3H6PA

Crystal structure of rv3019c-rv3020c from mycobacterium tuberculosis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
AFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rv3019c-Rv3020c from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords ESAT-6 LIKE PROTEIN ESXS
total genus 28
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h6pA00
1KFNA 1N2DC 2GUSA 3H6PA 1EQ7A 1KFMA 2GUVA 1T8ZA 2IX7C 1JCCA 1JCDA
chains in the Genus database with same CATH superfamily
3HD7C 3L71D 2JKVA 3V2PA 1JY3P 1L2PA 3L75G 3V2QA 1H89A 2NPSC 4WY4B 4HJGH 4OVNF 2IBZD 3TSIA 4D6TE 1NTKE 3G6EP 2OARA 1URQB 3RK2D 1OVVA 1YITP 1HTLC 1QVFO 1SQVK 5AVXB 2Y9ZA 3BATA 3H1ID 1KTMA 1YHQP 4L75A 1GK6A 1MUUA 1NOHA 3CXHI 3W68A 3OW2O 1DEBA 1GK4A 1LJ2A 2FYNC 2MJZA 5KKZB 1HWTC 1HVVA 3CCLP 4K35A 1EQ7A 1FJKA 1X79B 1KB9H 3CWBJ 4U3FD 3H1IJ 1T2KD 2WMMA 1YBKA 1NKZB 2W6AA 1RQUA 3WUUA 3NXSA 1JY3O 3CXHE 3MZWB 1RH5B 1QLED 1J1EC 3AEAC 3RL0g 1NTKD 3BCCE 4DCKA 1RY3A 5DJUB 5M1BA 2ZYDA 1X9VA 2XV5A 1MZ9A 4PD4I 3ZDMA 1L0NE 1H8AA 1L4AA 5CMZA 1BE3J 5AVVB 1G2CB 3BRTB 4ASVA 1K9MQ 3HE4B 2G8YA 1Y8AA 3AE7C 2AXCA 5AVTB 1SQBE 2Y9YA 3CI9A 1LTIC 1VQ9P 1SQPG 1WT6A 4GIFA 4WY4D 1LWUC 1GL2C 4RKUJ 1H0TA 1NAFA 3A3YB 1KORA 4OH8B 3WUTA 1GW4A 5BVZA 3RK2B 1GD2E 1BGYG 2KNCB 2QSIA 1SQXE 3TGUG 3UIAA 1ZLLA 3AE8C 3D70A 2YKPA 4UB6H 1T8ZA 4YTPC 2FYUJ 5B5EE 3L71E 3T97B 4PV1B 3VMXA 1FOSF 4L76A 3CC4P 1NU1G 2IFMA 1LGHB 1DH3A 2OTKE 1JY2O 1DD3A 1N7SB 2KS1A 1VQKP 4RO0A 2M0BA 1FDOA 1IK7A 2R5BA 2IBZI 3A2AA 3SFDC 1N8RQ 1OWAA 2BCCD 3WU2H 3VMZA 2ZYAA 4TLFA 1KFNA 1URQD 5TISH 2I1KA 3CC2P 1AJYA 2Z5HA 3W67A 3L74D 1NTKJ 1HH0A 5CCGD 1SQXJ 1NYHA 2NPSB 1JCCA 3HTKA 2L5GB 2BASA 1BDCA 3H32B 3L71J 2N1TB 1LTTC 3NTNA 1BCCE 3CWBD 4U3FJ 3HRNA 4KHXA 4H13D 2H7HA 4I6MC 2ZYGA 1LTGC 3G9RA 2GUSA 2HPCA 4OWFA 1R5SA 1Q90D 3HE5B 1A02F 1JM0A 3C8VA 1JMBA 4H13B 1OW8A 1NTMK 1NU1D 3RL0D 4C7RA 1YJWP 1NJIQ 2HLOA 4H44D 1GDTA 2E76D 2D2CB 2Q3IA 1N2DC 2IPPA 3P8CD 1H0TB 5GTHH 1X0TA 2KIKA 1OIPA 1S3JA 2WZ7A 4GKGA 1NVOA 1OXZA 4LLHA 2NPSA 3D6YA 3V6IA 1S2EA 3LW5J 4U3FE 1KILB 1OX3A 1BE3E 1CW5A 1OW6A 3L72G 1QVGO 4I1LA 3A0BE 1FZEA 5KTBA 4H13C 3A5TA 4Y28J 1SQBJ 2XDJA 2YNYA 2ZT9C 3O6QA 4N78E 3BVHA 1FC2C 1GZLA 2H8PD 3HUSC 3CMAP 1BSNA 1PGOA 3PP5A 5BU8B 1YI2P 1T6AA 2FXPA 3QH9A 2O1KA 3OA7A 1LWUB 1K05A 1SQPE 2E75C 4PV1D 2YKOA 4WB4A 1PPJE 2K1AA 3ABVC 3HTKB 3SFEC 1DD4A 1LP1A 1PP9G 1ZMEC 1Q2NA 3TYYA 1XTGB 2ITAA 4EDFA 3H1JG 3P8MC 1L0NK 2KOGA 3I55P 1L0LD 2O3JA 5CCHD 3RGUA 2WSFH 3IFMA 1FBMA 1RF0C 2E76B 2ZFCA 1KB9I 1RE4A 2P1JA 5L8RJ 5KJ7C 4K3AA 1NTZD 2WTYA 2HPCB 1T2KC 4RJTA 4OGQC 2W6BA 4Y99B 2IZ1A 1X8YA 2OYIB 1M1JB 1FZAA 3FXDA 1IFIA 4JYCA 3TGUE 1NAYA 2IBZG 2OGUA 1PPJD 5CCHA 2I8DA 1VQ6P 1JO5A 1PL5A 2A45I 3I5CA 5AW4B 3RBXA 2QJPB 2OTLP 1L0LK 2FFDC 2WPSA 2IYPA 1BGYD 1CSBA 1MKMA 1JEKA 2PAJA 2O01J 2WSCH 2WSCJ 1Y9BA 3M9QA 4H44B 4IOIH 3HD7B 5EFWB 1CI6B 4XA4A 1JOCA 4D6TJ 2AEMA 5KLVJ 5APWA 1NU1K 5AW6B 2OYHA 1ZXGA 2JO1A 1Y47A 2E5TA 5CBNA 1XTCC 2E74C 2CPSA 1FZCA 1VQ4P 3CMEP 1LTJC 4RESB 2O01N 3B71A 3F89A 3B5NB 3OAKA 5APXA 2I1JA 1ZP0C 3SWKA 4CPGA 2A06E 4DZOA 3BASA 2B88A 2FKWB 3RK3C 1RE3C 3CWBE 2XU6A 3B5ND 5APSA 3QWOC 2KSEA 5KKZC 4M3LA 1SQVJ 1EZVE 1SQXK 5KLVE 3E1RA 5E79H 5KLIB 3GW6A 1VF5C 2KZIA 2W6JH 1LTAC 1SVFA 3GHGA 3L35A 4W80A 3HD7A 3CCJP 1CI6A 3CLQA 1URQC 1PP9D 1W2EA 2KK7A 3FGAD 3FXEA 2B87A 3CCMP 2WPQA 2OYOA 4HB1A 1OVUA 4JPZB 2WQYC 5AW5B 3Q5SA 2O1JA 1VQ5P 4DT0A 3CD6P 2ZXXA 2E5YA 2V4HA 2FBWC 3H6PA 1JMMA 1JTHB 2ZAEB 5TJHA 2P10A 1AQ5A 2FYZA 1PGPA 2SPZA 3IF4A 4IL6E 1N73B 1X22A 2FXMA 3H1LJ 1W2BO 2PRRA 3VTPC 3GMAA 5APVA 4D6TD 2ZVOB 3V2NA 4DJGA 2JJLA 2N1TC 3L70J 3PHLA 4YPCA 1VQOP 4Z1MH 3VN0A 1EXIA 5B66H 4WBAA 1LNQA 3R2PA 4ASWA 1KILE 1PGJA 2OTJP 1OZHA 3Q1MA 1CZQA 3S9OA 1S4XA 3PJSK 1JTHA 1LT1A 2FY8A 