3H5YA

Norovirus polymerase+primer/template+ctp complex at 6 mm mncl2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
484
structure length
474
Chain Sequence
KGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of 2'-amino-2'-deoxycytidine-5'-triphosphate to norovirus polymerase induces rearrangement of the active site.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
total genus 150
structure length 474
sequence length 484
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3h5yA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3h5yA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h5yA03
3KLEB 4IRCA 1IKVB 2VG6A 5KG6A 2FVPA 5F9NA 3QLHB 3MEDB 2JEIA 3LP0A 2GIQA 1RDRA 3SFGA 1JLCA 4IQXA 4J9OA 3Q8PB 5J2MA 3RBEA 2R8KA 4TY8B 2ZE2B 3CJ2A 4F4YA 2I5JB 2BE2B 3KOAA 1C0TA 2JEJA 3DRPB 3BSOA 5HLFB 2R8GA 3C6UB 4G1QB 2WRMA 1S4FA 4NZ0A 5DQIA 2XC9A 2AX1A 3CWJA 3DMJA 3N6NA 2YKMB 4ECXA 5HBMA 2J6TA 3FFIB 3KLGA 2YNGB 5HROB 2E9ZA 4DG1A 5F8HA 2WONA 1SH0A 2E9RX 1S9EB 4IKAA 2YNHB 3MEEA 1SH3A 4NLRA 5I3UB 3BQ0A 2XI3A 2VG7B 5KFQA 4ED6A 4I7FB 5J2PB 1S1XB 3C6TA 4ED7A 1JLAB 4KFBA 5KFSA 3Q8QB 1JLEB 2IA6A 4Y2AA 3UQSA 4TLRA 5KFOA 3BQ1A 1T03A 1RTDB 2B5JA 1KHWA 2HWIA 4Q8FA 4RW9A 2YNFA 4H54A 3V81B 4WFYA 3KK2B 3JYTA 2FVCA 1TVRB 4ZHRB 1BQMA 5J2NA 2JEGA 4RW8A 4NLGA 2AGQA 4IFYB 4NLXA 3UDLA 3VQSA 1T05A 2OH2A 4M95A 4IG0A 3KHHA 1W25A 3KLIB 4ZVHA 3V6KA 3QZ7A 1KLMA 4ED0A 1RTIA 5C25A 1RT3A 2OPQA 2W9AA 4RNOA 3DDKA 4K4XA 4MK9A 1IKWA 5DGAA 2VG5B 4TXSA 2IAJA 3DI6B 4JV1A 4HKQA 3CDWA 5D3GA 3ICLA 2XWYA 4MK7A 5KG4A 1JLBA 1QUVA 1VRTB 4GC7A 3T19A 1JLQB 2BANB 3FDSA 3CJ4A 4JV0A 5L1KA 2UVRA 5F8JA 4Y3CA 2V9WA 1LW2A 1LWFA 2HWHA 5KT4A 4KSEB 3DOKB 5KFXA 1HYSA 5HP1A 2V4RA 1TL1B 3M8QA 3H4DA 4EYIB 4EBCA 2UUWA 1QE1A 3CVKA 2BRKA 3EPGA 1RT7A 2XGPA 1UWBB 2HNYA 3QIPB 1IKVA 2VG6B 3DLGB 4RNHA 4K4WA 3MEDA 3V6DA 2IJNA 4DL4A 2HMIB 2E9TA 1FK9B 1S48A 2FLPA 3BGRB 5K14A 1T94A 3I5AA 3OL9A 4B3OA 3QIDA 2ZD1B 3KLHA 2JC0A 3DRRA 1RT1B 3M9MB 4J9NA 3ISND 1YVFA 4IRKA 4KV8A 2XCPA 4J9PA 3C6UA 1C1CA 4ZP6A 5DQGA 2D7SA 3DMJB 5EWEA 3FFIA 5KFAA 2RDJA 1S6PA 3NMAA 1C0UB 1FKOB 1RTJB 2WONB 5KFLA 5C24B 2OPSA 3PVXA 1HQEB 2RF2A 1RT2B 3IG1A 3UR0A 1XR5A 3IS9A 4O3OA 4J9SA 1SUQA 4IFVB 4TYAA 3TQ1A 1S1XA 3C6TB 2C2RA 3KK1A 1S0MA 4KHMA 4ZVFA 1D0EA 3IRXA 3HHKA 3TVKA 3H5SA 4O3NA 3I0RA 4LSLA 4HYKA 4ECUA 1IM4A 1T03B 1RTDA 4XO0A 5CYMA 3NAHA 1HARA 1S1WA 3PR5B 1R0AA 2DPJA 1TL3A 2BQUA 5KFMA 4ZHRA 3GV7B 1BQMB 5FDLA 5J2NB 3M9NB 1TV6B 2WHOA 3CIZA 4J9KA 1IKYA 4O4RA 3BSNA 2OPPA 5KFTA 1HNVA 2GIRA 3PJXA 4ZPAA 4ID5B 1HNIA 4IG0B 3KLIA 5T14A 4EBEA 4RW4B 3V4IB 2C2EA 1S6QB 2OPQB 4TY9A 3MR3A 5F8IA 4M94A 1S10A 4K4SA 5C42A 1ZTTA 1JKHA 1TKZA 4ECRA 1N5YB 2VG5A 3BREA 4K4TA 3DI6A 2HNDB 4RW6A 2R2UA 3T5KA 4MKBA 2O5DA 1DTTB 1RT4A 5EDWA 4F50A 3CJ5A 3CDEA 5EWFA 4RZRA 4KE5A 4LSNA 4Q44A 3HVTA 4ECYA 2FJVA 3I0SB 3LP2A 4TYBA 4U6PA 5J1EA 5KG5A 2WCXA 3QGIA 5DG9A 4DL5A 3RAXA 1MU2B 2HNZA 4Y2CA 1JX4A 1RTHB 1JIHA 1TL1A 3KMQA 1DLOA 4ZPDA 5F8MA 4KAIA 2FJXA 4EO6A 2UVVA 4KB7A 5F8NA 3DLEA 4TY8A 2IM3A 2ASJA 2WTFA 4PQUB 3DLGA 2F8EX 3KLVA 4DL7A 1C0TB 2RDIA 2YKNB 3DRPA 4IDKB 4MK8A 1MMLA 1FK9A 5KG0A 5HLFA 2HMIA 5DQHA 2FLNA 4IR1A 4WZQA 2AX0A 3T5LA 2ZD1A 3KLHB 2UVWA 4B3OB 5HBMB 3H59A 3NKYA 1RT1A 5F9LA 4O44A 4DG1B 5KFCA 4NLDA 3ITHB 2ZKUA 1RT5B 4QWAA 3MEEB 4KKOB 1HMVA 3BSAA 2FVQA 2FLLA 4NLVA 3IGVA 5KT7A 3KNAA 1JLEA 3CJ3A 2WK4A 5C24A 1BQNA 2OPSB 2V0NA 2C22A 3IG1B 3IS9B 2AWZA 4X2BA 5KFBA 4RW9B 5KFHA 3V81A 1XR6A 1S1VA 5KG7A 3HVWA 5EWGA 3KK1B 3H98A 1NHVA 5KG2A 1XR7A 3NL0A 1N48A 1VRUA 3GQCA 4IH6A 2CJQA 2RKIA 3CJ0A 4NCGB 3PR4A 2I1RA 2IJFA 4QPXA 2QE5A 1J5OA 1S1WB 2R2RA 5F8LA 1R0AB 3KJVB 5FDLB 5KFJA 4FS2A 4PUOB 1HPZA 3MEGB 3CO9A 1HNVB 4TQSA 4F4ZA 4J9MA 1HNIB 4NLPA 5D3GB 1HQUA 1S6QA 3M8PB 3FSIA 3KMSA 4RU9A 1RA7A 4ZPCA 4NRTA 5C42B 2UUTA 4WFZA 5DG8A 4WXOA 4MKAA 1N5YA 1SV5A 4RW6B 2HNDA 1S9GA 4IR9A 1HYSB 3BR9A 5HP1B 1C2PA 3LP1B 5L9XA 4ZMMA 3EZUA 5JUMA 2JLEA 3QYYA 3BSCA 1JLFA 1LW0B 3I0SA 3LP2B 3UPFA 4ECVA 5KFGA 4ED3A 2B6AA 4ZP8A 1MU2A 2HNZB 4H4MA 3LALA 2W8LA 5I42B 3HVAA 1EP4B 2HNYB 3QIPA 3KLFA 4EO8A 3JSMA 4I2QB 4ECTA 3DOLA 2R8HA 1K1QA 2QV6A 4ZVEA 2CKWA 4IRDA 3DLEB 4PQUA 3PW7A 2R8JA 4DL6A 3DM2A 3DYAB 2OPRA 1D1UA 4KV8B 3T5HA 4IDKA 4RNFA 1C1CB 3MR2A 2B43A 1WNEA 2IC3A 3I5CA 3PW0A 1IKXA 1N56A 4IOBA 1S0OA 1RA6A 1C0UA 1RTJA 3H5UA 2AU0A 4XPCA 3QO9B 5KT5A 4MIAA 1HQEA 3MECB 2RF2B 4J9RA 1RT2A 4KKOA 4DL3A 1HMVB 2ATLA 3N6MA 2D3ZA 2AGPA 1RYSA 3OHBA 4O3RA 4NLSA 3V6JA 1BQNB 2R2TA 3RAQA 3D5MA 4KO0A 4YP3A 3H4BA 3MFHA 2W9CB 2ILZA 1NNDA 3HKWA 4JUZA 3MF5A 5CYMB 3BQ2A 1DTQA 1S1VB 4I2PA 2W8KA 3DLKA 3GIJA 1S1TB 1S49A 1ZTWA 2GC8A 4O3QA 4URGA 4TN2A 2OPPB 4O4GA 3TAMA 2RKIB 4NCGA 5KFIA 2BR0A 1RAJA 4Q0BA 1Z4UA 3T1AA 3KHRA 1J5OB 4RW4A 3MR5A 2WOMA 5KG1A 5C5JA 2AQ4A 5DLFA 3FRZA 4IH7A 1JLGB 4K50A 2FJWA 2JEFA 3Q8RB 3MR6A 2W9BA 1JKHB 3RBDA 3N6LA 3LANA 3KHLA 4WYWA 1S9FA 2XGQA 2C28A 3GYNA 2ALZA 1K1SA 1HQUB 2YNIA 4PWDB 3M8PA 4WYLA 4URQU 1DTTA 4Q8EA 4RNMA 1ZETA 4R8UA 4Q45A 3KHGA 1SV5B 3E01B 3I5BA 4IG3B 1C1BB 4NLOA 3NGDA 2AGOA 3GIMA 3OL8A 