3H6QA

Macrocypin, a beta-trefoil cysteine protease inhibitor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
168
structure length
168
Chain Sequence
b'GFEDGFYTILHLAEGQHPNSKIPGGMYASSKDGKDVPVTAEPLGPQSKIRWWIARDPQAGDDMYTITEFRIDNSIPGQWSRSPVETEVPVYLYDRIKAEETGYTCAWRIQPADHGADGVYHIVGNVRIGSTDWADLREEYGEPQVYMKPVPVIPNVYIPRWFILGYEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrocypin 1a
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
source organism Macrolepiota procera
molecule tags Hydrolase/hydrolase inhibitor
total genus 32
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3h6qA00
1BFGA 1AVAC 2QN4A 2Z48A 1QQLA 1ISWA 5B2HA 2KI6B 5FZUA 1HWOB 1ONKB 4WBCA 3WINA 1JY0A 4J2YA 1FGAA 1DJSB 4J2XA 5F8YA 3LLPA 3A07A 2VUAA 2AQZA 4GAFA 1D0HA 3N7LA 3ZX7A 1BFBA 3SNVA 4CJMA 3F62B 4Z9WB 3N7MA 1G9CA 4QD2C 1DFCA 3BA7A 3BADA 3O3QA 3QR5A 4JAWA 3IM7A 3JUTA 4ZKTB 2ZQNA 2K4AB 2GO2A 1J0SA 4QBCA 5DVHA 3OJVA 4LO7C 4KEJA 1W3GA 2WBCA 3CAHA 4QALA 2X2SA 4R6UB 4GAIA 1OQLB 3BAVA 2ERMA 1DIWA 3FJFA 1G9AA 3RTJB 2FFUA 4A7YA 4ZFWB 1ISZA 4G1RA 4IZXA 4OEEA 3FFZA 4ZFYB 2R9KB 4OUJA 3OGFA 2D43A 3V0AB 1MD6A 3CA1A 3CU1B 2IHOA 3VSZA 1V6UA 3AKIA 3B9UA 1TWMA 3ZXGA 3WMUA 1S0CA 1L2HA 1N4KA 4YOLA 2HWAA 1DZCA 1DQGA 3D7WB 3KMVA 4AN6A 5BXRA 1IILA 1QXMA 1HWPB 1WD3A 2LIEA 1FV2A 3T8SA 3WO4A 3IAGC 1E0OA 1FV3A 3AJ6A 1JLYA 1T4QA 2D7IA 3PG0A 3ZC9A 4EFPA 3WMVA 4JQ0A 1DQOA 1R8NA 3IIRA 4QBVA 4J23B 1SR4A 2ZR1B 1BA7A 1WBAA 1DLLA 4I4QA 1JTCA 4IHZA 4USOA 4I4UA 3HBWA 3UD9A 1HCEA 3FJKA 3HN1A 5GAQA 4OW4A 3PHZA 1PC8B 2RG9B 3O4DA 4II0A 5EG6C 4GOVA 3AJ5A 3NBDA 2F8XC 3CA3A 3N7KA 4I4VA 4TLPA 4G6MA 4OEFA 2AFGA 3VT2A 1ILR1 4A7ZA 2WRYA 3F1RA 5DZUA 2X2TA 3EF2A 1JLXA 2BEBA 4XKIA 3RTIB 2FGFA 3BAOA 4F83A 1HKNA 2VXTI 4OWLA 1JQZA 2BEAA 4L4IA 1FQ9A 4I37A 1AFCA 5F8WA 2XOAA 4HR6C 3CA4A 4I2SA 1KNMA 4JKXB 1M2TB 1IRAX 1TIEA 4G6JA 5FNXA 3JRRA 4LO0C 1V6XA 4DEPA 4F34A 3O44A 3V79C 1DFQA 1R8OA 4EFQA 4A7KA 1FWUA 2FFVA 3FJDA 5BQUC 4IQPA 2MIBA 1Q04A 2VU9A 2HZ9A 1PZZA 4LO1C 4X3AA 3VEQA 4I3NA 2LIQA 3HALA 4KBBA 2UUSA 3FUQA 3NBCA 3CA0A 3N0KA 4LO3A 2D7RA 3E8LC 1PUMB 3AZWA 3WINC 3CA6A 3BRGC 3H6QA 1K5VA 4JP0A 3P6IA 1FMZA 1Z4SA 2KKIA 2HW9A 3H6RA 3AH1A 3RMYA 2VXRA 8I1BA 21BIA 1ISXA 3HMYA 2RSTA 3ZXDA 1PUUB 3MALA 4I1BA 2AAIB 4ENDA 4LO2A 1BASA 3BB2A 3HOMA 1WBCA 1EVTA 2DREA 4Z8SB 3NBNA 1YXWA 3CQAA 2D24A 2IWTB 1A8DA 9ILBA 3AZVA 1M16A 1YBIA 1F31A 4DENA 1XYFA 3Q7WA 3W9TA 2D44A 2VSAA 1AVUA 2YUGA 1II4A 4FGFA 3O4OA 1IRPA 4I4SA 2ET2A 2K43A 4I6IA 1TOOA 3FUOA 2AXMA 2KLLA 4XFTA 3BX1C 2Y9WC 1BFFA 4L4HA 3Q7YA 1ABRB 1RZOB 1IT0A 2MC2A 4QKRA 1FMMS 5D63A 3NJ5A 4J2KA 2VSEA 1HWMB 1Z2VA 3PUBA 4JRAA 4KEIA 4QC4A 1BLAA 5I1BA 4KC3A 3UJ4A 3P53A 3BAGA 2F2FA 3BTAA 1MC9A 2Q3NB 4I4YA 2E4MC 3AKFA 1S0BA 4OEGA 5E24E 1IOBA 1W3FA 3UDAA 41BIA 1G9BA 4HA2A 2M49A 4EEEB 1SR4C 2KI4A 1YTOA 3Q7XA 1JT3A 5G00A 4D8HA 1RMLA 2NYYA 1AXMA 3P6JA 4ISRA 4EFRA 2J3PA 1YYNA 5F8SA 4IZEA 3BAHA 3FJ8A 5EC5A 3UD7A 1EYLA 4X39A 3CRHA 1G9DA 1I1BA 2MLLB 4HJJA 4H9WA 3OJMA 3AH2A 2DS0A 2QYIB 3VT0A 3H6RB 4I4XA 1TTUA 1ITBA 3UJ0A 1BARA 1T9FA 3FGMA 3VUOA 3NBEA 4FVVA 3OGGA 2D1ZA 4LO7B 2NVHA 5BP5A 5JMCA 4I8MA 1EV2A 4I7IA 4LO0A 1YF8B 4I0YA 2HWMA 4P0LA 1XHBA 4GOYA 5FZYA 4EB2B 3AKGA 1AVWB 3WO2A 3A21A 5JLVA 3O49A 5BQUA 4KEKA 3ZC8A 1AVXB 3I2AA 4ZFUB 3A23A 3K1XA 1AF9A 1VCLA 5BXPA 4P6AA 5BOWA 1S0DA 4ZOTA 2BFHA 3S8JA 2DRYA 4I4RA 4G9NA 1JT7A 1XG6A 1CE7B 2Y9GA 2K8RA 1TFMB 2NP0A 4LO3C 3R4UA 1V6VA 1RG8A 1Z0HA 3BAUA 4G9MA 2I1BA 3OBRA 3WA1A 4PC4A 3BRFA 4ISQA 1Q1UA 4X37A 1EPWA 4QO3A 1ISYA 1S0FA 2P23A 3MPPG 1XZZA 3VWCA 5BVPI 1I1EA 3VSFA 1S0LA 3A22A 5D61A 3O4CA 4I1EA 1HCDA 5DSSB 2Z49A 3FJBA 1Q03A 3BA5A 4LO2C 5HPZA 4I96A 3CRIA 3TC2A 2Y9FA 4ZBVB 4ZLBB 4XFUA 3AKHA 5F90A 3CA5A 3HSMA 1ISVA 2GZBA 3IM5A 4I4OA 4Q9GA 1FN0A 3LTQA 4D0TA 2ZQOA 1TWEA 3V0BB 4QKSA 4ZA3B 1SZ6B 3H6SE 3RSJA 3N7JA 31BIA 2DRZA 