3H6RA

Clitocypin, a beta-trefoil cysteine protease inhibitor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
b'MASLEDGTYRLRAVTTHNPDPGVGGEYATVEGARQPVKAEPSTPPFSEQQIWQVTRNSDGQYTIKYQGLNAPFEYGFSYDQLEPNAPVIAGDPKEYILQLVPSTADVYIIRAPIQRVGVDVEVGVQGNTLVYKFFPVDGSGGDRPAWRFTRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clitocypin analog
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 39
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10467 Inhibitor_I48 Peptidase inhibitor clitocypin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3h6rA00
1JT4A 3AJ5A 4G9NA 4Q91A 2ZR1B 8I1BA 4I4SA 1WD3A 3FJJA 2MC2A 3CA0A 2ZQNA 3BAHA 4A7ZA 3BRGC 2I1BA 5GAQA 3MPPG 1FN0A 3NJ5A 4DEPA 1Z4SA 3VSFA 1JTCA 3IAGC 3CA3A 1W3GA 2Q9XA 2VUAA 1WD4A 3UJ4A 2NZ9A 5E24E 3S8KA 4GAIA 1IRPA 1WBAA 4LO1A 1V6XA 2BEAA 5BXPA 2F8XC 3BB2A 3A21A 1DJSB 4J23B 4I4VA 5EC5A 3CA1A 4OEEA 4WBCA 1S0FA 3HBWA 4I3NA 1OQLB 2FDBM 1SZ6B 3I2XA 3V79C 1TOOA 3P6JA 1KNMA 5BVPI 3SNVA 4ISRA 1PUUB 2WRYA 1AF9A 3NBEA 3WINC 41BIA 2D44A 4I2SA 4X39A 5FNXA 2AQZA 1F31A 1V6WA 4J2SA 3RTIB 5EHAA 3CAHA 3AH1A 1WBCA 5BXTA 3CRIA 3CQAA 2D1ZA 1DZDA 3ZXDA 5JLVA 3QR5A 2D22A 3OBTA 4L4HA 2GO2A 4XKIA 2DRZA 1W3AA 2AAIB 3K1XA 5D62A 2HZ9A 4A7YA 1ISYA 4IYBA 3N7LA 3RMXA 1BFCA 4F34A 1EVTA 3VT1A 2HW9A 4JAWA 3IM5A 4LO8B 3CA5A 3FFZA 1IRAX 3UDAA 1JT5A 3LTQA 3BA5A 2Y9XE 5FNWA 3Q7YA 4ZGRB 2VXTI 1PWAA 2BFHA 3LLPA 3EF2A 4I0YA 1ONKB 1HKNA 3WO2A 2F2FA 3FJIA 1AVUA 3BAUA 1TIEA 2VSEA 4LO3C 1JLXA 21BIA 1FWUA 3O4DA 4ZLBB 4P0LA 1SR4C 4IZEA 2Z49A 1G9BA 5BP5C 2D24A 1V6UA 2GZBA 4H04A 1RG8A 2QN4A 2KKIA 1HWNB 4I4XA 4EEEB 4QD2C 5DUYA 3B9UA 3PUBA 3BRFA 4EFQA 3CRGA 3RTJB 4KC3A 5HPZA 3F1RA 4AN7B 3O5WB 1DLLA 1TP0A 2L5XA 3CU1B 5BQUA 1FQ9A 1TWEA 4QBCA 3ZC8A 1GGPB 1S0GA 4F83A 4PC4A 4HJJA 2ERMA 4X3AA 2FO1A 3W9TA 2D7RA 1FV3A 2RSTA 1MD6A 4GP0A 5F90A 4G9MA 9ILBA 2ZQOA 3BADA 4G6MA 4EKXB 1RZOB 1L2HA 1RMLA 4AN6A 1IHKA 4QKSA 1E0OA 2NTDA 1Z0HA 4R6UB 1G9CA 3ZC9A 1VCLA 4IONA 1M2TB 2KH2A 1BLDA 2FFVA 4IHZA 4JRAA 3P6IA 2D20A 4KEJA 3NBDA 1IILA 3WMVA 2ET2A 3VUOA 3BAOA 4LO7B 1PC8B 2K4AB 4IZXA 1K5UA 1XZZA 