3H6PA

Crystal structure of rv3019c-rv3020c from mycobacterium tuberculosis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
AFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESAT-6 LIKE PROTEIN ESXS
publication title Crystal structure of Rv3019c-Rv3020c from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 28
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h6pA00
1JCCA 2GUSA 1T8ZA 1JCDA 1EQ7A 1KFMA 2IX7C 2GUVA 3H6PA 1KFNA 1N2DC
chains in the Genus database with same CATH superfamily
3W67A 1T8ZA 3H1JE 1JY3O 2D2CD 1SQXE 3NXSA 2HLOA 4YXDC 2QJPB 1JY2P 3Q5PA 1U7JA 1JY2O 1J1DC 1KFMA 3K5BA 3RL0g 3O6QA 4WY4D 1BE3J 1IFIA 2WTYA 1FZFA 2P7JA 1L0NE 2BEZF 1IO4A 2GM4A 1X22A 1LTJB 4GOEA 3S4RA 1E5WA 1FZCB 3H1HG 1BDDA 3H1LG 3MP7B 2LR2A 2BCCG 3KHUA 3I5CA 1IK9A 2JR8A 2M8RA 4EIJA 2N1TC 1VQLP 1EZVI 1KC8Q 1MKMA 1RE4C 1CI6B 1PPJE 3PJSK 2LXCB 5KLVE 4OGQB 4L74A 3MIWA 1L2PA 4DT0A 1JMBA 4JQ0D 4ZKPA 3AE1C 1LTJA 2WQYC 1FZCA 3CCSP 3FWLA 1FDMA 1RF1B 1JM0A 3TYYA 2M0BA 2W6JH 3M0DC 3A2AA 1LT9B 2L5GB 1SQBD 4D6TE 2V4HA 2WPSA 5APSA 2Q3IA 1FOSF 1L0LG 1CI6A 2JWAA 4HB1A 1IFPA 3A3YB 4U3FG 3V2PA 4BWNA 2JDIH 2WPVB 4DOJA 3OJAB 1KTMA 2R3CA 1JCDA 2XNXA 2WSFJ 5GTHH 1PP9E 1H0TB 2G8YA 1OVUA 1SFCB 2QVAA 5KKZB 4JF7A 1RF1A 2LXBA 2FYUG 5AVVB 2K9YA 1LWUB 1HTLC 1EZVD 1FDOA 1M1JB 1BGYG 1SQBE 1BCCE 3TK1A 5BU5A 1UIIA 1CZQA 3RL0D 2QE7H 1MUUA 5KJ7C 1VQMP 3L70E 1N7SB 1SFCA 3HD7B 5E79H 4H13B 1X0TA 4W7YA 2VRSA 3FXDA 5KAIE 2WWWA 3AEEC 5DJUB 1N7LA 1P84E 2XU6A 1NTKK 3L4FA 1YYCA 4LLHA 1L0LK 1L4AC 3CWBD 4OH8B 3LW5H 4GOFA 3VYIA 1S9KE 4EI2A 1N7SA 4Z1MH 3HD7A 3AE9C 3C8VA 3AE3C 1YITP 3V6IA 3GHGB 2Q9IA 1URQB 2G3AA 2N9YB 2BCCD 1M57D 4OGQD 3UIAA 1DH3A 3USSA 1NU1J 1RQUA 2FYUK 3H32B 2Q7CA 3L72G 2UWJE 3RK2B 3CL3D 2JEEA 5CCGC 1FC2C 1VQ8P 1JTHA 1PZQA 4UB6H 4KT0J 3L71E 1FZAA 4H44C 1E79H 4WBAA 4I1LA 4HH2A 1GK6A 1PIXA 1IZNB 4LGDE 4N78D 4PJ0H 3D6YA 1DEEG 1VQNP 3H1KG 3U1AA 3MHVA 5AW6B 4I7ZC 3H32A 3MTUE 1NJIQ 2ZAEB 1L0LD 3G4SP 1SFCD 1QL2A 3AE8C 3VP8A 2IYPA 1USEA 1JY3N 2PAJA 2A06E 4OVNF 3L75E 2SPZA 2W27A 2Q6QA 2QM8A 3H1JG 4Y99B 1EDKA 4PD4D 1SQXG 1JY2N 5APWA 2MJZA 5DJTB 3AEBC 3S9OA 1ZOYC 5AW3B 5AW8B 1LT1A 4GIFA 2KSEA 1T2KC 1J2JB 4GODA 1W2EA 2E76C 2NPSC 4EYYQ 3TDKA 1QVFO 1FOSE 1AV1A 4IL6E 3U1CA 4AYCA 3A0HE 3L73D 1FAVA 3P8MC 5APUA 1MV8A 1PV3A 1L0NG 2NRGA 2FY8A 1GL2C 1N7SD 1FS0E 2P2UA 4I6MC 3TGUJ 2YIUB 2MKVA 4H13D 2ITAA 2ZT9B 3C1LA 4YTPC 1GU5A 2KZJA 2WMMA 1NTZE 5KLVG 1RQVA 4PD4E 4PV1C 2WT7A 1NTKJ 1JEKA 1RHZB 2Y0DA 3V2NA 5AVSB 1NAYA 5CBNA 4DJGA 1WT6A 1URQD 2AEMA 1Y9BA 3FGAD 1KQSO 1X8YA 1SQQJ 2OYHB 2XDJA 4TT3H 3RK2D 1JOCA 1SQXK 1AA0A 2KYVA 2FYUJ 2POHA 1KN7A 1G1IA 3B8EB 4K3AA 3P7KA 2JKVA 1AJYA 3LW5J 3BRTB 1L0NK 2AEFA 1OXZA 2YMYA 2H43A 1BGYJ 1EQ7A 1N73B 3WU2E 3RK3C 5APTA 3CCRP 1X9VA 1PFIA 3C9IA 2KXPB 2Q1KA 2C0WA 1SQBG 1BCCG 1EDJA 1SQPK 2LKMA 1JMMA 1S4XA 3CC2P 3D71A 3L70G 2WSCH 4GT1A 3PH0A 2W6BA 3IFMA 3IR9A 1T3UA 3RGUA 5AVRB 2RH0A 1BSNA 5TISE 2ZYAA 1JO5A 2QA4P 3M9HA 2RMZA 3CX5D 1M56D 3H1JD 3H1IJ 3L74E 3EWKA 1BE3D 2J59M 3BCCJ 1R5SA 1EZVG 1T6AA 2ZT9D 2GUSA 3M0AA 1ZXGA 1L0ND 3L72J 3KYQA 2Y9YA 2QRXA 3M9QA 5B5EE 3O6QB 3SFDC 4UB8E 2FXOA 3P32A 4TLFA 1Q82Q 2V7QH 5AVZB 3CLQA 1SQVE 1ZR4A 5BVZA 1S3JA 3KZIH 5B66E 1YJ9P 3JCUE 1PPJD 3CCQP 1GMJA 1WRGA 2PGDA 3SSUA 1JY3P 1DD4A 3CX5E 3B5NC 5KLVD 1SQBK 4H0LB 3LIEA 4KJMA 1BE3E 3CWBG 3NMDA 3H25A 4EDFA 3L36A 3Q2YA 1PGPA 3GLMA 3VP9A 4JPZB 1HUCA 1P84I 1KB9E 1ZR2A 2OYIC 3V2QA 2E42A 4D6TD 2GUVA 4L75A 1EXJA 1J1DB 1Y8AA 3CCEP 2KP8A 4CPGA 2IFMA 2IYOA 2CPBA 5K5GB 2A06G 1S72P 3ZDMA 2QIWA 1YTZT 2M5AB 1PP9D 1KILC 1VQ6P 2JJLA 1HH0A 2M3EA 2P1JA 2N1TB 1PL5A 1JNMA 2E75C 1QX8A 4BRYB 1NOHA 1S2EA 2L91A 1KV4A 2W83C 1UIXA 2Y0CA 1G2CA 3H6PA 1SQPJ 3CI9A 4W7ZA 1BSHA 1BCCD 1M8OB 2IDBA 1AFOA 1W5CE 2P10A 2OYIA 1EXIA 