4LXIA 4X44A 2BDTA 4NEQA 3ZW9A 3EIXA 1BEEA 1SOWA 3FWNA 2HHJA 4D5GA 4UM7A 4JP8A 4EDFA 4OQMA 1C5KA 1P3JA 4J0EA 3DB1A 2I76A 2PUFA 5FTWA 3LC2O 3R6LA 1XD2B 2P77A 3ROFA 7GPBA 5KO2A 3AY3A 3IV7A 4DG9A 4AG6A 1IHOA 1TA0A 4UAJA 5DGHA 2FEAA 1NSTA 1T2VA 1CHDA 2R87A 3BGVA 1D7OA 3FFXA 3OT1B 4NOKA 4ER5A 1JR2A 1QV6A 1O2DA 2IXFA 4NHOA 1ENOA 1N4DA 1HTBA 2VS1A 3DKIA 3FPJA 1Z28A 1VECA 4OVKA 4CODB 2V7BA 3OQ6A 3G2QA 4IQ8A 3PNLA 1TJYA 3PEFA 1JT2A 4BCCA 3L1VA 4KV7A 4NLLA 4RTQA 3OQ1A 2AKAB 2VDRB 3PXDA 5LMNB 3ZCSA 1VL5A 2CKMA 5U4QA 2DTDA 2YIMA 2I3DA 1G18A 1I5EA 4RJKA 4UTVA 2ZUTA 1YFJA 3CFYA 1N2CA 1SCQA 5EIWA 1XKXA 5DWVA 5JBQA 4I6EA 3QUQA 4ARZA 3TQQA 2IXGA 1RM4A 4J7AA 1M1XB 1R74A 5KU7A 4RMHA 4K2HA 3A70A 3V3TA 3SX4A 1CUYA 3VYRB 4CQMA 5BV1A 3CLTD 2HAEA 3RC1A 1CVIA 4MEAA 4Z53A 2WU8A 3A6PC 2OCKA 1FDUA 2O5RA 3C8ZA 3OTGA 3ETHA 4J3NA 1FS5A 4HEA6 2Q62A 3VR6A 1E2NA 1TADA 3B8HA 2HF7A 1W36C 3QMVA 4QRDA 3AY6A 5IAEA 2FW7A 2HJVA 2LV8A 2VJNA 4H18A 2OE2A 3QKUA 3RJ5A 3DLTA 5LUBA 3RWOA 1HDXA 1T0UA 1LVUA 5KB3A 3KZCA 3HL4A 1JXOA 3TIVA 3MG9A 4A92A 3EJWA 5AW1A 3AL3A 4URFA 1L5HB 1PJZA 2FH5B 4U1RA 3HDVA 1TEVA 3S1AA 3DDOA 4MLCA 3GZ4A 3JAWA 1XDGA 1FXWA 5DO9A 4RULA 4NZ9A 1PEDA 4YMWA 2GTIA 2R00C 4K9LA 1NYLA 4NZPA 4TMXA 2X9QA 4UBLA 4AMBA 5LN1A 1YQWA 4AY5A 1BA2A 2J6CA 4HP8A 3NORA 1L7XA 1U3DA 1WXIA 4D9NA 3QLUC 3BCRA 3S6JA 4FNOA 1F60A 4LZWA 1PK9A 3ANTA 2G71A 1BRTA 3MMZA 3PPWA 1F48A 1YS1X 3M6MD 4IIBA 5DBFA 1UANA 2BONA 5TPZA 5HQ3B 5L9AA 3EN0A 1EK1A 1L4GA 2A1TS 1ZD3A 2P2GA 3GJ7A 4KMSA 1O7JA 4N0DA 4UVGA 1Y1TA 2GS9A 1YL5A 2Q8PA 4XRRA 3ZCTA 2L17A 1TJPB 2QMHA 4Q3DA 4C21A 3SBOA 4NMWA 3M5DA 4C4SA 2XSZD 3SMVA 1Z2DA 1FUUA 1F38A 1WCIB 3AVWA 2HYDA 4LNHA 2ZANA 1T9CA 3EFEA 2WJVA 3SEZA 1YGYA 3OQMA 2QQFA 2HX1A 2R8EA 3OO0A 3TCKA 4QIHA 3NVMB 5LOVF 3GEEA 5DEIA 5BUCA 4G0WA 3IPXA 4LMPA 1XWWA 2P2DA 1OWOA 3WNDA 1GUFA 1EMDA 2YFKA 2ZK7A 3O8OA 2AG8A 1KOGA 1QX4A 2RHHA 1NW4A 4UZSA 3HBNA 5JYEA 3SOZA 3W5CA 1UMKA 3ICVA 2MR5A 1X13A 2GFQA 1G21E 4G0OA 5IDVA 3M6LA 3L0OA 4CCAA 4E7OA 3E4CA 2Z4RA 1YR7A 4NQZA 1F2VA 1OFGA 3DVLA 2VHXA 1UOOA 3VPAA 2UVQA 5BO5A 4RLHA 1YNOA 3T1QA 4I5IA 3CX8A 2Q0QA 2JIZD 2QXTA 1GU0A 2QDXA 2WF5A 3A9CA 3KNZA 4L15A 1TA9A 2PXXA 1UFQA 1GTG1 1UL1X 4QYWA 