2R8IA 1S1UA 4ICLB 1RTHA 3Q8SB 3LAKA 3OL6A 3LP1A 4XPEA 4ECWA 4EEYA 4RNNA 2ASLA 1DLOB 3IGNA 1JLFB 1LW0A 3OSPA 4H4MB 1REVA 5I42A 3KLEA 4FBTA 3KLFB 4R5PB 2IM0A 3LP0B 2ILYA 2YKNA 1TQLA 3QGGA 4RW7B 3DOLB 1U09A 3D28A 4H4OB 5CYQB 5L1JA 2IMWP 3H5XA 2VA2A 1JLCB 5J2MB 4QWDA 5J2QA 2FVRA 2ZE2A 3GIKA 3DM2B 3DYAA 2OPRB 3QZ8A 2BE2A 4O44B 3MFIA 4ED1A 2FVSA 3ITHA 1FKPB 4ZP7A 4MFBB 5L1IA 1RT5A 4G1QA 4F4XA 3RB3A 2ASDA 3ISNC 2BRLA 5EUHA 2IC3B 1LWCB 2WB4A 3QGHA 2YKMA 4R0EA 4QWCA 5KFNA 3PW2A 4NLQA 2YNGA 1S0NA 5HROA 5KFZA 1TKTB 3QO9A 5KFEA 1S9EA 2IM2A 1SH2A 2YNHA 4KHRA 1JXLA 4WE1B 3MTKA 3GV5B 1N6QA 2XCAA 2VG7A 4YMEA 4OL8A 4I7FA 5J2PA 4KBIA 2BQ3A 4LQ9A 3E51A 3G86A 1VRUB 3SI8A 4ED2A 2W9CA 3LAMA 4EBDA 3DRSB 3H2LA 4Q43A 3G6VA 3T5JA 2YNFB 1DTQB 4I2PB 3H5YA 4YR0A 3DLKB 3OHAA 2JC1A 4ECQA 4ED8A 4IH5A 5KFKA 3KJVA 1TVRA 3GV8B 1S1TA 5KT6A 4FS1A 4RW8B 5L1LA 4PUOA 1HPZB 3MEGA 1KHVA 4IFYA 3PHEA 4O4GB 3TAMB 5KT2A 2W7OA 4G3IA 4RUCA 1T05B 4NLYA 4J9QA 3EPIA 1QAIA 4K4VA 1KLMB 2WOMB 3NBPB 4NYZA 2EC0A 4URSA 4ECZA 3GILA 2J6UA 1JLGA 1LWEB 1RT6A 4K4YA 4QW9A 3RB0A 4MH8A 4RUAA 5KFRA 3OLBA 1EETB 3KK3B 4F4WA 1S9GB 2YNIB 4PWDA 5KT3A 1VRTA 4NLWA 1JLQA 3CDUA 5KFVA 4R8UB 2C2DA 3E01A 5KFUA 3OSNA 1LW2B 1LWFB 4LQ3A 2B6AB 4WFXA 1TKXB 2W7PA 2VA3A 3OLAA 1EP4A 3DOKA 4ECSA 4DL2A 5KFPA 4O3PA 3QLHA 3RB6A 3JSMB 4I2QA 3GIIA 3SFUA 5JXSA 5F8GA 3NAIA 1REVB 2D41A 1RT7B 3G6YA 1UWBA 2I5JA 4R5PA 3IN5A 5KFYA 1NHUA 3V6DB 1N4LA 4RW7A 4WXWA 3BJYA 4H4OA 5CYQA 3BGRA 5K14B 5J2QB 4FBUA 1IKXB 3DRRB 5KG3A 4YR3A 3KLGB 1TP7A 1FKPA 4MFBA 2R2SA 4QWEA 4ZPBA 3MECA 3M9OB 1CSJA 1LWCA 3FQLA 4ZVGA 4J9LA 5I3UA 5DG7A 3PZPA 1JLAA 4KFBB 5KFWA 1S6PB 2IM1A 1FKOA 1TKTA 4QW8A 3PW5A 4KO0B 4WE1A 2B5JB 1T3NA 1N6QB 1SUQB 4IFVA 1S97A 3RB4A 3KK2A 3JYTB 1I6JA 3IRXB 2D3UA 4TQRA 4NRUA 3OL7A 3I0RB 4LSLB 2UVUA 4DEZA 3FQKA 2V4QA 3DRSA 4QWBA 3G6XA 2IBKA 4Q0BB 1QAJA 5KFFA 4K4UA 1TL3B 4MIBA 4K4ZA 1RTIB 5C25B 1RT3B 2BQRA 1TV6A 4YQWA 1IKYB 3V6HA 1IKWB 1GX5A 2W9BB 5DGBA 4EYHB 4ID5A 2IAJB 2DPIA 3V4IA 5DLGA 4U7CA 3H40A 3NBPA 1JLBB 3PJWA 1RYRA 5KFDA 2BANA 1LWEA 1RT6B 4GC6A 1TKZB 3KK3A 4NLTA 1EETA 1GX6A 4IG3A 1C1BA 4ZP9A 2XI2A 4JV2A 1S1UB 1OS5A 1RT4B 4ICLA 4YR2A 4NLUA 2HAIA 3M8QB 4LSNB 3PW4A 3HVTB 4Y34A 1QE1B 2J6SA 4WZMA 5J1EB 1TKXA 4O3SA
chains in the Genus database with same CATH superfamily
1Y3KA 2HRTA 3MM9B 2M0GB 4KGKA 1IKVB 4P6QA 3JS9A 5CZXA 5KG6A 3QLHB 3OUYB 1YJNS 4F04B 1HNWF 2JEIA 2LXUA 2VPZB 4JI0F 3PRBA 4DR1F 3AD8C 2XNRA 3SCIE 3HULA 4DQQA 4BS2A 3SFGA 3W9IA 4J9OA 2R8KA 5D4PA 4F4YA 2AP6A 3A3OB 2PO4A 2BE2B 1C0TA 4U7UK 1R8BA 4B3SF 2B8PA 1UFLA 3C6UB 4FPIA 2CPEA 3CCES 3SV4A 2E7VA 1QAYA 3OR2B 2YKMB 4YB7A 1ZAWA 2VOOA 2BJDA 2DGSA 2RMLA 1CJUB 5F8HA 2Z2YB 5D15A 2KZZA 3ILLA 2HS0A 4LJMA 2VFRA 4P2MA 4RR5A 1UJ4A 1KONA 1VDHA 4UOGA 1U1QA 1VC5A 2A3JA 1FWPA 3KJNB 4ED6A 4ED7A 1T9TA 1JLAB 3TAPA 4LFCF 4A8XA 3Q8QB 1E6VA 2L9NA 4Y2AA 1YBTA 2UXBF 4OJ3A 2JXHA 1GMWD 4A46A 4F3OA 3QJJA 1FD2A 3N01A 5HJXA 2GIFA 4DHVA 2Y0SD 4M8LA 4NZ6A 4ZLJA 4X4OA 2YNFA 4KGVB 3W2VB 1UVNA 3DXBA 5IC4B 5JVGQ 2YWEA 4CP5A 1TVRB 2NPIA 2MQNA 2VKRA 2R3VA 3BV8A 3PM9A 4I0WA 4LRFA 4NYOA 5E3QA 1TUWA 4ZPWR 1RWNB 1S4EA 2AGQA 1HBMB 1HHTP 2CAJA 1HI8A 5ETQA 3PRVA 4M5GA 1QTMA 2ZVIA 3MAAA 1XMOJ 2APOA 3KLIB 1RADB 4ZVHA 5MLCV 2KJVA 2UUBF 3QZ7A 1KLMA 4HLBA 4M5JA 2OPQA 3R9LA 1U24A 5HO4A 3ZZ0A 3DDKA 4MK9A 4RNOA 1NSPA 1FJ7A 2AYGA 5DGAA 2A18A 2VG5B 1UUJA 4UW2A 1XMBA 3POTA 4DR3J 4JV1A 4HKQA 5D3GA 3G9CA 4WK3A 1PILA 2NCKL 2ZH1A 4AL6A 3BO4A 5IT4A 2HQGA 1VRTB 4DUYJ 2BANB 5IV4A 3FDSA 3CJ4A 3WHIA 2QA1A 5HL7Q 2N3OA 4PYDA 4OI2A 1RUSA 1T11A 2MKYA 1QTGA 4XTTA 5DJBA 4C0BA 4DR4F 1SKUB 3WC0A 2A2BA 2V8VA 4KSEB 1HD1A 1VK3A 2VBYA 5BYRA 5KFXA 1HYSA 5HP1A 4P71A 3M6WA 1WF1A 1R89A 3MHYA 3BPSP 4PABA 1IUJA 4C6AA 4I67A 2CQ1A 1BLUA 1N34J 4DPXA 3PEJA 2EFQA 3AOAA 1V3RA 3CVKA 4LFAF 2AW0A 5FIIA 3UNYA 1EX8A 1O8BA 1UWBB 3QIPB 2QLJB 5E3RA 3ILIA 4RNHA 3SQGA 5DDPC 3FSXA 1JK9B 3MEDA 3VGVA 4CNYA 4DU8A 5A8RB 2B56A 1FNXH 4LF6F 4FF4A 2E9TA 1FK9B 1EARA 4RBUA 1RB0A 1A0OB 1BHNA 2HSEB 2M2BA 1PYSB 2FQQB 3I5AA 3LW5C 3KLHA 3DDIA 3FNNA 3G71S 2DEIA 2D1CA 1RT1B 3TRGA 4KV8A 2ZUAA 2LDYA 3CCSS 2MY7A 4PXCA 2KJWA 1KR4A 3TARA 5EWEA 2XY7A 1X4GA 3FGVA 1L3SA 4I6YA 2PEBA 3SBMA 1RU2A 4DV2J 2KU7A 3NWRA 2K1RA 4HI1A 3NMAA 1RTJB 4RL1A 3QQCD 5C24B 4CZCA 1X5OA 2OPSA 3G8TA 3PVXA 2QIFA 1VIOA 1HQEB 4OV6A 3WBZA 1D9FA 2WSEC 3IS9A 4I68A 3TQ1A 1PC5A 1PAEX 1Y10A 1S1XA 2C2RA 4WJBA 2M88A 2MTLA 4KHMA 3HSGA 4MAKA 1OYDA 1KQFB 2DJWA 2OD6A 1ZAXA 4LSLA 4O3NA 2RU3A 4HYKA 4ECUA 4JI7F 2X3DA 3E2EA 4XO0A 1EJ7L 5CYMA 4C8KA 4IRCA 3D0HE 3PR5B 1TL3A 3A8IA 4FVCA 1WG5A 4WP9A 2JEFA 2U1AA 3M9NB 2V9KA 3CIZA 2EC2A 3GJTB 2L41A 5KFTA 1Q7LB 3TQEA 2NYIA 1H72C 3EGZA 1X4AA 2DCLA 1CULB 1QSLA 4GKKF 2HRYA 4PWWA 2C2EA 2DBBA 2VKZG 3R2DJ 1X8DA 4C11A 3HVRA 4M94A 1E6YB 4ECRA 1SC3B 3BREA 4TVAB 3CC7S 2DR7A 2R2UA 1NK4A 1M5SA 2GQ2A 4MKYA 1Y5IB 4DR5J 4MKBA 2O5DA 1RAGB 4HT5A 1OSDA 2ATCB 2RT3A 5EWFA 4RZRA 4KE5A 4DPUA 3MPDA 4Q44A 3H8YA 2CJXB 4ATNA 3NMRA 3SSSA 5KG5A 1IBMF 3RAXA 1JWWA 1MU2B 1FJCA 1FESA 5JMNA 5T7LB 3T1YJ 1N54B 3BPDA 4U95A 1KS2A 