3L75J 1LT9C 4XE5B 3TGUJ 2QJYC 2WPRA 3M0AA 4PD4D 3CCUP 4W7YA 2W27A 1Q7YQ 1EDKA 1PPJG 3ITKA 5TISE 3TDKA 1ZW0A 2WT7B 1RF1C 2JWAA 3WU2E 1SLQA 1USEA 1YYCA 3L72D 2QJPC 5AW9B 2FFDB 2FYUK 1N7SA 3H1HJ 2CK3H 1YQ3C 3V4WA 1EZVI 2ZT9D 2FYNB 1OW7A 2PGDA 5B5EH 1Z56A 3AE5C 4UB6E 1HF9A 3FX0A 1BGYJ 5CCGA 1QL2A 1U57A 2P67A 3EWKA 1IFJA 3PLNA 1IFPA 1KYOI 1RF1B 4JQ0D 3RK3E 2QRXA 2FXOA 2YXQB 4KT0J 3H1KJ 3A0HH 2HG5D 3VMYA 1JB0J 1ZV8A 2B89A 3KQGA 2E75B 3SWYA 2RH0A 3E1IA 3H1IG 3H1KD 4AQRD 1Q86Q 1L0LG 5BU5A 3MUDC 3V4QA 3RL0B 2R44A 3HE5A 1AA0A 3D6ZA 1JCDA 1NTKK 5B66E 2ZJSE 2MKVA 1SQXG 3AE6C 3HD7D 2WPVB 5APQA 4YXDC 1OVRA 2K9JB 1IK9A 2HODA 3AE3C 4TT3H 3NMDA 3TGUD 3CXHH 1GU4A 4LGDE 1G1JA 4R4MA 3H1IE 4I7ZB 4IL6H 1W5CE 1NKNA 2OQQA 5AW8B 3AEBC 1HJBA 4JBZA 1KB9E 1LTSC 2Y0CA 2H43A 1FOSE 2ZT9B 3BCCJ 3IR9A 1SQPJ 3JSVC 1BE3G 2QEXP 4GT1A 2WT7A 1LWUA 5CCHC 2W83C 3SSUA 1SQBK 2KZJA 1A02J 1S5LX 2R32A 3E7KA 5E79E 4HKZH 2Q7CA 3G3ZA 1M90Q 3KDPB 3BRVB 3AECC 1FDIA 1PP9J 2PP6A 5KLIC 2DW3A 3L36A 1SQXD 2C9LY 2E74B 1OFCX 2E75D 3AEDC 2JR8A 1KILA 3O8ZA 2P58A 3H1HE 1NTZJ 3B5NA 1VDFA 2RKLA 1FAVA 1J1EB 3AEGC 3HUSB 1KFMA 1QX8A 1KYOE 2J58A 1PFIA 3N7NA 2R3CA 4H0LD 4JF7A 1M7LA 1U7JA 2W8ZA 3MIWA 1WRGA 1SQPK 3TNUB 3M91A 5AW0B 3KHUA 1QGKB 1FDMA 2WSFJ 3H1LG 2KXPB 1N86A 3H1KE 4U3FG 4BRYA 3HUSA 1NWQA 3L4FA 4O9BA 2Q1KA 4JYBA 1S5LE 4H44C 2YKQA 1ZN5A 2RN0A 3IAOA 3P32A 2P7JA 2WITA 1JY2P 1NU1E 3L72J 2AEFA 4ZNCA 1JY2N 1S9KD 1EZVD 1L4AD 5DJTB 1NHLA 2LXCB 4I2LC 2NRGA 2W90A 1E79H 1HJ0A 1S72P 2CPBA 2E74D 2R3SA 3AE9C 1SQQG 3P8CE 4LC1A 5AVUB 5CCGC 2KLUA 1NTMD 2KB7P 3CX5I 3KZIH 1K8AQ 5AVZB 2XNDH 3C1LA 3LW5H 4ZKUA 5KLVK 2NPSD 2BEQD 2QJYB 1PGQA 4WY4A 1NU1J 1PV3A 2WVRA 3H1JJ 3Q2YA 1URQA 1EZVG 3A7OA 1HBWA 2J5UA 4PJ0H 1ZRTD 3L74G 1VQLP 1M56D 3M0DA 3GF7A 1SFCD 2B87B 1DX7A 2BCCG 3A0BH 1KILD 1U7MA 2M3EA 3RK2C 2LKMA 2QJKB 1JY3N 1BCCG 1LP1B 3L70D 4EIJA 1GL2D 1KB9D 1UIXA 1NTZE 2K88A 1N73C 1NO4A 3F5HA 1VF5B 3IN6A 1SQBD 2IYOA 3H1LD 2NZ2A 5GTHE 1RQVA 2D2CD 2YXRB 3CL3D 1HUCA 2AXTH 5AVWB 1KZUB 3L75E 1FZCC 1FZFA 4AUWA 2IFNA 4NPDA 5H2FE 1SS1A 2Y0EA 3C9IA 1SQPD 2GM4A 3BCCD 1LT9B 1L0ND 1MFTA 1VL2A 2A45G 2O01H 1SFCA 4OGQD 5APTA 3D71A 1KD1Q 4IFMA 2KYVA 2GA1A 5AVRB 1DEEG 4ZMDA 2FFDA 3B5NC 1T3JA 1SP4A 1D7MA 2WSEH 3L73D 5KAFH 3OJAB 5GTIE 1E5WA 2K37A 5AW1B 3U1CA 3WUVA 1BGYE 1M1KQ 1P84I 3G71P 2B9BA 2JDIH 1JUNA 1YTZI 3GHGB 3GLMA 4PD4E 5CJ4A 3MUDA 3L73J 1SFCB 1BE3D 1GMJA 1VPCA 1M8OB 4N6JA 3VYIA 4IL6X 1AV1A 1IFNA 2A45H 5AW2B 1VQPP 1IC2A 3K5BA 5KAFE 1P84H 4BWNA 3M06A 3L74J 1L0NG 2LXBA 5AVQB 3CX5E 5CBOA 2C9NY 4B86A 2BCCJ 1EDJA 4ZKPA 1VQMP 2JWDA 1NTKG 1ZRTE 3FWNA 2IBZE 3CWBG 2QG4A 2WSEJ 1PZQA 3L37A 4UB8H 3Q3DA 2E42A 1BCCJ 1RHZB 1ZOYC 1M1JC 1QL1A 2KUBA 3S1KA 1N7LA 3VP9A 1AVOA 2OYIC 2OYHB 3H1JD 2FYUD 2N9BA 3H32A 1BCCD 3L70G 1SQVE 4BXLA 1KQSO 1YJ9P 1AQTA 2G3AA 3NFQA 2YMKA 3L71G 3L74E 4GOEA 3G4SP 1L4AB 1KMIZ 2HODB 3CCVP 2KS1B 1H88A 4GDOA 3GF3A 1ZR2A 3B8EB 5APYA 5AVSB 4WWIA 1NTME 4EI2A 3LIDA 2JEEA 3N4XA 5C39A 5KJ7A 1N73A 2POHA 3MTUE 1VQ7P 1LTJB 1LTBC 2H89C 4L74A 1MFZA 3MP7B 3U59A 1JNMA 4GODA 1P84D 1DIPA 1USDA 2L91A 4BRYB 3M0DC 1GW3A 4KJMA 2Q3EA 1EDLA 1FZCB 1NTMG 2BEZF 1VF5D 4QMAA 1SQQD 3KXDA 5CHXA 2KLVA 4R4LA 1R8EA 1G2CA 2R5DA 3L73G 4OGQB 4U7JA 4H0LB 4Y99C 4UB8E 4A7PA 4D6TG 3CCRP 5KJ7D 1VQ8P 3CC7P 4N3YB 2A06D 4N78D 1MV8A 3CX5H 2C0XA 1L0NJ 4IFFA 3H1KG 2M3BA 2HR3A 3VP8A 3SWFA 1IO4A 1P84E 2IDBA 1AFOA 3L73E 1KQFB 1EC5A 4W7ZA 3USSA 3GHGC 3H25A 2N9YB 2C0WA 3RL0C 2V7QJ 2PFXA 3A0HE 4H0LC 4PD4H 1R5LA 1SQBG 5AVYB 1BSHA 3CCEP 1S1CX 2UWJE 3EFGA 4EOTA 3I56P 3VMAA 5GTIH 4MN4C 1L0LE 1N7SD 2HFED 3GG2A 3L72E 1K04A 1NTZG 2WWWA 2M5AB 4I7ZC 3MHVA 4NPEA 2QVAA 3VOPA 1YIJP 2YIUB 2Z4EA 2Q5UA 2LR2A 3JCUE 2M8RA 1LTJA 2KI7B 3T97A 1M1JA 1IFDA 2A06G 2WSSH 3M9BA 2H88C 2K3RA 2OYIA 3LIEA 