2M1XA 3QW4B 1A9SA 1P5FA 2H1RA 4NDZA 5F33A 2PJRA 2GRUA 4EJSB 1WUYA 5KSWB 4DCSA 4R2JA 4LF6B 1E2IA 5ICMA 4NXMB 1DC4A 3QLVC 3M89A 1AZSC 3M6FA 1LSJA 1FSGA 1OZAA 2CE7A 2AJTA 2WYUA 4KCGA 3I5UA 2RJNA 4RQTA 3T0IA 3WYCA 4AK9A 4AZ3B 2FSHA 5JCOC 5COAA 1A5AB 2ZT8A 4GR4A 4ZYXA 1H5UA 3C7KA 4JHXA 4MO9A 5SYNA 3USZA 4HSGA 4OUDA 2NSHA 2PY6A 1EPUA 1JDNA 2BRUC 3PDCA 4PG5A 2C58A 1FMTA 3L0BA 1WOYA 2VJMA 3D6VA 2HQOA 4DR7B 2F4NA 4OQDA 2XDQA 2BKAA 3QVGB 5ALVA 3LSTA 2PRKA 4UMFA 1YJBA 2CEAA 1UK8A 1XZ8A 1DJLA 2W90A 2V7WA 4E2FA 4LTMA 4HNAB 4LX8A 4F8EA 1KTVA 2D3WA 5CHEA 5BXQC 1QQ5A 5JWOA 3EIQA 1RJEA 2JFXA 2IKSA 5ILGA 3RYFA 1DEXA 1QBKC 3UGJA 5F9FA 4J0HA 1I51A 1D2MA 3B82A 4LV8B 1U2ZA 1K9SA 1H1LB 3PQ2A 4QBTA 3LT4A 4I4TF 3IVAA 2X40A 4EKDA 2G28A 3BZWA 1Z5NA 2WTEA 4KN8A 4CF5A 4MPDA 3ZXYA 3CZCA 1VA4A 3VR1A 3VAYA 1DX6A 3GLVA 4ED9A 3SHOA 2FK7A 2JFBA 1L3CA 2GYVA 2SHKA 3L43A 4RCZA 4PQFA 2P4UA 1E1QA 4BCBA 5LA6A 1YU6A 1XG5A 4C7OB 3AI3A 3AUSA 4W8GA 1GV1A 1GCGA 1I1HA 3WGQA 2HPHA 1U8UA 2EQAA 4Z4HA 6AT1A 1DFGA 4C0QC 4LBVA 4KQJA 2EWVA 1LF5A 3ID6C 4ZV9A 1NUSA 5B1IA 4FGWA 4UNSA 3TOXA 2FA9A 2RHOA 3RAFC 1QP4A 2EYQA 5TSDA 2M6SA 3PPXA 3QUAA 4YRGA 1CUCA 3EOZA 3GMIA 1JQEA 4ZVOA 1ZK3A 3R0IA 4L2IB 5CPBA 5SY6A 2OV2A 4HNTA 2C5BA 1DAIA 1X74A 4G1MB 4JU9A 4ZXFA 1PT7A 2C8KA 3G7SA 5FB3A 5BSKA 1CP3A 2NG1A 3ZNOA 1U7HA 1CULC 1JHDA 2XB8A 2QOEA 5HTKA 3T1YB 2OG2A 4X3CA 2DR3A 4I4CA 4B2IA 1ZJ5A 2VOEA 3KZXA 3QY9A 4C0XA 4BGDA 3F67A 2CV0A 4IIJB 3OX4A 2VTKA 4RYLA 1AA9A 5JFTA 1VIMA 2XI4A 3W9SA 1X94A 1BMDA 4PSVA 3WL8A 3CXRA 5C31A 3A14A 1OGYA 3K0AB 3IURA 4UHHA 4AJJA 3SVTA 2Q5JA 3PJDA 2BKUA 3G7UA 3SYMA 4B7CA 1U0FA 2C31A 4FT2A 4AYWA 1XMIA 1EUDB 1ZX1A 1NXOA 1RWBA 2CYBA 4M1OA 1J9GA 1OYYA 3AXTA 5KTOA 2HIAA 3PHBE 2VHEA 3AUYA 3FGNA 4WE3A 4EKGA 2WWYA 5DTJA 2P41A 2WFMA 4LE2A 2CXNA 4V1CB 2R7NA 1RWPA 2MHCA 1SUAA 2A9OA 2F1KA 5KOHA 5EPEA 2YV5A 4C0LA 3HABA 4PLCA 4ETIA 1LF0A 2ZI7A 2BCEA 1WB6A 3BH6A 3D7NA 3HA3A 1YE5A 4HH3C 4R8VA 3NKFA 4Y2RA 1BX0A 2P1ZA 1ODSA 4ZT5A 1GEGA 5IXSA 3IPAA 3HLYA 1EP2B 4EARA 5KNBD 4MIYA 1FUEA 3D1VA 5ALDA 3A1UA 3LX5A 3BGWA 1GVNB 3OSUA 3S0JA 4IDBA 3HSYA 2JGEA 2DXIA 5BOSA 1MIHA 1PI3A 3P97A 3CZMA 3DOEA 2O7NA 4JJ7A 4XM2A 1P2FA 1YDWA 3B13B 5AK4A 3SFTA 