2CQGA 5GAHI 1TMJA 2CYYA 3HI9A 4EO6A 2UVVA 1VQ6S 2EG2A 5F8NA 2J9DE 4TY8A 4WIQA 1UVIA 3ISZA 4PQUB 1TK5A 4LSZB 3KLVA 3CEDA 1FERA 3DRPA 4PWUA 5KG0A 4C3MA 1MMLA 5HLFA 4J5OA 3KDNA 2KG1A 2HMIA 4AL7A 2WVBA 1O5JA 4C0OC 4WZQA 1FRLA 1SC6A 2KDOA 4W98A 5GMEA 3RBZA 1KTVA 2Y1IA 4F8RA 3K7RA 3H59A 4FZVA 3NKYA 4F25A 3J7AN 4DG1B 5KFCA 1ZYQA 2VFSA 4EZ6A 3A8EA 4ZIVA 3GE9A 4NMXA 2DRBA 3O8WA 4QWAA 2Z2MA 4RBVA 3BSAA 1Q8BA 1YIJS 1N32F 4DV3F 4B9VA 4ERDA 3AX5A 1IR0A 3C46A 4L3KA 3ENQA 1NSKL 4P2SA 3VAGA 2YPZA 1LXNA 4B3TJ 3AA9A 3OJSA 2MLYA 2KI2A 4D3GA 1U1OA 3BF4A 1XR6A 3AX2A 1RWVB 2VDIA 3AB2B 3IXQA 3HHNB 2YX1A 1U47A 1VOMA 3LTOA 3J7YU 3NL0A 2HEKA 3CJKB 2QN6B 4QBUA 1ZA1B 4RBTA 1X9SA 1UJ5A 2CDQA 5A8WA 1J5OA 2R2RA 1R0AB 5J1NA 3KJVB 1NK7A 1RHQB 2R4FA 3KWMA 4A8KA 5FDLB 2W2PP 2OTLS 3OVBA 4PUOB 4LF4F 5C2GA 1YJWS 3CO9A 1F60B 1H74A 2C2KB 2G9OA 1HNVB 3EGNA 4FXWA 1U2RA 2EI5A 2RRBA 4NOHA 5AE2A 1M0SA 4NLPA 1FDBA 1KLNA 4DPTA 4C9DA 3O6QA 4ME7E 1U1PA 3FSIA 5KOWA 1VGYA 3NS6A 1VMBA 4WFZA 1RLCL 1H2TZ 3MPVA 4MKAA 3RYLA 2H54B 4C97A 5L39A 1SV5A 3M8ZA 3J7ZT 4LF5J 3A4TA 4CLPA 5U47A 3VAKA 1AXQA 3TR5A 4QR1A 2CXEA 1Y7PA 1TMMA 2DEJA 2G0JA 3W62A 3CCVS 1X7VA 2CNOB 3LP1B 5L9XA 5HP1B 3IFEA 1X5SA 3QYYA 3HMJG 5EX3A 1VQ8S 1JXEA 4L74A 3FEZA 5LSOA 4UOFA 2NQPA 2VJUA 3FKBA 2BV3A 3CT9A 3SCJE 4B9UA 5I42B 1D8ZA 1OY6A 1HHQA 2HNYB 2NUUG 5A0YA 3W65A 3ZZZA 2VU5A 2GJIA 5A2QY 2NR0A 4UZCA 5C2CA 1TU0B 3H90A 1RKJA 1R8HA 5GVQA 2JSXA 5DM6Q 2CKWA 3MTJA 4DV4F 5E3AA 4IRDA 2HHTA 3W60A 3PW7A 1K9MT 2R8JA 4JI5F 4X4VA 3DYAB 4YY3F 2OPRA 4OYMA 1B4SA 4IDKA 5J1PA 3K5LA 1MNEA 2B43A 1OHNA 2IC3A 4OI4A 4YFUA 2ZH7A 2MZQA 4C0HA 1W26A 4CYUA 2MB0B 2K1RB 4UF4A 3H5UA 3IBWA 2DVIA 2LMIA 4XPCA 1FX2A 1H3DA 5KT5A 4UT4A 1HQEA 3CUNA 2C3UA 4MIWA 4J9RA 3TJ8A 5DZ7A 4DL3A 1NB7A 1HMVB 3BDPA 3RR7A 2KZMA 1T9UA 1NPKA 1CJTA 2AGPA 2CZVC 2BJEA 4J9VA 4YUDA 2ASYA 2DGUA 4ED4A 4MKVA 4NLSA 3BKTA 3MM5A 4OLOA 2DY9A 3M8RA 2R2TA 4M5KA 3Q22A 1CQNA 1FRHA 3D5MA 4KO0A 2ZBCA 4ZPVR 3RAQA 1PKUA 3OTEA 1NNDA 4P7VA 1FDNA 4FYXB 3T1HJ 1DTQA 4I2PA 2W8KA 2P9CA 2YWGA 5IC6B 3CPWR 4K8RA 1N33J 2P9GA 2HHXA 4TN2A 4B9LA 4N47A 4DN9A 2RKIB 1RAJA 1V3SA 2CVIA 5CZVA 2Q79A 3KHRA 2VJVA 2ZNZA 1J2VA 4CLWA 5D4NA 3MR5A 1X5PA 2GHWA 3TX8A 1U26A 5DLFA 2ZJRQ 1JLGB 2MXYA 2FJWA 3NXZA 1WUUA 3ADAC 4K59A 3N6LA 2LQJA 3ENVA 4PAAA 1ZH5A 2NSBA 2PC6A 3B4DA 2P6TA 4USJC 4X65J 1P9QC 3J80Y 4URQU 3AY0A 3CDAA 4DR7F 4LFBJ 2VD3A 2HFUA 3M6VA 5D8HB 1W7WA 2OO4A 4NA2A 2UXDJ 1F2HA 2BEFA 2HKEA 2V34A 1NHKL 2QL5B 1VQ4S 3I82A 1SBRA 3RZAA 1PC4A 2KXFA 2CJKA 3K0JA 2MKCA 1SL0A 1RTHA 4YB1P 3LAKA 5E3PA 2XYHB 2ASLA 2F4FA 3IGNA 2JH3A 2IRYA 1SJ4P 1JLFB 1BWEA 4USWA 4PPDA 2HVEA 4H4MB 2RS2A 2CPIA 1X4EA 2Z58B 1QVGR 2BMBA 5LMUF 4ZLLA 2MQLA 1Y00A 3KLFB 3PDNA 3UR3C 1U25A 2BJ9A 3H20A 2RDDA 4KPCA 4AFFA 4JV5F 3DOLB 1U09A 5CYQB 3HJVA 3H5XA 2A6MA 4I6WA 3L09A 2FVRA 3OTDA 2ZE2A 3MUVP 2HS4A 2BE2A 2V8GA 1PARA 3SQOP 3RB3A 1FRJA 1V9OA 3GG0A 4DCPB 2J9EA 5EUHA 2EFNA 3LWMA 2OMLA 4DV5J 1P1TA 2YKMA 4DR5F 3SSQA 4IQMA 4PXDA 4A4JA 5KFNA 3PYDA 1S0NA 1N5QA 2YNGA 3KNGA 3IWNC 5KFZA 3QO9A 4DR1J 1HQ2A 4JI0J 4NXNF 1T8EA 4KHRA 4DX6A 1F3VA 2HHQA 4WE1B 1U48A 2XCAA 1D8YA 4YMEA 2V68A 5LM7E 4E2FB 1UEVA 1E6VB 1TTHB 3D1QA 4ELTA 1U1KA 2BQ3A 2RHSB 3IWLA 2RQMA 3G86A 4MYTA 3OV7A 5M2RA 2ZH9A 4DFPA 4ED2A 2W9CA 3ZZPA 4Q43A 4B02A 1Z2LA 2FHJA 4G1IA 1BQXA 1VS3A 2DR5A 5B0FA 1WOSA 2Y1JA 4OHZA 3GV8B 1FNMA 1S1TA 2YWWA 2V2ZA 4PUOA 3MEGA 4FKYA 1F6TA 1YJVA 2CQ4A 3PHEA 4IFYA 2A2DA 4UTGA 2QMUB 4DS5A 2O1PA 3MAAB 3ET6B 2AJ1A 3IR7B 2O3DA 1QAIA 4LF6J 1KLMB 2WOMB 3QGPA 4DR2F 3JSBA 4NYZA 2C42A 3NBPB 4URSA 3GILA 2VPWB 1U0HA 2YBVA 4DPYA 1NAQA 2E5JA 4F0HA 4N56A 5KFRA 1UWAA 3OLBA 5K8PA 4F4WA 3B54A 1RWOB 1VQ7S 2PFFB 4LF1A 4PWDA 1VRTA 4HT7A 2MZSA 4DQPA 1VLOA 1JNRB 1ELOA 5KFVA 4GKJJ 4DS4A 3CJSA 3NP5A 1OIAA 1UVJA 5MAOA 2VUGA 2JXIA 3L7OA 2V4JB 4HDHA 4RLEA 1BXNA 2GVDA 2ZVSA 3BS9A 5KFUA 2V2VA 4WFXA 4PKDB 3OLAA 3DOKA 1BMQB 3L7PA 2FPHX 4ZHRB 4DL2A 3B82A 3HHDA 3OUYA 3W1YC 3JSMB 3SFUA 3TANA 2YKPA 4CLKA 2CQHA 2DNZA 5HJYA 1EKRA 5F8GA 2CQ3A 4UOCA 2IYIA 3EVWA 3OBIA 2XY6A 4FYYB 1UWBA 1YJ7A 2J9DA 3TI0A 1JNZB 3SDEB 2EWHA 1NHUA 1DY3A 1R8PA 2CDRB 4MTPA 4H4OA 1SQFA 3M6UA 3QATA 3TP2A 2BJ8A 5J2QB 4P75A 4AQYJ 5ETMA 5HN0A 2XTDA 4B3RJ 2N3LA 2DNYA 2KFZA 3VVUA 4G6VB 3O2IA 1TP7A 4HV0A 1WHWA 2FJBB 2Z2LA 3ENWA 4MFBA 1B0TA 2DT9A 4ZVGA 3V5RA 5BJRA 4QIWD 4J9LA 5I3UA 2DCUB 2HQFA 4FF1A 2FC9A 2LU1A 1F9FA 1S6PB 2GZOA 5KFWA 2IM1A 1FJEB 1R0CB 2CQ0A 3JAMY 2BOPA 2R7QA 4KO0B 1N6QB 1SUQB 4IFVA 3UVJA 4W90B 1P9YA 3NGUA 4CO1A 2OFGX 3JYTB 1B7YB 1LV5A 1I6JA 3JSRA 4FYWB 2OHDA 4G65A 2XM3A 1OO0B 1GEHA 2HGNA 4HHJA 2KFYA 1IBMJ 1HBOB 2UV8A 3DRSA 3PFOA 3ZTSA 3G6XA 2IBKA 5KFFA 1TL3B 2J8AA 2JX2A 3JTOA 2ZJPQ 4K4ZA 2H4WB 2MQ8A 2F1FA 2K3KA 2BQRA 4BDPA 5IQ6A 2QC3A 5ETSA 1I94J 2W9BB 2CPDA 3NOCA 1SL2A 5E33A 3UCZP 2IAJB 3TW0A 3POTB 3ZZYA 4Q2LA 3QFWA 3K58A 2QEXS 1LK7A 2ZM6F 1S0VA 4A8FA 3PJWA 3PKYA 2OJ3A 1CS4A 3NEKA 4GC6A 1FHTA 4WCEQ 2EBEA 4Y65A 1HA1A 4K7QA 1KNZA 2WSFC 1GX6A 2AKWB 3DN9A 2E1CA 3UNGC 2CJAA 4JV2A 1P8GA 3MMBB 3G6VA 1S1UB 1OS5A 4GVLA 2DHGA 2HW3A 4L76A 3GFHA 