2M5AA 3L70D 5CHXA 4EOTA 3V5BA 2I8DA 1LNQA 3R2PA 2N1TA 1FU1A 2FFDC 1K8AQ 1GZLA 1RE4A 4BRYA 1D7MA 2AXTE 5GTIE 1P84D 1CSBA 2WZ7A 2ZVOB 2FYZA 2B87B 3L73G 4XE5B 3V4WA 5AW1B 2WSCJ 1NH4A 4C7NA 2IBZE 1IK7A 3IAOA 1S9KD 5AVUB 2YKQA 4C46A 3M0DA 1AQTA 2XV5A 1Z56A 4ASWA 1NU1D 1NTMJ 1LJ2A 3MD0A 4C7RA 4IFFA 4HKZH 4H0LD 2FYNC 5AW4B 1HJBA 3F5HA 1Q90D 3SWKA 4PD4H 2B87A 5H2FH 1FDIA 2K37A 1OMIA 2RN0A 3CPWO 2FFDA 4XFJA 1IFMA 4DZOA 1SVFA 3VMZA 4A7PA 3L71D 1NGMB 2O1JA 1GW3A 3B4SA 1JTHB 2B89A 2V7QJ 4PD4I 5CCHC 5AVYB 1RF0C 1ZV8A 1NU1E 3GF3A 1L4AB 2AEJA 3HE5B 5APQA 3T97A 4IFDK 5KJ7A 1GW4A 2JO1A 2KIKA 2N1TD 1KMIZ 2A06D 3GG2A 3L75D 2QJYC 3RBXA 1YI2P 3N7NA 2K1AA 1H88A 3EQ2A 1M90Q 3D6ZA 2E74C 1GU4A 3VOPA 1NAFA 4IL6X 3PLNA 1J1EC 2W90A 2KUBA 1L4AA 3HUSC 1FBMA 3HE5A 1KFNA 3AE4C 1AQ5A 2WPRA 4H44B 3CMEP 3I56P 2Q3EA 1OZHA 1Q2NA 1SQVG 5AVWB 1ZP0C 1Y47A 4JBZA 1QEXA 3WUVA 3A0BH 3CWBJ 4AUWA 1VF5C 1RE3C 3A5TA 1IFJA 3CXHI 1YIJP 4I7ZB 1NTZD 4ZNCA 1S1CX 1KILE 5CCGA 1LTGC 1BE3G 1S5LH 2R32A 3HTKA 1R5LA 1HF9A 3H1HJ 3H1LJ 2BCCJ 3TGUE 2WT7B 1VQOP 1OIPA 1QGKB 1SQQD 4GDOA 1KZUB 1KYOD 1LTIC 4HJGH 2R44A 2QJKC 3HD7D 2E76B 2NPSB 3CC4P 1OW8A 3HUSA 2J58A 1OVRA 4QMAA 1K73Q 1IFNA 2HODB 1GL2B 1M1KQ 5CMZA 1LTSC 3FWNA 1PPJG 1NTKE 1YTZI 2XKMA 2KLUA 3E7KA 3I55P 3CMAP 3EFGA 1GD2E 3MUDC 3U59A 5E79E 4WB4A 1L0LJ 2JP3A 1SQVK 1SQQE 2YXQB 2NPSA 3S1KA 2D2CC 4U3FJ 1L4AD 4PV1B 1KYOE 5CBOA 1HGVA 3CX5I 4D6TG 3CXHD 3G71P 2HODA 1GL2A 2KNCA 2R5BA 2FYUE 4WY4C 3G3ZA 2IZ1A 2Z5HA 1MZ9A 3L73J 3PRJA 2CK3H 1PP9G 1KB9I 1USDA 1HBWA 1ZW0A 1BGYE 2NZ2A 2ZXEB 2K9JA 5KAFE 3BCCD 3OAKA 1PGOA 1PGQA 1ZRTE 3L74D 3MUDA 1S5LX 1SLQA 4H44D 5APXA 2IBZG 3N4XA 3AE2C 1R8EA 3JSVC 5L8RJ 3CXHE 1GTWA 1VQ9P 3RK3B 3AECC 4UB6E 5KLVK 2WSFH 1AVOA 4I2LC 2Z4EA 4WVZA 3TNUB 2WVRA 2YNYA 4WY4A 1SQVD 1VQ5P 1OWAA 4PJ0E 2PRRA 2RKLA 3R4YA 3BVHA 2WSEH 2ZVNB 3H1IE 4LC1A 3P8CE 3CCVP 3BCCE 2C9LY 1DEBA 5AVXB 3V2RA 2I1KA 1K9MQ 1FZEA 1T2KD 2E76D 1VPCA 3L72E 2NPSD 4HYTB 2H7HA 3PHLA 5KLIC 1AVYA 3NTNA 3TNUA 3AE7C 1KB9D 1ZN5A 1NU1G 1GL2D 3BASA 1DIPA 5KAIH 2R5DA 2IBZI 3RL0C 1P84H 3CCMP 4RKUJ 3AEFC 2O1KA 1KQLA 2P58A 3L71G 3HE4B 3H1KJ 1VQPP 2I1JA 2QJPC 3ITKA 2OGUA 5M1BA 3WUUA 3B5NB 4N6JA 5AW2B 4OWFA 1LTJC 1FZCC 1EDLA 4K35A 3CCLP 3SWFA 1XTCC 3H1JJ 2ZYDA 4IOIH 1CW5A 1SQXJ 1G2CB 2HFED 3II6A 3L75G 3HE4A 4Y28J 2OYIB 5AW7B 3KQGA 2HYNA 3A7OA 3LIDA 1L0NJ 4OGQC 4BXLA 2JWDA 1NO4A 3BATA 1NU1K 1VQ4P 3B5NA 3TGUG 2C9NY 3RK3D 4YXWH 1SQPE 1A02F 2E5YA 2OTJP 3PTZA 2GA1A 4W80A 1RF1C 1KILB 2IBZD 1N86A 1FJPA 1NTMD 1LT9C 2E75B 3MZWB 2J5UA 1GK4A 5KLVJ 3Q5RA 2IFNA 4C7NB 1FZBA 1VDFA 4U7JA 1NTKG 1JUNA 3Q5SA 2YXRB 3OA7A 4L76A 1NTZG 4RJTA 1W2BO 1K04A 1SFCC 5KKZC 5APVA 1KILA 4D6TJ 4IL6H 3L35A 3A0HH 1Q7YQ 1SQQG 1X79B 4R4LA 3RK3E 1LWUC 1GDTA 3RBZA 3AE5C 2FFDB 5APYA 4WWIA 1NTME 1M1JC 1DX7A 1SS1A 2M3BA 2N9BA 1PP9J 3F89A 3VMAA 2K88A 2W8ZA 5EFWB 3CD6P 1LT9A 3CC7P 2WSEJ 1Q81Q 5CJ4A 1N7SC 1MFZA 3FXEA 2OARA 3HD7C 4H13C 2B9BA 1KD1Q 4IFMA 3T97B 3VN0A 4KHXA 1IC2A 2A45G 1WMKA 2OTKE 1SQBJ 1H0TA 3GF7A 1BCCJ 2YO2A 3B5ND 1EDIA 3V4QA 2WSSH 2FYNB 5AW9B 1JB0J 3L70J 3KZIE 1H8AA 3G6EP 1KYOH 4JYBA 1LWUA 2HPCB 3D70A 1NHLA 2H88C 2Z5IA 1NTZK 1YQ3C 1M1JA 3GHGC 2KLVA 1URQC 1NYHA 2YMKA 2XNDH 2B88A 2FXPA 1EZVE 3GMAA 2O01H 3IF4A 4NPEA 1KYOI 4YPCA 2W6AA 3CCUP 1OFCX 1SQQK 5C39A 3RK2C 3H1IG 2Y0EA 5KAFH 3BCCG 2FXMA 2IPPA 2QEXP 1T3JA 3H1HD 2A45H 1RH5B 3AEAC 3H1LD 2C0XA 3WU2H 1KILD 3L74G 1YBKA 4R4MA 2HPCA 4RESB 2E75D 3AE6C 1IJDB 2P67A 4NPDA 1EC5A 2CPSA 2IZ0A 3E1RA 1HWTC 3TGUD 2QJYB 3CXHH 3HRNA 2KK7A 1Q86Q 3HTKB 2KOGA 5TJHA 3SFEC 4GKGA 1VQKP 2E74B 2A45I 5CCHA 2YO3A 1XTGB 3B71A 3CWBE 1NKZB 1RF0A 1J1EB 3TSIA 3GHGA 3L71J 1URQA 1KORA 1HJ0A 1LTTC 3HUSB 5TISH 1TU3F 1LTBC 1NTKD 1JCCA 1YQ4C 4Y99C 4JYCA 3H1HE 1DD3A 3H1LE 4O9BA 2BCCE 3MGNA 1VQ7P 1H89A 