1J1DB 2QM8A 3S4RA 2Y0DA 3PTZA 2YMYA 3CX5D 5H2FH 4C7NB 5KAIH 2OYHC 3CCQP 3CPWO 4IFDK 2AXTE 1HGZA 2N1TD 3H1HD 1GU5A 1KN7A 1EXJA 3WMM0 1NTMJ 3KYQA 5AW3B 1K73Q 1SQVD 2KSJA 1KILC 4HH2A 2KNCA 2QE7H 3H1JE 2RMZA 2ZVNB 4C46A 1Q81Q 1EDIA 2YO2A 1NH4A 1RE3A 2XNXA 1UIIA 5K5GB 1KQGB 5AW7B 1PIXA 1J1DC 2D2CC 1FZGA 1RE4C 3AEFC 1YTZT 2IZ0A 4GOFA 3HE4A 2XZRA 4PJ0E 2J59M 3KPEA 2K9JA 2AEJA 1SQQJ 1FZBA 5KLVD 3CCSP 2ZXEB 3H1HG 3P7KA 1YQ4C 3RBZA 3U1AA 3O6QB 1FJPA 1GL2A 1SFCC 2FYUG 2K9YA 1S9KE 3RK3D 3KZIE 4L73A 2Z5IA 4PV1C 1ZR4A 1KQLA 1OMIA 4EYYQ 1N7SC 3Q5PA 1IFMA 1WMKA 1PP9E 1BDDA 3AE4C 4XFJA 1L4AC 2IX7C 3H1LE 1NGMB 1KYOD 1RF1A 3TNUA 3L70E 2Q6QA 3JC22 1SQQE 3EFFK 4DOJA 2QJKC 3TF5A 1VQNP 1RF0A 2HYNA 3CXHD 1FS0E 1LT9A 2Q9IA 4HYTB 1NTZK 3V5BA 1L0LJ 4WVZA 1Q82Q 1IJDB 1FE6A 3II6A 4AYCA 3R4YA 1M57D 1S5LH 1FU1A 3L75D 1AVYA 3AE2C 4C7NA 3MD0A 1IZNB 3MGNA 2V7QH 3B4SA 5KAIE 1GL2B 5KLVG 2N1TA 2E76C 3AE1C 4NPFX 2YO3A 3TK1A 3V2RA 2YIUC 1J2JB 1HGVA 2JP3A 2KP8A 5CJ0A 3JCUH 1SQQK 4YXWH 2GUVA 4WY4C 2QA4P 2XKMA 1KC8Q 2M5AA 3AEEC 2VRSA 3M9HA 3PH0A 1YJNP 1T3UA 2BCCE 2QM7A 1TU3F 1QEXA 2FYUE 3PRJA 1KYOH 1KV4A 3FWLA 3BCCG 3EQ2A 3Q5RA 2E43A 5APUA 3RK3B 1SQVG 1G1IA 2QIWA 1GTWA 2P2UA
chains in the Genus database with same CATH topology
3HD7C 3V2PA 1JY3P 3V2QA 1H89A 2NPSC 4WY4B 3TSIA 2OARA 1URQB 3RK2D 1HTLC 1SQVK 5AVXB 3BATA 1GK6A 1MUUA 1NOHA 1DEBA 1GK4A 1HWTC 2MJZA 1HVVA 1EQ7A 1FJKA 1X79B 1NKZB 2W6AA 3NXSA 1JY3O 1J1EC 1RY3A 1X9VA 2XV5A 1MZ9A 1H8AA 1L4AA 5CMZA 5AVVB 1G2CB 3BRTB 3HE4B 5AVTB 3CI9A 1LTIC 1WT6A 4GIFA 4WY4D 1LWUC 1GL2C 1NAFA 3A3YB 4OH8B 1GW4A 5BVZA 3RK2B 1GD2E 3UIAA 1ZLLA 2YKPA 1T8ZA 3VMXA 1FOSF 2IFMA 1LGHB 1DH3A 1JY2O 1N7SB 2R5BA 3A2AA 1OWAA 3VMZA 1KFNA 1URQD 2I1KA 2Z5HA 1HH0A 5CCGD 2NPSB 1JCCA 3HTKA 2L5GB 2BASA 3H32B 2N1TB 1LTTC 3NTNA 3HRNA 4KHXA 2H7HA 4I6MC 1LTGC 2GUSA 2HPCA 3HE5B 1A02F 3RL0D 1NTMK 4C7RA 2HLOA 1GDTA 2Q3IA 1N2DC 2IPPA 3P8CD 2WZ7A 4GKGA 4LLHA 1OXZA 2NPSA 1KILB 1CW5A 4I1LA 1FZEA 5KTBA 3A5TA 2XDJA 2YNYA 4N78E 3BVHA 1GZLA 3HUSC 2H8PD 5BU8B 3PP5A 2O1KA 3OA7A 1LWUB 2YKOA 4WB4A 3HTKB 3TYYA 1XTGB 3P8MC 1L0NK 2KOGA 5CCHD 2WSFH 3IFMA 2ZFCA 1RF0C 1FBMA 1RE4A 2P1JA 5KJ7C 2WTYA 1T2KC 2W6BA 4Y99B 1X8YA 2OYIB 1M1JB 1FZAA 1IFIA 4JYCA 5CCHA 1JO5A 2A45I 3I5CA 5AW4B 1L0LK 2FFDC 2WPSA 1CSBA 2WSCH 2PAJA 3M9QA 3HD7B 1CI6B 4XA4A 1JOCA 2OYHA 5APWA 1NU1K 5AW6B 1XTCC 2CPSA 1FZCA 1LTJC 4RESB 5APXA 2HPCB 3B5NB 3OAKA 4DZOA 2I1JA 3BASA 2FKWB 3RK3C 1RE3C 2XU6A 3B5ND 5APSA 4M3LA 1SQXK 3GHGA 3L35A 4W80A 1LTAC 1SVFA 3HD7A 1CI6A 3CLQA 1URQC 1W2EA 2WPQA 5AW5B 2O1JA 3H6PA 1JMMA 1JTHB 1AQ5A 2FYZA 1N73B 2FXMA 3VTPC 5APVA 3V2NA 2JJLA 2N1TC 3VN0A 4WBAA 3R2PA 1CZQA 1JTHA 4XE5B 1LT9C 2WPRA 3M0AA 4W7YA 2W27A 2WT7B 1RF1C 1SLQA 1YYCA 5AW9B 2FFDB 2FYUK 1N7SA 3V4WA 1Z56A 5CCGA 1QL2A 2P67A 1IFJA 1RF1B 2HG5D 3VMYA 1ZV8A 3KQGA 3SWYA 3E1IA 4AQRD 5BU5A 3V4QA 3RL0B 3HE5A 1JCDA 1NTKK 3HD7D 5APQA 1IK9A 2HODA 1GU4A 3NMDA 4LGDE 1G1JA 1NKNA 5AW8B 1HJBA 1LTSC 2H43A 1FOSE 3IR9A 4GT1A 2WT7A 1LWUA 5CCHC 1SQBK 1A02J 2R32A 2Q7CA 3G3ZA 3KDPB 3BRVB 2PP6A 2C9LY 3L36A 1KILA 3O8ZA 3HUSB 3B5NA 3SWFA 1VDFA 1FAVA 1J1EB 1KFMA 1PFIA 2J58A 3N7NA 2R3CA 4JF7A 1M7LA 3MIWA 1WRGA 1SQPK 3TNUB 3M91A 5AW0B 1FDMA 1N86A 3HUSA 1NWQA 3L4FA 4O9BA 4JYBA 2YKQA 1ZN5A 3P32A 2P7JA 2WITA 1JY2P 1JY2N 1S9KD 1L4AD 1NHLA 4I2LC 2CPBA 3P8CE 4LC1A 5AVUB 5CCGC 2KB7P 5AVZB 3LW5H 4ZKUA 5KLVK 2NPSD 4WY4A 1URQA 3A7OA 1HBWA 3M0DA 1SFCD 1DX7A 1KILD 3RK2C 2LKMA 1JY3N 1N73C 4EIJA 1GL2D 1NO4A 3CL3D 1HUCA 1KZUB 1FZCC 1FZFA 2IFNA 3C9IA 2GM4A 1T2KD 1LT9B 2O01H 2A45G 5APTA 1SFCA 4IFMA 2KYVA 5AVRB 2FFDA 3B5NC 1T3JA 1SP4A 2WSEH 3OJAB 1E5WA 5AW1B 3U1CA 1JUNA 1YTZI 3GHGB 5CJ4A 3MUDA 1SFCB 1VPCA 4N6JA 3VYIA 1IFNA 2A45H 5AW2B 1IC2A 3M06A 5AVQB 2C9NY 4B86A 4ZKPA 5AVWB 4AUWA 3L37A 2E42A 