4Z2XA 4LSNB 1XQIA 3HVTB 4KHPJ 2GO9A 1A7GE 3KUGA 4Y34A 3TO8A 3U7JA 4ALZA 2MHEA 3UW1A 1AFJA 1HWJA 2Q66A 2C3OA 4ZVPB 1YITS 4K0KF 2ZKTA 1Q1KA 4Y2MA 3SQGB 2FVPA 1OMSA 2K2PA 4LREA 3TZXA 1M5HA 3M30A 2KN4A 3C3LA 1AW0A 4IQXA 1G7CB 3Q8PB 3RBEA 2IY5B 2PEHA 4TY8B 2ZE2B 2K7KA 1M1HA 3VHQA 4CWBA 5C7PA 2X1AA 2KG0A 3DRPB 5HLFB 1Q4RA 3A8KA 3C14A 3W2WA 5AE1A 1NKCA 1FDDA 2J6TA 4ECXA 3N6NA 4RX6A 3AQPA 2ZBRA 4LT6A 5HBMA 2Q6BA 3VWSA 2DYAA 2WZ1A 2YNGB 4AUKA 1VQYA 2E9ZA 4DG1A 3OFFA 4DX7A 3UD5A 2BKNA 4JI2F 3FEYB 1WWHA 2N82B 4ILLA 2AF6A 3IM9A 1HLWA 3MM8A 4FNHA 2FUG9 2QRRA 2DXFA 1Q53A 3C6TA 3WIUA 1V3ZA 4OX7A 5KFSA 2IA6A 1HWKA 2B0GA 4RO0A 3UQSA 2LEPA 2JWNA 4WWSA 1FEHA 2FY1A 2ZNYA 1T03A 1FVQA 2B5JA 4CT9A 2B4VA 1RTDB 4Q8FA 2FLOA 4H54A 4ES2A 4WFYA 2C2MB 3V81B 2UUBJ 3KK2B 2XTEA 2FVCA 4DPOA 3P6YC 2E7WA 3OFEA 3KJFB 3I6PA 5J2NA 1T0TV 3RRKA 2RILA 3GXQA 1FE4A 2PDAA 2R7WA 4IFYB 1REGX 2LA6A 1GQEA 2P6SA 2XHWA 1UMJA 3GIRA 4M95A 3CC2S 4C8NA 3MMCB 4BCAA 3KHHA 4DR6F 2UXCJ 2E44A 2VFVA 3N79A 5C25A 1RT3A 7AT1B 3MM6B 3BYPA 9RUBA 4EWTA 1MWYA 1WI8A 2K8GA 3A13A 2M70A 5ETOA 3X1LB 3DI6B 4P72A 4DV1F 3BGFA 3ICLA 2J7KA 1JB0C 2XWYA 3DU5A 4MK7A 1JLBA 1QUVA 1TK0A 2DGQA 4HEA9 4X64J 1JLQB 1EIYB 3ZTOA 4NXMJ 2O66A 2HQDA 2OEJA 2G13A 2XO7A 4Y3CA 4OHWA 3NG8A 6AT1B 2V9WA 2HWHA 3OT9A 1TR0A 2FZKB 2QMXA 5DRKA 2LDIA 3JQMA 1WTFA 3AODA 2F8HA 3DOKB 5GMDA 2HBYB 4F7VA 4C8LA 2G2ZA 1JXVA 5T7LA 5KT4A 1WKKA 2E5IA 3FEXB 2XMMA 4JI1F 2UUWA 2BSQE 1FDAA 2EBGA 1YDLA 5KOXA 3QAEA 3H87C 4IO1A 2VICA 1SJFA 1SQEA 2AHOB 4DV6F 5CCMA 3R7NB 1RT7A 1GTEA 3EPGA 1Q8LA 2HNYA 2V8DA 3GJQB 1R31A 1URRA 5D4LA 1B3TA 4K4WA 4LMZA 4C4WA 4OYWA 2DNOA 3EVOA 3M2RB 2HMIB 1GK8A 2GQCA 2PFDA 2D69A 2DNRA 3M7VA 5K14A 2FLPA 1HR0J 4B3OA 3QIDA 2ZD1B 4ZCIA 2XZDB 3LO3A 2FLNA 4J9NA 1GMVA 2MQMA 1H98A 3ISND 4IRKA 1UAWA 2XCPA 5DDOC 1YQHA 4HH1A 4DSFA 1C1CA 2W4CA 2LQ9A 1I51B 4U9RA 5DQGA 1HI1A 1RHRB 3FFIA 5KFAA 1J5EJ 1FRMA 3RW6A 1S6PA 3FZ2A 2YTCA 2WONB 2FHKA 3T9NA 2EFVA 2HS3A 3W7BA 3VVTA 5F3ZA 4J9SA 1SUQA 4IFVB 1DQ8A 4O23A 2J5AA 1KVKA 3UVJB 2CPFA 4DX8H 1VIXA 4ZVFA 5K8NA 4FDFA 3H5SA 2BKOA 3CJKA 1XJWB 5CXTA 3GSDA 3K5NA 1I5OB 1G6BA 4YDDB 2ZH5A 2K5JA 2ZWOA 3MM7A 1HARA 3N0VA 1S1WA 4HR2A 3UFCX 8ATCB 3K57A 1R0AA 3OXGA 2CZ9A 4H4KA 1WSRA 2ZH6A 1BQMB 3GJSB 1PJ5A 1ZM2A 4J9KA 2PGCA 4O4RA 3MZIA 1OQ3A 1HNVA 4Z7YA 1PJ7A 4ZVTB 4ZPAA 2PMZD 1DBDA 1HNIA 4IG0B 4J9UE 4WFBQ 2ERRA 1Q78A 3NY0A 4EBEA 1WELA 3Q24A 2MZTA 1N5TA 1FWKA 4PG7A 1U1NA 2F65A 2H1YA 2IVMA 5CH7B 1R8CA 2RAQA 4K4SA 4CM0A 2BNWA 1JKHA 3Q23A 1ZTTA 4M5LA 3NNHA 3HHLC 2CAXA 4K4TA 1RWKB 3G5OA 1XERA 2HNDB 3IM8A 3RBXA 5LMNJ 5M2UA 1QY7A 4ZJOA 2DISA 3T5KA 2AYBA 4OFZA 4F50A 2P9EA 5EDWA 4WF9Q 3CJ5A 3CDEA 4B3TF 4FF2A 2OEMA 3BN7A 4LSNA 4M5IA 3FMWA 3HVTA 4LUBA 2W4DA 4ECYA 1LKZA 3LP2A 1ZPVA 2WCXA 2DH7A 4B3MJ 4DL5A 2HWTA 1BAZA 5CA5A 3AD7C 4EFAC 4E0DA 3CCRS 1RTHB 2F4VF 1JIHA 3VCDA 3D7SB 3OFHA 3KMQA 3M8SA 2M7SA 3R1HA 4KAIA 1D09B 2BA9A 3HDSA 5F0WA 3GCWP 4X4SA 3M30B 2HRUA 3TX0A 9ATCB 1FF2A 3NCRA 2GMHA 3T6BA 3DLGA 2ZITA 2F8EX 1FI4A 4BLGA 4OX6A 2Q6CA 4OZLA 4MK8A 4ZVUB 1VBKA 1VQLS 2ZFHA 3W66A 2ZJQQ 2AX0A 3BGOP 2WBRA 2W01A 3AOBA 4NPOA 4P2XA 1SC4B 5HBMB 1UVKA 4KYZA 3J80U 1TL7A 5GMKa 3UDEA 5SZTA 4OJHA 5HVFA 2DGVA 2CPHA 3ITHB 3CW2C 4ZVQB 4ZLPA 1T3OA 3G82B 3NNAA 4CLSA 2DH8A 3VAHA 2WW8A 4C8ZA 1HMVA 2P2CB 4PR6A 3IGVA 5KT7A 1S59A 3KNAA 5K5MA 2VQFJ 3UD3P 4CQ1A 3CJ3A 4DFMA 4WIIA 4CH1A 3R5CA 1JJ2R 2VASA 2V0NA 2C22A 4KIAA 1LQ9A 3MOJB 5KFBA 4WPAA 4WFNQ 3V81A 3HVWA 5IWAF 3CCUS 2FB0A 4NI2B 2N7CA 1FX4A 5KG2A 1XR7A 2RH3A 1N48A 2CPJA 1W2BR 2JVRA 5IQQA 2L08A 2F5GA 3CJ0A 2GVZB 4NCGB 3PR4A 3D66A 1LFPA 3VW4A 4QPXA 2IJFA 1S77D 2F4VJ 1M5KC 4W4MA 2PA8D 2VZ9A 5IT0A 2BW7A 3MM6A 2B3TB 3MEGB 1UFWA 5CABA 3HO1A 4J90A 3DNCA 4NWBA 4TQSA 3O44A 2FGCA 1WC6A 4I56A 4UQGA 2R7RA 4J9MA 4F4ZA 1P94A 2BVZA 4LR8A 4LF8J 3W61A 1HQUA 1I3OB 1WD6A 2EW9A 2YPYA 3M8PB 1NH8A 3KMSA 1UVLA 2MKHA 2BJ3A 1UTAA 4NRTA 4OYAA 1AZSA 1VCTA 2GAHC 2KOEA 2DTJA 1N5YA 1TUGB 1CC7A 3Q86A 4HDGA 4IR9A 3N5FA 1WG1A 4C8OA 5AE3A 3W64A 3LH2S 4P73A 2MY8A 3A12A 4XAKA 3A1YG 2JXGA 1NCLA 5IM0B 1XEZA 2JLEA 3NOGA 1MMNA 3BSCA 3I0SA 2UV8G 2KM8C 4ED3A 3UPFA 2GVDB 4A8MP 3P49B 1D9DA 4ZP8A 4U96A 3A3NB 5ETVA 3MCNA 2HHHJ 2KXNB 1XMOF 3HVAA 5HVHA 1LWXA 1XMQF 3U02A 1F9HA 4QR2A 4EO8A 2XLIA 3JSMA 4KR0B 4ECTA 3DOLA 5B0DA 3QSYB 1K1QA 3R5DA 2QV6A 2NLWA 3DLEB 2QL9B 4DL6A 2BBEA 1AA1B 4MJKA 4DQSA 2AT1B 2DGOA 2K3IA 3GJRB 3EUNA 3W5YA 1C1CB 1YSJA 3VEAA 1WNEA 3JTPA 4RNFA 3MR2A 3CD6S 1FRIA 4ZS6A 3JQKA 4IOBA 2JBVA 1RA6A 3C15B 3FSYA 1HWIA 3DLHA 3LGNA 2BJ1A 1C0UA 1S6OA 1OYEA 2XTJP 3QNWB 4MIAA 2RF2B 4DLGA 4KH0B 3TZYA 2HFSA 4KKOA 1MYKA 3BBBA 4YDXA 4ZK7M 2D3ZA 1VI7A 2ATLA 1U1LA 2I2YA 3Q2TC 4WKRA 3CCZA 2WVEA 2V8HA 1UA1A 4O3RA 1KOHA 2M8HA 2LXIA 2RRAA 1BQNB 1KQGB 1U4BA 4YP3A 3TJ9A 3H4BA 2W9CB 1KRPA 4F4KA 3HKWA 4ZOSA 1XNRF 2VB6A 1GFWB 1S1VB 1UW9A 3DLKA 4QPTA 1O51A 1JJ4A 4OHXA 3TWZA 2C3PA 1U8WA 1S1TB 2W2QP 3P3DA 3PFEA 3I56S 1B01A 3LWLA 2HG4A 2X51A 4KHPF 1TL4A 2AYEA 2OPPB 4O4GA 3VTIA 4RUBA 2BR0A 2PSZA 2RSQA 4DV7F 4Q0BA 3CCTA 2JFKA 2R7TA 1M5VC 2OAUA 2YWKA 2MHNA 1TAUA 2WOMA 