3GNSA 4NJMA 2HZ7A 4LX0A 3S28A 1A9TA 2HSDA 3COYA 3SS7X 3PR3A 2XT0A 2V45A 1YJ5A 2ZJ6A 4RVOA 2K7ZA 5JIBA 1IPEA 2IA5A 2QW1A 1M6HA 3HKCA 1CY6A 3VZQA 2FCRA 3OLYA 1JHOA 3T61A 1T3ZA 2E1PA 2WPNA 3TLYA 4RVSA 2HADA 5H82A 2DJIA 2CFTA 1Y42X 1RQ7A 1D09A 3E5NA 3F9CA 4HZGA 5TPWB 3TWOA 2WSLA 6LDHA 2TMDA 4ZCPA 1IHYA 4DSUA 3KXKA 4ENSA 1CZRA 3BL6A 3P0IA 4M98A 1AHNA 3KEQA 4HTFA 4EABA 5CVTA 4G8BA 1MAVA 4AKGA 5AKLA 3UK0A 5KREA 3R7LA 1Q2UA 3V1NA 2DM6A 3D6MA 1X7XA 3K71B 3DBRB 5LJLA 4UFPA 2B7BA 3BK2A 4MV1A 3D8HA 4LZJA 3X1MA 1U5BB 4EW6A 3W5DA 1Q83A 2P3LA 2FW6A 4PRLA 1OGIA 3DEAA 2H2AA 4XLZA 1FMJA 2JFPA 3D3WA 3LP5A 4NYJR 1JWBB 4CEJB 1PR4A 4MI1A 4U0KA 4LC9A 3C15C 3C6ZA 2FOIA 2P8JA 3IQHX 4G56A 4W5JA 2GRAA 3I12A 5DMXA 3I5YA 4WIAA 4NMHA 1XQXA 4YAUA 4H16A 5T4EA 5LQDA 4FS8A 4IIUA 4LEIA 4PIMA 1K2VN 2FFAA 1TF7A 1D0SA 1ZBQA 4IXNA 4U9HS 5EE3A 5F2OA 4PNPA 3K73O 3S2SA 1SBYA 3AHJA 5JOQA 2RB5A 5DN9A 1GQSA 1JDVA 1ZFNA 4RGBA 1V39A 3ZR4B 4HWOA 2HA7A 1OXXK 4FGJA 4G85A 1W0JA 3IEIA 5FI5A 5IDYA 2WVJA 1XVVA 2DH6A 3AF0A 4Y2PA 5F1OA 1F4VA 2RH4A 3LPDA 5HUHA 4R8SA 4CL3A 1W0KD 1DKQA 1E1RD 1ARZA 2WM9B 3EB9A 3IUMA 1QE3A 4QQRA 4U7TB 2OCLA 4V3BA 3WJAA 1PV4A 2E18A 4G2NA 5TQ2A 3WMWA 3WLHA 2KPOA 2CZQA 3GEMA 4IOJA 4JJKA 4BV9A 1FJHA 1QONA 1JG1A 1NQVA 2F90A 2LZ0A 2UZIR 1NZFA 2HIGA 1A2KC 2E2WA 2R8BA 3FCXA 4KB5A 4U39A 4HMQA 4LISA 2FW9A 3ABQB 3WP0A 2J5KA 4EGCB 5L6MB 4QBGB 3CNHA 5BUSA 1B26A 3WLJA 2P2CA 4LHZA 3X1JA 3L7YA 3O38A 4D3DA 4JI0B 2Z57A 4OY3A 4EUKA 2TRSB 4HGYA 1KK1A 1DUSA 1NFFA 3N8HA 4UCFA 5CH5A 4AURA 4DZTA 4EJ6A 5JNRA 1V41E 3RTCA 2QIOA 4FC7A 4MR8B 5LD2B 4OB8A 1Z37A 3FPEA 2R6R1 1L2TA 3D31A 2Z6UA 3HEMA 3VPXA 4EGAA 1USIA 2R6GA 2Y4NA 2GJ8A 3H5OA 3ZCXA 3ZWNA 2NVBA 3EDMA 2BH2A 5J5AA 3UUFA 1SWWA 1TLLA 3M0EA 3HG7A 4QELA 4E09A 1NG9A 1YQGA 4FK8A 1SN7A 2XXBA 3E9EA 4PYRA 1ODLA 3U49A 4JBNA 4KWHA 5HF6A 5TF4A 3TD2A 4B3GA 1PR6A 3VKGA 2IEAA 2R6ZA 5K1ZA 5J4YA 1W4LA 4ZAXA 3QG5A 2J45A 1JIKA 3CZ5A 2ESRA 5KTTA 4JYCA 1VYVA 5KX5F 4ZWNA 3PCXA 4EI9A 2FWIA 5IANA 2QUBA 2CSUA 2WF7A 3H65A 1VG9B 4EHFA 2XCLA 3AJRA 2CNLA 3PT5A 3IQZA 3IHTA 4R0NA 3A6LA 4A15A 4ALJA 1LZLA 1Q92A 3CPEA 4BVEA 4Q4HA 4QJIA 4HLQB 4WVFA 4Y1RA 1DTSA 1WP4A 2HKIA 4QA9A 2GXUA 1B1AA 2DTEA 1ENYA 2NAFA 