2OYIC 1M1JC 1QL1A 1N7LA 3VP9A 2OYHB 2N9BA 3H32A 3NFQA 1L4AB 1H88A 2HODB 1ZR2A 3B8EB 5APYA 5AVSB 3LIDA 2JEEA 3N4XA 5KJ7A 1N73A 2POHA 3MTUE 1LTJB 1LTBC 3U59A 1MFZA 1JNMA 3M0DC 1GW3A 1FZCB 5CHXA 2KLVA 1G2CA 2R5DA 4Y99C 5KJ7D 4N3YB 4N78D 1MV8A 2C0XA 4IFFA 2M3BA 1IO4A 3VP8A 1AFOA 4W7ZA 3GHGC 2C0WA 3RL0C 5AVYB 3EFGA 4EOTA 1N7SD 2HFED 2WWWA 3VOPA 2Z4EA 2Q5UA 2M8RA 1LTJA 3T97A 1M1JA 1IFDA 3M9BA 2OYIA 3LIEA 1J1DB 2QM8A 2OYHC 2YMYA 4C7NB 4IFDK 1HGZA 2N1TD 1GU5A 3WMM0 3KYQA 5AW3B 2KSJA 1KILC 4HH2A 4C46A 2YO2A 1NH4A 1RE3A 2XNXA 5AW7B 1J1DC 1FZGA 1RE4C 1YTZT 3HE4A 2XZRA 2J59M 3KPEA 1FZBA 1FJPA 2ZXEB 3P7KA 3U1AA 1GL2A 1SFCC 1S9KE 3RK3D 1ZR4A 2Z5IA 1KQLA 1N7SC 1IFMA 1L4AC 2IX7C 1RF1A 3TNUA 4DOJA 1RF0A 2HYNA 1LT9A 2Q9IA 4HYTB 1NTZK 3V5BA 1IJDB 3II6A 4AYCA 1FU1A 4C7NA 3MD0A 3MGNA 1GL2B 2N1TA 3TK1A 2YO3A 3V2RA 1J2JB 1HGVA 5CJ0A 2KP8A 1SQQK 2GUVA 4WY4C 2XKMA 3M9HA 2VRSA 1T3UA 2QM7A 2E43A 3EQ2A 5APUA 3RK3B 1G1IA 1GTWA 2P2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFN A;  1N2D C;  2GUS A;  3H6P A;  1EQ7 A;  1KFM A;  2GUV A;  1T8Z A;  2IX7 C;  1JCC A;  1JCD A; 
#chains in the Genus database with same CATH topology
 3HD7 C;  3L71 D;  2JKV A;  3V2P A;  1JY3 P;  1L2P A;  3L75 G;  3V2Q A;  1H89 A;  2NPS C;  4WY4 B;  4HJG H;  4OVN F;  2IBZ D;  3TSI A;  4D6T E;  1NTK E;  3G6E P;  2OAR A;  1URQ B;  3RK2 D;  1OVV A;  1YIT P;  1HTL C;  1QVF O;  1SQV K;  5AVX B;  2Y9Z A;  3BAT A;  3H1I D;  1KTM A;  1YHQ P;  4L75 A;  1GK6 A;  1MUU A;  1NOH A;  3CXH I;  3W68 A;  3OW2 O;  1DEB A;  1GK4 A;  1LJ2 A;  2FYN C;  2MJZ A;  5KKZ B;  1HWT C;  1HVV A;  3CCL P;  4K35 A;  1EQ7 A;  1FJK A;  1X79 B;  1KB9 H;  3CWB J;  4U3F D;  3H1I J;  1T2K D;  2WMM A;  1YBK A;  1NKZ B;  2W6A A;  1RQU A;  3WUU A;  3NXS A;  1JY3 O;  3CXH E;  3MZW B;  1RH5 B;  1QLE D;  1J1E C;  3AEA C;  3RL0 g;  1NTK D;  3BCC E;  4DCK A;  1RY3 A;  5DJU B;  5M1B A;  2ZYD A;  1X9V A;  2XV5 A;  1MZ9 A;  4PD4 I;  3ZDM A;  1L0N E;  1H8A A;  1L4A A;  5CMZ A;  1BE3 J;  5AVV B;  1G2C B;  3BRT B;  4ASV A;  1K9M Q;  3HE4 B;  2G8Y A;  1Y8A A;  3AE7 C;  2AXC A;  5AVT B;  1SQB E;  2Y9Y A;  3CI9 A;  1LTI C;  1VQ9 P;  1SQP G;  1WT6 A;  4GIF A;  4WY4 D;  1LWU C;  1GL2 C;  4RKU J;  1H0T A;  1NAF A;  3A3Y B;  1KOR A;  4OH8 B;  3WUT A;  1GW4 A;  5BVZ A;  3RK2 B;  1GD2 E;  1BGY G;  2KNC B;  2QSI A;  1SQX E;  3TGU G;  3UIA A;  1ZLL A;  3AE8 C;  3D70 A;  2YKP A;  4UB6 H;  1T8Z A;  4YTP C;  2FYU J;  5B5E E;  3L71 E;  3T97 B;  4PV1 B;  3VMX A;  1FOS F;  4L76 A;  3CC4 P;  1NU1 G;  2IFM A;  1LGH B;  1DH3 A;  2OTK E;  1JY2 O;  1DD3 A;  1N7S B;  2KS1 A;  1VQK P;  4RO0 A;  2M0B A;  1FDO A;  1IK7 A;  2R5B A;  2IBZ I;  3A2A A;  3SFD C;  1N8R Q;  1OWA A;  2BCC D;  3WU2 H;  3VMZ A;  2ZYA A;  4TLF A;  1KFN A;  1URQ D;  5TIS H;  2I1K A;  3CC2 P;  1AJY A;  2Z5H A;  3W67 A;  3L74 D;  1NTK J;  1HH0 A;  5CCG D;  1SQX J;  1NYH A;  2NPS B;  1JCC A;  3HTK A;  2L5G B;  2BAS A;  1BDC A;  3H32 B;  3L71 J;  2N1T B;  1LTT C;  3NTN A;  1BCC E;  3CWB D;  4U3F J;  3HRN A;  4KHX A;  4H13 D;  2H7H A;  4I6M C;  2ZYG A;  1LTG C;  3G9R A;  2GUS A;  2HPC A;  4OWF A;  1R5S A;  1Q90 D;  3HE5 B;  1A02 F;  1JM0 A;  3C8V A;  1JMB A;  4H13 B;  1OW8 A;  1NTM K;  1NU1 D;  3RL0 D;  4C7R A;  1YJW P;  1NJI Q;  2HLO A;  4H44 D;  1GDT A;  2E76 D;  2D2C B;  2Q3I A;  1N2D C;  2IPP A;  3P8C D;  1H0T B;  5GTH H;  1X0T A;  2KIK A;  1OIP A;  1S3J A;  2WZ7 A;  4GKG A;  1NVO A;  1OXZ A;  4LLH A;  2NPS A;  3D6Y A;  3V6I A;  1S2E A;  3LW5 J;  4U3F E;  1KIL B;  1OX3 A;  1BE3 E;  1CW5 A;  1OW6 A;  3L72 G;  1QVG O;  4I1L A;  3A0B E;  1FZE A;  5KTB A;  4H13 C;  3A5T A;  4Y28 J;  1SQB J;  2XDJ A;  2YNY A;  2ZT9 C;  3O6Q A;  4N78 E;  3BVH A;  1FC2 C;  1GZL A;  2H8P D;  3HUS C;  3CMA P;  1BSN A;  