3H61A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c) with two mn2+ atoms originally soaked with norcantharidin (which is present in the structure in the hydrolyzed form)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
total genus 111
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h61A00
2JOGA 2NYLC 4H1SA 3QFNA 1TCOA 4UT2A 3T1IA 3DW8C 1SU1A 3H67A 5INBA 3TGHA 2WDDA 1IT6A 1QFCA 4Q7FA 3GVEA 3IB7A 3H61A 1S70A 4LTYA 3K7VC 1NNWA 4MOVA 4ORCA 2WDCA 4UT3A 4JA9A 3DSDA 2HY1A 2Z1AA 4IYPC 2YVTA 1FJMA 4UT3B 2BCDA 4FBKA 3H69A 2O8AA 5B8IA 5GTUA 3ZU0A 2Q8UA 1UTEA 3P71C 3RL3A 3H64A 2DFJA 4WWLA 3PSOA 4H2IA 4FCXA 2USHA 2XMOA 3AUZA 3EGGA 1G5BA 3H60A 1T70A 3HVQA 4TUIA 4FBQA 2IE3C 3IVDA 5EQVA 2R17A 3H66A 4G9JA 5J28A 3V4YA 4KBPA 5JPFA 4V0VA 2BDXA 3IB8A 4IL1A 4ORBA 1OIDA 4O43A 1II7A 2Z72A 1S3MA 1S8EA 5JJTA 3PSNA 4H2BA 3RL5A 5F3WA 1UF3A 3RQZA 2ZBMA 4JA7A 1OIEA 2WDEA 1USHA 4B2OA 4O24A 3ICFA 1S3LA 1U32A 2WDFA 4O4KA 2NYMC 3LL8A 4KKZA 2A22A 3QFMA 2HYPA 4V0WA 3ZTVA 3N5UA 2NPPC 2P6BA 2NXFA 2IE4C 3EGHA 1QHWA 4ORAA 2CV9A 2AHDA 1HP1A 4XPNA 4DSYA 4OR9A 4FBWA 1JK7A 3C9FA 1HO5A 4DHLA 1XZWA 3H63A 3QFKA 4HD0A 2O8GA 4I5NC 4H2FA 4DT2A 3KBPA 1S95A 2QJCA 3K7WC 4I5LC 4M0VA 4YKEA 3DSCA 4NZVA 1S3NA 5C1VA 1Z2WA 5HPEA 3E7BA 3RL4A 3C5WC 5JPEA 3THOB 3AV0A 4TUGA 5DNYA 4ZX2A 2HYOA 1Z2XA 1WARA 4H2GA 1OI8A 1KBPA 2QFPA 1WAO1 4J6OA 3H62B 1T71A 3E7AA 4V0XA 2Z06A 1MF8A 3FGAC 4H1YP 4MOYA 1XM7A 4MP0A 4O5GA 4F0ZA 2QFRA 4UWQA 1W24A 4LU9A 1M63A 3THNA 4LACC 3JYFA 3QG5C 2BQ8X 5IOHA 2KKNA 1AUIA 4ZVZA 1HPUA 2GJUA 3IVEA 1V73A 2IAEC 3CK2A 3QFOA 3H68A
chains in the Genus database with same CATH superfamily
2JOGA 2NYLC 4H1SA 3QFNA 1TCOA 4UT2A 3T1IA 2ZO9B 3DW8C 1SU1A 3H67A 5INBA 2ZOAA 3TGHA 2WDDA 1IT6A 1QFCA 4Q7FA 3GVEA 3IB7A 2YEQA 3H61A 1S70A 4LTYA 3K7VC 1NNWA 4MOVA 4ORCA 2WDCA 4UT3A 4JA9A 3DSDA 2HY1A 2Z1AA 4IYPC 2YVTA 1FJMA 4UT3B 2BCDA 4FBKA 3H69A 2O8AA 5B8IA 5GTUA 3ZU0A 2Q8UA 1UTEA 3P71C 3RL3A 3H64A 2DFJA 4WWLA 3PSOA 4H2IA 4FCXA 2USHA 2XMOA 3AUZA 3EGGA 1G5BA 3H60A 1T70A 3HVQA 2DXNA 4TUIA 4FBQA 2IE3C 3IVDA 5EQVA 2R17A 