3L5KA 2H1WA 4GLOA 4MUFA 3BA1A 1PFYA 2YFQA 1Q1GA 1EHCA 4LYFA 2DGDA 3VO8A 3MJSA 5HKOA 1DRJA 2OAP1 5A6SB 5DULA 1Z08A 4EFLA 4I36A 2PVSA 3C3JA 2AQIA 5IYZB 1VE3A 1IK6A 2IIBA 4OH1A 3DULA 4PEVA 4GEGA 5JROA 1SWVA 4FMDB 3ECAA 3I9JA 1J4AA 5EWJB 5K3BA 3I9KA 2YZKA 3DO5A 1VLMA 2BHLA 4A91A 4BX3A 4HDRB 3Q7RA 1IBKB 2XITA 3FB1A 1N0WA 2Y05A 3R9XA 2G88A 3W34A 4BKOA 3PL1A 3EMKA 2OK7A 2ZFUA 2VN8A 1SB8A 1PJTA 1GU7A 2WTMA 4BJ1A 3O7WA 3MQ4A 1QFZA 1IN4A 3S5UA 4AJ2A 4CDRA 3AXSA 4REQA 3ZNQA 2GK3A 1ATIA 4ALNA 3RGWS 4RTNA 3A06A 4KQIA 4OA5A 5EERA 1OWPA 4MVYA 4N0QA 5I01A 1SC1A 4H9GA 1UKAA 5ITZA 2XUAA 1TMYA 4LDRA 1Z8DA 2VF7A 1PYOA 4UEKA 4XJXA 4G4IA 3PFWO 3VJMA 1ZJJA 2XQGA 3FWYA 4JLAA 1C41A 2Z4SA 4LOJA 5IUJC 1M2VA 4CM9D 2RHLA 1ABFA 1GG9A 2QRLA 4XDYA 4ZT7A 3H17A 1A8QA 1N2SA 1XZGA 4EPTA 1TLFA 2V4ZA 3SF0A 1N6PA 3OWXA 4G65A 4JQSA 5CLQA 3K0SA 4OQQA 4YHBA 3RC9A 3LCRA 4IMJB 2G4LA 2IHBA 1PL8A 3PQ8A 3ZU4A 4ZIRB 3JQBC 4GMGA 5LQMA 1GPAA 3BB4A 3C1AA 3EGIA 1U5AA 2ISQA 3O8OB 4IH4A 5E3IA 4YV7A 2HWXA 2GEFA 3JVUA 5EJFA 5JCJA 3TM5A 5MGBA 3AUAA 1EVQA 1JL3A 4AS2A 5A4IS 4DLXA 2EZ9A 1AKQA 3PGJA 1Z39A 2CUKA 2BJHA 3M6UA 2VJMB 3KVNA 1XAIA 2Q07A 4IH9A 4ZZ3A 4JWKA 3TOSA 2QV0A 1R4AA 3IAM6 5LQNA 3IIKA 5HGJA 2EIXA 3D1JA 2AF4C 4QDKA 1U9YA 2JZOA 2UUOA 3BRWA 5GOTA 3TRFA 3B3QA 2QRVB 3E7FA 2E4XA 1CUUA 4MVJD 2W6IA 1E2DA 3KYCA 4Q15A 2C2KA 1GL3A 3IQGX 4BRZA 7YASA 3RASA 4W5TA 4RVDA 4P4NA 4CU5A 3MTAA 1I2DA 3FPGA 4M0UA 1SMKA 2QPTA 3L0ZA 4C2AA 4EEKA 4Y8VA 3ZX5A 4KSYA 2QTCA 3H8SA 1P7PA 1PZHA 2ZJBA 3UWMA 3WRWA 3GP8A 1NMXA 1AQIA 1KBOA 2C5FA 1QZUA 2OOSA 4GSYA 1ZUNB 4MJ3A 3KAQA 1WW3A 2YV3A 3A1CA 3GGPA 3MUFA 1N1GA 4MWBA 3U9TA 3KL2A 4AJNA 5BNWA 1NPTO 4CNBA 3OOWA 2W8BA 4RUKA 2E37A 3NTUA 1QIIA 3MCTA 3U3ZA 4KZKA 3DUWA 5UKDA 5JCXA 1FMFA 1VLLA 1YQXA 4QXQA 5DB4A 3RRXA 3OFKA 2YRFA 2MU1A 1HKUA 2YQ5A 4MP6A 3O7MA 1E8NA 1K89A 3I64A 1G9SA 3LT5A 4KVFA 4ASUD 4FHEA 2BL4A 5C9ZA 4PQYA 3THXA 1TJ5A 1K7XB 1XRMA 2Q9CA 1NTOA 3EXHB 4FQ5A 2FP4A 1V5FA 3CLUC 1COWA 3OJEA 5C8DA 4R5HA 4KR2A 3EF0A 1A9PA 1P39A 1BWPA 2WJGA 1IBSA 4DSAA 2O6LA 1MJGA 3ETNA 1LDMA 3NAMA 5L7WA 3IP6A 3SBEA 4B6SA 1HETA 1U7PA 5LUAA 1H1TA 4E2YA 2AT1A 4RCVA 2P3SA 1OH8A 4O6VA 1C4XA 1UMDA 3K0AA 3RT7A 1YULA 3DBVO 1O89A 