4CRJA 1TUVA 3QSIA 1AB8A 3FRZA 1AROP 3DGPA 1UEUA 3M4XA 2H1OE 1JKHB 3Q8RB 2W9BA 2ROEA 3LANA 4UY8T 2XGQA 5GAEU 5GAGU 2CQCA 1X0PA 3GYNA 2D3O1 1K1SA 2ALZA 1HBUB 1IWGA 1TFWA 1WOOA 2CPGA 4WYLA 4PWDB 1FJGF 1CS4B 4UY85 4Q45A 4Z7CA 1B0VA 1UPPA 4QOTA 5FLXU 1URNA 3E01B 2V4JA 2AN7A 4ZA1A 4NLOA 4ANEA 2XLJA 1V5IB 1S7HA 1XBWA 3CIMA 2IIHA 2E5GA 2HVZA 3NGRA 3S7RA 1S1UA 2R8IA 1KC8T 4DPWA 3OL6A 4ECWA 4EEYA 4RNNA 4E98A 1DLOB 5L8RC 2HLTA 1RXOB 3D4JA 1LW0A 2HBQB 3CF5Q 5D6GA 2XY5A 2CUYA 3OSPA 3ZZTA 4EGLA 2OSQA 3MWBA 1U49A 1REVA 3KLEA 1QTNB 4HHHA 4OYBA 1HW9A 5HI7A 3O5TB 1MROB 2IA0A 3SDEA 3J7Z5 5H9FK 1RBLA 1KSPA 1H7WA 4H4OB 4JB8B 4F4AA 5L1JA 2M5YA 1N34F 4OYZA 4Y6IA 2RUGA 1JLCB 4DX5A 5J2MB 1OSCA 2XSFA 2XEXA 2ZOMA 3D0GE 3UWTA 2BA3A 3GIKA 4P52A 4CLTA 2XG8A 3WZ0A 1KN6A 3QZ8A 2M8DB 3MFIA 4KH1B 1NDPA 2J8SA 3ITHA 4RU2A 4DV7J 1FKPB 4ZP7A 4GVBB 4MFBB 1RT5A 4CO5A 2ASDA 4OI1A 3ZZRA 1QD1A 2A1BA 3ISNC 4KPYA 4IUFA 4X4UA 2X1GA 3MCMA 1VQOS 3D68A 3HT0A 5DS7A 3SXLA 1GMWA 3PW2A 4RUHA 4N8OA 4A8SA 1C4AA 2HLUA 2LQBA 3QT5A 3HXMA 3MI7X 3F44A 1I94F 4JV5J 4AAIA 3UN3A 1JMTA 1N6QA 4TNOA 3EYZA 4OL8A 4DOZA 4FYVB 3EXYA 4JI5J 1T02A 2ACYA 3Q83A 4KBIA 3CXCR 2GA7A 1X0FA 3FCHA 3WIVA 3HHLD 1M90T 2RHQB 3SI8A 3IAS9 2H4YB 5GAEI 1HBOA 5HMZA 3H2LA 4EBDA 2VFUA 1FD8A 3NS7B 1RHKB 5DDQC 3OHAA 4ECQA 2LKZA 2JC1A 2XWXA 1R27B 5LMUJ 2AV5A 5KT6A 4A47A 2GW8A 4FS1A 2XLKA 3HK2A 1HPZB 1KHVA 5KT2A 3TAMB 4WP3A 7FD1A 4G3IA 1T05B 5LOQA 1SL1A 1OQ6A 2IBOA 2L48A 3PCOB 4P9SA 1EB0A 4PZVA 2XMVA 2BJ7A 4CO4A 2B8QA 3HJFA 4TLQA 2N4DA 3B4MA 4FXDA 2J6UA 4GKJF 2XQCA 2HVDA 2QO3A 3TOQA 1NZ8A 4QW9A 2QA4G 4MH8A 2COLA 2VFTA 3FBCA 5EN1A 3KK3B 1F2GA 1FXDA 5A6PA 2YNIB 4B17A 1K8AT 1N33F 2MZ1A 1JLQA 2C2OB 2EEYA 3J81j 3MXHP 1ITPA 1KP6A 1FXLA 2Y1RI 1RJJA 1LK5A 3OSNA 4U8VA 5IZHA 4LQ3A 2B6AB 1TKXB 1HNXJ 1UKUA 2PMWA 2CNLB 4PPZA 4C7QA 2YXLA 3PHTA 4NL5A 4ECSA 1VBYA 2LP4A 3BM7A 3MD3A 3QLHA 4O3PA 2KHCA 4A48A 5HMWA 3HM9A 1FWLA 4JI6F 2KT2A 3ILOA 1KVJA 1RT7B 3CD7A 1SJQA 2G0IA 4R5PA 4PG4A 2AD9A 4LF9F 3IN5A 1APSA 2DO0A 2HBRB 4WFAQ 4NXMF 4RW7A 5E3CA 4TU8A 3MURP 3BJYA 4QYRA 3T5JA 1CG2A 5K14B 1H73A 2YKOA 2WBMA 1IKXB 4FPRA 1H7XA 4OZNA 4WU3A 2FHOB 3C15A 4UQTA 4X66J 4CLZA 3DGVA 3K5PA 1ARQA 1HBNB 4U8YA 1WKLA 5EHHA 3W9JA 2R7UA 2X1BA 4QWEA 3M9OB 3S1TA 1O0PA 2QLFB 1L3TA 1C4CA 1LWCA 2K6LA 4DV6J 4I1TA 2MDAA 3HZEA 3MEKA 3N9UC 3GR1A 3GWCA 5DG7A 5IWAJ 3HHLA 1JLAA 3PZPA 3DLBA 4LBHA 1B28A 3KKFA 1FKOA 1M1GA 3PYFA 4M1KA 5CCLA 1H2VZ 4NE9C 3UD4P 4CH7A 3VV2B 3NWGA 1T3NA 1HWLA 4LRDA 3U27A 3DLLQ 3NNCA 4DDFA 4CH0S 2BW2A 1YGYA 2CQDA 2VODA 4RJVA 1IRQA 5HATA 4F3QA 5B7WA 4TQRA 4NRUA 2VF3A 1PCAA 2W2NP 3I0RB 2UVUA 2W25A 3FQKA 4DEZA 5DETA 4Q0BB 4P7TA 1RAEB 2PI5A 3FBEA 4Q2MA 3V4MA 4MIBA 2CNNB 3AA8A 3GR0A 3MD1A 3CMQA 4OYOA 2EG1A 1RT3B 2G2YA 2DGTA 3CMAS 3K17A 2Y1LB 2YKQA 3EDQB 4AYBD 2X1FA 1RE1B 1SIWA 3M2VB 2DPIA 3H40A 1KEKA 1JLBB 2KB2A 4EMDA 2CPYA 5LXYA 5KFDA 2BANA 4YOEA 4WKYA 1IQZA 3BR8A 5L9NA 2HGLA 4NLTA 1EETA 5HANA 1C1BA 1S99A 1KFDA 5IFMA 4ZP9A 2V2KA 3BKUA 2YQ3A 4DFKA 4PXBA 1IBCB 3QT8A 5IT9U 3MPYA 2HAIA 4DLEA 2HHVA 3PW4A 2OELA 4TU9A 1RCOB 5ETRA 5CYJA 4ED5A 3I4PA 2DRAA 3OL7A 3W3SA 1RI7A 3KLEB 3RU0A 3J81Y 3MEDB 5A8RA 4YB6A 2IVYA 3AT1B 3JAMU 1XC9A 3DOMA 2R9LA 1JLCA 5J2MA 1XN9A 1SPBP 3R27A 2ADBA 1IBLJ 3CJ2A 3CDBA 2I8EA 5AXNA 3PX0A 3EMTA 3LQVA 3G4SS 2N7YA 3KOAA 2NXCA 3BSOA 3CO0P 1ZM9A 3TYTA 2FTRA 1B70B 3G96A 1DRZA 1YJRA 1S4FA 2B9WA 4DQIA 1MN7A 2CVEA 4MMOA 2AX1A 2LCWA 3CWJA 3G2XA 1MN9A 2XC9A 3KYLA 4DUZF 1RWXB 2ZUGA 2GFFA 3FFIB 4KQZA 3SCKE 1Q16A 4DR4J 4L72B 1Q81T 1SH0A 5LSRA 5B0BA 3QT6A 4IKAA 5G4DA 2J7WA 2F3JA 4NLRA 4HTIA 3BQ0A 2VG7B 5KFQA 2XTCA 1S1XB 1YX2A 3B78A 4KFBA 4XDDA 1RHMB 2Z30B 1A6LA 2JLFA 2W7AA 5H9FJ 5KFOA 3BQ1A 2ZH8A 4N7TA 2J76E 3MM7B 4A8OA 1HL6A 1VFJA 1HD0A 4NI2A 2DHHA 1NK9A 5E2QA 4ANDA 4NLGA 5HSPA 4RW8A 2GQQA 3HFVA 3W5ZA 2JEGA 2Q1LA 4K0KJ 2Y9HA 1NK5A 3UDLA 1WJ9A 1T05A 4IG0A 1W25A 5FJ4A 4CO2A 1V6HA 4ED0A 4NEZA 2W9AA 3P5TL 4K4XA 3BGLA 1IBKF 1NLAA 1IKWA 2GJ2A 2K29A 3BH7B 2DNHA 2VC1A 1FTRA 3CDWA 4RKUC 3TA0A 3VZIA 4CLLA 1N0UA 3CCLS 1M5PC 1CBKA 4NMLA 2KVIA 5KG4A 3P96A 1G1XA 4GC7A 3T19A 7FDRA 2R7VA 2CIMA 4JV0A 1PYTA 2E7XA 5L1KA 2AMCB 1VJQA 2IDLA 3ENAA 1RAFB 1LWFA 3CB4A 3L95X 3E3XA 1RU1A 2A6OA 3M8QA 1RAOA 5IM0A 1OY9A 3W8GA 2NSCA 4NA3A 3HT3A 3H4DA 3NLCA 2RQ4A 5K20B 1QE1A 2AEMA 4EBCA 3GU0A 4PG6A 2BRKA 3GFZA 2XGPA 2UXBJ 2VG6B 3DLGB 4M5HA 3R1LA 2XMAA 3TVYA 1HNZF 2ZOFA 1UFKA 1VQSA 4CO3A 4DL4A 1PBUA 4QYZJ 4QIFA 5ETTA 4Z37A 3TZZA 3BGRB 1SXLA 4CCHA 4ELVA 2JC0A 3SIPB 2WW4A 3UI3A 4C3KA 1J5EF 2J9CA 4X4NA 3OD2A 1RBAA 3IBCB 1SJ1A 3RW7A 3M9MB 3AJDA 2IRXA 1T9VA 2BABA 4OYPA 1VC6A 5LMNF 4OHYA 2BZ2A 3BYRA 2D7SA 3OR2A 3DMJB 1B7FA 1WEXA 4Q7AA 2MZJA 4X4TA 2QA4S 2NXUA 3THPA 2RDJA 2L3MA 3R7BB 4C2MA 3NNEA 1KQSR 1C0UB 1FKOB 3BDEA 5KFLA 4Y0FA 2CJ9A 2MPUA 3MUMP 2E29A 4ZVOB 3VAJA 3QJLA 2RF2A 3SEOA 3UR0A 4O3OA 4TYAA 1R3NA 2IPOB 2MSSA 3K8VA 3U1NA 1OG7A 1SJ3P 1NO8A 4NCBA 1X4DA 3IRXA 1EQMA 3HHKA 3TVKA 2UZAA 3I0RA 1AT1B 2B4PA 4BWMA 2R7OA 4ANCA 1RHUB 2GVZA 3IO1A 2JL9A 1UPMB 3NO7A 3W2VA 4D3HA 2DPJA 2BQUA 4H4KC 4TKTA 1UJ6A 