3H66A 4G9JA 5J28A 3V4YA 4KBPA 5JPFA 4V0VA 2BDXA 3IB8A 4IL1A 4ORBA 1OIDA 4O43A 1II7A 2Z72A 1S3MA 1S8EA 5JJTA 3PSNA 4H2BA 3RL5A 5F3WA 1UF3A 3RQZA 2ZBMA 4JA7A 1OIEA 2WDEA 1USHA 4B2OA 4O24A 3ICFA 1S3LA 1U32A 2WDFA 4O4KA 2NYMC 3LL8A 4KKZA 2A22A 3QFMA 2HYPA 4V0WA 3ZTVA 3N5UA 2NPPC 2P6BA 2NXFA 2IE4C 3EGHA 1QHWA 4ORAA 2CV9A 2AHDA 1HP1A 4XPNA 4DSYA 4OR9A 4FBWA 1JK7A 3C9FA 1HO5A 4DHLA 1XZWA 3H63A 3QFKA 4HD0A 2O8GA 4I5NC 4H2FA 4DT2A 3E0JA 3KBPA 1S95A 2QJCA 3K7WC 4I5LC 4M0VA 4YKEA 3DSCA 4NZVA 1S3NA 3D03A 5C1VA 1Z2WA 5HPEA 3E7BA 3RL4A 3C5WC 5JPEA 3THOB 3AV0A 4TUGA 5DNYA 4ZX2A 2HYOA 1Z2XA 1WARA 4H2GA 1OI8A 1KBPA 2QFPA 1WAO1 4J6OA 3H62B 1T71A 3E7AA 4V0XA 3CK2A 2Z06A 1MF8A 3FGAC 4H1YP 4MOYA 1XM7A 4MP0A 4O5GA 4F0ZA 2QFRA 4UWQA 1W24A 4LU9A 1M63A 3THNA 4LACC 3JYFA 3QG5C 2BQ8X 5IOHA 2KKNA 1AUIA 4ZVZA 1HPUA 2GJUA 3IVEA 1V73A 2IAEC 3FLOA 2DXLA 3QFOA 3H68A
chains in the Genus database with same CATH topology
2JOGA 2NYLC 4H1SA 3QFNA 1TCOA 4UT2A 3T1IA 2ZO9B 3DW8C 1SU1A 3H67A 5INBA 2ZOAA 3TGHA 2WDDA 1IT6A 1QFCA 4Q7FA 3GVEA 3IB7A 2YEQA 3H61A 1S70A 4LTYA 3K7VC 1NNWA 4MOVA 4ORCA 2WDCA 4UT3A 4JA9A 3DSDA 2HY1A 2Z1AA 4IYPC 2YVTA 1FJMA 4UT3B 2BCDA 4FBKA 3H69A 2O8AA 5B8IA 5GTUA 3ZU0A 2Q8UA 1UTEA 3P71C 3RL3A 3H64A 2DFJA 4WWLA 3PSOA 4H2IA 4FCXA 2USHA 2XMOA 3AUZA 3EGGA 1G5BA 3H60A 1T70A 3HVQA 2DXNA 4TUIA 4FBQA 2IE3C 3IVDA 5EQVA 2R17A 3H66A 4G9JA 5J28A 3V4YA 4KBPA 5JPFA 4V0VA 2BDXA 3IB8A 4IL1A 4ORBA 1OIDA 4O43A 1II7A 2Z72A 1S3MA 1S8EA 5JJTA 3PSNA 4H2BA 3RL5A 5F3WA 1UF3A 3RQZA 2ZBMA 4JA7A 1OIEA 2WDEA 1USHA 4B2OA 4O24A 3ICFA 1S3LA 1U32A 2WDFA 4O4KA 2NYMC 3LL8A 4KKZA 2A22A 3QFMA 2HYPA 4V0WA 3ZTVA 3N5UA 2NPPC 2P6BA 2NXFA 2IE4C 3EGHA 1QHWA 4ORAA 2CV9A 2AHDA 1HP1A 4XPNA 4DSYA 4OR9A 4FBWA 1JK7A 3C9FA 1HO5A 4DHLA 1XZWA 3H63A 3QFKA 4HD0A 2O8GA 4I5NC 4H2FA 4DT2A 3E0JA 3KBPA 1S95A 2QJCA 3K7WC 4I5LC 4M0VA 4YKEA 3DSCA 4NZVA 1S3NA 3D03A 5C1VA 1Z2WA 5HPEA 3E7BA 3RL4A 3C5WC 5JPEA 3THOB 3AV0A 4TUGA 5DNYA 4ZX2A 2HYOA 1Z2XA 1WARA 4H2GA 1OI8A 1KBPA 2QFPA 1WAO1 4J6OA 3H62B 1T71A 3E7AA 4V0XA 3CK2A 2Z06A 1MF8A 3FGAC 4H1YP 