1PGO A;  3PP5 A;  5BU8 B;  1YI2 P;  1T6A A;  2FXP A;  3QH9 A;  2O1K A;  3OA7 A;  1LWU B;  1K05 A;  1SQP E;  2E75 C;  4PV1 D;  2YKO A;  4WB4 A;  1PPJ E;  2K1A A;  3ABV C;  3HTK B;  3SFE C;  1DD4 A;  1LP1 A;  1PP9 G;  1ZME C;  1Q2N A;  3TYY A;  1XTG B;  2ITA A;  4EDF A;  3H1J G;  3P8M C;  1L0N K;  2KOG A;  3I55 P;  1L0L D;  2O3J A;  5CCH D;  3RGU A;  2WSF H;  3IFM A;  1FBM A;  1RF0 C;  2E76 B;  2ZFC A;  1KB9 I;  1RE4 A;  2P1J A;  5L8R J;  5KJ7 C;  4K3A A;  1NTZ D;  2WTY A;  2HPC B;  1T2K C;  4RJT A;  4OGQ C;  2W6B A;  4Y99 B;  2IZ1 A;  1X8Y A;  2OYI B;  1M1J B;  1FZA A;  3FXD A;  1IFI A;  4JYC A;  3TGU E;  1NAY A;  2IBZ G;  2OGU A;  1PPJ D;  5CCH A;  2I8D A;  1VQ6 P;  1JO5 A;  1PL5 A;  2A45 I;  3I5C A;  5AW4 B;  3RBX A;  2QJP B;  2OTL P;  1L0L K;  2FFD C;  2WPS A;  2IYP A;  1BGY D;  1CSB A;  1MKM A;  1JEK A;  2PAJ A;  2O01 J;  2WSC H;  2WSC J;  1Y9B A;  3M9Q A;  4H44 B;  4IOI H;  3HD7 B;  5EFW B;  1CI6 B;  4XA4 A;  1JOC A;  4D6T J;  2AEM A;  5KLV J;  5APW A;  1NU1 K;  5AW6 B;  2OYH A;  1ZXG A;  2JO1 A;  1Y47 A;  2E5T A;  5CBN A;  1XTC C;  2E74 C;  2CPS A;  1FZC A;  1VQ4 P;  3CME P;  1LTJ C;  4RES B;  2O01 N;  3B71 A;  3F89 A;  3B5N B;  3OAK A;  5APX A;  2I1J A;  1ZP0 C;  3SWK A;  4CPG A;  2A06 E;  4DZO A;  3BAS A;  2B88 A;  2FKW B;  3RK3 C;  1RE3 C;  3CWB E;  2XU6 A;  3B5N D;  5APS A;  3QWO C;  2KSE A;  5KKZ C;  4M3L A;  1SQV J;  1EZV E;  1SQX K;  5KLV E;  3E1R A;  5E79 H;  5KLI B;  3GW6 A;  1VF5 C;  2KZI A;  2W6J H;  1LTA C;  1SVF A;  3GHG A;  3L35 A;  4W80 A;  3HD7 A;  3CCJ P;  1CI6 A;  3CLQ A;  1URQ C;  1PP9 D;  1W2E A;  2KK7 A;  3FGA D;  3FXE A;  2B87 A;  3CCM P;  2WPQ A;  2OYO A;  4HB1 A;  1OVU A;  4JPZ B;  2WQY C;  5AW5 B;  3Q5S A;  2O1J A;  1VQ5 P;  4DT0 A;  3CD6 P;  2ZXX A;  2E5Y A;  2V4H A;  2FBW C;  3H6P A;  1JMM A;  1JTH B;  2ZAE B;  5TJH A;  2P10 A;  1AQ5 A;  2FYZ A;  1PGP A;  2SPZ A;  3IF4 A;  4IL6 E;  1N73 B;  1X22 A;  2FXM A;  3H1L J;  1W2B O;  2PRR A;  3VTP C;  3GMA A;  5APV A;  4D6T D;  2ZVO B;  3V2N A;  4DJG A;  2JJL A;  2N1T C;  3L70 J;  3PHL A;  4YPC A;  1VQO P;  4Z1M H;  3VN0 A;  1EXI A;  5B66 H;  4WBA A;  1LNQ A;  3R2P A;  4ASW A;  1KIL E;  1PGJ A;  2OTJ P;  1OZH A;  3Q1M A;  1CZQ A;  3S9O A;  1S4X A;  3PJS K;  1JTH A;  1LT1 A;  2FY8 A;  3L75 J;  1LT9 C;  4XE5 B;  3TGU J;  2QJY C;  2WPR A;  3M0A A;  4PD4 D;  3CCU P;  4W7Y A;  2W27 A;  1Q7Y Q;  1EDK A;  1PPJ G;  3ITK A;  5TIS E;  3TDK A;  1ZW0 A;  2WT7 B;  1RF1 C;  2JWA A;  3WU2 E;  1SLQ A;  1USE A;  1YYC A;  3L72 D;  2QJP C;  5AW9 B;  2FFD B;  2FYU K;  1N7S A;  3H1H J;  2CK3 H;  1YQ3 C;  3V4W A;  1EZV I;  2ZT9 D;  2FYN B;  1OW7 A;  2PGD A;  5B5E H;  1Z56 A;  3AE5 C;  4UB6 E;  1HF9 A;  3FX0 A;  1BGY J;  5CCG A;  1QL2 A;  1U57 A;  2P67 A;  3EWK A;  1IFJ A;  3PLN A;  1IFP A;  1KYO I;  1RF1 B;  4JQ0 D;  3RK3 E;  2QRX A;  2FXO A;  2YXQ B;  4KT0 J;  3H1K J;  3A0H H;  2HG5 D;  3VMY A;  1JB0 J;  1ZV8 A;  2B89 A;  3KQG A;  2E75 B;  3SWY A;  2RH0 A;  3E1I A;  3H1I G;  3H1K D;  4AQR D;  1Q86 Q;  1L0L G;  5BU5 A;  3MUD C;  3V4Q A;  3RL0 B;  2R44 A;  3HE5 A;  1AA0 A;  3D6Z A;  1JCD A;  1NTK K;  5B66 E;  2ZJS E;  2MKV A;  1SQX G;  3AE6 C;  3HD7 D;  2WPV B;  5APQ A;  4YXD C;  1OVR A;  2K9J B;  1IK9 A;  2HOD A;  3AE3 C;  4TT3 H;  3NMD A;  3TGU D;  3CXH H;  1GU4 A;  4LGD E;  1G1J A;  4R4M A;  3H1I E;  4I7Z B;  4IL6 H;  1W5C E;  1NKN A;  2OQQ A;  5AW8 B;  3AEB C;  1HJB A;  4JBZ A;  1KB9 E;  1LTS C;  2Y0C A;  2H43 A;  1FOS E;  2ZT9 B;  3BCC J;  3IR9 A;  1SQP J;  3JSV C;  1BE3 G;  2QEX P;  4GT1 A;  2WT7 A;  1LWU A;  5CCH C;  2W83 C;  3SSU A;  1SQB K;  2KZJ A;  1A02 J;  1S5L X;  2R32 A;  3E7K A;  5E79 E;  4HKZ H;  2Q7C A;  3G3Z A;  1M90 Q;  3KDP B;  3BRV B;  3AEC C;  1FDI A;  1PP9 J;  2PP6 