3CCJP 1A02J 4L73A 3SWYA 4U3FD 2XZRA 1VF5B 3TF5A 2HR3A 1K05A 2E5TA 3M06A 1OX3A 3NFQA 3M9BA 2KS1B 1OVVA 5GTHE 1M7LA 2K3RA 3L75J 5B5EH 1FZGA 2YIUC 4UB8H 3PP5A 3Q3DA 1QVGO 2ZT9C 2OYOA 2FYUD 3E1IA 4N78E 3QWOC 3W68A 5KJ7D 3VMXA 5B66H 3JCUH 2KNCB 1FJKA 2Q5UA 1MFTA 2QJKB 2OTLP 1LGHB 2ZJSE 3CX5H 1BGYD 2BASA 1RE3A 5AW0B 2E43A 1L0LE 2KS1A 4U3FE 1U57A 1SQPG 1NKNA 1ZRTD 2K9JB 2FKWB 1LP1B 2HG5D 1KB9H 1KQFB 5H2FE 2PFXA 5KTBA 2H89C 2QM7A 5AVTB 1NTZJ 5CCHD 4ASVA 2OYHC 2ZXXA 4NPFX 2WPQA 3IN6A 3L73E 3QH9A 3BRVB 2Y9ZA 2O3JA 3GW6A 1HGZA 2D2CB 3VTPC 4B86A 4ZKUA 3WMM0 4AQRD 5BU8B 1QLED 1SP4A 2KZIA 3H1ID 4WY4B 2O01N 3P8CD 4DCKA 2DW3A 2H8PD 5CCGD 1LP1A 1NVOA 1YJWP 1N73C 2BEQD 2KI7B 1BDCA 2E74D 3L72D 1YJNP 1NTMG 3WUTA 1OW6A 2KSJA 2KB7P 2O01J 2PP6A 1ZLLA 3JC22 1OW7A 3KDPB 2ZFCA 3Q1MA 2OYHA 1N2DC 1N8RQ 4MN4C 1PGJA 2IX7C 3FX0A 1NWQA 3AEDC 1KQGB 2AXTH 5GTIH 1VF5D 3H1KD 2YKPA 3O8ZA 1IFDA 3KXDA 5CJ0A 2AXCA 2ZYGA 1N73A 3A0BE 3OW2O 4ZMDA 5AVQB 2OQQA 1SQXD 5AW5B 4N3YB 1FE6A 1S5LE 4RO0A 2R3SA 5KLIB 1VL2A 3L74J 1YHQP 1RY3A 3EFFK 2FBWC 3L37A 2YKOA 3AEGC 2QG4A 1G1JA 3H1KE 3KPEA 1NTMK 1LTAC 1HVVA 4H0LC 4PV1D 4XA4A 2QSIA 3VMYA 3G9RA 2WITA 1U7MA 1QL1A 3RL0B 1SQVJ 1SQPD 3M91A 1ZMEC 4M3LA 3ABVC
chains in the Genus database with same CATH topology
1T8ZA 1LT9A 1JY3O 3B8EB 3P7KA 3NXSA 2HLOA 3BRTB 1L0NK 5CJ4A 1RE3C 1N7SC 3A5TA 4AUWA 1OXZA 1MFZA 1IFJA 2OARA 2YMYA 3HD7C 1JY2P 2H43A 1EQ7A 1J1DC 1JY2O 1KFMA 1N73B 3RK3C 4WY4D 5APTA 5CCGA 1IFIA 2WTYA 1X9VA 1LTGC 1FZFA 2P7JA 1IO4A 2GM4A 4IFMA 2R32A 3HTKA 1PFIA 3C9IA 3VN0A 4KHXA 1IC2A 1LTJB 2A45G 1E5WA 1FZCB 2C0WA 2WT7B 3I5CA 1IK9A 2YO2A 2M8RA 3B5ND 1SQPK 2LKMA 3V4QA 1JMMA 5AW9B 1KZUB 4EIJA 2N1TC 1H8AA 1LTIC 2WSCH 4JYBA 3HD7D 1RE4C 1LWUA 1CI6B 4GT1A 2NPSB 3HUSA 2J58A 2W6BA 2HPCB 3IFMA 1NHLA 1T3UA 3IR9A 2Z5IA 1NTZK 5AVRB 1M1JA 3GHGC 3MIWA 2KLVA 1URQC 1IFNA 2HODB 1GL2B 5CMZA 1LTSC 1JO5A 3M9HA 1YTZI 2O01H 4ZKPA 2XKMA 1LTJA 3EFGA 1FZCA 2W6AA 1GD2E 1SQQK 1FDMA 3RK2C 1RF1B 2J59M 3TYYA 3M0DC 2FXMA 2IPPA 3U59A 3A2AA 1LT9B 1T3JA 2A45H 2C0XA 2L5GB 2GUSA 1KILD 4WB4A 2WPSA 5APSA 2Q3IA 1FOSF 1SQVK 1CI6A 3M0AA 2NPSA 3A3YB 3KYQA 1L4AD 2HPCA 4RESB 3V2PA 3M9QA 1IJDB 2P67A 1HWTC 2CPSA 1HGVA 3P32A 4DOJA 2HODA 3HRNA 1GL2A 3OJAB 5AVZB 3CLQA 2R3CA 3HTKB 1JCDA 2XNXA 2R5BA 2KOGA 1ZR4A 5BVZA 4WY4C 4GKGA 3G3ZA 1SFCB 2A45I 5CCHA 2YO3A 1XTGB 4JF7A 2Z5HA 1MZ9A 1RF1A 1WRGA 1NKZB 1RF0A 1J1EB 3TSIA 1JY3P 3GHGA 1HBWA 5AVVB 1URQA 3B5NC 1SQBK 1LTTC 1LWUB 2ZXEB 1HTLC 3LIEA 3HUSB 1LTBC 3NMDA 1JCCA 3L36A 1M1JB 4Y99C 4JYCA 3OAKA 4O9BA 3MGNA 3MUDA 3VP9A 3TK1A 1SLQA 1HUCA 5BU5A 1H89A 1A02J 1CZQA 5APXA 3SWYA 3RL0D 1MUUA 5KJ7C 2XZRA 3N4XA 1N7SB 1ZR2A 2OYIC 3V2QA 2E42A 1SFCA 3HD7B 2GUVA 3M06A 1GTWA 1J1DB 4W7YA 2VRSA 3NFQA 2KP8A 3M9BA 3RK3B 1M7LA 2IFMA 5KLVK 2WSFH 2CPBA 1FZGA 4I2LC 2WWWA 2Z4EA 3PP5A 1N7LA 2XU6A 3TNUB 1NTKK 2YNYA 4WY4A 1YTZT 3L4FA 1OWAA 3E1IA 3BVHA 1KILC 4N78E 1YYCA 2JJLA 1HH0A 2P1JA 5KJ7D 4LLHA 1L0LK 2WSEH 3VMXA 1L4AC 2N1TB 4LC1A 1FJKA 2Q5UA 3P8CE 4OH8B 1JNMA 3LW5H 1LGHB 2C9LY 1DEBA 3VYIA 1NOHA 1S9KE 2BASA 1RE3A 1N7SA 5AW0B 2E43A 3HD7A 5AVXB 3V2RA 2I1KA 1FZEA 1T2KD 3GHGB 1VPCA 4HYTB 2NPSD 2Q9IA 2H7HA 1URQB 1G2CA 3H6PA 3CI9A 4W7ZA 1NKNA 3NTNA 3UIAA 1DH3A 2FKWB 3TNUA 1AFOA 1ZN5A 2FYUK 2OYIA 3H32B 2Q7CA 1GL2D 2HG5D 3BASA 5CHXA 3RK2B 5KTBA 3CL3D 4EOTA 2JEEA 2QM7A 5CCGC 3V5BA 5AVTB 5CCHD 3R2PA 2OYHC 2N1TA 1FU1A 1JTHA 2WPQA 2R5DA 2FFDC 1GZLA 1RE4A 3BRVB 1FZAA 1HGZA 3VTPC 4B86A 1CSBA 2WZ7A 4ZKUA 3RL0C 4WBAA 3WMM0 4AQRD 4I1LA 4HH2A 1GK6A 2FYZA 2O1KA 5BU8B 4LGDE 4N78D 1KQLA 4XE5B 3HE4B 3V4WA 5AW1B 1SP4A 4WY4B 3P8CD 2I1JA 3U1AA 2H8PD 5AW6B 5CCGD 1NH4A 4C7NA 3H32A 1S9KD 3MTUE 1N73C 5AVUB 2YKQA 4C46A 3M0DA 1SFCD 1QL2A 2XV5A 1Z56A 3B5NB 4N6JA 3VP8A 5AW2B 1JY3N 1LTJC 2PAJA 3MD0A 1FZCC 2KSJA 