5KFMA 3QRRA 3K59A 2BKPA 2O01C 5FDLA 3N5BA 3QAUA 1VBXA 2WHOA 2D3OR 2YH1A 1IKYA 2OPPA 5A6WA 3AAWB 3F73A 4ID5B 1DURA 1NEEA 3KLIA 4ETZA 1HR0F 1XK8A 1VQNS 2XS2A 3TUZC 1IXKA 4OZ1A 1FRXA 3VALA 1OPZA 4TY9A 2K06A 3G87A 5F8IA 1QUPA 3DHXA 5C42A 1S10A 3VR1A 4ZVSB 2XZTB 5I3QA 5EX0A 2VC0A 2VG5A 4JBCA 1NUEA 1N5YB 1YRXA 2J7UA 4QIEA 1X4HA 1RT4A 3OTBA 4OZ2A 5BXIA 3DCAA 2QTWA 4KGXB 1X31C 4CIOA 1FFWB 2W24A 3ZXWA 3PJ9A 4TYBA 4KJIA 2RBFA 2ACMA 3QGIA 3MR7A 2XB2D 2H3EB 2CNKB 3PX4A 1S72S 4I69A 2FHMA 2DR6A 1TL1A 3PYGA 1DLOA 4ZPDA 5F8MA 2FHJD 3EGWB 1RK8A 4CLFA 5DM7Q 4B3MF 4OV1A 3GP9A 3DLEA 1ZZFA 1NK8A 1H6KX 4FYDA 1ACMB 2HHUA 2ZEJA 5G0RA 4DL0C 2MLXA 2RDIA 1G3OA 2YKNB 1VR6A 4IDKB 1FK9A 5DZ6A 4RPFA 5ADZA 2DXDA 5DQHA 4IR1A 1RQ0A 2HFVA 3KLHB 3G8QA 3FT7A 2VOPA 1TK8A 2BM0A 4USIA 1TKDA 3D9BA 1NRKA 4O44A 3MUTP 4NLDA 3TJAA 5H9EK 1RT5B 4X62J 4LRAA 2DXEA 3L3CA 5IS2A 2BACA 2YH0A 1NK6A 2FLLA 4O0IA 1YBAA 3KDOA 3MCSA 2E1RA 2V67A 1KBRA 2KT5A 3AOCA 2O67A 2CZ4A 1Y9OA 4DSEA 2FD2A 3D0IE 1CJVA 3IG1B 3IS9B 2AWZA 4RW9B 1D3WA 4YS2A 2PI4A 1S1VA 5KG7A 5EWGA 3KK1B 1YLXA 3AX3A 1IJFB 2DD8S 1NHVA 3H98A 4M63A 2E5HA 1YJUA 1FJGJ 1YWXA 1L3KA 2WVFA 2CJQA 2RKIA 5B09A 4A8WA 4DMZA 4DV0J 4FP9A 5F8LA 1MWQA 1RKIA 1V5VA 4DSJA 1OM2A 3FBBA 5KFJA 3W5XA 5CD4A 1KVIA 1HPZA 1RGVA 2BOAA 5ETPA 5A8KB 2CWKA 3DGPB 3R5BA 2HVIA 2RQCA 4PYAA 1M1KT 4F02A 2B4OA 3KG0A 4B3OB 4AD6A 1NPRA 1S6QA 3DHWC 4L73A 3TA2A 4RU9A 1RA7A 4ZPCA 4MJWA 1RWUA 1E6YA 2JNJA 2ZWPA 5AT1B 1BDTA 1NSAA 2WAQD 2UUCF 2Z57B 2MKSA 2Q2KA 4OHVA 4RW6B 1S9GA 1U7LA 2FZGB 3NRBA 3WX4A 1WDDA 2Y8YA 4X4PA 2H3AA 2OSRA 2VBZA 3EICA 1KOOA 2VQEF 3BR9A 1FRKA 4QIVA 1WF0A 3KFWX 2DH9A 3AXMA 4ZMMA 2QYGA 4ER8A 1JLFA 4OX9J 1O6XA 3GCXP 2B6AA 1WEZA 2HNZB 4H4MA 2W8LA 3LALA 4EK2A 3MMAA 4HTJA 3KLFA 1ZM3A 2WVCA 1MROA 3MCOA 1RCXB 2IMOA 3VAIA 4MYUA 2DITA 2IVFB 2IHR1 4CTAB 2R8HA 1ZZNA 4GMKA 4ZVEA 3QPIA 5B0EA 1Q82T 1CPZA 2HHHF 4DUTA 3Q89A 1SC1B 4USKA 4AXJA 1QLNA 1IBKJ 2NXEA 6FD1A 2NYHA 3ZNJ1 1FXRA 2B7CB 4LR7A 4DR7J 2HK3A 2M52A 2MMYA 2LECA 4B08A 2FJDB 3IMQJ 3PY8A 1IKXA 1H2UX 1N56A 5CD4H 1S0OA 1CJKB 3HF5A 3Q8VA 4LF4J 3IC1A 3S01A 8AT1B 2J0WA 4U67Q 4X4RA 3QO9B 1R0BG 2ZBPA 2AU0A 1M5OC 2F40A 1HFEL 3MECB 5D77A 3FMTA 1UVMA 3HZGA 1G4CA 3N6MA 4NA1A 5RUBA 3HD1A 4QJVA 1RYSA 3PTWA 2E66A 2QMWA 1WC5A 3MAQA 4ZN3A 1QSSA 1GAOA 1FA0A 3KUHA 2MSTA 3RR8A 1WC4A 1Z1ZA 3MFHA 1K0VA 3DRYA 1B99A 1GMUA 4WBFA 3MF5A 4K2XA 3ETOA 2ADCA 1D9AA 4PXEA 3GIJA 1HNZJ 1SCJB 3PO5A 1ZTWA 5C42B 3F56A 2H5IB 2CRLA 1MYLA 2FC8A 2VIHA 1YZ6A 3W63A 2DIVA 1Z4UA 2BM1A 2LVWA 3T1AA 3OTOJ 2QFJA 2A2CA 5C5JA 3M6XA 4J91A 4Y2KA 4IH7A 1FFGB 2GJFA 2NPFA 2BNZA 2QFIA 3EDRB 3EM1A 4HACB 5B0GA 1IBLF 4QU7A 3CJRA 3UDVA 3QBCA 5BR8F 4QR0A 4BC9A 1Y5LB 2XHCA 3M2VA 2UXCF 3DKDA 3EZ5A 3D3CJ 4PQAA 1MMDA 4Q8EA 4RNMA 1KQKA 3RGIA 1ZETA 2NXNA 4USTA 1MW7A 4LF2A 3KHGA 1N52B 1YK9A 1SV5B 1ZBTA 3I5BA 3R6GB 1BDVA 4IG3B 1C1BB 2AGOA 2WB1D 2ZC3A 3V2UC 3PACA 5ETLA 3NGTA 2DB1A 1MSWD 4C3LA 3HSDA 2XMTA 3M2UB 4GRSA 1NB2A 1TL5A 3OJUA 1PO6A 3CCWA 2OGUA 3T6JA 1BC6A 2ZDPA 1N5SA 3S8SA 4B9TA 4LF8F 1S79A 3H2UB 4JI8J 3EVMA 4KC5A 3QMQA 3ZTPA 5A0YB 2VL1A 2HQ3A 4LIRA 2IM0A 2K7JA 1NJWA 3LP0B 4JOUA 2YKNA 1TQLA 3K5OA 3QGGA 4RW7B 5B08A 3D28A 2JJ4D 1RP5A 3BO3A 4DFJA 1N36J 2VA2A 1WORA 2EVZA 4QWDA 5E5NA 5LL6d 1BE4A 5J2QA 2HFNA 4W92B 4ILMA 3PXGa 3DM2B 2GS8A 2OPRB 4ED1A 2UUAF 2EPIA 4O44B 2FVSA 4OI3A 2ZZTA 3QRPA 4LR9A 4F26A 4AT1B 2XYPB 4F4XA 1HI0P 2DNNA 4HVZA 2AZ1A 3M1VA 1BD6A 1RAAB 3VGTA 2IC3B 5LSLA 2JLGA 4EZ9A 4KTQA 1FFSB 4ZKAA 4QWCA 3PV8A 4LRVA 3DU6A 4O0NA 4IO9Q 2CADA 1XMQJ 4DJBA 3T41A 2V5HG 3R5AA 4N77A 5K9FA 4NYPA 1S9EA 5KTQA 2YNHA 3CNQP 4M5NA 3THVA 3SSRA 3MTKA 3RG6A 3GV5B 5B0AA 3HSZA 2VG7A 3W9HA 3Q2SC 4ZN1A 1NK0A 4XDCA 3J81U 4GO7X 2V2QA 3TEGA 3LAMA 3DRSB 1WC3A 1IR1A 2BE9B 2WVDA 4EUVA 5B0CA 1DTQB 4I2PB 5FLXY 4YR0A 4ED8A 2JZ5A 1SKRA 4IH5A 2X3GA 1VHFA 5KFKA 1FKAF 1R7IA 1DFDA 4RW8B 3GFXA 4IOAQ 1GTHA 1AUDA 1Q79A 2ROGA 5CHCB 5ETNA 4RUCA 2M3DA 4J9QA 4D8JA 1RHJB 1QSYA 3VF0B 2UP1A 4K4VA 1VJWA 2CWXA 8RUCA 2EC0A 2HZCA 4ECZA 1K0TA 5BYSA 4ZCMA 4Y2IA 1WTBA 4K4YA 2W2OP 3J7YI 1FVSA 2V1SA 1R43A 2DHXA 2R42A 4HHUA 3AWRA 1EETB 1ZS6A 1U6ZA 3HFZB 1S7IA 1S9GB 1OPIA 4L6V3 5HQMA 1NJIT 2BDPA 5KT3A 2Z0GA 2CJBA 2H65B 3CDUA 3DLJA 1DARA 1XIQA 3P5BP 2F63A 2DNPA 4R8UB 1WC1A 5L46A 2C2DA 4Y00A 2QA2A 3S6EA 5JVHQ 1LWFB 3EZOA 4KRWA 5D0EA 2W7PA 1P6TA 2DRDA 2YQ0A 3HCXA 3LUYA 3MMAB 1EP4A 5D0GA 3ZO7A 5KFPA 1WSVA 4LVOP 3IR6B 3RB6A 2VHGA 3GIIA 3M32B 3EE3A 2OFHX 1NDLA 3QRQA 2D41A 2HPUA 3VGSA 5IXUA 4DUYF 3QT7A 4NCAA 1YBUA 5KFYA 1N4LA 1VQ5S 2XMWA 1IWAA 3KJQB 2F9DA 1J27A 5CYQA 3WDOA 2YVSA 3BGRA 4BHQA 2AY0A 4DSKA 4FBUA 3LJPA 4ZDNA 2KYZA 1SI9A 3TNVA 3ULHA 1XNRJ 1CJKA 3GYXB 2ABYA 2EK6A 3A8JA 1Q16B 5GADI 4ILRA 3K2YA 3I9ZA 2R2SA 4DI6A 3MECA 3G8SA 2DGXA 3MM8B 3FQLA 2RJZA 2FDNA 3C8YA 3GSIA 4LFAJ 1TELA 1SJRA 2ADLA 3WQPA 3PYEA 1TKTA 4DQRA 3C2PA 1Y3JA 3RAMA 1A9NB 2J0SD 2BXJA 5D78A 1U0SA 1ZAVA 2B5JB 2OTJS 4JP8A 1S97A 2KM8B 3RB4A 3KK2A 1NJXA 1Q5YA 3IRXB 1HNWJ 1Q5VA 2D3UA 2AZ3A 2K9IA 1UL3A 5BYQA 4CT8A 2V4QA 4ELUA 2H51B 2MKIA 3MMCA 4OLPA 4OYIA 4K4UA 2LLZA 2V69A 