A;  5KLI C;  2DW3 A;  3L36 A;  1SQX D;  2C9L Y;  2E74 B;  1OFC X;  2E75 D;  3AED C;  2JR8 A;  1KIL A;  3O8Z A;  2P58 A;  3H1H E;  1NTZ J;  3B5N A;  1VDF A;  2RKL A;  1FAV A;  1J1E B;  3AEG C;  3HUS B;  1KFM A;  1QX8 A;  1KYO E;  2J58 A;  1PFI A;  3N7N A;  2R3C A;  4H0L D;  4JF7 A;  1M7L A;  1U7J A;  2W8Z A;  3MIW A;  1WRG A;  1SQP K;  3TNU B;  3M91 A;  5AW0 B;  3KHU A;  1QGK B;  1FDM A;  2WSF J;  3H1L G;  2KXP B;  1N86 A;  3H1K E;  4U3F G;  4BRY A;  3HUS A;  1NWQ A;  3L4F A;  4O9B A;  2Q1K A;  4JYB A;  1S5L E;  4H44 C;  2YKQ A;  1ZN5 A;  2RN0 A;  3IAO A;  3P32 A;  2P7J A;  2WIT A;  1JY2 P;  1NU1 E;  3L72 J;  2AEF A;  4ZNC A;  1JY2 N;  1S9K D;  1EZV D;  1L4A D;  5DJT B;  1NHL A;  2LXC B;  4I2L C;  2NRG A;  2W90 A;  1E79 H;  1HJ0 A;  1S72 P;  2CPB A;  2E74 D;  2R3S A;  3AE9 C;  1SQQ G;  3P8C E;  4LC1 A;  5AVU B;  5CCG C;  2KLU A;  1NTM D;  2KB7 P;  3CX5 I;  3KZI H;  1K8A Q;  5AVZ B;  2XND H;  3C1L A;  3LW5 H;  4ZKU A;  5KLV K;  2NPS D;  2BEQ D;  2QJY B;  1PGQ A;  4WY4 A;  1NU1 J;  1PV3 A;  2WVR A;  3H1J J;  3Q2Y A;  1URQ A;  1EZV G;  3A7O A;  1HBW A;  2J5U A;  4PJ0 H;  1ZRT D;  3L74 G;  1VQL P;  1M56 D;  3M0D A;  3GF7 A;  1SFC D;  2B87 B;  1DX7 A;  2BCC G;  3A0B H;  1KIL D;  1U7M A;  2M3E A;  3RK2 C;  2LKM A;  2QJK B;  1JY3 N;  1BCC G;  1LP1 B;  3L70 D;  4EIJ A;  1GL2 D;  1KB9 D;  1UIX A;  1NTZ E;  2K88 A;  1N73 C;  1NO4 A;  3F5H A;  1VF5 B;  3IN6 A;  1SQB D;  2IYO A;  3H1L D;  2NZ2 A;  5GTH E;  1RQV A;  2D2C D;  2YXR B;  3CL3 D;  1HUC A;  2AXT H;  5AVW B;  1KZU B;  3L75 E;  1FZC C;  1FZF A;  4AUW A;  2IFN A;  4NPD A;  5H2F E;  1SS1 A;  2Y0E A;  3C9I A;  1SQP D;  2GM4 A;  3BCC D;  1LT9 B;  1L0N D;  1MFT A;  1VL2 A;  2A45 G;  2O01 H;  1SFC A;  4OGQ D;  5APT A;  3D71 A;  1KD1 Q;  4IFM A;  2KYV A;  2GA1 A;  5AVR B;  1DEE G;  4ZMD A;  2FFD A;  3B5N C;  1T3J A;  1SP4 A;  1D7M A;  2WSE H;  3L73 D;  5KAF H;  3OJA B;  5GTI E;  1E5W A;  2K37 A;  5AW1 B;  3U1C A;  3WUV A;  1BGY E;  1M1K Q;  1P84 I;  3G71 P;  2B9B A;  2JDI H;  1JUN A;  1YTZ I;  3GHG B;  3GLM A;  4PD4 E;  5CJ4 A;  3MUD A;  3L73 J;  1SFC B;  1BE3 D;  1GMJ A;  1VPC A;  1M8O B;  4N6J A;  3VYI A;  4IL6 X;  1AV1 A;  1IFN A;  2A45 H;  5AW2 B;  1VQP P;  1IC2 A;  3K5B A;  5KAF E;  1P84 H;  4BWN A;  3M06 A;  3L74 J;  1L0N G;  2LXB A;  5AVQ B;  3CX5 E;  5CBO A;  2C9N Y;  4B86 A;  2BCC J;  1EDJ A;  4ZKP A;  1VQM P;  2JWD A;  1NTK G;  1ZRT E;  3FWN A;  2IBZ E;  3CWB G;  2QG4 A;  2WSE J;  1PZQ A;  3L37 A;  4UB8 H;  3Q3D A;  2E42 A;  1BCC J;  1RHZ B;  1ZOY C;  1M1J C;  1QL1 A;  2KUB A;  3S1K A;  1N7L A;  3VP9 A;  1AVO A;  2OYI C;  2OYH B;  3H1J D;  2FYU D;  2N9B A;  3H32 A;  1BCC D;  3L70 G;  1SQV E;  4BXL A;  1KQS O;  1YJ9 P;  1AQT A;  2G3A A;  3NFQ A;  2YMK A;  3L71 G;  3L74 E;  4GOE A;  3G4S P;  1L4A B;  1KMI Z;  2HOD B;  3CCV P;  2KS1 B;  1H88 A;  4GDO A;  3GF3 A;  1ZR2 A;  3B8E B;  5APY A;  5AVS B;  4WWI A;  1NTM E;  4EI2 A;  3LID A;  2JEE A;  3N4X A;  5C39 A;  5KJ7 A;  1N73 A;  2POH A;  3MTU E;  1VQ7 P;  1LTJ B;  1LTB C;  2H89 C;  4L74 A;  1MFZ A;  3MP7 B;  3U59 A;  1JNM A;  4GOD A;  1P84 D;  1DIP A;  1USD A;  2L91 A;  4BRY B;  3M0D C;  1GW3 A;  4KJM A;  2Q3E A;  1EDL A;  1FZC B;  1NTM G;  2BEZ F;  1VF5 D;  4QMA A;  1SQQ D;  3KXD A;  5CHX A;  2KLV A;  4R4L A;  1R8E A;  1G2C A;  2R5D A;  3L73 G;  4OGQ B;  4U7J A;  4H0L B;  4Y99 C;  4UB8 E;  4A7P A;  4D6T G;  3CCR P;  5KJ7 D;  1VQ8 P;  3CC7 P;  4N3Y B;  2A06 D;  4N78 D;  1MV8 A;  3CX5 H;  2C0X A;  1L0N J;  4IFF A;  3H1K G;  2M3B A;  2HR3 A;  3VP8 A;  3SWF A;  1IO4 A;  1P84 E;  2IDB A;  1AFO A;  3L73 E;  1KQF B;  1EC5 A;  4W7Z A;  3USS A;  3GHG C;  3H25 A;  2N9Y B;  2C0W A;  3RL0 C;  2V7Q J;  2PFX A;  3A0H E;  4H0L C;  4PD4 H;  1R5L A;  1SQB G;  5AVY