4JPZA 4OWJA 1HIBA 2P39A 1GGPB 1FWVA 4P0JA 3ILAA 4LO8B 1K5UA 3BAQA 3OBTA 3FJEA 1BFCA 2NM1A 4USPA 1P63A 4GP0A 2E4MA 3I29B 3QYDA 2Q9XA 2VLCA 5D62A 3R4SA 4H04A 4GP3A 1RY7A 2D23A 1DZDA 3OJ2A 1IHKA 2F2FC 5BXSA 1S0GA 3O5WB 5FNWA 6I1BA 3FJJA 3VT1A 3AH4A 3WO3A 4EKXB 1V6WA 1S0EA 3O4BA 3FJCA 1QQKA 2ESUA 3V0AA 1PWAA 4DCKC 2Y9XE 2NZ9A 3UD8A 2FDBM 3V0BA 5FZZA 3CRGA 4IY8A 3C9ZA 1JT5A 1UPSA 3I2XA 3IM6A 2D22A 4I4PA 2KH2A 1WD4A 4OWKA 4Q9PA 4QD2B 7I1BA 4IYBA 4IONA 3BA4A 3S8KA 2RQ9A 3FJAA 1HWNB 4Q91A 3O4AA 3BRDA 3POKA 2FO1A 3PMEA 1NZKA 3FJHA 4JKQA 4D0ZA 1CVSA 4IY9A 3FJ9A 1IJTA 1NUNA 5DUYA 5EHAA 4AN7B 1BLDA 1W3AA 4ZGRB 4P0KA 2L5XA 1TP0A 4X38A 3RMXA 4LO1A 4XFSA 5BXTA 1G82A 5BP5C 2NTDA 3FJIA 4J2SA 1JT4A 2D20A
chains in the Genus database with same CATH superfamily
1BFGA 1AVAC 2QN4A 2Z48A 1QQLA 1ISWA 5B2HA 2KI6B 5FZUA 1HWOB 1ONKB 4WBCA 3WINA 1JY0A 4J2YA 4MZGB 1FGAA 1DJSB 4J2XA 5F8YA 3LLPA 3A07A 2VUAA 2AQZA 4GAFA 1D0HA 3N7LA 3ZX7A 1BFBA 3SNVA 4CJMA 3F62B 4Z9WB 3N7MA 1G9CA 4QD2C 1DFCA 3BA7A 3BADA 3O3QA 3QR5A 4JAWA 3IM7A 3JUTA 4ZKTB 2ZQNA 2K4AB 2GO2A 1J0SA 4QBCA 5DVHA 3OJVA 4LO7C 4KEJA 1W3GA 2WBCA 3CAHA 4QALA 2X2SA 4R6UB 4GAIA 1OQLB 3BAVA 2ERMA 1DIWA 3FJFA 1G9AA 3RTJB 2FFUA 4A7YA 4ZFWB 1ISZA 4G1RA 4IZXA 4OEEA 3FFZA 4ZFYB 2R9KB 4UY4A 4OUJA 3OGFA 2D43A 3V0AB 1MD6A 3CA1A 3CU1B 2IHOA 3VSZA 1V6UA 3AKIA 3B9UA 1TWMA 3ZXGA 3WMUA 1S0CA 1L2HA 1N4KA 4YOLA 2HWAA 1DZCA 1DQGA 3D7WB 3KMVA 4AN6A 5BXRA 1IILA 1QXMA 1HWPB 1WD3A 2LIEA 1FV2A 3T8SA 3WO4A 3IAGC 1E0OA 1FV3A 3AJ6A 1JLYA 1T4QA 2D7IA 3PG0A 3ZC9A 4EFPA 3WMVA 4JQ0A 1DQOA 1R8NA 3IIRA 4QBVA 4J23B 1SR4A 2ZR1B 1BA7A 1WBAA 1DLLA 4I4QA 1JTCA 4IHZA 4USOA 4I4UA 3HBWA 3UD9A 1HCEA 3FJKA 3HN1A 5GAQA 4OW4A 3PHZA 1PC8B 2RG9B 3O4DA 4II0A 5EG6C 4GOVA 3AJ5A 3NBDA 2F8XC 3CA3A 3N7KA 4I4VA 4TLPA 4G6MA 4OEFA 2AFGA 3VT2A 1ILR1 4A7ZA 2WRYA 3F1RA 5DZUA 2X2TA 3EF2A 1JLXA 2BEBA 4XKIA 3RTIB 2FGFA 3BAOA 4F83A 1HKNA 2VXTI 4OWLA 1JQZA 2BEAA 4L4IA 1FQ9A 4I37A 1AFCA 5F8WA 2XOAA 4HR6C 3CA4A 4I2SA 1KNMA 4JKXB 1M2TB 1IRAX 1TIEA 4G6JA 5FNXA 3JRRA 4LO0C 1V6XA 4DEPA 4F34A 3O44A 3V79C 1DFQA 1R8OA 4EFQA 4A7KA 1FWUA 2FFVA 3FJDA 5BQUC 4IQPA 2MIBA 1Q04A 2VU9A 2HZ9A 1PZZA 4LO1C 4X3AA 3VEQA 4I3NA 2LIQA 3HALA 4KBBA 2UUSA 3FUQA 3NBCA 3CA0A 3N0KA 4MZFB 4LO3A 2D7RA 3E8LC 1PUMB 3AZWA 3WINC 3CA6A 3BRGC 3H6QA 1K5VA 4JP0A 3P6IA 1FMZA 1Z4SA 2KKIA 2HW9A 3H6RA 3AH1A 3RMYA 2VXRA 8I1BA 21BIA 1ISXA 3HMYA 2RSTA 3ZXDA 1PUUB 3MALA 4I1BA 2AAIB 4ENDA 4LO2A 1BASA 3BB2A 3HOMA 1WBCA 1EVTA 2DREA 4Z8SB 3NBNA 1YXWA 3CQAA 2D24A 2IWTB 1A8DA 9ILBA 3AZVA 1M16A 1YBIA 1F31A 4DENA 1XYFA 3Q7WA 3W9TA 2D44A 2VSAA 1AVUA 2YUGA 1II4A 4FGFA 3O4OA 1IRPA 4I4SA 2ET2A 2K43A 4I6IA 1TOOA 3FUOA 2AXMA 2KLLA 4XFTA 3BX1C 2Y9WC 1BFFA 4L4HA 3Q7YA 1ABRB 1RZOB 1IT0A 2MC2A 4QKRA 1FMMS 5D63A 3NJ5A 4J2KA 2VSEA 1HWMB 1Z2VA 3PUBA 4JRAA 4KEIA 4QC4A 1BLAA 5I1BA 4KC3A 3UJ4A 3P53A 3BAGA 2F2FA 3BTAA 1MC9A 2Q3NB 4I4YA 2E4MC 3AKFA 1S0BA 4OEGA 5E24E 1IOBA 1W3FA 3UDAA 41BIA 1G9BA 4HA2A 2M49A 4EEEB 1SR4C 4H75A 2KI4A 1YTOA 3Q7XA 1JT3A 5G00A 4D8HA 1RMLA 2NYYA 1AXMA 3P6JA 4ISRA 4EFRA 2J3PA 1YYNA 5F8SA 4IZEA 3BAHA 3FJ8A 5EC5A 3UD7A 1EYLA 4X39A 3CRHA 1G9DA 1I1BA 2MLLB 4HJJA 4H9WA 3OJMA 3AH2A 2DS0A 2QYIB 3VT0A 3H6RB 4I4XA 1TTUA 1ITBA 3UJ0A 1BARA 1T9FA 3FGMA 3VUOA 3NBEA 4FVVA 3OGGA 2D1ZA 4LO7B 2NVHA 5BP5A 5JMCA 4I8MA 1EV2A 4I7IA 4LO0A 1YF8B 4I0YA 2HWMA 4P0LA 1XHBA 4GOYA 5FZYA 4EB2B 3AKGA 1AVWB 3WO2A 3A21A 5JLVA 3O49A 5BQUA 4KEKA 3ZC8A 1AVXB 3I2AA 4ZFUB 3A23A 3K1XA 1AF9A 1VCLA 5BXPA 4P6AA 5BOWA 1S0DA 4ZOTA 2BFHA 3S8JA 2DRYA 4I4RA 4G9NA 1JT7A 1XG6A 1CE7B 2Y9GA 2K8RA 1TFMB 2NP0A 4MZHA 4LO3C 3R4UA 1V6VA 1RG8A 1Z0HA 3BAUA 4G9MA 2I1BA 3OBRA 3WA1A 4PC4A 3BRFA 4ISQA 1Q1UA 4X37A 1EPWA 4QO3A 1ISYA 1S0FA 2P23A 3MPPG 1XZZA 3VWCA 5BVPI 1I1EA 3VSFA 1S0LA 3A22A 5D61A 3O4CA 4I1EA 1HCDA 5DSSB 2Z49A 3FJBA 1Q03A 3BA5A 4LO2C 