4MOYA 1XM7A 4MP0A 4O5GA 4F0ZA 2QFRA 4UWQA 1W24A 4LU9A 1M63A 3THNA 4LACC 3JYFA 3QG5C 2BQ8X 5IOHA 2KKNA 1AUIA 4ZVZA 1HPUA 2GJUA 3IVEA 1V73A 2IAEC 3FLOA 2DXLA 3QFOA 3H68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOG A;  2NYL C;  4H1S A;  3QFN A;  1TCO A;  4UT2 A;  3T1I A;  3DW8 C;  1SU1 A;  3H67 A;  5INB A;  3TGH A;  2WDD A;  1IT6 A;  1QFC A;  4Q7F A;  3GVE A;  3IB7 A;  3H61 A;  1S70 A;  4LTY A;  3K7V C;  1NNW A;  4MOV A;  4ORC A;  2WDC A;  4UT3 A;  4JA9 A;  3DSD A;  2HY1 A;  2Z1A A;  4IYP C;  2YVT A;  1FJM A;  4UT3 B;  2BCD A;  4FBK A;  3H69 A;  2O8A A;  5B8I A;  5GTU A;  3ZU0 A;  2Q8U A;  1UTE A;  3P71 C;  3RL3 A;  3H64 A;  2DFJ A;  4WWL A;  3PSO A;  4H2I A;  4FCX A;  2USH A;  2XMO A;  3AUZ A;  3EGG A;  1G5B A;  3H60 A;  1T70 A;  3HVQ A;  4TUI A;  4FBQ A;  2IE3 C;  3IVD A;  5EQV A;  2R17 A;  3H66 A;  4G9J A;  5J28 A;  3V4Y A;  4KBP A;  5JPF A;  4V0V A;  2BDX A;  3IB8 A;  4IL1 A;  4ORB A;  1OID A;  4O43 A;  1II7 A;  2Z72 A;  1S3M A;  1S8E A;  5JJT A;  3PSN A;  4H2B A;  3RL5 A;  5F3W A;  1UF3 A;  3RQZ A;  2ZBM A;  4JA7 A;  1OIE A;  2WDE A;  1USH A;  4B2O A;  4O24 A;  3ICF A;  1S3L A;  1U32 A;  2WDF A;  4O4K A;  2NYM C;  3LL8 A;  4KKZ A;  2A22 A;  3QFM A;  2HYP A;  4V0W A;  3ZTV A;  3N5U A;  2NPP C;  2P6B A;  2NXF A;  2IE4 C;  3EGH A;  1QHW A;  4ORA A;  2CV9 A;  2AHD A;  1HP1 A;  4XPN A;  4DSY A;  4OR9 A;  4FBW A;  1JK7 A;  3C9F A;  1HO5 A;  4DHL A;  1XZW A;  3H63 A;  3QFK A;  4HD0 A;  2O8G A;  4I5N C;  4H2F A;  4DT2 A;  3KBP A;  1S95 A;  2QJC A;  3K7W C;  4I5L C;  4M0V A;  4YKE A;  3DSC A;  4NZV A;  1S3N A;  5C1V A;  1Z2W A;  5HPE A;  3E7B A;  3RL4 A;  3C5W C;  5JPE A;  3THO B;  3AV0 A;  4TUG A;  5DNY A;  4ZX2 A;  2HYO A;  1Z2X A;  1WAR A;  4H2G A;  1OI8 A;  1KBP A;  2QFP A;  1WAO 1;  4J6O A;  3H62 B;  1T71 A;  3E7A A;  4V0X A;  2Z06 A;  1MF8 A;  3FGA C;  4H1Y P;  4MOY A;  1XM7 A;  4MP0 A;  4O5G A;  4F0Z A;  2QFR A;  4UWQ A;  1W24 A;  4LU9 A;  1M63 A;  3THN A;  4LAC C;  3JYF A;  3QG5 C;  2BQ8 X;  5IOH A;  2KKN A;  1AUI A;  4ZVZ A;  1HPU A;  2GJU A;  3IVE A;  1V73 A;  2IAE C;  3CK2 A;  3QFO A;  3H68 A; 