2KB7P 4C7RA 3SWFA 1XTCC 2W27A 2QM8A 4IFFA 2PP6A 4Y99B 1ZLLA 1CW5A 5AW4B 1HJBA 1G2CB 1JY2N 5APWA 2MJZA 3KDPB 2HFED 3II6A 5AW3B 2ZFCA 5AW8B 2OYHA 4GIFA 1N2DC 1T2KC 1J2JB 1W2EA 3HE4A 2NPSC 1FOSE 2IX7C 3U1CA 2FFDA 2OYIB 1IFMA 4AYCA 4DZOA 5AW7B 3KQGA 1NWQA 1SVFA 2HYNA 1FAVA 3A7OA 3LIDA 3P8MC 3VMZA 5APUA 1MV8A 2O1JA 1GW3A 1GL2C 1NO4A 3BATA 1N7SD 2P2UA 4I6MC 1NU1K 1JTHB 2YKPA 3B5NA 2C9NY 3O8ZA 1IFDA 3RK3D 5CJ0A 5CCHC 1A02F 4W80A 1RF1C 1KILB 5AVYB 1RF0C 1ZV8A 1N73A 1N86A 1FJPA 1LT9C 1L4AB 5AVQB 1GU5A 3HE5B 5APQA 3T97A 1GK4A 4IFDK 5KJ7A 2IFNA 4C7NB 1GW4A 1FZBA 2N1TD 1VDFA 2WT7A 5AW5B 4N3YB 1JUNA 3V2NA 3N7NA 3OA7A 5AVSB 1H88A 3EQ2A 1RY3A 1SFCC 1GU4A 3VOPA 3L37A 1NAFA 1URQD 1WT6A 2YKOA 5APVA 1G1JA 1KILA 3KPEA 3L35A 1NTMK 1J1EC 1X8YA 1LTAC 1HVVA 1X79B 2OYHB 1L4AA 1LWUC 2XDJA 1GDTA 3HUSC 3RK2D 2FFDB 1FBMA 3HE5A 1KFNA 5APYA 1JOCA 4XA4A 1SQXK 3VMYA 2WITA 1QL1A 1AQ5A 2WPRA 3RL0B 1M1JC 1DX7A 2KYVA 3M91A 2M3BA 2N9BA 2POHA 4M3LA 5AVWB 1G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCC A;  2GUS A;  1T8Z A;  1JCD A;  1EQ7 A;  1KFM A;  2IX7 C;  2GUV A;  3H6P A;  1KFN A;  1N2D C; 
#chains in the Genus database with same CATH topology
 3W67 A;  1T8Z A;  3H1J E;  1JY3 O;  2D2C D;  1SQX E;  3NXS A;  2HLO A;  4YXD C;  2QJP B;  1JY2 P;  3Q5P A;  1U7J A;  1JY2 O;  1J1D C;  1KFM A;  3K5B A;  3RL0 g;  3O6Q A;  4WY4 D;  1BE3 J;  1IFI A;  2WTY A;  1FZF A;  2P7J A;  1L0N E;  2BEZ F;  1IO4 A;  2GM4 A;  1X22 A;  1LTJ B;  4GOE A;  3S4R A;  1E5W A;  1FZC B;  3H1H G;  1BDD A;  3H1L G;  3MP7 B;  2LR2 A;  2BCC G;  3KHU A;  3I5C A;  1IK9 A;  2JR8 A;  2M8R A;  4EIJ A;  2N1T C;  1VQL P;  1EZV I;  1KC8 Q;  1MKM A;  1RE4 C;  1CI6 B;  1PPJ E;  3PJS K;  2LXC B;  5KLV E;  4OGQ B;  4L74 A;  3MIW A;  1L2P A;  4DT0 A;  1JMB A;  4JQ0 D;  4ZKP A;  3AE1 C;  1LTJ A;  2WQY C;  1FZC A;  3CCS P;  3FWL A;  1FDM A;  1RF1 B;  1JM0 A;  3TYY A;  2M0B A;  2W6J H;  3M0D C;  3A2A A;  1LT9 B;  2L5G B;  1SQB D;  4D6T E;  2V4H A;  2WPS A;  5APS A;  2Q3I A;  1FOS F;  1L0L G;  1CI6 A;  2JWA A;  4HB1 A;  1IFP A;  3A3Y B;  4U3F G;  3V2P A;  4BWN A;  2JDI H;  2WPV B;  4DOJ A;  3OJA B;  1KTM A;  2R3C A;  1JCD A;  2XNX A;  2WSF J;  5GTH H;  1PP9 E;  1H0T B;  2G8Y A;  1OVU A;  1SFC B;  2QVA A;  5KKZ B;  4JF7 A;  1RF1 A;  2LXB A;  2FYU G;  5AVV B;  2K9Y A;  1LWU B;  1HTL C;  1EZV D;  1FDO A;  1M1J B;  1BGY G;  1SQB E;  1BCC E;  3TK1 A;  5BU5 A;  1UII A;  1CZQ A;  3RL0 D;  2QE7 H;  1MUU A;  5KJ7 C;  1VQM P;  3L70 E;  1N7S B;  1SFC A;  3HD7 B;  5E79 H;  4H13 B;  1X0T A;  4W7Y A;  2VRS A;  3FXD A;  5KAI E;  2WWW A;  3AEE C;  5DJU B;  1N7L A;  1P84 E;  2XU6 A;  1NTK K;  3L4F A;  1YYC A;  4LLH A;  1L0L K;  1L4A C;  3CWB D;  4OH8 B;  3LW5 H;  4GOF A;  3VYI A;  1S9K E;  4EI2 A;  1N7S A;  4Z1M H;  3HD7 A;  3AE9 C;  3C8V A;  3AE3 C;  1YIT P;  3V6I A;  3GHG B;  2Q9I A;  1URQ B;  2G3A A;  2N9Y B;  2BCC D;  1M57 D;  4OGQ D;  3UIA A;  1DH3 A;  3USS A;  1NU1 J;  1RQU A;  2FYU K;  3H32 B;  2Q7C A;  3L72 G;  2UWJ E;  3RK2 B;  3CL3 D;  2JEE A;  5CCG C;  1FC2 C;  1VQ8 P;  1JTH A;  1PZQ A;  4UB6 H;  4KT0 J;  3L71 E;  1FZA A;  4H44 C;  1E79 H;  4WBA A;  4I1L A;  4HH2 A;  1GK6 A;  1PIX A;  1IZN B;  4LGD E;  4N78 D;  4PJ0 H;  3D6Y A;  1DEE G;  1VQN P;  3H1K G;  3U1A A;  3MHV A;  5AW6 B;  4I7Z C;  3H32 A;  3MTU E;  1NJI Q;  2ZAE B;  1L0L D;  3G4S P;  1SFC D;  1QL2 A;  3AE8 C;  3VP8 A;  2IYP A;  1USE A;  1JY3 N;  2PAJ A;  2A06 E;  4OVN F;  3L75 E;  2SPZ A;  2W27 A;  2Q6Q A;  2QM8 A;  3H1J G;  4Y99 B;  1EDK A;  4PD4 D;  1SQX G;  1JY2 N;  5APW A;  2MJZ A;  5DJT B;  3AEB C;  3S9O A;  1ZOY C;  5AW3 B;  5AW8 B;  1LT1 A;  4GIF A;  2KSE A;  1T2K C;  1J2J B;  4GOD A;  1W2E A;  2E76 C;  2NPS C;  4EYY Q;  3TDK A;  1QVF O;  1FOS E;  1AV1 A;  4IL6 