5HPZA 4I96A 3CRIA 3TC2A 2Y9FA 4ZBVB 4ZLBB 4XFUA 3AKHA 5F90A 3CA5A 3HSMA 1ISVA 2GZBA 2NS2A 3IM5A 4I4OA 4Q9GA 1FN0A 3LTQA 4D0TA 2ZQOA 1TWEA 3V0BB 4QKSA 4ZA3B 1SZ6B 3H6SE 3RSJA 3N7JA 31BIA 2DRZA 4JPZA 4OWJA 1HIBA 2P39A 1GGPB 1FWVA 4P0JA 3ILAA 4LO8B 1K5UA 3BAQA 3OBTA 3FJEA 1BFCA 2NM1A 4USPA 1P63A 4GP0A 2E4MA 3I29B 3QYDA 2Q9XA 2VLCA 5D62A 3R4SA 4H04A 4GP3A 1RY7A 2D23A 1DZDA 3OJ2A 1IHKA 2F2FC 5BXSA 1S0GA 3O5WB 5FNWA 6I1BA 3FJJA 3VT1A 3AH4A 3WO3A 4EKXB 1V6WA 1S0EA 3O4BA 3FJCA 1QQKA 2ESUA 3V0AA 1PWAA 4DCKC 2Y9XE 2NZ9A 3UD8A 2FDBM 3V0BA 5FZZA 3CRGA 4IY8A 3C9ZA 1JT5A 1UPSA 3I2XA 3IM6A 2D22A 4I4PA 2KH2A 1WD4A 4OWKA 4Q9PA 4QD2B 7I1BA 4IYBA 4IONA 3BA4A 3S8KA 2RQ9A 3FJAA 1HWNB 4Q91A 3O4AA 3BRDA 3POKA 2FO1A 3PMEA 1NZKA 3FJHA 4JKQA 4D0ZA 1CVSA 4IY9A 3FJ9A 1IJTA 1NUNA 5DUYA 5EHAA 4AN7B 1BLDA 1W3AA 4ZGRB 4P0KA 2L5XA 1TP0A 4X38A 3RMXA 4LO1A 4XFSA 5BXTA 1G82A 5BP5C 2NTDA 3FJIA 4J2SA 1JT4A 2D20A
chains in the Genus database with same CATH topology
1BFGA 1AVAC 2QN4A 2Z48A 1QQLA 1ISWA 5B2HA 2KI6B 5FZUA 1HWOB 1ONKB 4WBCA 3WINA 1JY0A 4J2YA 4MZGB 1FGAA 1DJSB 4J2XA 5F8YA 3LLPA 3A07A 2VUAA 2AQZA 4GAFA 1D0HA 3N7LA 3ZX7A 1BFBA 3SNVA 4CJMA 3F62B 4Z9WB 3N7MA 1G9CA 4QD2C 1DFCA 3BA7A 3BADA 3O3QA 3QR5A 4JAWA 3IM7A 3JUTA 4ZKTB 2ZQNA 2K4AB 2GO2A 1J0SA 4QBCA 5DVHA 3OJVA 4LO7C 4KEJA 1W3GA 2WBCA 3CAHA 4QALA 2X2SA 4R6UB 4GAIA 1OQLB 3BAVA 2ERMA 1DIWA 3FJFA 1G9AA 3RTJB 2FFUA 4A7YA 4ZFWB 1ISZA 4G1RA 4IZXA 4OEEA 3FFZA 4ZFYB 2R9KB 4UY4A 4OUJA 3OGFA 2D43A 3V0AB 1MD6A 3CA1A 3CU1B 2IHOA 3VSZA 1V6UA 3AKIA 3B9UA 1TWMA 3ZXGA 3WMUA 1S0CA 1L2HA 1N4KA 4YOLA 2HWAA 1DZCA 1DQGA 3D7WB 3KMVA 4AN6A 5BXRA 1IILA 1QXMA 1HWPB 1WD3A 2LIEA 1FV2A 3T8SA 3WO4A 3IAGC 1E0OA 1FV3A 3AJ6A 1JLYA 1T4QA 2D7IA 3PG0A 3ZC9A 4EFPA 3WMVA 4JQ0A 1DQOA 1R8NA 3IIRA 4QBVA 4J23B 1SR4A 2ZR1B 1BA7A 1WBAA 1DLLA 4I4QA 1JTCA 4IHZA 4USOA 4I4UA 3HBWA 3UD9A 1HCEA 3FJKA 3HN1A 5GAQA 4OW4A 3PHZA 1PC8B 2RG9B 3O4DA 4II0A 5EG6C 4GOVA 3AJ5A 3NBDA 2F8XC 3CA3A 3N7KA 4I4VA 4TLPA 4G6MA 4OEFA 2AFGA 3VT2A 1ILR1 4A7ZA 2WRYA 3F1RA 5DZUA 2X2TA 3EF2A 1JLXA 2BEBA 4XKIA 3RTIB 2FGFA 3BAOA 4F83A 1HKNA 2VXTI 4OWLA 1JQZA 2BEAA 4L4IA 1FQ9A 4I37A 1AFCA 5F8WA 2XOAA 4HR6C 3CA4A 4I2SA 1KNMA 4JKXB 1M2TB 1IRAX 1TIEA 4G6JA 5FNXA 3JRRA 4LO0C 1V6XA 4DEPA 4F34A 3O44A 3V79C 1DFQA 1R8OA 4EFQA 4A7KA 1FWUA 2FFVA 3FJDA 5BQUC 4IQPA 2MIBA 1Q04A 2VU9A 2HZ9A 1PZZA 4LO1C 4X3AA 3VEQA 4I3NA 2LIQA 3HALA 4KBBA 2UUSA 3FUQA 3NBCA 3CA0A 3N0KA 4MZFB 4LO3A 2D7RA 3E8LC 1PUMB 3AZWA 3WINC 3CA6A 3BRGC 3H6QA 1K5VA 4JP0A 3P6IA 1FMZA 1Z4SA 2KKIA 2HW9A 3H6RA 3AH1A 3RMYA 2VXRA 8I1BA 21BIA 1ISXA 3HMYA 2RSTA 3ZXDA 1PUUB 3MALA 4I1BA 2AAIB 4ENDA 4LO2A 1BASA 3BB2A 3HOMA 1WBCA 1EVTA 2DREA 4Z8SB 3NBNA 1YXWA 3CQAA 2D24A 2IWTB 1A8DA 9ILBA 3AZVA 1M16A 1YBIA 1F31A 4DENA 1XYFA 3Q7WA 3W9TA 2D44A 2VSAA 1AVUA 2YUGA 1II4A 4FGFA 3O4OA 1IRPA 4I4SA 2ET2A 2K43A 4I6IA 1TOOA 3FUOA 2AXMA 2KLLA 4XFTA 3BX1C 2Y9WC 1BFFA 4L4HA 3Q7YA 1ABRB 1RZOB 1IT0A 2MC2A 4QKRA 1FMMS 5D63A 3NJ5A 4J2KA 2VSEA 1HWMB 1Z2VA 3PUBA 4JRAA 4KEIA 4QC4A 1BLAA 5I1BA 4KC3A 3UJ4A 3P53A 3BAGA 2F2FA 3BTAA 1MC9A 2Q3NB 4I4YA 2E4MC 3AKFA 1S0BA 4OEGA 5E24E 1IOBA 1W3FA 3UDAA 41BIA 1G9BA 4HA2A 2M49A 4EEEB 1SR4C 4H75A 2KI4A 1YTOA 3Q7XA 1JT3A 5G00A 4D8HA 1RMLA 2NYYA 1AXMA 3P6JA 4ISRA 4EFRA 2J3PA 1YYNA 5F8SA 4IZEA 3BAHA 3FJ8A 5EC5A 3UD7A 1EYLA 4X39A 3CRHA 1G9DA 1I1BA 2MLLB 4HJJA 4H9WA 3OJMA 3AH2A 2DS0A 2QYIB 3VT0A 3H6RB 4I4XA 1TTUA 1ITBA 3UJ0A 1BARA 1T9FA 3FGMA 3VUOA 3NBEA 4FVVA 3OGGA 2D1ZA 4LO7B 2NVHA 5BP5A 5JMCA 4I8MA 1EV2A 4I7IA 4LO0A 1YF8B 4I0YA 2HWMA 4P0LA 1XHBA 4GOYA 5FZYA 4EB2B 3AKGA 1AVWB 3WO2A 3A21A 5JLVA 3O49A 5BQUA 4KEKA 3ZC8A 1AVXB 3I2AA 4ZFUB 3A23A 3K1XA 1AF9A 1VCLA 5BXPA 4P6AA 5BOWA 1S0DA 4ZOTA 2BFHA 3S8JA 2DRYA 4I4RA 4G9NA 1JT7A 1XG6A 1CE7B 2Y9GA 2K8RA 1TFMB 2NP0A 4MZHA 4LO3C 3R4UA 1V6VA 1RG8A 1Z0HA 3BAUA 4G9MA 