#chains in the Genus database with same CATH topology
 2JOG A;  2NYL C;  4H1S A;  3QFN A;  1TCO A;  4UT2 A;  3T1I A;  2ZO9 B;  3DW8 C;  1SU1 A;  3H67 A;  5INB A;  2ZOA A;  3TGH A;  2WDD A;  1IT6 A;  1QFC A;  4Q7F A;  3GVE A;  3IB7 A;  2YEQ A;  3H61 A;  1S70 A;  4LTY A;  3K7V C;  1NNW A;  4MOV A;  4ORC A;  2WDC A;  4UT3 A;  4JA9 A;  3DSD A;  2HY1 A;  2Z1A A;  4IYP C;  2YVT A;  1FJM A;  4UT3 B;  2BCD A;  4FBK A;  3H69 A;  2O8A A;  5B8I A;  5GTU A;  3ZU0 A;  2Q8U A;  1UTE A;  3P71 C;  3RL3 A;  3H64 A;  2DFJ A;  4WWL A;  3PSO A;  4H2I A;  4FCX A;  2USH A;  2XMO A;  3AUZ A;  3EGG A;  1G5B A;  3H60 A;  1T70 A;  3HVQ A;  2DXN A;  4TUI A;  4FBQ A;  2IE3 C;  3IVD A;  5EQV A;  2R17 A;  3H66 A;  4G9J A;  5J28 A;  3V4Y A;  4KBP A;  5JPF A;  4V0V A;  2BDX A;  3IB8 A;  4IL1 A;  4ORB A;  1OID A;  4O43 A;  1II7 A;  2Z72 A;  1S3M A;  1S8E A;  5JJT A;  3PSN A;  4H2B A;  3RL5 A;  5F3W A;  1UF3 A;  3RQZ A;  2ZBM A;  4JA7 A;  1OIE A;  2WDE A;  1USH A;  4B2O A;  4O24 A;  3ICF A;  1S3L A;  1U32 A;  2WDF A;  4O4K A;  2NYM C;  3LL8 A;  4KKZ A;  2A22 A;  3QFM A;  2HYP A;  4V0W A;  3ZTV A;  3N5U A;  2NPP C;  2P6B A;  2NXF A;  2IE4 C;  3EGH A;  1QHW A;  4ORA A;  2CV9 A;  2AHD A;  1HP1 A;  4XPN A;  4DSY A;  4OR9 A;  4FBW A;  1JK7 A;  3C9F A;  1HO5 A;  4DHL A;  1XZW A;  3H63 A;  3QFK A;  4HD0 A;  2O8G A;  4I5N C;  4H2F A;  4DT2 A;  3E0J A;  3KBP A;  1S95 A;  2QJC A;  3K7W C;  4I5L C;  4M0V A;  4YKE A;  3DSC A;  4NZV A;  1S3N A;  3D03 A;  5C1V A;  1Z2W A;  5HPE A;  3E7B A;  3RL4 A;  3C5W C;  5JPE A;  3THO B;  3AV0 A;  4TUG A;  5DNY A;  4ZX2 A;  2HYO A;  1Z2X A;  1WAR A;  4H2G A;  1OI8 A;  1KBP A;  2QFP A;  1WAO 1;  4J6O A;  3H62 B;  1T71 A;  3E7A A;  4V0X A;  3CK2 A;  2Z06 A;  1MF8 A;  3FGA C;  4H1Y P;  4MOY A;  1XM7 A;  4MP0 A;  4O5G A;  4F0Z A;  2QFR A;  4UWQ A;  1W24 A;  4LU9 A;  1M63 A;  3THN A;  4LAC C;  3JYF A;  3QG5 C;  2BQ8 X;  5IOH A;  2KKN A;  1AUI A;  4ZVZ A;  1HPU A;  2GJU A;  3IVE A;  1V73 A;  2IAE C;  3FLO A;  2DXL A;  3QFO A;  3H68 A; 