1VQKS 1HHSA 2QLXA 5C25B 2XZ2A 5CQGA 3UCGA 2HZVA 1K44A 4YQWA 1IKYB 2JFDA 3V6HA 1FEEA 2OUGA 2GGPA 2KELA 1RSCA 3EXCX 3H42A 4HACA 4ID5A 1NZAA 5SUHA 3IR7A 4EYHB 1UA0A 3OQ2A 2LYVA 3D6TB 2CQ2A 4HH0A 4U7CA 3Q8YA 4OZJA 2BE7D 1RYRA 1U2FA 2G0CA 2RE1A 1LWEA 1RT6B 3IAM9 4K2JA 4N5SA 1WC0A 3EX7B 3ZC4A 3PX6A 3UCUP 1SVDA 1TKZB 1RWMB 4PEOA 5HVGA 3AJ1A 4OI6A 2UU9F 4JYAF 4IG3A 4RWWA 2XI2A 1QVFR 1VQ9S 3JTNA 3K5MA 4YB5A 4ICLA 1RT4B 1UCNA 1ZOTA 2YWFA 4YR2A 2VQFF 1NMEB 3M2UA 3G6ES 4OYXA 3UO0A 2JRSA 3VGUA 4MT1A 1QE1B 2J6SA 4WZMA 2W2MP 2H9ZA 5AXLA 1ULRA 4USVA 4O3SA 5DO2A 3FCWA 4DV2F 2VG6A 5F9NA 2QJ3A 3KTQA 3D1HA 3LP0A 4OZ0A 3R2CJ 1BWVA 2GIQA 1RDRA 3I55S 2OKQA 2AJ0A 4OJ1A 2MJUA 4C11B 2G1HA 2HGMA 4V1Ak 4KT0C 5ETKA 5IOLA 3UE2A 2I5JB 4DN0A 2YY3A 2HHSA 1VBZA 5G0RB 3D3BJ 4V19X 2JEJA 4PG5A 2R8GA 4G1QB 2WRMA 3PKMA 2HIYA 1PGZA 4NZ0A 2OEKA 5DQIA 4JI3J 3DMJA 1KD1T 3TAQA 4PG8A 2I0XA 2OI2A 3FBFA 4WK1A 3KG4A 4DXLA 3BBFA 3R7SB 5HROB 3KLGA 3T1YF 1X93A 2WONA 2E9RX 1S9EB 4JI6J 2V50A 2YNHB 3MEEA 1SH3A 1CC8A 1X4CA 2MEWA 5KAKA 5I3UB 1SQGA 2XI3A 2Y0BB 4GO5X 4I7FB 5J2PB 1PIEA 3AHPA 1N0VC 2DY1A 2KH9A 1JLEB 2C2NA 2LXFA 3L4BC 4R25A 5HK4A 1KTQA 4TLRA 4NZ7A 1VQMS 4DCOB 3PIPQ 3SYZA 2L9WA 1KHWA 2BYCA 2HWIA 2YWHA 4RW9A 4JI8F 1YTYA 3HPOA 3JYTA 4LBPA 1BQMA 2XULA 2GMJA 4V19J 4LBIA 1EZZB 1RAIB 4DU7A 4NLXA 2CFXA 2GHVC 3VQSA 1IR2A 2OH2A 3CJTA 3TA1A 3WX8A 2GCFA 3IP0A 4F0KA 2POKA 3FUYA 1RISA 3F41A 3MPUB 4X65F 2MQPA 2A0FB 1RTIA 3V6KA 2PN6A 4FXVA 1NDCA 4NEYA 3MOZA 4B9SA 2ROPA 2V94A 2ZHAA 4TXSA 2IAJA 4WU2A 1LXJA 2CA9A 2A10A 2MJNA 2DNMA 1VISA 3H2VE 2VBWA 1WHVA 2KT3A 3I87A 4E8UA 3QWUA 1T9YA 3FC9A 2IFXA 1R6YA 2UVRA 5F8JA 4DSLA 1YKWA 2QZ8A 3L7UA 2MKKA 1YZ7A 1LW2A 1HWUA 4ZLNA 2JDJA 2QLWA 4M5DB 1X9WA 4X66F 2ZZNA 2Z8QA 3MMBA 1NH7A 2PT0A 3D6FB 3RUBL 1TAQA 4ES1A 5CAAA 1EHWA 1TL1B 2NZCA 2V4RA 1NKEA 1DZ5A 4ZPTR 1VRQC 3MGJA 4EYIB 2OD4A 4CDIA 5A76A 1B0PA 5K8MA 1EA4A 3B8HA 4OJGA 3T9ZA 2YX4A 3BKFA 4B9NA 3TZWA 4UZBA 2PD1A 3MAHA 5IT9Y 3D6HB 3PEHA 1IKVA 6FDRA 1RAHB 3V6DA 2IJNA 2DKOB 3D1OA 3GFYA 1MG7A 4L3NA 4JI4J 2R7SA 1LOUA 1S48A 3OPKA 1U8SA 4UOHA 1T94A 2IJRA 3OL9A 2C2ZB 2HAFA 3FJ2A 4WP8A 4CTAA 3FK4A 4DV5F 5HAOA 3DRRA 3SZ2A 4GKKJ 3JQJA 3FRYA 1G2EA 1TL7B 1YVFA 3M8YA 4J9PA 2MKJA 3C14B 4HI2A 3C6UA 3OTCA 2HFOA 2LQ5A 3GMGA 3W2WB 4USMA 4ZP6A 2B7BB 5F3TA 1K47A 4QYZK 3MMJA 4DR3F 4QCLA 5EGYA 1UW4A 5D0HA 2EKYA 3WC2A 1FNOA 1U45A 4ETXA 3OXLA 1RT2B 1CJVB 2GO8A 1XR5A 2LU2A 3IG1A 1DHMA 4YHHF 5E41A 3C6TB 1S0MA 3KK1A 1T9XA 1EAYC 2Z2ZA 1HKAA 3R6LB 1D0EA 2KXHA 1Y4ZB 2QX0A 3PIOQ 2UXDF 2VBXA 1IM4A 2W4PA 1T03B 1OJ4A 4P2FA 1RTDA 2HVHA 3NS5A 4LRCA 3NAHA 1ZM4A 3FCVA 4F67A 5AJ3J 2ZH4A 4BBYA 4U7UD 4ZHRA 3GV7B 5J2NB 1KKHA 1N88A 1RZMA 1TV6B 2D9OA 2XBPA 2OIHA 3BSNA 1F5CA 1HBMA 1PSDA 3M05A 4QZVB 5A8KA 2GIRA 3PJXA 3PG9A 4OX9F 3ZFVA 2HIQA 3OXFA 1LEOA 5T14A 2GAGC 1P1LA 1OY8A 4RW4B 5LJ5Y 3V4IB 1S6QB 2OPQB 3MR3A 1IJEB 1F1BB 3NGSA 3PO4A 1AZSB 4YN3B 4EU0A 3VQTA 1TKZA 2DNQA 4DCJB 5HMXA 2HHPA 1ARRA 3DI6A 4RW6A 4ZITA 2GX8A 3CGIA 5FD1A 3JSYA 1EQ0A 3DC2A 1DTTB 1X4BA 3LF0A 4DF8A 1WDTA 4A8QA 1CLFA 3O3LA 3OW2R 2FJVA 3I0SB 5E0OA 3E8OA 4U6PA 5J1EA 3DDNA 5DG9A 3OTOF 2B9XA 4DWIA 4QU6A 2AJQA 2HNZA 2B51A 3D6MB 4Y2CA 4KGMA 3DXSX 4CLUA 3H25A 1JX4A 3MM9A 3AXKA 4LVNP 4NXNJ 3EGVA 1SIZA 2Z4PA 4UUXA 2FJXA 4C48A 2K1OA 4KB7A 2HBZB 2DNLA 4B3RF 4P74A 1KFSA 2VH7A 2IM3A 2ASJA 2WTFA 3I96A 1HNXF 4LFCJ 3X3UA 1KWMA 1C0TB 2VV5A 2M4MA 2ZDOA 3U1LA 1R6VA 3M2RA 4DL7A 3HKZD 2ZC4A 2HFZA 2KL8A 1TZ0A 3JB9k 2DNKA 2B9EA 2UVWA 3T5LA 2ZD1A 1WF2A 3CE8A 1RT1A 4C8YA 4IYQA 4WTYA 5F9LA 1YRUA 1GH8A 1UZDA 2ZKUA 1NLKL 4FN5A 3M1VB 1NPPA 3MEEB 2B4UA 4KKOB 4I64A 1U02A 3SMZA 2Y3YA 2FVQA 2JVOA 2HK2A 4NLVA 3BO2A 4BWJA 1UP1A 3EWGA 1HIYA 1JLEA 1U1RA 1VC0A 3AJ2A 2WK4A 5C24A 3CCJS 1BQNA 2OPSB 2QL7B 2NUHA 2DNGA 3N4WA 2CPZA 4X2BA 1N5VA 3EJMA 5KFHA 1FO1A 1P27B 2D9PA 3R5GA 4UUWA 4DV3J 2FGOA 1S76D 2ZBIA 1U6FA 1CQMA 3I32A 1VRUA 4LFBF 2LEAA 1X4FA 2YQ1A 3GQCA 3TUIC 4IH6A 2YKAA 3BB5A 2XNQA 3HFKA 3KG1A 1K73T 2I1RA 1H38A 2QE5A 1YHQS 1S1WB 2IDEA 1DQAA 3UN2A 1UEKA 3R8YA 4FS2A 3P45B 3BN4A 3FVYA 2NXJA 1DJ0A 4K5SA 1ICEB 1U1MA 3OVSA 2GV1A 5K8OA 1PYOB 5LJ3Y 2UU9J 4JYAJ 3OR1B 1HNIB 4Y28C 2ZOGA 3NGKA 3TEHB 2AEJA 3LOUA 5D3GB 1R8AA 2VQEJ 3AFGA 2LQ8A 2RU9A 1RLDA 3GTYX 3NCQA 4RWXA 1PJ6A 3US5A 5J1EB 2UUTA 2QYCA 4ITSA 4WXOA 2PA3A 1QDUB 2EK1A 2AEFA 1NBEB 2PIIA 2H5JB 2HNDA 4X62F 2QSFA 2XSJB 4CO0A 4M5DA 1W2IA 4XIUA 4R0JA 1VYAA 1UETA 2ZBQA 1T7PA 1HYSB 1C2PA 4QIGA 5F0UA 4I6AA 3EZUA 3N28A 2KKEA 4K5RA 2YX7A 2RNEA 5JUMA 3LP2B 1LW0B 3MDFA 4XK8C 4ECVA 2UUCJ 4LF5F 5KFGA 1MU2A 5AXMA 1CEZA 3BBCA 3C16A 3ELHA 1EP4B 3UN5A 4DR2J 3QIPA 3QJPA 4AE5A 1Z2ZA 3ZZUA 5GADU 2KO1A 4I2QB 1Y5NB 2KFNA 1WI6A 3OFGA 1JJCB 3M32A 1JQGA 1ZA2B 2LFVA 4PQUA 3RTVA 2XO6A 2BUNA 4X84A 3DM2A 1D1UA 2IYGA 4KV8B 1NJYA 1MLAA 3VAFA 3D54A 3I5CA 3PW0A 3ZZOA 2FJAB 4LIWA 5LT5A 2E5LF 3PRDA 4EI2A 3W8PA 5ITHA 3HX9A 1NDKA 1RTJA 3QOQA 2AIRB 3GONA 4ZVRB 3SCLE 4B3SJ 3G82A 4J37A 5D4OA 2KHDA 1GT8A 1SKWA 1RT2A 1WEYA 4KGZB 3D67A 1NXIA 2I38A 2H48B 2X7IA 1VLYA 3BEGB 3OHBA 4DUZJ 5M2PA 1T9WA 3NCPA 2QG9B 4G1PA 