2WBLC 4GM0A 1YFKA 4OH7A 2VPZA 3TBFA 2IEZA 3GCGA 3PB3A 4HGRA 4CMEA 3LUBA 1V8ZA 1LPOA 5IUNC 4H7DA 2PDAA 1Q0RA 5KTKA 1ISGA 1FBTA 4B8YA 1ACMA 5A03A 4NK4A 2B4KA 3IQWA 4F4UA 5AI6A 1ZW6A 1T8PA 4TYPA 5CBPB 4C2TA 5DCYA 1NR5A 2I1WA 2ZE5A 1ADGA 2AL7A 4E3WA 4NE7A 1JW9B 1WSWA 1GHTA 4O0LA 3RROA 1O1YA 4CCWA 4F12A 3TW8B 4H7EA 1WMFA 2HRBA 1US8B 3CNQS 3GUYA 4DKJA 4DV4B 1L7RA 4YJHA 1G291 3WDKA 3FETA 1TQ2A 1SUFA 4HH1A 1DC5A 3ENKA 1CUIA 5E1MA 3AF5A 2WDPA 4N76A 2X4LA 2PMWB 1K3TA 1SD1A 3KT3A 1U0EA 5DBHX 5D2CA 1H8HD 3B78A 1X77A 1QF7A 1VB5A 2IUEA 3FF4A 3HKBA 4MR8A 4Q0MA 1FU8A 4ZDWA 1U5CA 3P9NA 4OYHA 4X85A 4Z0TA 3TAUA 1B15A 1UBGA 5LKRA 1H0HA 2GPAA 3IP7A 3LY5A 3GLFA 3STYA 1EGQA 1Z3IX 3ADOA 4TPKA 5F4ZA 3VR3D 2C7RA 4KR6A 1G1AA 2NO4A 4XARA 1XI2A 1CX9B 4HJRA 3TD9A 4DQVA 1X38A 4F4CA 3C6KA 4UHKA 4C3VA 1TQHA 1Y3DE 1L7OA 3H18A 1WABA 5K4HA 1AE1A 1J23A 2QUAA 4QOGA 2GVNA 4KREA 3NOXA 3UANA 3GRUA 2Y8EA 3TLJA 1W36D 4IMPA 2PUDA 4D9BA 1IM8A 2HU8A 3AEUA 3R5TA 4TV8B 3KU4A 3R7SA 1KQNA 1I0ZA 3WZLA 1EVKA 1FDRA 2QAIA 4LXHA 2W6ID 3F7NA 5BQOA 2EX4A 3VZRA 3GJ3A 3QX8A 1OYOA 1Z4OA 2EFGA 3FSGD 3K70C 4C2UA 2Y76A 1EFRA 4IDAA 1JHQA 4QYXA 5DI9A 3TSZA 3LWBA 1FFXA 1QIGA 1KR2A 4OHVA 2FFHA 3RRJA 5NULA 3U56A 4AECA 1Z22A 3BD8A 2F9LA 1G3UA 3A2MA 1A5TA 1B1CA 2PV0A 3O4RA 4N3CA 3U0VA 4RK1A 2Q21A 4X20B 4YJFB 2MSDB 5B58C 1WDMA 2GUGA 1ODFA 4OAPA 2CK3D 3D6AA 1N3IA 4NBTA 1QZTA 1ZO8A 3IAM1 1PTJC 3R3JA 4IJVA 4M54A 2FNAA 2YV2A 3DH0A 4OYYA 4QWMA 1A77A 4CG0A 2D5BA 1KOFA 1EP9A 4CMBA 1N6NA 2QTNA 4U2KA 5CLHA 4RLSA 3AUTA 1KK3A 4C06A 2VSXA 4DIEA 4Z1OA 1EB8A 1LPAB 1M72A 4CIWA 1UAYA 2VNKA 3V4OA 4G84A 5THXA 2WKWA 4EG7A 1V8OA 1LI5A 2BEVB 1Z4NA 1E3WA 2JIDA 1YT5A 2PGNA 2X1HA 1UDRA 4K9NA 3FGZA 1FFBA 4B2YA 2QEQA 2YZ2A 2K7FA 4LYYA 4ENQA 1LS6A 1W75A 4PQRA 3GPLA 1BMFA 4BY9E 4K86A 4HMPA 4Z99A 3JR3A 2AHOA 4X6YA 1C9KA 1OH6A 3MT0A 5A0TA 2MIIA 2O06A 4ZVKA 2OBXA 2WHPB 3QLVA 1Q7RA 5D6OA 3VNVA 2IYRA 2VYVD 2HT1A 1M76A 3PDWA 1GUBA 2GJ9A 1XA0A 3PGMA 2QI9C 3PQDA 1Z6ZA 2GESA 5TY0A 4LC0A 1JR6A 1G21B 1MXFA 1ZI9A 2E49A 2QNIA 4K03A 4XFDA 4XJVA 2OV1A 4Y0VA 5I6DA 3M70A 5LBIA 4EO7A 5BN4B 2Q4DA 3JYNA 1EX1A 1GCOA 1BW9B 1WV1A 2I7VA 1XTSA 4TYQA 5DHPA 1ZIOA 3NXKA 4MWDA 5J63A 4MPJA 2B69A 2ZRMA 4M87A 