2I1BA 3OBRA 3WA1A 4PC4A 3BRFA 4ISQA 1Q1UA 4X37A 1EPWA 4QO3A 1ISYA 1S0FA 2P23A 3MPPG 1XZZA 3VWCA 5BVPI 1I1EA 3VSFA 1S0LA 3A22A 5D61A 3O4CA 4I1EA 1HCDA 5DSSB 2Z49A 3FJBA 1Q03A 3BA5A 4LO2C 5HPZA 4I96A 3CRIA 3TC2A 2Y9FA 4ZBVB 4ZLBB 4XFUA 3AKHA 5F90A 3CA5A 3HSMA 1ISVA 2GZBA 2NS2A 3IM5A 4I4OA 4Q9GA 1FN0A 3LTQA 4D0TA 2ZQOA 1TWEA 3V0BB 4QKSA 4ZA3B 1SZ6B 3H6SE 3RSJA 3N7JA 31BIA 2DRZA 4JPZA 4OWJA 1HIBA 2P39A 1GGPB 1FWVA 4P0JA 3ILAA 4LO8B 1K5UA 3BAQA 3OBTA 3FJEA 1BFCA 2NM1A 4USPA 1P63A 4GP0A 2E4MA 3I29B 3QYDA 2Q9XA 2VLCA 5D62A 3R4SA 4H04A 4GP3A 1RY7A 2D23A 1DZDA 3OJ2A 1IHKA 2F2FC 5BXSA 1S0GA 3O5WB 5FNWA 6I1BA 3FJJA 3VT1A 3AH4A 3WO3A 4EKXB 1V6WA 1S0EA 3O4BA 3FJCA 1QQKA 2ESUA 3V0AA 1PWAA 4DCKC 2Y9XE 2NZ9A 3UD8A 2FDBM 3V0BA 5FZZA 3CRGA 4IY8A 3C9ZA 1JT5A 1UPSA 3I2XA 3IM6A 2D22A 4I4PA 2KH2A 1WD4A 4OWKA 4Q9PA 4QD2B 7I1BA 4IYBA 4IONA 3BA4A 3S8KA 2RQ9A 3FJAA 1HWNB 4Q91A 3O4AA 3BRDA 3POKA 2FO1A 3PMEA 1NZKA 3FJHA 4JKQA 4D0ZA 1CVSA 4IY9A 3FJ9A 1IJTA 1NUNA 5DUYA 5EHAA 4AN7B 1BLDA 1W3AA 4ZGRB 4P0KA 2L5XA 1TP0A 4X38A 3RMXA 4LO1A 4XFSA 5BXTA 1G82A 5BP5C 2NTDA 3FJIA 4J2SA 1JT4A 2D20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFG A;  1AVA C;  2QN4 A;  2Z48 A;  1QQL A;  1ISW A;  5B2H A;  2KI6 B;  5FZU A;  1HWO B;  1ONK B;  4WBC A;  3WIN A;  1JY0 A;  4J2Y A;  1FGA A;  1DJS B;  4J2X A;  5F8Y A;  3LLP A;  3A07 A;  2VUA A;  2AQZ A;  4GAF A;  1D0H A;  3N7L A;  3ZX7 A;  1BFB A;  3SNV A;  4CJM A;  3F62 B;  4Z9W B;  3N7M A;  1G9C A;  4QD2 C;  1DFC A;  3BA7 A;  3BAD A;  3O3Q A;  3QR5 A;  4JAW A;  3IM7 A;  3JUT A;  4ZKT B;  2ZQN A;  2K4A B;  2GO2 A;  1J0S A;  4QBC A;  5DVH A;  3OJV A;  4LO7 C;  4KEJ A;  1W3G A;  2WBC A;  3CAH A;  4QAL A;  2X2S A;  4R6U B;  4GAI A;  1OQL B;  3BAV A;  2ERM A;  1DIW A;  3FJF A;  1G9A A;  3RTJ B;  2FFU A;  4A7Y A;  4ZFW B;  1ISZ A;  4G1R A;  4IZX A;  4OEE A;  3FFZ A;  4ZFY B;  2R9K B;  4OUJ A;  3OGF A;  2D43 A;  3V0A B;  1MD6 A;  3CA1 A;  3CU1 B;  2IHO A;  3VSZ A;  1V6U A;  3AKI A;  3B9U A;  1TWM A;  3ZXG A;  3WMU A;  1S0C A;  1L2H A;  1N4K A;  4YOL A;  2HWA A;  1DZC A;  1DQG A;  3D7W B;  3KMV A;  4AN6 A;  5BXR A;  1IIL A;  1QXM A;  1HWP B;  1WD3 A;  2LIE A;  1FV2 A;  3T8S A;  3WO4 A;  3IAG C;  1E0O A;  1FV3 A;  3AJ6 A;  1JLY A;  1T4Q A;  2D7I A;  3PG0 A;  3ZC9 A;  4EFP A;  3WMV A;  4JQ0 A;  1DQO A;  1R8N A;  3IIR A;  4QBV A;  4J23 B;  1SR4 A;  2ZR1 B;  1BA7 A;  1WBA A;  1DLL A;  4I4Q A;  1JTC A;  4IHZ A;  4USO A;  4I4U A;  3HBW A;  3UD9 A;  1HCE A;  3FJK A;  3HN1 A;  5GAQ A;  4OW4 A;  3PHZ A;  1PC8 B;  2RG9 B;  3O4D A;  4II0 A;  5EG6 C;  4GOV A;  3AJ5 A;  3NBD A;  2F8X C;  3CA3 A;  3N7K A;  4I4V A;  4TLP A;  4G6M A;  4OEF A;  2AFG A;  3VT2 A;  1ILR 1;  4A7Z A;  2WRY A;  3F1R A;  5DZU A;  2X2T A;  3EF2 A;  1JLX A;  2BEB A;  4XKI A;  3RTI B;  2FGF A;  3BAO A;  4F83 A;  1HKN A;  2VXT I;  4OWL A;  1JQZ A;  2BEA A;  4L4I A;  1FQ9 A;  4I37 A;  1AFC A;  5F8W A;  2XOA A;  4HR6 C;  3CA4 A;  4I2S A;  1KNM A;  4JKX B;  1M2T B;  1IRA X;  1TIE A;  4G6J A;  5FNX A;  3JRR A;  4LO0 C;  1V6X A;  4DEP A;  4F34 A;  3O44 A;  3V79 C;  1DFQ A;  1R8O A;  4EFQ A;  4A7K A;  1FWU A;  2FFV A;  3FJD A;  5BQU C;  4IQP A;  2MIB A;  1Q04 A;  2VU9 A;  2HZ9 A;  1PZZ A;  4LO1 C;  4X3A A;  3VEQ A;  4I3N A;  2LIQ A;  3HAL A;  4KBB A;  2UUS A;  3FUQ A;  3NBC A;  3CA0 A;  3N0K A;  4LO3 A;  2D7R A;  3E8L C;  1PUM B;  3AZW A;  3WIN C;  3CA6 A;  3BRG C;  3H6Q A;  1K5V A;  4JP0 A;  3P6I A;  1FMZ A;  1Z4S A;  2KKI A;  2HW9 A;  3H6R A;  3AH1 A;  3RMY A;  2VXR A;  8I1B A;  21BI A;  1ISX A;  3HMY A;  2RST A;  3ZXD A;  1PUU B;  3MAL A;  4I1B A;  2AAI B;  4END A;  4LO2 A;  1BAS A;  3BB2 A;  3HOM A;  1WBC A;  1EVT A;  2DRE A;  4Z8S B;  3NBN A;  1YXW A;  3CQA A;  2D24 A;  2IWT B;  1A8D A;  9ILB A;  3AZV A;  1M16 A;  1YBI A;  1F31 A;  4DEN A;  1XYF A;  