E;  3U1C A;  4AYC A;  3A0H E;  3L73 D;  1FAV A;  3P8M C;  5APU A;  1MV8 A;  1PV3 A;  1L0N G;  2NRG A;  2FY8 A;  1GL2 C;  1N7S D;  1FS0 E;  2P2U A;  4I6M C;  3TGU J;  2YIU B;  2MKV A;  4H13 D;  2ITA A;  2ZT9 B;  3C1L A;  4YTP C;  1GU5 A;  2KZJ A;  2WMM A;  1NTZ E;  5KLV G;  1RQV A;  4PD4 E;  4PV1 C;  2WT7 A;  1NTK J;  1JEK A;  1RHZ B;  2Y0D A;  3V2N A;  5AVS B;  1NAY A;  5CBN A;  4DJG A;  1WT6 A;  1URQ D;  2AEM A;  1Y9B A;  3FGA D;  1KQS O;  1X8Y A;  1SQQ J;  2OYH B;  2XDJ A;  4TT3 H;  3RK2 D;  1JOC A;  1SQX K;  1AA0 A;  2KYV A;  2FYU J;  2POH A;  1KN7 A;  1G1I A;  3B8E B;  4K3A A;  3P7K A;  2JKV A;  1AJY A;  3LW5 J;  3BRT B;  1L0N K;  2AEF A;  1OXZ A;  2YMY A;  2H43 A;  1BGY J;  1EQ7 A;  1N73 B;  3WU2 E;  3RK3 C;  5APT A;  3CCR P;  1X9V A;  1PFI A;  3C9I A;  2KXP B;  2Q1K A;  2C0W A;  1SQB G;  1BCC G;  1EDJ A;  1SQP K;  2LKM A;  1JMM A;  1S4X A;  3CC2 P;  3D71 A;  3L70 G;  2WSC H;  4GT1 A;  3PH0 A;  2W6B A;  3IFM A;  3IR9 A;  1T3U A;  3RGU A;  5AVR B;  2RH0 A;  1BSN A;  5TIS E;  2ZYA A;  1JO5 A;  2QA4 P;  3M9H A;  2RMZ A;  3CX5 D;  1M56 D;  3H1J D;  3H1I J;  3L74 E;  3EWK A;  1BE3 D;  2J59 M;  3BCC J;  1R5S A;  1EZV G;  1T6A A;  2ZT9 D;  2GUS A;  3M0A A;  1ZXG A;  1L0N D;  3L72 J;  3KYQ A;  2Y9Y A;  2QRX A;  3M9Q A;  5B5E E;  3O6Q B;  3SFD C;  4UB8 E;  2FXO A;  3P32 A;  4TLF A;  1Q82 Q;  2V7Q H;  5AVZ B;  3CLQ A;  1SQV E;  1ZR4 A;  5BVZ A;  1S3J A;  3KZI H;  5B66 E;  1YJ9 P;  3JCU E;  1PPJ D;  3CCQ P;  1GMJ A;  1WRG A;  2PGD A;  3SSU A;  1JY3 P;  1DD4 A;  3CX5 E;  3B5N C;  5KLV D;  1SQB K;  4H0L B;  3LIE A;  4KJM A;  1BE3 E;  3CWB G;  3NMD A;  3H25 A;  4EDF A;  3L36 A;  3Q2Y A;  1PGP A;  3GLM A;  3VP9 A;  4JPZ B;  1HUC A;  1P84 I;  1KB9 E;  1ZR2 A;  2OYI C;  3V2Q A;  2E42 A;  4D6T D;  2GUV A;  4L75 A;  1EXJ A;  1J1D B;  1Y8A A;  3CCE P;  2KP8 A;  4CPG A;  2IFM A;  2IYO A;  2CPB A;  5K5G B;  2A06 G;  1S72 P;  3ZDM A;  2QIW A;  1YTZ T;  2M5A B;  1PP9 D;  1KIL C;  1VQ6 P;  2JJL A;  1HH0 A;  2M3E A;  2P1J A;  2N1T B;  1PL5 A;  1JNM A;  2E75 C;  1QX8 A;  4BRY B;  1NOH A;  1S2E A;  2L91 A;  1KV4 A;  2W83 C;  1UIX A;  2Y0C A;  1G2C A;  3H6P A;  1SQP J;  3CI9 A;  4W7Z A;  1BSH A;  1BCC D;  1M8O B;  2IDB A;  1AFO A;  1W5C E;  2P10 A;  2OYI A;  1EXI A;  2M5A A;  3L70 D;  5CHX A;  4EOT A;  3V5B A;  2I8D A;  1LNQ A;  3R2P A;  2N1T A;  1FU1 A;  2FFD C;  1K8A Q;  1GZL A;  1RE4 A;  4BRY A;  1D7M A;  2AXT E;  5GTI E;  1P84 D;  1CSB A;  2WZ7 A;  2ZVO B;  2FYZ A;  2B87 B;  3L73 G;  4XE5 B;  3V4W A;  5AW1 B;  2WSC J;  1NH4 A;  4C7N A;  2IBZ E;  1IK7 A;  3IAO A;  1S9K D;  5AVU B;  2YKQ A;  4C46 A;  3M0D A;  1AQT A;  2XV5 A;  1Z56 A;  4ASW A;  1NU1 D;  1NTM J;  1LJ2 A;  3MD0 A;  4C7R A;  4IFF A;  4HKZ H;  4H0L D;  2FYN C;  5AW4 B;  1HJB A;  3F5H A;  1Q90 D;  3SWK A;  4PD4 H;  2B87 A;  5H2F H;  1FDI A;  2K37 A;  1OMI A;  2RN0 A;  3CPW O;  2FFD A;  4XFJ A;  1IFM A;  4DZO A;  1SVF A;  3VMZ A;  4A7P A;  3L71 D;  1NGM B;  2O1J A;  1GW3 A;  3B4S A;  1JTH B;  2B89 A;  2V7Q J;  4PD4 I;  5CCH C;  5AVY B;  1RF0 C;  1ZV8 A;  1NU1 E;  3GF3 A;  1L4A B;  2AEJ A;  3HE5 B;  5APQ A;  3T97 A;  4IFD K;  5KJ7 A;  1GW4 A;  2JO1 A;  2KIK A;  2N1T D;  1KMI Z;  2A06 D;  3GG2 A;  3L75 D;  2QJY C;  3RBX A;  1YI2 P;  3N7N A;  2K1A A;  1H88 A;  3EQ2 A;  1M90 Q;  3D6Z A;  2E74 C;  1GU4 A;  3VOP A;  1NAF A;  4IL6 X;  3PLN A;  1J1E C;  2W90 A;  2KUB A;  1L4A A;  3HUS C;  1FBM A;  3HE5 A;  1KFN A;  3AE4 C;  1AQ5 A;  2WPR A;  4H44 B;  3CME P;  3I56 P;  2Q3E A;  1OZH A;  1Q2N A;  1SQV G;  5AVW B;  1ZP0 C;  1Y47 A;  4JBZ A;  1QEX A;  3WUV A;  3A0B H;  3CWB J;  4AUW A;  1VF5 C;  1RE3 C;  3A5T A;  1IFJ A;  3CXH I;  1YIJ P;  4I7Z B;  1NTZ D;  4ZNC A;  1S1C X;  1KIL E;  5CCG A;  1LTG C;  1BE3 G;  1S5L