#chains in the Genus database with same CATH homology
 2JOG A;  2NYL C;  4H1S A;  3QFN A;  1TCO A;  4UT2 A;  3T1I A;  2ZO9 B;  3DW8 C;  1SU1 A;  3H67 A;  5INB A;  2ZOA A;  3TGH A;  2WDD A;  1IT6 A;  1QFC A;  4Q7F A;  3GVE A;  3IB7 A;  2YEQ A;  3H61 A;  1S70 A;  4LTY A;  3K7V C;  1NNW A;  4MOV A;  4ORC A;  2WDC A;  4UT3 A;  4JA9 A;  3DSD A;  2HY1 A;  2Z1A A;  4IYP C;  2YVT A;  1FJM A;  4UT3 B;  2BCD A;  4FBK A;  3H69 A;  2O8A A;  5B8I A;  5GTU A;  3ZU0 A;  2Q8U A;  1UTE A;  3P71 C;  3RL3 A;  3H64 A;  2DFJ A;  4WWL A;  3PSO A;  4H2I A;  4FCX A;  2USH A;  2XMO A;  3AUZ A;  3EGG A;  1G5B A;  3H60 A;  1T70 A;  3HVQ A;  2DXN A;  4TUI A;  4FBQ A;  2IE3 C;  3IVD A;  5EQV A;  2R17 A;  3H66 A;  4G9J A;  5J28 A;  3V4Y A;  4KBP A;  5JPF A;  4V0V A;  2BDX A;  3IB8 A;  4IL1 A;  4ORB A;  1OID A;  4O43 A;  1II7 A;  2Z72 A;  1S3M A;  1S8E A;  5JJT A;  3PSN A;  4H2B A;  3RL5 A;  5F3W A;  1UF3 A;  3RQZ A;  2ZBM A;  4JA7 A;  1OIE A;  2WDE A;  1USH A;  4B2O A;  4O24 A;  3ICF A;  1S3L A;  1U32 A;  2WDF A;  4O4K A;  2NYM C;  3LL8 A;  4KKZ A;  2A22 A;  3QFM A;  2HYP A;  4V0W A;  3ZTV A;  3N5U A;  2NPP C;  2P6B A;  2NXF A;  2IE4 C;  3EGH A;  1QHW A;  4ORA A;  2CV9 A;  2AHD A;  1HP1 A;  4XPN A;  4DSY A;  4OR9 A;  4FBW A;  1JK7 A;  3C9F A;  1HO5 A;  4DHL A;  1XZW A;  3H63 A;  3QFK A;  4HD0 A;  2O8G A;  4I5N C;  4H2F A;  4DT2 A;  3E0J A;  3KBP A;  1S95 A;  2QJC A;  3K7W C;  4I5L C;  4M0V A;  4YKE A;  3DSC A;  4NZV A;  1S3N A;  3D03 A;  5C1V A;  1Z2W A;  5HPE A;  3E7B A;  3RL4 A;  3C5W C;  5JPE A;  3THO B;  3AV0 A;  4TUG A;  5DNY A;  4ZX2 A;  2HYO A;  1Z2X A;  1WAR A;  4H2G A;  1OI8 A;  1KBP A;  2QFP A;  1WAO 1;  4J6O A;  3H62 B;  1T71 A;  3E7A A;  4V0X A;  3CK2 A;  2Z06 A;  1MF8 A;  3FGA C;  4H1Y P;  4MOY A;  1XM7 A;  4MP0 A;  4O5G A;  4F0Z A;  2QFR A;  4UWQ A;  1W24 A;  4LU9 A;  1M63 A;  3THN A;  4LAC C;  3JYF A;  3QG5 C;  2BQ8 X;  5IOH A;  2KKN A;  1AUI A;  4ZVZ A;  1HPU A;  2GJU A;  3IVE A;  1V73 A;  2IAE C;  3FLO A;  2DXL A;  3QFO A;  3H68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...