3OPYB 3NTLA 3PX7A 1AQNA 4CMIA 1HLDA 1B93A 4UNNA 4XUCA 1QRRA 2VQSA 2N75A 3M4ZA 4P3OA 1BHJA 1NJSA 2PT5A 1JXMA 2V74B 3N2KB 3ZHRA 1BH6A 1EFVB 5BT9A 4BLVA 4ES6A 4EY3A 2I3BA 4P58A 2L2QA 4FZ5A 4Y2TA 2IQIA 4F84A 1OOEA 2Z9DA 3T8YA 4LQ4A 2XEXA 1ZA1A 4D3FA 1XCMA 3DWFA 3SPXA 1L4FA 1W2WB 2I65A 1H2XA 2VAXA 5E6SB 5I9NA 2QMZA 4FKBA 5DGCA 1AVTA 2GN9A 1EWYA 1V16B 3G2KA 3QP9A 4WOPA 4DV1B 3DE7X 3UAXA 1QDLB 4OHBA 1LX6A 3PUWA 4GRAA 2AG1A 2AFHB 3KQLA 3WGOA 1W4AA 4CFZA 4IIJF 4A2QA 4OHWA 3PUHA 1L7QA 5CB0A 4W1SA 4MRRA 5BYKA 3ENQA 1WAMA 5DNYB 1YI1A 3IDFA 2O7RA 3RB8A 2QW8A 2BFCB 2RBGA 3HRHA 1GL9B 2GK4A 2JLBA 4BNLA 4ZJYA 3U16A 5JXWA 1NC3A 3M5WA 4QAQA 5DI3A 5EVJA 5FV7A 3ZHQA 1TZKA 2GD0A 2ORWA 3ED5A 5H3HA 5ITVA 4ZVQA 4UHBA 3ZDZB 2PLWA 4JI1B 4BLWA 2NW6A 1ZUWA 5JH7B 3WY9A 3GJ5A 3MRTA 4ZDIA 1PNOA 1Y1KE 3D3QA 1JALA 3FYCA 4D74A 4JXXA 4ZXPA 1OBVA 2Q2QA 3FZEA 1EZ1A 3WQQA 2KSQA 3BF7A 3TZHA 1HDCA 4XWAA 4PPGA 3L7OA 3QELA 3Q4GA 3MFYA 4AYTA 3HU5A 4BO7A 4Q7QA 3G0CA 4D81A 2FPWA 2BJWA 2QLTA 3M4NA 3OE7A 1OWMA 4I1SA 4EMSA 3HJFA 3HZZA 1IG3A 3U1TA 2Y3IA 1C30A 1NE7A 3FYUB 1X14A 4G0ZA 4C7BA 2CWWA 2PX3A 5GM2A 5BT8A 5KJFA 1RPAA 1QLHA 4URUR 5KQSA 1MQ8B 1XYVA 1K6JA 2AFIE 1QWSA 2AOTB 4BO4A 1OLXA 4V0QA 5IBRA 2IU0A 4YPFA 1DU4A 4MQEA 1SQSA 2D1YA 4BCDA 1KAMA 3PTLA 3IAAA 3FUVA 1V96A 2CLEB 3I30X 3SJCA 1Z4LA 3QIAA 4ZTUB 4MV6A 4RABA 3WA7A 5CNMA 1W4CA 3EXIA 1QZXA 4PE5B 4IHJF 1B4DA 3PT9A 1LPSA 1FQWA 1M2GA 3IQXA 4HATA 4Q18A 4G09A 2R1VA 5EGSA 2DP4E 1QCDA 4BZWA 3PQCA 3K9BA 2VYVA 5AKXA 1DIBA 1WU7A 3DHNA 4GP6A 1U9IA 3CW8X 5EXSA 2YY6A 5REQA 1NW9B 5COBA 1QGDA 1I6MA 3TEMA 3KTFA 1BU5A 2ARKA 5AXAA 2PBRA 4PAGA 1BE8A 3IDSA 1SBZA 2J07A 4NENA 4CKYA 2OCPA 5HKKD 2QRNA 2VA9A 3K05A 1ZD8A 4L16A 4PXSA 2WR8A 2QP3A 2QTHA 3UK7A 4PC1A 1T6BY 4R05A 1XNHA 5EQJB 3ZXXA 3H2BA 5IVKA 1YFZA 3B6EA 3PQ6A 1K8YB 1IPFA 4WK0B 4X1IA 2RBKA 2NXEA 4N82A 3D8NA 3ZWVA 1A71A 4IXDA 4NPAA 2FN7A 2R1TA 4MV0A 4Q3AA 3U3OA 4KXUA 4F9TA 1TYZA 3DD5A 5LQJA 1I2BA 5HMLA 2CBGA 2H2DA 4OM7A 5E2BA 3RU9A 3UJAA 1C1HA 4EVIA 1XTVA 3WKDA 1ZCJA 2VHZA 2WA2A 3RVMA 1H9BA 4ESHA 5HILA 2DFPA 2IEGA 1L4MA 5F2NA 4AJKA 5K6TA 5T7BA 2BM0A 3FTPA 4QGAA 1WHTA 2PQ6A 4BFCA 3A04A 5I7UA 1VPVA 1FZTA 1XDUA 2DMRA 2H4JA 4FCVA 4D5EA 