H;  2R32 A;  3HTK A;  1R5L A;  1HF9 A;  3H1H J;  3H1L J;  2BCC J;  3TGU E;  2WT7 B;  1VQO P;  1OIP A;  1QGK B;  1SQQ D;  4GDO A;  1KZU B;  1KYO D;  1LTI C;  4HJG H;  2R44 A;  2QJK C;  3HD7 D;  2E76 B;  2NPS B;  3CC4 P;  1OW8 A;  3HUS A;  2J58 A;  1OVR A;  4QMA A;  1K73 Q;  1IFN A;  2HOD B;  1GL2 B;  1M1K Q;  5CMZ A;  1LTS C;  3FWN A;  1PPJ G;  1NTK E;  1YTZ I;  2XKM A;  2KLU A;  3E7K A;  3I55 P;  3CMA P;  3EFG A;  1GD2 E;  3MUD C;  3U59 A;  5E79 E;  4WB4 A;  1L0L J;  2JP3 A;  1SQV K;  1SQQ E;  2YXQ B;  2NPS A;  3S1K A;  2D2C C;  4U3F J;  1L4A D;  4PV1 B;  1KYO E;  5CBO A;  1HGV A;  3CX5 I;  4D6T G;  3CXH D;  3G71 P;  2HOD A;  1GL2 A;  2KNC A;  2R5B A;  2FYU E;  4WY4 C;  3G3Z A;  2IZ1 A;  2Z5H A;  1MZ9 A;  3L73 J;  3PRJ A;  2CK3 H;  1PP9 G;  1KB9 I;  1USD A;  1HBW A;  1ZW0 A;  1BGY E;  2NZ2 A;  2ZXE B;  2K9J A;  5KAF E;  3BCC D;  3OAK A;  1PGO A;  1PGQ A;  1ZRT E;  3L74 D;  3MUD A;  1S5L X;  1SLQ A;  4H44 D;  5APX A;  2IBZ G;  3N4X A;  3AE2 C;  1R8E A;  3JSV C;  5L8R J;  3CXH E;  1GTW A;  1VQ9 P;  3RK3 B;  3AEC C;  4UB6 E;  5KLV K;  2WSF H;  1AVO A;  4I2L C;  2Z4E A;  4WVZ A;  3TNU B;  2WVR A;  2YNY A;  4WY4 A;  1SQV D;  1VQ5 P;  1OWA A;  4PJ0 E;  2PRR A;  2RKL A;  3R4Y A;  3BVH A;  2WSE H;  2ZVN B;  3H1I E;  4LC1 A;  3P8C E;  3CCV P;  3BCC E;  2C9L Y;  1DEB A;  5AVX B;  3V2R A;  2I1K A;  1K9M Q;  1FZE A;  1T2K D;  2E76 D;  1VPC A;  3L72 E;  2NPS D;  4HYT B;  2H7H A;  3PHL A;  5KLI C;  1AVY A;  3NTN A;  3TNU A;  3AE7 C;  1KB9 D;  1ZN5 A;  1NU1 G;  1GL2 D;  3BAS A;  1DIP A;  5KAI H;  2R5D A;  2IBZ I;  3RL0 C;  1P84 H;  3CCM P;  4RKU J;  3AEF C;  2O1K A;  1KQL A;  2P58 A;  3L71 G;  3HE4 B;  3H1K J;  1VQP P;  2I1J A;  2QJP C;  3ITK A;  2OGU A;  5M1B A;  3WUU A;  3B5N B;  4N6J A;  5AW2 B;  4OWF A;  1LTJ C;  1FZC C;  1EDL A;  4K35 A;  3CCL P;  3SWF A;  1XTC C;  3H1J J;  2ZYD A;  4IOI H;  1CW5 A;  1SQX J;  1G2C B;  2HFE D;  3II6 A;  3L75 G;  3HE4 A;  4Y28 J;  2OYI B;  5AW7 B;  3KQG A;  2HYN A;  3A7O A;  3LID A;  1L0N J;  4OGQ C;  4BXL A;  2JWD A;  1NO4 A;  3BAT A;  1NU1 K;  1VQ4 P;  3B5N A;  3TGU G;  2C9N Y;  3RK3 D;  4YXW H;  1SQP E;  1A02 F;  2E5Y A;  2OTJ P;  3PTZ A;  2GA1 A;  4W80 A;  1RF1 C;  1KIL B;  2IBZ D;  1N86 A;  1FJP A;  1NTM D;  1LT9 C;  2E75 B;  3MZW B;  2J5U A;  1GK4 A;  5KLV J;  3Q5R A;  2IFN A;  4C7N B;  1FZB A;  1VDF A;  4U7J A;  1NTK G;  1JUN A;  3Q5S A;  2YXR B;  3OA7 A;  4L76 A;  1NTZ G;  4RJT A;  1W2B O;  1K04 A;  1SFC C;  5KKZ C;  5APV A;  1KIL A;  4D6T J;  4IL6 H;  3L35 A;  3A0H H;  1Q7Y Q;  1SQQ G;  1X79 B;  4R4L A;  3RK3 E;  1LWU C;  1GDT A;  3RBZ A;  3AE5 C;  2FFD B;  5APY A;  4WWI A;  1NTM E;  1M1J C;  1DX7 A;  1SS1 A;  2M3B A;  2N9B A;  1PP9 J;  3F89 A;  3VMA A;  2K88 A;  2W8Z A;  5EFW B;  3CD6 P;  1LT9 A;  3CC7 P;  2WSE J;  1Q81 Q;  5CJ4 A;  1N7S C;  1MFZ A;  3FXE A;  2OAR A;  3HD7 C;  4H13 C;  2B9B A;  1KD1 Q;  4IFM A;  3T97 B;  3VN0 A;  4KHX A;  1IC2 A;  2A45 G;  1WMK A;  2OTK E;  1SQB J;  1H0T A;  3GF7 A;  1BCC J;  2YO2 A;  3B5N D;  1EDI A;  3V4Q A;  2WSS H;  2FYN B;  5AW9 B;  1JB0 J;  3L70 J;  3KZI E;  1H8A A;  3G6E P;  1KYO H;  4JYB A;  1LWU A;  2HPC B;  3D70 A;  1NHL A;  2H88 C;  2Z5I A;  1NTZ K;  1YQ3 C;  1M1J A;  3GHG C;  2KLV A;  1URQ C;  1NYH A;  2YMK A;  2XND H;  2B88 A;  2FXP A;  1EZV E;  3GMA A;  2O01 H;  3IF4 A;  4NPE A;  1KYO I;  4YPC A;  2W6A A;  3CCU P;  1OFC X;  1SQQ K;  5C39 A;  3RK2 C;  3H1I G;  2Y0E A;  5KAF H;  3BCC G;  2FXM A;  2IPP A;  2QEX P;  1T3J A;  3H1H D;  2A45 H;  1RH5 B;  3AEA C;  3H1L D;  2C0X A;  3WU2 H;  1KIL D;  3L74 G;  1YBK A;  4R4M A;  2HPC A;  4RES B;  2E75 D;  3AE6 C;  1IJD B;  2P67 A;  4NPD A;  1EC5 A;  2CPS A;  2IZ0 A;  3E1R A;  1HWT C;  3TGU D;  2QJY B;  3CXH H;  3HRN A;  2KK7 