3V6JA 4OQJA 2DIUA 1IM6A 1LNQA 4JI1J 3FMBA 1L3UA 2DHAA 3LGMA 3OVAA 1WHXA 2ILZA 3K89A 3TUJC 4JUZA 3BQ2A 2W1BA 5CYMB 3IA0A 4AQYF 2ZHOA 4QQBA 1BUXA 1X9MA 3RRGA 2D68A 3CJ8A 1Y11A 1S49A 1U2CA 2PMHA 2GC8A 4O3QA 4URGA 1N36F 3TAMA 4NCGA 5KFIA 3O1LA 4A8YA 3ZTQA 1XNQJ 5IV3A 2VDHA 4ZCLA 3GYGA 5A8WB 4ENOA 1J5OB 4DV1J 4RW4A 2AQ4A 5KG1A 4DSIA 2GNKA 2NZ4A 2XMKA 1MWZA 2CPXA 1DAXA 4NASA 4K50A 3MR6A 2GGPB 1EKSA 3RBDA 3BGUA 3KHLA 4WYWA 3FZBA 3ZNUA 3CCQS 2MLZA 2C28A 1S9FA 2F8MA 1HQUB 2YNIA 3AH6A 3M8PA 2XYGB 1DTTA 2KVQE 2CG4A 4USUA 2Y8WA 1QAXA 2N4CA 1GXLA 2XS5A 4R8UA 2FYXA 1S5ZA 3DFEA 2EFOA 1ROFA 3CD5A 1Q86T 2E5LJ 1RBOB 2MYFA 3VZHA 3NGDA 2U2FA 3CSKA 4LF7F 2CG8A 3OL8A 3GIMA 3GZ7A 1XWLA 4ICLB 2BX6A 1NSQA 5GAHU 3Q8SB 3LP1A 4XPEA 3CCMS 3D2WA 4DZ6A 3J7A1 2MGZA 2EFGA 2DGWA 2H5EA 3IBFB 3GB0A 3I4HX 3CTRA 2OMOA 4PCQA 4ES3A 5I42A 1H0HB 4FBTA 2DK2A 2V63A 4R5PB 4WTOB 3ETMA 2ILYA 2V6AA 3HP6A 5JJBA 1WHYA 1GXTA 2FY8A 2IMWP 3GPAA 2AJ2A 1GXUA 3HSJA 3IRWP 4N41A 3DYAA 5A2QU 2GHPA 1HBNA 1YI2S 2V1TA 4OX8A 1XNQF 5L1IA 1Q95G 2XMJA 4G1QA 4CNZA 2ZH2A 2E1AA 2BRLA 2NREA 2P8IA 1LWCB 2WB4A 4DZDA 4TU7A 3QGHA 2MQQA 4R0EA 5D0RA 3L9ZA 1NU4A 4CYUB 3HHLB 5BR8J 4NLQA 1L5UA 4OZ3A 5HROA 1CJUA 2E1PA 1OWXA 1TKTB 1X60A 5E7OB 1JJHA 4BC7A 4J7CA 5KFEA 5DG8A 2IM2A 1SH2A 1SB6A 1I1GA 2HURA 1F3FA 3H0PA 1WKJA 4NX9A 4YEAA 3ZTRA 1JXLA 3TUPA 3LPYA 5I4MA 4FF3A 2P5VA 4I7FA 4L75A 5L38A 5AJ3F 5J2PA 3CMES 3CULA 2CJYB 4LQ9A 3MM5B 3E51A 1BY9A 2I9SA 1VRUB 2J0XA 2KRRA 2C3MA 4ZJQA 4LF9J 4LF7J 2OP5A 3QFHA 1HW8A 2G2OA 4B9MA 4FVMA 5H1SV 2YNFB 1XTZA 3H5YA 3T5HA 3DLKB 5DDRC 2JOQA 2V8PA 3KJVA 1TVRA 1AFIA 2QSWA 3RRHA 1DQ9A 2FJEB 5L1LA 2XS7A 4KY3A 2HQIA 1X5TA 4O4GB 3CD0A 2W7OA 4HL9A 5H9EJ 5T41A 1NKBA 2I6WA 4JI7J 2RUSA 3OR1A 2DR9A 4NLYA 2EFPA 1SIWB 4F36A 2ZHBA 3EPIA 1YRTA 2QT7A 4C8MA 1PBAA 1RABB 3ILJA 4S0MA 1Q8KA 4ZIWA 2DHSA 1N8RT 3R3TA 2HHWA 2C1EB 1JLGA 1LWEB 2GPEA 1RT6A 4OMFG 1BGXT 3IR5B 3C66A 2Q3PA 2SXLA 3RB0A 2KTQA 2QLBB 1VHIA 3T1HF 1YG0A 3KUEA 4RUAA 3LGHA 2ZH3A 3QWPA 2AJFE 3Q0AA 2XSJA 3GG1A 4DV4J 1HBUA 2E1MC 2F9JA 4F3MA 1AUSL 4DF4A 1L3VA 3B6BA 4NLWA 2J0QD 1F9EB 5GAGI 4USHA 4OZ5A 1CVJA 3R5JB 2CQIA 2PE8A 1RTZA 3E01A 1IVZA 3ONQA 4DR6J 1LW2B 2RB7A 1B64A 4IOCQ 3C16B 2VA3A 2ZZMA 2LEBA 4DV0F 3Q8UA 3KXDA 3P4UB 2QGFB 4LRBA 4ID8A 2XMUA 2L9DA 4I2QA 1FE0A 2C3YA 5JXSA 4OIXA 3DOMB 4JI2J 1FTCA 3NAIA 1LFWA 3I31A 1REVB 2ALYB 3G6YA 2OLWA 1U6BA 2HQCA 2AYMA 2I5JA 3VAMA 2EXUA 3M8WA 3V6DB 1RWWB 2CQPA 4DBQA 3CC4S 4WXWA 4N76A 1FCAA 1UZHA 4I4BA 2LA4A 5F41A 3CJQA 1MNTA 2MZRA 2WSCC 3AB4B 1WACA 4FNIA 1Q8IA 3U1MA 2DR8A 1PG5B 2UUAJ 2D74B 3DRRB 2EKNA 5KG3A 2G1DA 2RIJA 2RVJA 2RQKA 3BZQA 1T95A 3R97A 3UDCA 4YR3A 3KLGB 1NJZA 1Q7YT 2VONA 1FKPA 4GVBA 4FXEA 1RWPB 4ZPBA 4FKXA 2VPXB 1CSJA 4F2RA 2VPYB 4N8NA 2R7XA 1S6UA 3MPWA 1CJTB 2MQOA 4KFBB 2B9YA 2JHEA 5THWA 4F0MA 4X4QA 4QW8A 3PW5A 1ZPWX 2RS8A 4WE1A 1FT8A 4Q5VA 3PNIA 4ZJLA 4PRFA 1WG4A 3VEBA 1QM9A 3JXOA 2KKHA 1YJTA 3LA0A 4X64F 4LSLB 2KRBA 1U9PA 4YY3J 1Q0NA 1F5BA 5HMYA 2HZAA 1S12A 1F0XA 4QWBA 4CM2A 1SKSA 3P8BB 1QAJA 1YJ9S 1TFYA 2G4BA 4ZCKA 2ZM6J 1IN0A 1RTIB 3HHEA 5HQ8A 4F2SA 1Y0HA 1TV6A 1AYEA 2F7VA 2AJ4A 2RRNA 1PAUB 1IKWB 2FZCB 4CI0B 3I9V9 1GX5A 3SV3A 5DGBA 4JI3F 4OI0A 5LXRA 3ET6A 3AQOA 3THTA 3TVZA 4YHHJ 3T3FA 1CULA 1VQPS 2XZWA 2HYIB 4AXIA 2KYXA 1GNKA 2CQBA 3HD2A 3F0NA 5DLGA 3V4IA 3NBPA 1RACB 1QJHA 3K8WA 1U0HB 3BH6B 5AXKA 2IRUA 4M5MA 4JI4F 1S57A 1VK8A 3DRXA 5HQLA 3KK3A 2RD5C 2Q43A 1WOPA 3C19A 2DO4A 3GLJA 2NS1B 1KDNA 1F5AA 2GMLA 1IQTA 2M9KA 1N32J 4NLUA 3M8QB 2MGZB 3IWXA 4CLYA 5I3PA 3A3PB 3AD9C 2Z56B 3HLUA 4P10A 4C98A 1NM2A 3RJMB 2FIUA 3H7HB 1TKXA 3LPEA 4AL5A
chains in the Genus database with same CATH topology
1Y3KA 4KGKA 3MM9B 2M0GB 4P6QA 1IKVB 5CZXA 5KG6A 3OUYB 4IRCA 3QLHB 1HNWF 2JEIA 2LXUA 2VPZB 4JI0F 3PRBA 4DR1F 2XNRA 3SCIE 4BS2A 4DQQA 3SFGA 4J9OA 2R8KA 5D4PA 4F4YA 2AP6A 2PO4A 2BE2B 1C0TA 4U7UK 1R8BA 4B3SF 1UFLA 3C6UB 3CCES 2CPEA 3SV4A 1QAYA 3OR2B 2YKMB 4YB7A 1ZAWA 2VOOA 2BJDA 2DGSA 2RMLA 5F8HA 2KZZA 2HS0A 4LJMA 2VFRA 1VC5A 1UJ4A 1KONA 1U1QA 2A3JA 4ED6A 4ED7A 1JLAB 3TAPA 4LFCF 4A8XA 3Q8QB 1E6VA 2L9NA 4Y2AA 2UXBF 4OJ3A 4F3OA 3QJJA 4A46A 1FD2A 3N01A 4DHVA 2Y0SD 4M8LA 4NZ6A 4X4OA 2YNFA 3W2VB 1UVNA 3DXBA 5JVGQ 2YWEA 1TVRB 2NPIA 2MQNA 2VKRA 3PM9A 4I0WA 4NYOA 5E3QA 4ZHRB 4NLGA 4ZPWR 2AGQA 1HHTP 1HBMB 1HI8A 1QTMA 2APOA 3KLIB 4ZVHA 5MLCV 2UUBF 2KJVA 3QZ7A 1KLMA 4HLBA 2OPQA 5HO4A 1U24A 3ZZ0A 3DDKA 4MK9A 4RNOA 1FJ7A 2AYGA 5DGAA 2A18A 2VG5B 1UUJA 4UW2A 1XMBA 3POTA 4JV1A 4HKQA 5D3GA 3G9CA 4WK3A 1PILA 2ZH1A 4AL6A 3BO4A 5IT4A 1VRTB 2BANB 3FDSA 3CJ4A 2QA1A 5HL7Q 2N3OA 4OI2A 4C0BA 5DJBA 4DR4F 3WC0A 2A2BA 2V8VA 4KSEB 1HD1A 1VK3A 2VBYA 5BYRA 5KFXA 1HYSA 5HP1A 3M6WA 1WF1A 1R89A 3MHYA 4I67A 1IUJA 4WKRA 2CQ1A 1BLUA 3PEJA 2EFQA 1V3RA 3CVKA 4LFAF 2AW0A 5FIIA 1O8BA 1UWBB 3QIPB 5E3RA 3SQGA 4RNHA 5DDPC 3FSXA 1JK9B 3MEDA 4CNYA 5A8RB 1FNXH 4LF6F 2B56A 4FF4A 2E9TA 1FK9B 4RBUA 3I5AA 2M2BA 3KLHA 3LW5C 3FNNA 3G71S 2D1CA 1RT1B 3TRGA 4KV8A 2LDYA 3CCSS 2MY7A 4PXCA 2KJWA 1KR4A 3TARA 5EWEA 2XY7A 1X4GA 3FGVA 1L3SA 4I6YA 2KU7A 4HI1A 2K1RA 3NMAA 1RTJB