2Z56A 4Q1BA 5ADHA 2FDXA 2J9XB 4ZIRA 1BDIA 2HF2A 1GQRA 2XNKA 4TWBA 3E7XA 2W43A 4V02A 3SX2A 1DCMA 1IJFA 2YVLA 2C94A 4JYAB 2DHEA 5K3FA 3S7TA 3R40A 3IUEA 4EY6A 1SU7A 1T9KA 3EA5A 4LF9B 3UV6A 1N2OA 1XVAA 4TS3A 3P9RA 2P5SA 5JPDA 1H3EA 1ISHA 1P5ZB 2QM7A 2VF4X 5DCLA 2ZYSA 1IEQA 4JR1A 5A9RA 1GZVA 2Z5FA 4EDHA 2R97A 4IG9A 4BVGA 2DHRA 2WT9A 4KXWA 2VSYA 3WGLA 1BDBA 4AWBA 1A9XB 3BORA 1MGPA 3GRAA 3AC0A 1VMEA 4TXNA 3OJWA 1A9YA 5C8YF 2I2WA 5JAMA 4PSCA 1JG7A 3DNMA 3KKEA 4O3MA 1ID8A 1CUBA 2QMEA 2OG1A 4FLEA 3VR2A 5LQAA 3TNLA 4QG3A 4B6OA 1SQGA 2RBEA 1F8GA 2R4UA 4UVDA 4UUQA 5B7QA 4MCAA 1WVGA 1ADCA 4YUYA 2NU6B 3HP1A 2ODEA 3TRIA 3MVEA 2IVZA 2WD9A 3IEMA 5F5NA 3MYYA 1P6XA 4POOA 4R2MA 4U0JA 5CX1A 3HGMA 2AJDA 1HDZA 3WNVA 4CKEB 1NX9A 2R4TA 4UJ3A 3FCSB 1VC2A 2Q1UA 2YS7A 5E9JA 4YAIA 2F4VB 2XYPA 4KO1S 5BUQA 4D56A 3VPSA 4AUMA 3KKOA 3NBKA 4QWWA 1GT6A 2DUMA 3K5HA 4H7PA 3WGKA 2A1UB 3LYHA 2C7BA 4LI0A 1XTKA 2OA0A 2A9QA 1C0EA 3ZEAA 4DMLA 2EZ8A 5K45A 5LYJF 1XGKA 3L92A 1O8CA 4E22A 4MB2A 3GGJA 4BQOA 3AZOA 1DQZA 1UFOA 1UP6A 2ST1A 3W78A 2HLDD 5CNKA 4NPHA 4DCTA 4DA6A 2VH1A 4MUNA 1NRIA 3AKEA 3I9NA 3T3HA 1Q77A 1T8SA 2G8LA 1GUDA 2XTAA 4FMPA 1NLYA 4C4XA 1GUYA 4IDQA 2VHWA 4HZIA 4N18A 3RU2A 1CUFA 2D1QA 3RVLA 4GYYA 4TKUB 4XCQA 3AWDA 3B89A 1I36A 1A98A 2Z95A 2SKCA 3BMNB 3VAAA 5F2KA 3WBKA 721PA 3E70C 5IXYA 3QQPA 2BFBB 3KDAA 3ZJ4A 3VH4A 4AN1A 3HB4X 4F6RB 3DOIA 1QMPA 1RFGE 1YB6A 4EKYA 1FTSA 3AOEA 4MW2A 2BGIA 4WFIA 5CUQA 2PL3A 2OR3A 4YRBA 2WNIA 2FZ4A 3IMEA 3NBQA 5E1OA 3MCVA 5JBIA 4LJYA 3EIEA 1TGYA 4R1UA 3UKJA 4BYGA 1SUBA 3T0FA 2ZKLA 3W3AA 3IMCA 4IXWA 3V8MA 1K3FA 3CBGA 1JIUA 1GAWA 3JSAA 3MGAA 2UU9B 1E6KA 3H1GA 2B6NA 1Q3KA 3RS3A 2VJQA 5FBVB 2IGBA 1NF3A 2JKVA 5ESDA 3DAFA 1HM5A 3CLVA 2QS9A 3VYVA 1G8AA 1QVZA 4MLPA 4B4VA 4DDHA 2ZXUA 3FNFA 3H4VA 3NRBA 2JIQA 4L5BA 4XFKA 5A6VA 4ZGGA 4K9PA 1ZHFA 3F78A 1H4QA 2DFKB 4F5WA 3TZQA 1NBOA 1MO2A 1XPOA 1OH7A 4G25A 4PC3A 1TKCA 1ZGGA 2V7TA 3QFRA 4HOYA 3WICA 2QAGB 2GZSA 1B0PA 1U8ZA 1SQFA 5F21A 2BGJA 3AJEA 2ODAA 2QX8A 2HDHA 3M34A 2X15A 4PYIA 1RWOA 1I0LA 4QRIA 5IU6A 4OGGA 4W5NA 1RM3A 3IESA 1IHXA 4NNOA 3HDJA 4HDQB 1ZBDA 1Z2CA 3HXTA 1O6GA 1Y1RA 1CY0A 4GE3A 2PKCA 4OHXA 1VZ2A 1DB3A 1PZXA 4WK2B 4EO9A 2F43A 5JADA 