A;  1Q86 Q;  3HTK B;  2KOG A;  5TJH A;  3SFE C;  4GKG A;  1VQK P;  2E74 B;  2A45 I;  5CCH A;  2YO3 A;  1XTG B;  3B71 A;  3CWB E;  1NKZ B;  1RF0 A;  1J1E B;  3TSI A;  3GHG A;  3L71 J;  1URQ A;  1KOR A;  1HJ0 A;  1LTT C;  3HUS B;  5TIS H;  1TU3 F;  1LTB C;  1NTK D;  1JCC A;  1YQ4 C;  4Y99 C;  4JYC A;  3H1H E;  1DD3 A;  3H1L E;  4O9B A;  2BCC E;  3MGN A;  1VQ7 P;  1H89 A;  3CCJ P;  1A02 J;  4L73 A;  3SWY A;  4U3F D;  2XZR A;  1VF5 B;  3TF5 A;  2HR3 A;  1K05 A;  2E5T A;  3M06 A;  1OX3 A;  3NFQ A;  3M9B A;  2KS1 B;  1OVV A;  5GTH E;  1M7L A;  2K3R A;  3L75 J;  5B5E H;  1FZG A;  2YIU C;  4UB8 H;  3PP5 A;  3Q3D A;  1QVG O;  2ZT9 C;  2OYO A;  2FYU D;  3E1I A;  4N78 E;  3QWO C;  3W68 A;  5KJ7 D;  3VMX A;  5B66 H;  3JCU H;  2KNC B;  1FJK A;  2Q5U A;  1MFT A;  2QJK B;  2OTL P;  1LGH B;  2ZJS E;  3CX5 H;  1BGY D;  2BAS A;  1RE3 A;  5AW0 B;  2E43 A;  1L0L E;  2KS1 A;  4U3F E;  1U57 A;  1SQP G;  1NKN A;  1ZRT D;  2K9J B;  2FKW B;  1LP1 B;  2HG5 D;  1KB9 H;  1KQF B;  5H2F E;  2PFX A;  5KTB A;  2H89 C;  2QM7 A;  5AVT B;  1NTZ J;  5CCH D;  4ASV A;  2OYH C;  2ZXX A;  4NPF X;  2WPQ A;  3IN6 A;  3L73 E;  3QH9 A;  3BRV B;  2Y9Z A;  2O3J A;  3GW6 A;  1HGZ A;  2D2C B;  3VTP C;  4B86 A;  4ZKU A;  3WMM 0;  4AQR D;  5BU8 B;  1QLE D;  1SP4 A;  2KZI A;  3H1I D;  4WY4 B;  2O01 N;  3P8C D;  4DCK A;  2DW3 A;  2H8P D;  5CCG D;  1LP1 A;  1NVO A;  1YJW P;  1N73 C;  2BEQ D;  2KI7 B;  1BDC A;  2E74 D;  3L72 D;  1YJN P;  1NTM G;  3WUT A;  1OW6 A;  2KSJ A;  2KB7 P;  2O01 J;  2PP6 A;  1ZLL A;  3JC2 2;  1OW7 A;  3KDP B;  2ZFC A;  3Q1M A;  2OYH A;  1N2D C;  1N8R Q;  4MN4 C;  1PGJ A;  2IX7 C;  3FX0 A;  1NWQ A;  3AED C;  1KQG B;  2AXT H;  5GTI H;  1VF5 D;  3H1K D;  2YKP A;  3O8Z A;  1IFD A;  3KXD A;  5CJ0 A;  2AXC A;  2ZYG A;  1N73 A;  3A0B E;  3OW2 O;  4ZMD A;  5AVQ B;  2OQQ A;  1SQX D;  5AW5 B;  4N3Y B;  1FE6 A;  1S5L E;  4RO0 A;  2R3S A;  5KLI B;  1VL2 A;  3L74 J;  1YHQ P;  1RY3 A;  3EFF K;  2FBW C;  3L37 A;  2YKO A;  3AEG C;  2QG4 A;  1G1J A;  3H1K E;  3KPE A;  1NTM K;  1LTA C;  1HVV A;  4H0L C;  4PV1 D;  4XA4 A;  2QSI A;  3VMY A;  3G9R A;  2WIT A;  1U7M A;  1QL1 A;  3RL0 B;  1SQV J;  1SQP D;  3M91 A;  1ZME C;  4M3L A;  3ABV C; 
#chains in the Genus database with same CATH homology
 1T8Z A;  1LT9 A;  1JY3 O;  3B8E B;  3P7K A;  3NXS A;  2HLO A;  3BRT B;  1L0N K;  5CJ4 A;  1RE3 C;  1N7S C;  3A5T A;  4AUW A;  1OXZ A;  1MFZ A;  1IFJ A;  2OAR A;  2YMY A;  3HD7 C;  1JY2 P;  2H43 A;  1EQ7 A;  1J1D C;  1JY2 O;  1KFM A;  1N73 B;  3RK3 C;  4WY4 D;  5APT A;  5CCG A;  1IFI A;  2WTY A;  1X9V A;  1LTG C;  1FZF A;  2P7J A;  1IO4 A;  2GM4 A;  4IFM A;  2R32 A;  3HTK A;  1PFI A;  3C9I A;  3VN0 A;  4KHX A;  1IC2 A;  1LTJ B;  2A45 G;  1E5W A;  1FZC B;  2C0W A;  2WT7 B;  3I5C A;  1IK9 A;  2YO2 A;  2M8R A;  3B5N D;  1SQP K;  2LKM A;  3V4Q A;  1JMM A;  5AW9 B;  1KZU B;  4EIJ A;  2N1T C;  1H8A A;  1LTI C;  2WSC H;  4JYB A;  3HD7 D;  1RE4 C;  1LWU A;  1CI6 B;  4GT1 A;  2NPS B;  3HUS A;  2J58 A;  2W6B A;  2HPC B;  3IFM A;  1NHL A;  1T3U A;  3IR9 A;  2Z5I A;  1NTZ K;  5AVR B;  1M1J A;  3GHG C;  3MIW A;  2KLV A;  1URQ C;  1IFN A;  2HOD B;  1GL2 B;  5CMZ A;  1LTS C;  1JO5 A;  3M9H A;  1YTZ I;  2O01 H;  4ZKP A;  2XKM A;  1LTJ A;  3EFG A;  1FZC A;  2W6A A;  1GD2 E;  1SQQ K;  1FDM A;  3RK2 C;  1RF1 B;  2J59 M;  3TYY A;  3M0D C;  2FXM A;  2IPP A;  3U59 A;  3A2A A;  1LT9 B;  1T3J A;  2A45 H;  2C0X A;  2L5G B;  2GUS A;  1KIL D;  4WB4 A;  2WPS A;  5APS A;  2Q3I A;  1FOS F;  1SQV K;  1CI6 A;  3M0A A;  2NPS A;  3A3Y B;  3KYQ A;  1L4A D;  2HPC A;  4RES B;  3V2P A;  3M9Q A;  1IJD B;  2P67 A;  1HWT C;  2CPS A;  1HGV A;  3P32 A;  4DOJ A;  2HOD A;  3HRN A;  1GL2 A;  3OJA B;  5AVZ B;  3CLQ A;  2R3C A;  3HTK B;  1JCD A;  2XNX