3Q7W A;  3W9T A;  2D44 A;  2VSA A;  1AVU A;  2YUG A;  1II4 A;  4FGF A;  3O4O A;  1IRP A;  4I4S A;  2ET2 A;  2K43 A;  4I6I A;  1TOO A;  3FUO A;  2AXM A;  2KLL A;  4XFT A;  3BX1 C;  2Y9W C;  1BFF A;  4L4H A;  3Q7Y A;  1ABR B;  1RZO B;  1IT0 A;  2MC2 A;  4QKR A;  1FMM S;  5D63 A;  3NJ5 A;  4J2K A;  2VSE A;  1HWM B;  1Z2V A;  3PUB A;  4JRA A;  4KEI A;  4QC4 A;  1BLA A;  5I1B A;  4KC3 A;  3UJ4 A;  3P53 A;  3BAG A;  2F2F A;  3BTA A;  1MC9 A;  2Q3N B;  4I4Y A;  2E4M C;  3AKF A;  1S0B A;  4OEG A;  5E24 E;  1IOB A;  1W3F A;  3UDA A;  41BI A;  1G9B A;  4HA2 A;  2M49 A;  4EEE B;  1SR4 C;  2KI4 A;  1YTO A;  3Q7X A;  1JT3 A;  5G00 A;  4D8H A;  1RML A;  2NYY A;  1AXM A;  3P6J A;  4ISR A;  4EFR A;  2J3P A;  1YYN A;  5F8S A;  4IZE A;  3BAH A;  3FJ8 A;  5EC5 A;  3UD7 A;  1EYL A;  4X39 A;  3CRH A;  1G9D A;  1I1B A;  2MLL B;  4HJJ A;  4H9W A;  3OJM A;  3AH2 A;  2DS0 A;  2QYI B;  3VT0 A;  3H6R B;  4I4X A;  1TTU A;  1ITB A;  3UJ0 A;  1BAR A;  1T9F A;  3FGM A;  3VUO A;  3NBE A;  4FVV A;  3OGG A;  2D1Z A;  4LO7 B;  2NVH A;  5BP5 A;  5JMC A;  4I8M A;  1EV2 A;  4I7I A;  4LO0 A;  1YF8 B;  4I0Y A;  2HWM A;  4P0L A;  1XHB A;  4GOY A;  5FZY A;  4EB2 B;  3AKG A;  1AVW B;  3WO2 A;  3A21 A;  5JLV A;  3O49 A;  5BQU A;  4KEK A;  3ZC8 A;  1AVX B;  3I2A A;  4ZFU B;  3A23 A;  3K1X A;  1AF9 A;  1VCL A;  5BXP A;  4P6A A;  5BOW A;  1S0D A;  4ZOT A;  2BFH A;  3S8J A;  2DRY A;  4I4R A;  4G9N A;  1JT7 A;  1XG6 A;  1CE7 B;  2Y9G A;  2K8R A;  1TFM B;  2NP0 A;  4LO3 C;  3R4U A;  1V6V A;  1RG8 A;  1Z0H A;  3BAU A;  4G9M A;  2I1B A;  3OBR A;  3WA1 A;  4PC4 A;  3BRF A;  4ISQ A;  1Q1U A;  4X37 A;  1EPW A;  4QO3 A;  1ISY A;  1S0F A;  2P23 A;  3MPP G;  1XZZ A;  3VWC A;  5BVP I;  1I1E A;  3VSF A;  1S0L A;  3A22 A;  5D61 A;  3O4C A;  4I1E A;  1HCD A;  5DSS B;  2Z49 A;  3FJB A;  1Q03 A;  3BA5 A;  4LO2 C;  5HPZ A;  4I96 A;  3CRI A;  3TC2 A;  2Y9F A;  4ZBV B;  4ZLB B;  4XFU A;  3AKH A;  5F90 A;  3CA5 A;  3HSM A;  1ISV A;  2GZB A;  3IM5 A;  4I4O A;  4Q9G A;  1FN0 A;  3LTQ A;  4D0T A;  2ZQO A;  1TWE A;  3V0B B;  4QKS A;  4ZA3 B;  1SZ6 B;  3H6S E;  3RSJ A;  3N7J A;  31BI A;  2DRZ A;  4JPZ A;  4OWJ A;  1HIB A;  2P39 A;  1GGP B;  1FWV A;  4P0J A;  3ILA A;  4LO8 B;  1K5U A;  3BAQ A;  3OBT A;  3FJE A;  1BFC A;  2NM1 A;  4USP A;  1P63 A;  4GP0 A;  2E4M A;  3I29 B;  3QYD A;  2Q9X A;  2VLC A;  5D62 A;  3R4S A;  4H04 A;  4GP3 A;  1RY7 A;  2D23 A;  1DZD A;  3OJ2 A;  1IHK A;  2F2F C;  5BXS A;  1S0G A;  3O5W B;  5FNW A;  6I1B A;  3FJJ A;  3VT1 A;  3AH4 A;  3WO3 A;  4EKX B;  1V6W A;  1S0E A;  3O4B A;  3FJC A;  1QQK A;  2ESU A;  3V0A A;  1PWA A;  4DCK C;  2Y9X E;  2NZ9 A;  3UD8 A;  2FDB M;  3V0B A;  5FZZ A;  3CRG A;  4IY8 A;  3C9Z A;  1JT5 A;  1UPS A;  3I2X A;  3IM6 A;  2D22 A;  4I4P A;  2KH2 A;  1WD4 A;  4OWK A;  4Q9P A;  4QD2 B;  7I1B A;  4IYB A;  4ION A;  3BA4 A;  3S8K A;  2RQ9 A;  3FJA A;  1HWN B;  4Q91 A;  3O4A A;  3BRD A;  3POK A;  2FO1 A;  3PME A;  1NZK A;  3FJH A;  4JKQ A;  4D0Z A;  1CVS A;  4IY9 A;  3FJ9 A;  1IJT A;  1NUN A;  5DUY A;  5EHA A;  4AN7 B;  1BLD A;  1W3A A;  4ZGR B;  4P0K A;  2L5X A;  1TP0 A;  4X38 A;  3RMX A;  4LO1 A;  4XFS A;  5BXT A;  1G82 A;  5BP5 C;  2NTD A;  3FJI A;  4J2S A;  1JT4 A;  2D20 A; 
#chains in the Genus database with same CATH topology