B;  1BSH A;  3CCE P;  1S1C X;  2UWJ E;  3EFG A;  4EOT A;  3I56 P;  3VMA A;  5GTI H;  4MN4 C;  1L0L E;  1N7S D;  2HFE D;  3GG2 A;  3L72 E;  1K04 A;  1NTZ G;  2WWW A;  2M5A B;  4I7Z C;  3MHV A;  4NPE A;  2QVA A;  3VOP A;  1YIJ P;  2YIU B;  2Z4E A;  2Q5U A;  2LR2 A;  3JCU E;  2M8R A;  1LTJ A;  2KI7 B;  3T97 A;  1M1J A;  1IFD A;  2A06 G;  2WSS H;  3M9B A;  2H88 C;  2K3R A;  2OYI A;  3LIE A;  1J1D B;  2QM8 A;  3S4R A;  2Y0D A;  3PTZ A;  2YMY A;  3CX5 D;  5H2F H;  4C7N B;  5KAI H;  2OYH C;  3CCQ P;  3CPW O;  4IFD K;  2AXT E;  1HGZ A;  2N1T D;  3H1H D;  1GU5 A;  1KN7 A;  1EXJ A;  3WMM 0;  1NTM J;  3KYQ A;  5AW3 B;  1K73 Q;  1SQV D;  2KSJ A;  1KIL C;  4HH2 A;  2KNC A;  2QE7 H;  3H1J E;  2RMZ A;  2ZVN B;  4C46 A;  1Q81 Q;  1EDI A;  2YO2 A;  1NH4 A;  1RE3 A;  2XNX A;  1UII A;  5K5G B;  1KQG B;  5AW7 B;  1PIX A;  1J1D C;  2D2C C;  1FZG A;  1RE4 C;  3AEF C;  1YTZ T;  2IZ0 A;  4GOF A;  3HE4 A;  2XZR A;  4PJ0 E;  2J59 M;  3KPE A;  2K9J A;  2AEJ A;  1SQQ J;  1FZB A;  5KLV D;  3CCS P;  2ZXE B;  3H1H G;  3P7K A;  1YQ4 C;  3RBZ A;  3U1A A;  3O6Q B;  1FJP A;  1GL2 A;  1SFC C;  2FYU G;  2K9Y A;  1S9K E;  3RK3 D;  3KZI E;  4L73 A;  2Z5I A;  4PV1 C;  1ZR4 A;  1KQL A;  1OMI A;  4EYY Q;  1N7S C;  3Q5P A;  1IFM A;  1WMK A;  1PP9 E;  1BDD A;  3AE4 C;  4XFJ A;  1L4A C;  2IX7 C;  3H1L E;  1NGM B;  1KYO D;  1RF1 A;  3TNU A;  3L70 E;  2Q6Q A;  3JC2 2;  1SQQ E;  3EFF K;  4DOJ A;  2QJK C;  3TF5 A;  1VQN P;  1RF0 A;  2HYN A;  3CXH D;  1FS0 E;  1LT9 A;  2Q9I A;  4HYT B;  1NTZ K;  3V5B A;  1L0L J;  4WVZ A;  1Q82 Q;  1IJD B;  1FE6 A;  3II6 A;  4AYC A;  3R4Y A;  1M57 D;  1S5L H;  1FU1 A;  3L75 D;  1AVY A;  3AE2 C;  4C7N A;  3MD0 A;  1IZN B;  3MGN A;  2V7Q H;  3B4S A;  5KAI E;  1GL2 B;  5KLV G;  2N1T A;  2E76 C;  3AE1 C;  4NPF X;  2YO3 A;  3TK1 A;  3V2R A;  2YIU C;  1J2J B;  1HGV A;  2JP3 A;  2KP8 A;  5CJ0 A;  3JCU H;  1SQQ K;  4YXW H;  2GUV A;  4WY4 C;  2QA4 P;  2XKM A;  1KC8 Q;  2M5A A;  3AEE C;  2VRS A;  3M9H A;  3PH0 A;  1YJN P;  1T3U A;  2BCC E;  2QM7 A;  1TU3 F;  1QEX A;  2FYU E;  3PRJ A;  1KYO H;  1KV4 A;  3FWL A;  3BCC G;  3EQ2 A;  3Q5R A;  2E43 A;  5APU A;  3RK3 B;  1SQV G;  1G1I A;  2QIW A;  1GTW A;  2P2U A; 
#chains in the Genus database with same CATH homology
 3HD7 C;  3V2P A;  1JY3 P;  3V2Q A;  1H89 A;  2NPS C;  4WY4 B;  3TSI A;  2OAR A;  1URQ B;  3RK2 D;  1HTL C;  1SQV K;  5AVX B;  3BAT A;  1GK6 A;  1MUU A;  1NOH A;  1DEB A;  1GK4 A;  1HWT C;  2MJZ A;  1HVV A;  1EQ7 A;  1FJK A;  1X79 B;  1NKZ B;  2W6A A;  3NXS A;  1JY3 O;  1J1E C;  1RY3 A;  1X9V A;  2XV5 A;  1MZ9 A;  1H8A A;  1L4A A;  5CMZ A;  5AVV B;  1G2C B;  3BRT B;  3HE4 B;  5AVT B;  3CI9 A;  1LTI C;  1WT6 A;  4GIF A;  4WY4 D;  1LWU C;  1GL2 C;  1NAF A;  3A3Y B;  4OH8 B;  1GW4 A;  5BVZ A;  3RK2 B;  1GD2 E;  3UIA A;  1ZLL A;  2YKP A;  1T8Z A;  3VMX A;  1FOS F;  2IFM A;  1LGH B;  1DH3 A;  1JY2 O;  1N7S B;  2R5B A;  3A2A A;  1OWA A;  3VMZ A;  1KFN A;  1URQ D;  2I1K A;  2Z5H A;  1HH0 A;  5CCG D;  2NPS B;  1JCC A;  3HTK A;  2L5G B;  2BAS A;  3H32 B;  2N1T B;  1LTT C;  3NTN A;  3HRN A;  4KHX A;  2H7H A;  4I6M C;  1LTG C;  2GUS A;  2HPC A;  3HE5 B;  1A02 F;  3RL0 D;  1NTM K;  4C7R A;  2HLO A;  1GDT A;  2Q3I A;  1N2D C;  2IPP A;  3P8C D;  2WZ7 A;  4GKG A;  4LLH A;  1OXZ A;  2NPS A;  1KIL B;  1CW5 A;  4I1L A;  1FZE A;  5KTB A;  3A5T A;  2XDJ A;  2YNY A;  4N78 E;  3BVH A;  1GZL A;  3HUS C;  2H8P D;  5BU8 B;  3PP5 A;  2O1K A;  3OA7 A;  1LWU B;  2YKO A;  4WB4 A;  3HTK B;  3TYY A;  1XTG B;  3P8M C;  1L0N K;  2KOG A;  5CCH D;  2WSF H;  3IFM A;  2ZFC A;  1RF0 C;  1FBM A;  1RE4 A;  2P1J A;  5KJ7 C;  2WTY A;  1T2K C;  2W6B A;  4Y99 B;  1X8Y A;  2OYI B;  1M1J B;  1FZA A;  1IFI A;  4JYC A;  5CCH A;  1JO5 A;  2A45 I;  3I5C A;  