A;  2R5B A;  2KOG A;  1ZR4 A;  5BVZ A;  4WY4 C;  4GKG A;  3G3Z A;  1SFC B;  2A45 I;  5CCH A;  2YO3 A;  1XTG B;  4JF7 A;  2Z5H A;  1MZ9 A;  1RF1 A;  1WRG A;  1NKZ B;  1RF0 A;  1J1E B;  3TSI A;  1JY3 P;  3GHG A;  1HBW A;  5AVV B;  1URQ A;  3B5N C;  1SQB K;  1LTT C;  1LWU B;  2ZXE B;  1HTL C;  3LIE A;  3HUS B;  1LTB C;  3NMD A;  1JCC A;  3L36 A;  1M1J B;  4Y99 C;  4JYC A;  3OAK A;  4O9B A;  3MGN A;  3MUD A;  3VP9 A;  3TK1 A;  1SLQ A;  1HUC A;  5BU5 A;  1H89 A;  1A02 J;  1CZQ A;  5APX A;  3SWY A;  3RL0 D;  1MUU A;  5KJ7 C;  2XZR A;  3N4X A;  1N7S B;  1ZR2 A;  2OYI C;  3V2Q A;  2E42 A;  1SFC A;  3HD7 B;  2GUV A;  3M06 A;  1GTW A;  1J1D B;  4W7Y A;  2VRS A;  3NFQ A;  2KP8 A;  3M9B A;  3RK3 B;  1M7L A;  2IFM A;  5KLV K;  2WSF H;  2CPB A;  1FZG A;  4I2L C;  2WWW A;  2Z4E A;  3PP5 A;  1N7L A;  2XU6 A;  3TNU B;  1NTK K;  2YNY A;  4WY4 A;  1YTZ T;  3L4F A;  1OWA A;  3E1I A;  3BVH A;  1KIL C;  4N78 E;  1YYC A;  2JJL A;  1HH0 A;  2P1J A;  5KJ7 D;  4LLH A;  1L0L K;  2WSE H;  3VMX A;  1L4A C;  2N1T B;  4LC1 A;  1FJK A;  2Q5U A;  3P8C E;  4OH8 B;  1JNM A;  3LW5 H;  1LGH B;  2C9L Y;  1DEB A;  3VYI A;  1NOH A;  1S9K E;  2BAS A;  1RE3 A;  1N7S A;  5AW0 B;  2E43 A;  3HD7 A;  5AVX B;  3V2R A;  2I1K A;  1FZE A;  1T2K D;  3GHG B;  1VPC A;  4HYT B;  2NPS D;  2Q9I A;  2H7H A;  1URQ B;  1G2C A;  3H6P A;  3CI9 A;  4W7Z A;  1NKN A;  3NTN A;  3UIA A;  1DH3 A;  2FKW B;  3TNU A;  1AFO A;  1ZN5 A;  2FYU K;  2OYI A;  3H32 B;  2Q7C A;  1GL2 D;  2HG5 D;  3BAS A;  5CHX A;  3RK2 B;  5KTB A;  3CL3 D;  4EOT A;  2JEE A;  2QM7 A;  5CCG C;  3V5B A;  5AVT B;  5CCH D;  3R2P A;  2OYH C;  2N1T A;  1FU1 A;  1JTH A;  2WPQ A;  2R5D A;  2FFD C;  1GZL A;  1RE4 A;  3BRV B;  1FZA A;  1HGZ A;  3VTP C;  4B86 A;  1CSB A;  2WZ7 A;  4ZKU A;  3RL0 C;  4WBA A;  3WMM 0;  4AQR D;  4I1L A;  4HH2 A;  1GK6 A;  2FYZ A;  2O1K A;  5BU8 B;  4LGD E;  4N78 D;  1KQL A;  4XE5 B;  3HE4 B;  3V4W A;  5AW1 B;  1SP4 A;  4WY4 B;  3P8C D;  2I1J A;  3U1A A;  2H8P D;  5AW6 B;  5CCG D;  1NH4 A;  4C7N A;  3H32 A;  1S9K D;  3MTU E;  1N73 C;  5AVU B;  2YKQ A;  4C46 A;  3M0D A;  1SFC D;  1QL2 A;  2XV5 A;  1Z56 A;  3B5N B;  4N6J A;  3VP8 A;  5AW2 B;  1JY3 N;  1LTJ C;  2PAJ A;  3MD0 A;  1FZC C;  2KSJ A;  2KB7 P;  4C7R A;  3SWF A;  1XTC C;  2W27 A;  2QM8 A;  4IFF A;  2PP6 A;  4Y99 B;  1ZLL A;  1CW5 A;  5AW4 B;  1HJB A;  1G2C B;  1JY2 N;  5APW A;  2MJZ A;  3KDP B;  2HFE D;  3II6 A;  5AW3 B;  2ZFC A;  5AW8 B;  2OYH A;  4GIF A;  1N2D C;  1T2K C;  1J2J B;  1W2E A;  3HE4 A;  2NPS C;  1FOS E;  2IX7 C;  3U1C A;  2FFD A;  2OYI B;  1IFM A;  4AYC A;  4DZO A;  5AW7 B;  3KQG A;  1NWQ A;  1SVF A;  2HYN A;  1FAV A;  3A7O A;  3LID A;  3P8M C;  3VMZ A;  5APU A;  1MV8 A;  2O1J A;  1GW3 A;  1GL2 C;  1NO4 A;  3BAT A;  1N7S D;  2P2U A;  4I6M C;  1NU1 K;  1JTH B;  2YKP A;  3B5N A;  2C9N Y;  3O8Z A;  1IFD A;  3RK3 D;  5CJ0 A;  5CCH C;  1A02 F;  4W80 A;  1RF1 C;  1KIL B;  5AVY B;  1RF0 C;  1ZV8 A;  1N73 A;  1N86 A;  1FJP A;  1LT9 C;  1L4A B;  5AVQ B;  1GU5 A;  3HE5 B;  5APQ A;  3T97 A;  1GK4 A;  4IFD K;  5KJ7 A;  2IFN A;  4C7N B;  1GW4 A;  1FZB A;  2N1T D;  1VDF A;  2WT7 A;  5AW5 B;  4N3Y B;  1JUN A;  3V2N A;  3N7N A;  3OA7 A;  5AVS B;  1H88 A;  3EQ2 A;  1RY3 A;  1SFC C;  1GU4 A;  3VOP A;  3L37 A;  1NAF A;  1URQ D;  1WT6 A;  2YKO A;  5APV A;  1G1J A;  1KIL A;  3KPE A;  3L35 A;  1NTM K;  1J1E C;  1X8Y A;  1LTA C;  1HVV A;  1X79 B;  2OYH B;  1L4A A;  1LWU C;  2XDJ A;  1GDT A;  3HUS C;  3RK2 D;  2FFD B;  1FBM A;  3HE5 A;  1KFN A;  5APY A;  1JOC A;  4XA4 A;  1SQX K;  3VMY A;  2WIT A;  1QL1 A;  1AQ5 A;  2WPR A;  3RL0 B;  1M1J C;  1DX7 A;  2KYV A;  3M91 A;  2M3B A;  2N9B A;  2POH A;  4M3L A;  5AVW B;  1G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...