 1BFG A;  1AVA C;  2QN4 A;  2Z48 A;  1QQL A;  1ISW A;  5B2H A;  2KI6 B;  5FZU A;  1HWO B;  1ONK B;  4WBC A;  3WIN A;  1JY0 A;  4J2Y A;  4MZG B;  1FGA A;  1DJS B;  4J2X A;  5F8Y A;  3LLP A;  3A07 A;  2VUA A;  2AQZ A;  4GAF A;  1D0H A;  3N7L A;  3ZX7 A;  1BFB A;  3SNV A;  4CJM A;  3F62 B;  4Z9W B;  3N7M A;  1G9C A;  4QD2 C;  1DFC A;  3BA7 A;  3BAD A;  3O3Q A;  3QR5 A;  4JAW A;  3IM7 A;  3JUT A;  4ZKT B;  2ZQN A;  2K4A B;  2GO2 A;  1J0S A;  4QBC A;  5DVH A;  3OJV A;  4LO7 C;  4KEJ A;  1W3G A;  2WBC A;  3CAH A;  4QAL A;  2X2S A;  4R6U B;  4GAI A;  1OQL B;  3BAV A;  2ERM A;  1DIW A;  3FJF A;  1G9A A;  3RTJ B;  2FFU A;  4A7Y A;  4ZFW B;  1ISZ A;  4G1R A;  4IZX A;  4OEE A;  3FFZ A;  4ZFY B;  2R9K B;  4UY4 A;  4OUJ A;  3OGF A;  2D43 A;  3V0A B;  1MD6 A;  3CA1 A;  3CU1 B;  2IHO A;  3VSZ A;  1V6U A;  3AKI A;  3B9U A;  1TWM A;  3ZXG A;  3WMU A;  1S0C A;  1L2H A;  1N4K A;  4YOL A;  2HWA A;  1DZC A;  1DQG A;  3D7W B;  3KMV A;  4AN6 A;  5BXR A;  1IIL A;  1QXM A;  1HWP B;  1WD3 A;  2LIE A;  1FV2 A;  3T8S A;  3WO4 A;  3IAG C;  1E0O A;  1FV3 A;  3AJ6 A;  1JLY A;  1T4Q A;  2D7I A;  3PG0 A;  3ZC9 A;  4EFP A;  3WMV A;  4JQ0 A;  1DQO A;  1R8N A;  3IIR A;  4QBV A;  4J23 B;  1SR4 A;  2ZR1 B;  1BA7 A;  1WBA A;  1DLL A;  4I4Q A;  1JTC A;  4IHZ A;  4USO A;  4I4U A;  3HBW A;  3UD9 A;  1HCE A;  3FJK A;  3HN1 A;  5GAQ A;  4OW4 A;  3PHZ A;  1PC8 B;  2RG9 B;  3O4D A;  4II0 A;  5EG6 C;  4GOV A;  3AJ5 A;  3NBD A;  2F8X C;  3CA3 A;  3N7K A;  4I4V A;  4TLP A;  4G6M A;  4OEF A;  2AFG A;  3VT2 A;  1ILR 1;  4A7Z A;  2WRY A;  3F1R A;  5DZU A;  2X2T A;  3EF2 A;  1JLX A;  2BEB A;  4XKI A;  3RTI B;  2FGF A;  3BAO A;  4F83 A;  1HKN A;  2VXT I;  4OWL A;  1JQZ A;  2BEA A;  4L4I A;  1FQ9 A;  4I37 A;  1AFC A;  5F8W A;  2XOA A;  4HR6 C;  3CA4 A;  4I2S A;  1KNM A;  4JKX B;  1M2T B;  1IRA X;  1TIE A;  4G6J A;  5FNX A;  3JRR A;  4LO0 C;  1V6X A;  4DEP A;  4F34 A;  3O44 A;  3V79 C;  1DFQ A;  1R8O A;  4EFQ A;  4A7K A;  1FWU A;  2FFV A;  3FJD A;  5BQU C;  4IQP A;  2MIB A;  1Q04 A;  2VU9 A;  2HZ9 A;  1PZZ A;  4LO1 C;  4X3A A;  3VEQ A;  4I3N A;  2LIQ A;  3HAL A;  4KBB A;  2UUS A;  3FUQ A;  3NBC A;  3CA0 A;  3N0K A;  4MZF B;  4LO3 A;  2D7R A;  3E8L C;  1PUM B;  3AZW A;  3WIN C;  3CA6 A;  3BRG C;  3H6Q A;  1K5V A;  4JP0 A;  3P6I A;  1FMZ A;  1Z4S A;  2KKI A;  2HW9 A;  3H6R A;  3AH1 A;  3RMY A;  2VXR A;  8I1B A;  21BI A;  1ISX A;  3HMY A;  2RST A;  3ZXD A;  1PUU B;  3MAL A;  4I1B A;  2AAI B;  4END A;  4LO2 A;  1BAS A;  3BB2 A;  3HOM A;  1WBC A;  1EVT A;  2DRE A;  4Z8S B;  3NBN A;  1YXW A;  3CQA A;  2D24 A;  2IWT B;  1A8D A;  9ILB A;  3AZV A;  1M16 A;  1YBI A;  1F31 A;  4DEN A;  1XYF A;  3Q7W A;  3W9T A;  2D44 A;  2VSA A;  1AVU A;  2YUG A;  1II4 A;  4FGF A;  3O4O A;  1IRP A;  4I4S A;  2ET2 A;  2K43 A;  4I6I A;  1TOO A;  3FUO A;  2AXM A;  2KLL A;  4XFT A;  3BX1 C;  2Y9W C;  1BFF A;  4L4H A;  3Q7Y A;  1ABR B;  1RZO B;  1IT0 A;  2MC2 A;  4QKR A;  1FMM S;  5D63 A;  3NJ5 A;  4J2K A;  2VSE A;  1HWM B;  1Z2V A;  3PUB A;  4JRA A;  4KEI A;  4QC4 A;  1BLA A;  5I1B A;  4KC3 A;  3UJ4 A;  3P53 A;  3BAG A;  2F2F A;  3BTA A;  1MC9 A;  2Q3N B;  4I4Y A;  2E4M C;  3AKF A;  1S0B A;  4OEG A;  5E24 E;  1IOB A;  1W3F A;  3UDA A;  41BI A;  1G9B A;  4HA2 A;  2M49 A;  4EEE B;  1SR4 C;  4H75 A;  2KI4 A;  1YTO A;  3Q7X A;  1JT3 A;  5G00 A;  4D8H A;  1RML A;  2NYY A;  1AXM A;  3P6J A;  4ISR A;  4EFR A;  2J3P A;  1YYN A;  5F8S A;  4IZE A;  3BAH A;  3FJ8 A;  5EC5 A;  3UD7 A;  1EYL A;  4X39 A;  3CRH A;  1G9D A;  1I1B A;  2MLL B;  4HJJ A;  4H9W A;  3OJM A;  3AH2 A;  2DS0 A;  2QYI B;  3VT0 A;  3H6R B;  4I4X A;  1TTU A;  1ITB A;  3UJ0 A;  1BAR A;  1T9F A;  3FGM A;  3VUO A;  3NBE A;  4FVV A;  3OGG A;  2D1Z A;  4LO7 B;  2NVH A;  5BP5 A;  5JMC A;  4I8M A;  1EV2 A;  4I7I A;  4LO0 A;  1YF8 B;  4I0Y A;  2HWM A;  4P0L A;  1XHB A;  4GOY A;  5FZY A;  4EB2 B;  3AKG A;  1AVW B;  3WO2 A;  3A21 A;  5JLV A;  3O49 A;  5BQU A;  4KEK A;  3ZC8 A;  1AVX B;  3I2A A;  4ZFU B;  3A23 A;  3K1X A;  1AF9 A;  1VCL A;  5BXP A;  4P6A A;  5BOW A;  1S0D A;  4ZOT A;  2BFH A;  3S8J A;  2DRY A;  4I4R A;  4G9N A;  1JT7 A;  1XG6 A;  1CE7 B;  2Y9G A;  2K8R A;  1TFM B;  2NP0 A;  4MZH A;  4LO3 C;  3R4U A;  1V6V A;  1RG8 A;  1Z0H A;  3BAU A;  4G9M A;  2I1B A;  3OBR A;  3WA1 A;  4PC4 A;  3BRF A;  4ISQ A;  1Q1U A;  4X37 A;  1EPW A;  