3EASA 5TQ2B 1LC3A 4Z7OB 1E4OA 3T5AA 4MRMB 3CV3A 5KWJA 1PR1A 3V1MA 4Q48A 3HKEB 1Y8CA 3LQ1A 3Q7IA 3C8MA 4Y2YA 3V46A 5AP9A 1KYQA 4B33A 3UEOA 3TECE 5GONA 1CETA 1M6WA 2OUKA 4I66A 3UTDA 1EGHA 5B1DA 5I8ZA 4X66B 1TAHA 3E9YA 2BGLA 1FU4A 1U8YA 2FEXA 2GXQA 3KE8A 4QYIB 5A7HA 2RGRA 1M8GA 1OR8A 4RY0A 3N0WA 2V5AA 3CUKA 3WQSB 2VRNA 3IUQA 4J2TA 2A84A 1ND6A 4AS1A 4LSGA 4J91A 4Q19A 3I5XA 2BR5A 2Z2YA 5ERGB 3QVVA 1AMUA 1QK3A 1SC9A 2EGGA 3ICCA 3QEKA 3SFZA 1J0XO 2XWPA 3UA3A 4CUJA 4GWLA 5K3OA 5DGTA 1IATA 1E92A 5BR1A 5EHZA 1NKSA 3F5SA 2V1XA 5TIIA 1O4WA 3ZDRA 3ZE0B 4K9RA 4RELA 4OLAA 2ILTA 3LQ2A 2OB2A 1PSZA 3OA0A 2VNJA 4Y67A 2P0AA 3E9NA 4MGHA 1JYSA 4X1KA 5BMVB 3NFYA 4K6GA 3F1LA 3DE4X 3RKUA 1LVHA 3ZWCA 2VTEA 1I5RA 1JLHA 1QKIA 1SVSA 2XHEA 4JENA 4N54A 2X0FA 2C8VA 3MWEA 2O19A 4DEXA 2OHJA 3T3PB 1L5NA 2XRMA 1ZNWA 3G0OA 1PNVA 1AD2A 1SXJD 1URPA 2XECA 3PQEA 3ZYZA 1V5EA 4F3NA 5CDFA 3ETDA 1YC2A 2Z43A 5ALJA 4YDHB 3VR4A 3W5VA 2ZPAA 3GDOA 4BQQA 3FTNA 1OVGA 3U60B 1P2DA 3C41J 4QRHA 4EKEA 4FSHA 9ABPA 2JK0A 4Q93A 3ZVMA 1YBMA 4ZV7A 3KQPA 3OAAA 4YLGA 5KC8A 1VKOA 5H68A 1A8HA 1L1EA 1JLLB 1UBLS 4R98A 3V8EA 5BQ3A 4R2LA 1KSJA 3DCNA 5AOVA 1P1HA 3FKSA 4JK3A 3R7NA 2OCDA 1SA0B 5ISMA 3GLQA 4EI7A 3F46A 1W4BA 1XVLA 3LXMA 2WEKA 4IIXA 3THWA 3G9XA 4GKJB 4OOFA 4J0FA 5GZ3A 1UBHS 2RHMA 3Q3VA 4NU8X 3W4JA 1H6BA 4BLOA 4H59A 2DOKA 4NV1A 4PBTA 4V38A 5E2IA 4C87A 3BX1A 3EXEB 2Y0EA 4KQFA 4YCBA 5T6MA 1VKHA 1N9GA 1QIJA 2JGRA 4RKFA 3WLEA 5CD1A 4P0PB 3NH9A 4Q7LA 5JQWA 5LVAA 2PS3A 1L5RA 2FEMA 5MHTA 3DS8A 1DEOA 4B3CA 3IKTA 5T3YA 5IBCA 5D3KA 4AG5A 1TTTA 1V95A 4D4IA 2Z0MA 4D2IA 3OD5A 2ZITA 4MJ7A 4FFSA 1B8PA 2NNWB 3BD7A 3NIWA 3OQNA 2G83A 4FE7A 2DKFA 4NYIR 2DU8A 4BUCA 3AIKA 4DZRA 3I37X 1ISJA 4Q1EA 4QGFA 3IL2A 1M2WA 3M1AA 3L4BA 3RYFB 4ZYWA 4R2XA 1SAYA 4S0ZA 4Y2XA 3OA2A 3TQRA 3DC2A 1HEYA 1WS6A 3P8ZA 3CCFA 1NN3A 1OXBB 1SBNE 3OCYA 1YOVA 4J7XA 1QE5A 1Y5MA 3L1JA 3V2GA 4RA9A 5KSPA 3QPBA 5DISB 2AZMA 1EX9A 3LPAA 5FA8A 2AFVA 3FMPB 4QFCA 3VKHA 4F5DA 2XE6A 4E6EA 3LDGA 3N8IA 4GICA 1UWCA 1Z6PA 3PQFA 3V4FA 2ZU0C 3QVTA 2QZ9A 1PR9A 1QHHB 4P3PA 3WLKX 2PGAA 5COQA 1JIXA 3ZIAA 3GJ8A 4P92A 5KKAA 4GLJA 4QU0A 3DPSA 1GKIA 3DZBA 5EFZA 3S2FA 4RIGA 1MJ5A 1W4RA 4R2IA 1A2BA 1P7VA 5FOUA