5AW4 B;  1L0L K;  2FFD C;  2WPS A;  1CSB A;  2WSC H;  2PAJ A;  3M9Q A;  3HD7 B;  1CI6 B;  4XA4 A;  1JOC A;  2OYH A;  5APW A;  1NU1 K;  5AW6 B;  1XTC C;  2CPS A;  1FZC A;  1LTJ C;  4RES B;  5APX A;  2HPC B;  3B5N B;  3OAK A;  4DZO A;  2I1J A;  3BAS A;  2FKW B;  3RK3 C;  1RE3 C;  2XU6 A;  3B5N D;  5APS A;  4M3L A;  1SQX K;  3GHG A;  3L35 A;  4W80 A;  1LTA C;  1SVF A;  3HD7 A;  1CI6 A;  3CLQ A;  1URQ C;  1W2E A;  2WPQ A;  5AW5 B;  2O1J A;  3H6P A;  1JMM A;  1JTH B;  1AQ5 A;  2FYZ A;  1N73 B;  2FXM A;  3VTP C;  5APV A;  3V2N A;  2JJL A;  2N1T C;  3VN0 A;  4WBA A;  3R2P A;  1CZQ A;  1JTH A;  4XE5 B;  1LT9 C;  2WPR A;  3M0A A;  4W7Y A;  2W27 A;  2WT7 B;  1RF1 C;  1SLQ A;  1YYC A;  5AW9 B;  2FFD B;  2FYU K;  1N7S A;  3V4W A;  1Z56 A;  5CCG A;  1QL2 A;  2P67 A;  1IFJ A;  1RF1 B;  2HG5 D;  3VMY A;  1ZV8 A;  3KQG A;  3SWY A;  3E1I A;  4AQR D;  5BU5 A;  3V4Q A;  3RL0 B;  3HE5 A;  1JCD A;  1NTK K;  3HD7 D;  5APQ A;  1IK9 A;  2HOD A;  1GU4 A;  3NMD A;  4LGD E;  1G1J A;  1NKN A;  5AW8 B;  1HJB A;  1LTS C;  2H43 A;  1FOS E;  3IR9 A;  4GT1 A;  2WT7 A;  1LWU A;  5CCH C;  1SQB K;  1A02 J;  2R32 A;  2Q7C A;  3G3Z A;  3KDP B;  3BRV B;  2PP6 A;  2C9L Y;  3L36 A;  1KIL A;  3O8Z A;  3HUS B;  3B5N A;  3SWF A;  1VDF A;  1FAV A;  1J1E B;  1KFM A;  1PFI A;  2J58 A;  3N7N A;  2R3C A;  4JF7 A;  1M7L A;  3MIW A;  1WRG A;  1SQP K;  3TNU B;  3M91 A;  5AW0 B;  1FDM A;  1N86 A;  3HUS A;  1NWQ A;  3L4F A;  4O9B A;  4JYB A;  2YKQ A;  1ZN5 A;  3P32 A;  2P7J A;  2WIT A;  1JY2 P;  1JY2 N;  1S9K D;  1L4A D;  1NHL A;  4I2L C;  2CPB A;  3P8C E;  4LC1 A;  5AVU B;  5CCG C;  2KB7 P;  5AVZ B;  3LW5 H;  4ZKU A;  5KLV K;  2NPS D;  4WY4 A;  1URQ A;  3A7O A;  1HBW A;  3M0D A;  1SFC D;  1DX7 A;  1KIL D;  3RK2 C;  2LKM A;  1JY3 N;  1N73 C;  4EIJ A;  1GL2 D;  1NO4 A;  3CL3 D;  1HUC A;  1KZU B;  1FZC C;  1FZF A;  2IFN A;  3C9I A;  2GM4 A;  1T2K D;  1LT9 B;  2O01 H;  2A45 G;  5APT A;  1SFC A;  4IFM A;  2KYV A;  5AVR B;  2FFD A;  3B5N C;  1T3J A;  1SP4 A;  2WSE H;  3OJA B;  1E5W A;  5AW1 B;  3U1C A;  1JUN A;  1YTZ I;  3GHG B;  5CJ4 A;  3MUD A;  1SFC B;  1VPC A;  4N6J A;  3VYI A;  1IFN A;  2A45 H;  5AW2 B;  1IC2 A;  3M06 A;  5AVQ B;  2C9N Y;  4B86 A;  4ZKP A;  5AVW B;  4AUW A;  3L37 A;  2E42 A;  2OYI C;  1M1J C;  1QL1 A;  1N7L A;  3VP9 A;  2OYH B;  2N9B A;  3H32 A;  3NFQ A;  1L4A B;  1H88 A;  2HOD B;  1ZR2 A;  3B8E B;  5APY A;  5AVS B;  3LID A;  2JEE A;  3N4X A;  5KJ7 A;  1N73 A;  2POH A;  3MTU E;  1LTJ B;  1LTB C;  3U59 A;  1MFZ A;  1JNM A;  3M0D C;  1GW3 A;  1FZC B;  5CHX A;  2KLV A;  1G2C A;  2R5D A;  4Y99 C;  5KJ7 D;  4N3Y B;  4N78 D;  1MV8 A;  2C0X A;  4IFF A;  2M3B A;  1IO4 A;  3VP8 A;  1AFO A;  4W7Z A;  3GHG C;  2C0W A;  3RL0 C;  5AVY B;  3EFG A;  4EOT A;  1N7S D;  2HFE D;  2WWW A;  3VOP A;  2Z4E A;  2Q5U A;  2M8R A;  1LTJ A;  3T97 A;  1M1J A;  1IFD A;  3M9B A;  2OYI A;  3LIE A;  1J1D B;  2QM8 A;  2OYH C;  2YMY A;  4C7N B;  4IFD K;  1HGZ A;  2N1T D;  1GU5 A;  3WMM 0;  3KYQ A;  5AW3 B;  2KSJ A;  1KIL C;  4HH2 A;  4C46 A;  2YO2 A;  1NH4 A;  1RE3 A;  2XNX A;  5AW7 B;  1J1D C;  1FZG A;  1RE4 C;  1YTZ T;  3HE4 A;  2XZR A;  2J59 M;  3KPE A;  1FZB A;  1FJP A;  2ZXE B;  3P7K A;  3U1A A;  1GL2 A;  1SFC C;  1S9K E;  3RK3 D;  1ZR4 A;  2Z5I A;  1KQL A;  1N7S C;  1IFM A;  1L4A C;  2IX7 C;  1RF1 A;  3TNU A;  4DOJ A;  1RF0 A;  2HYN A;  1LT9 A;  2Q9I A;  4HYT B;  1NTZ K;  3V5B A;  1IJD B;  3II6 A;  4AYC A;  1FU1 A;  4C7N A;  3MD0 A;  3MGN A;  1GL2 B;  2N1T A;  3TK1 A;  2YO3 A;  3V2R A;  1J2J B;  1HGV A;  5CJ0 A;  2KP8 A;  1SQQ K;  2GUV A;  4WY4 C;  2XKM A;  3M9H A;  2VRS A;  1T3U A;  2QM7 A;  2E43 A;  3EQ2 A;  5APU A;  3RK3 B;  1G1I A;  1GTW A;  2P2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...