4QO3 A;  1ISY A;  1S0F A;  2P23 A;  3MPP G;  1XZZ A;  3VWC A;  5BVP I;  1I1E A;  3VSF A;  1S0L A;  3A22 A;  5D61 A;  3O4C A;  4I1E A;  1HCD A;  5DSS B;  2Z49 A;  3FJB A;  1Q03 A;  3BA5 A;  4LO2 C;  5HPZ A;  4I96 A;  3CRI A;  3TC2 A;  2Y9F A;  4ZBV B;  4ZLB B;  4XFU A;  3AKH A;  5F90 A;  3CA5 A;  3HSM A;  1ISV A;  2GZB A;  2NS2 A;  3IM5 A;  4I4O A;  4Q9G A;  1FN0 A;  3LTQ A;  4D0T A;  2ZQO A;  1TWE A;  3V0B B;  4QKS A;  4ZA3 B;  1SZ6 B;  3H6S E;  3RSJ A;  3N7J A;  31BI A;  2DRZ A;  4JPZ A;  4OWJ A;  1HIB A;  2P39 A;  1GGP B;  1FWV A;  4P0J A;  3ILA A;  4LO8 B;  1K5U A;  3BAQ A;  3OBT A;  3FJE A;  1BFC A;  2NM1 A;  4USP A;  1P63 A;  4GP0 A;  2E4M A;  3I29 B;  3QYD A;  2Q9X A;  2VLC A;  5D62 A;  3R4S A;  4H04 A;  4GP3 A;  1RY7 A;  2D23 A;  1DZD A;  3OJ2 A;  1IHK A;  2F2F C;  5BXS A;  1S0G A;  3O5W B;  5FNW A;  6I1B A;  3FJJ A;  3VT1 A;  3AH4 A;  3WO3 A;  4EKX B;  1V6W A;  1S0E A;  3O4B A;  3FJC A;  1QQK A;  2ESU A;  3V0A A;  1PWA A;  4DCK C;  2Y9X E;  2NZ9 A;  3UD8 A;  2FDB M;  3V0B A;  5FZZ A;  3CRG A;  4IY8 A;  3C9Z A;  1JT5 A;  1UPS A;  3I2X A;  3IM6 A;  2D22 A;  4I4P A;  2KH2 A;  1WD4 A;  4OWK A;  4Q9P A;  4QD2 B;  7I1B A;  4IYB A;  4ION A;  3BA4 A;  3S8K A;  2RQ9 A;  3FJA A;  1HWN B;  4Q91 A;  3O4A A;  3BRD A;  3POK A;  2FO1 A;  3PME A;  1NZK A;  3FJH A;  4JKQ A;  4D0Z A;  1CVS A;  4IY9 A;  3FJ9 A;  1IJT A;  1NUN A;  5DUY A;  5EHA A;  4AN7 B;  1BLD A;  1W3A A;  4ZGR B;  4P0K A;  2L5X A;  1TP0 A;  4X38 A;  3RMX A;  4LO1 A;  4XFS A;  5BXT A;  1G82 A;  5BP5 C;  2NTD A;  3FJI A;  4J2S A;  1JT4 A;  2D20 A; 
#chains in the Genus database with same CATH homology
 1BFG A;  1AVA C;  2QN4 A;  2Z48 A;  1QQL A;  1ISW A;  5B2H A;  2KI6 B;  5FZU A;  1HWO B;  1ONK B;  4WBC A;  3WIN A;  1JY0 A;  4J2Y A;  4MZG B;  1FGA A;  1DJS B;  4J2X A;  5F8Y A;  3LLP A;  3A07 A;  2VUA A;  2AQZ A;  4GAF A;  1D0H A;  3N7L A;  3ZX7 A;  1BFB A;  3SNV A;  4CJM A;  3F62 B;  4Z9W B;  3N7M A;  1G9C A;  4QD2 C;  1DFC A;  3BA7 A;  3BAD A;  3O3Q A;  3QR5 A;  4JAW A;  3IM7 A;  3JUT A;  4ZKT B;  2ZQN A;  2K4A B;  2GO2 A;  1J0S A;  4QBC A;  5DVH A;  3OJV A;  4LO7 C;  4KEJ A;  1W3G A;  2WBC A;  3CAH A;  4QAL A;  2X2S A;  4R6U B;  4GAI A;  1OQL B;  3BAV A;  2ERM A;  1DIW A;  3FJF A;  1G9A A;  3RTJ B;  2FFU A;  4A7Y A;  4ZFW B;  1ISZ A;  4G1R A;  4IZX A;  4OEE A;  3FFZ A;  4ZFY B;  2R9K B;  4UY4 A;  4OUJ A;  3OGF A;  2D43 A;  3V0A B;  1MD6 A;  3CA1 A;  3CU1 B;  2IHO A;  3VSZ A;  1V6U A;  3AKI A;  3B9U A;  1TWM A;  3ZXG A;  3WMU A;  1S0C A;  1L2H A;  1N4K A;  4YOL A;  2HWA A;  1DZC A;  1DQG A;  3D7W B;  3KMV A;  4AN6 A;  5BXR A;  1IIL A;  1QXM A;  1HWP B;  1WD3 A;  2LIE A;  1FV2 A;  3T8S A;  3WO4 A;  3IAG C;  1E0O A;  1FV3 A;  3AJ6 A;  1JLY A;  1T4Q A;  2D7I A;  3PG0 A;  3ZC9 A;  4EFP A;  3WMV A;  4JQ0 A;  1DQO A;  1R8N A;  3IIR A;  4QBV A;  4J23 B;  1SR4 A;  2ZR1 B;  1BA7 A;  1WBA A;  1DLL A;  4I4Q A;  1JTC A;  4IHZ A;  4USO A;  4I4U A;  3HBW A;  3UD9 A;  1HCE A;  3FJK A;  3HN1 A;  5GAQ A;  4OW4 A;  3PHZ A;  1PC8 B;  2RG9 B;  3O4D A;  4II0 A;  5EG6 C;  4GOV A;  3AJ5 A;  3NBD A;  2F8X C;  3CA3 A;  3N7K A;  4I4V A;  4TLP A;  4G6M A;  4OEF A;  2AFG A;  3VT2 A;  1ILR 1;  4A7Z A;  2WRY A;  3F1R A;  5DZU A;  2X2T A;  3EF2 A;  1JLX A;  2BEB A;  4XKI A;  3RTI B;  2FGF A;  3BAO A;  4F83 A;  1HKN A;  2VXT I;  4OWL A;  1JQZ A;  2BEA A;  4L4I A;  1FQ9 A;  4I37 A;  1AFC A;  5F8W A;  2XOA A;  4HR6 C;  3CA4 A;  4I2S A;  1KNM A;  4JKX B;  1M2T B;  1IRA X;  1TIE A;  4G6J A;  5FNX A;  3JRR A;  4LO0 C;  1V6X A;  4DEP A;  4F34 A;  3O44 A;  3V79 C;  1DFQ A;  1R8O A;  4EFQ A;  4A7K A;  1FWU A;  2FFV A;  3FJD A;  5BQU C;  4IQP A;  2MIB A;  1Q04 A;  2VU9 A;  2HZ9 A;  1PZZ A;  4LO1 C;  4X3A A;  3VEQ A;  4I3N A;  2LIQ A;  3HAL A;  4KBB A;  2UUS A;  3FUQ A;  3NBC A;  3CA0 A;  3N0K A;  4MZF B;  4LO3 A;  2D7R A;  3E8L C;  1PUM B;  3AZW A;  3WIN C;  3CA6 A;  3BRG C;  3H6Q A;  1K5V A;  4JP0 A;  3P6I A;  1FMZ A;  1Z4S A;  2KKI A;  2HW9 A;  3H6R A;  3AH1 A;  3RMY A;  2VXR A;  8I1B A;  21BI A;  1ISX A;  3HMY A;  2RST A;  3ZXD A;  1PUU B;  3MAL A;  4I1B A;  2AAI B;  4END A;  4LO2 A;  1BAS A;  3BB2 A;  3HOM A;  1WBC A;  1EVT A;  2DRE A;  4Z8S B;  3NBN A;  1YXW A;  3CQA A;  2D24 A;  2IWT B;  1A8D A;  9ILB A;  3AZV A;  1M16 A;  1YBI A;  1F31 A;  4DEN A;  1XYF A;  3Q7W A;  3W9T A;  2D44 A;  2VSA A;  1AVU A;  2YUG A;  1II4 A;  4FGF A;  3O4O A;  1IRP A;  4I4S A;  2ET2 A;  2K43 A;  4I6I A;  1TOO A;  3FUO A;  2AXM A;  2KLL A;  4XFT A;  3BX1 C;  2Y9W C;  1BFF A;  4L4H A;  3Q7Y A;  1ABR B;  1RZO B;  1IT0 A;  2MC2 A;  4QKR A;  1FMM S;  5D63 A;  3NJ5 A;  4J2K A;  2VSE A;  1HWM B;  1Z2V A;  3PUB A;  4JRA A;  4KEI A;  4QC4 A;  1BLA A;  5I1B A;  4KC3 A;  3UJ4 A;  3P53 A;  3BAG A;  2F2F A;  3BTA A;  1MC9 A;  2Q3N B;  4I4Y A;  2E4M C;  3AKF A;  1S0B A;  4OEG A;  5E24 E;  1IOB A;  1W3F A;  3UDA A;  41BI A;  1G9B A;  4HA2 A;  2M49 A;  4EEE B;  1SR4 C;  4H75 A;  2KI4 A;  1YTO A;  3Q7X A;  1JT3 A;  5G00 A;  4D8H A;  1RML A;  2NYY A;  1AXM A;  3P6J A;  4ISR A;  4EFR A;  2J3P A;  1YYN A;  5F8S A;  4IZE A;  3BAH A;  3FJ8 A;  5EC5 A;  3UD7 A;  1EYL A;  4X39 A;  3CRH A;  1G9D A;  1I1B A;  2MLL B;  4HJJ A;  4H9W A;  3OJM A;  3AH2 A;  2DS0 A;  2QYI B;  3VT0 A;  3H6R B;  4I4X A;  1TTU A;  1ITB A;  3UJ0 A;  1BAR A;  1T9F A;  3FGM A;  3VUO A;  3NBE A;  4FVV A;  3OGG A;  2D1Z A;  4LO7 B;  2NVH A;  5BP5 A;  5JMC A;  4I8M A;  1EV2 A;  4I7I A;  4LO0 A;  1YF8 B;  4I0Y A;  2HWM A;  4P0L A;  1XHB A;  4GOY A;  5FZY A;  4EB2 B;  3AKG A;  1AVW B;  3WO2 A;  3A21 A;  5JLV A;  3O49 A;  5BQU A;  4KEK A;  3ZC8 A;  1AVX B;  3I2A A;  4ZFU B;  3A23 A;  3K1X A;  1AF9 A;  1VCL A;  5BXP A;  4P6A A;  5BOW A;  1S0D A;  4ZOT A;  2BFH A;  3S8J A;  2DRY A;  4I4R A;  4G9N A;  1JT7 A;  1XG6 A;  1CE7 B;  2Y9G A;  2K8R A;  1TFM B;  2NP0 A;  4MZH A;  4LO3 C;  3R4U A;  1V6V A;  1RG8 A;  1Z0H A;  3BAU A;  4G9M A;  2I1B A;  3OBR A;  3WA1 A;  4PC4 A;  3BRF A;  4ISQ A;  1Q1U A;  4X37 A;  1EPW A;  4QO3 A;  1ISY A;  1S0F A;  2P23 A;  3MPP G;  1XZZ A;  3VWC A;  5BVP I;  1I1E A;  3VSF A;  1S0L A;  3A22 A;  5D61 A;  3O4C A;  4I1E A;  1HCD A;  5DSS B;  2Z49 A;  3FJB A;  1Q03 A;  3BA5 A;  4LO2 C;  5HPZ A;  4I96 A;  3CRI A;  3TC2 A;  2Y9F A;  4ZBV B;  4ZLB B;  4XFU A;  3AKH A;  5F90 A;  3CA5 A;  3HSM A;  1ISV A;  2GZB A;  2NS2 A;  3IM5 A;  4I4O A;  4Q9G A;  1FN0 A;  3LTQ A;  4D0T A;  2ZQO A;  1TWE A;  3V0B B;  4QKS A;  4ZA3 B;  1SZ6 B;  3H6S E;  3RSJ A;  3N7J A;  31BI A;  2DRZ A;  4JPZ A;  4OWJ A;  1HIB A;  2P39 A;  1GGP B;  1FWV A;  4P0J A;  3ILA A;  4LO8 B;  1K5U A;  3BAQ A;  3OBT A;  3FJE A;  1BFC A;  2NM1 A;  4USP A;  1P63 A;  4GP0 A;  2E4M A;  3I29 B;  3QYD A;  2Q9X A;  2VLC A;  5D62 A;  3R4S A;  4H04 A;  4GP3 A;  1RY7 A;  2D23 A;  1DZD A;  3OJ2 A;  1IHK A;  2F2F C;  5BXS A;  1S0G A;  3O5W B;  5FNW A;  6I1B A;  3FJJ A;  3VT1 A;  3AH4 A;  3WO3 A;  4EKX B;  1V6W A;  1S0E A;  3O4B A;  3FJC A;  1QQK A;  2ESU A;  3V0A A;  1PWA A;  4DCK C;  2Y9X E;  2NZ9 A;  3UD8 A;  2FDB M;  3V0B A;  5FZZ A;  3CRG A;  4IY8 A;  3C9Z A;  1JT5 A;  1UPS A;  3I2X A;  3IM6 A;  2D22 A;  4I4P A;  2KH2 A;  1WD4 A;  4OWK A;  4Q9P A;  4QD2 B;  7I1B A;  4IYB A;  4ION A;  3BA4 A;  3S8K A;  2RQ9 A;  3FJA A;  1HWN B;  4Q91 A;  3O4A A;  3BRD A;  3POK A;  2FO1 A;  3PME A;  1NZK A;  3FJH A;  4JKQ A;  4D0Z A;  1CVS A;  4IY9 A;  3FJ9 A;  1IJT A;  1NUN A;  5DUY A;  5EHA A;  4AN7 B;  1BLD A;  1W3A A;  4ZGR B;  4P0K A;  2L5X A;  1TP0 A;  4X38 A;  3RMX A;  4LO1 A;  4XFS A;  5BXT A;  1G82 A;  5BP5 C;  2NTD A;  3FJI A;  4J2S A;  1JT4 A;  2D20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...