1IJTA 4IY9A 4LO2C 4Q9PA 1ABRB 1T9FA 4OWLA 1ITBA 3FGMA 4JKQA 4P6AA 2HWMA 3FJEA 3O4AA 5BXSA 3IM6A 3OGGA 3O44A 4I4RA 5FZZA 5F8SA 3FUQA 4LO0C 4GAFA 1S0EA 3AKGA 3H6RA 2AXMA 1S0CA 4OEGA 4Z8SB 4EB2B 4OW4A 2X2SA 3N0KA 5JMCA 3NBCA 3RSJA 1V6VA 2NVHA 4ZFWB 1BFGA 4QKRA 2D23A 4YOLA 1BFBA 2E4MC 3WO3A 4HR6C 1T4QA 4Z9WB 2MLLB 3FJ9A 3KMVA 1YXWA 2P23A 1IT0A 1FMZA 4JQ0A 3PHZA 3Q7WA 2YUGA 1S0DA 3VSZA 3WINA 3CRHA 4ISQA 4QALA 1TTUA 3CA4A 2NYYA 3AKIA 2KLLA 1EYLA 3BAGA 1AVAC 3PG0A 4QO3A 3OBRA 3H6RB 2IHOA 3BA4A 2DRYA 3S8JA 1I1EA 4ZFYB 3WMUA 1PUMB 3O49A 3ILAA 3IIRA 3R4UA 4HA2A 4I7IA 3TC2A 4I4YA 3V0AA 3N7JA 5F8WA 6I1BA 4J2YA 1M16A 2DREA 3ZX7A 3NBNA 4ENDA 1JQZA 1Q04A 4I4UA 4J2XA 3OJVA 3O4CA 2FGFA 4J2KA 1S0LA 4FGFA 2M49A 4GOYA 1QQLA 3H6QA 3R4SA 3V0BA 1Z2VA 2MIBA 4I4OA 1HWMB 4ZOTA 1R8NA 2VLCA 4LO3A 3UD9A 1BA7A 1SR4A 2Q3NB 4ZFUB 4I96A 3A07A 2HWAA 3OJ2A 4DCKC 5BP5A 3VT2A 1ILR1 3HSMA 5EG6C 1II4A 3AJ6A 1HIBA 3RMYA 2J3PA 3FJHA 4I8MA 3V0AB 1ISVA 1Q1UA 1XHBA 2D7IA 4EFPA 4II0A 2VU9A 1YYNA 5F8YA 5DZUA 1HCDA 1PZZA 3P53A 2RQ9A 2ESUA 1AFCA 3AH4A 3UJ0A 2R9KB 4ZKTB 2NM1A 31BIA 2XOAA 3V0BB 1K5VA 4ZA3B 1Q03A 3PMEA 4XFSA 1AVWB 1FV2A 3T8SA 3BA7A 2WBCA 1IOBA 1DFQA 3F62B 2X2TA 1AVXB 1ISXA 4LO1C 3FJCA 4OWJA 1BARA 4JP0A 3VWCA 2KI4A 4GOVA 4I1EA 4QD2B 3ZXGA 4D0ZA 1CE7B 3FJAA 1QXMA 4G6JA 1BASA 2KI6B 1HCEA 2K8RA 1UPSA 1FWVA 3BX1C 4OWKA 1DQOA 4GP3A 5FZUA 1HWOB 2LIEA 4JKXB 4DENA 4KEIA 4JPZA 4I4QA 4XFTA 5DSSB 3BRDA 1RY7A 2RG9B 4LO2A 3FJDA 1R8OA 2FFUA 1ISWA 4X37A 3AZWA 3FUOA 1TWMA 2QYIB 4H9WA 4P0JA 4Q9GA 5FZYA 3E8LC 1DZCA 5G00A 3N7KA 3JUTA 2Y9GA 4LO0A 1A8DA 1ISZA 7I1BA 3HALA 3HOMA 3I29B 1N4KA 3UD8A 5I1BA 2Y9FA 1QQKA 3WA1A 3HN1A 4I6IA 4L4IA 2E4MA 5BXRA 4KEKA 2AFGA 3UD7A 3AZVA 3I2AA 4D8HA 1CVSA 1JY0A 4I1BA 1BLAA 3FJKA 1DIWA 1G82A 3AKFA 1JLYA 3BAVA 1FGAA 4XFUA 2VXRA 3A22A 2BEBA 4KBBA 1JT3A 3IM7A 3OJMA 4IY8A 2F2FC 5DVHA 3VT0A 1TFMB 1MC9A 4I4PA 1JT7A 4IQPA 1XG6A 4USPA 4D0TA 3D7WB 1XYFA 3MALA 3Q7XA 1S0BA 4A7KA 2NP0A 2DS0A 3POKA 4P0KA 3CA6A 3BAQA 4EFRA 3H6SE 1YF8B 4X38A 2LIQA 3WO4A 1DFCA 1HWPB 4QC4A 4CJMA 3AKHA 1J0SA 1EPWA 2UUSA 3A23A 3BTAA 3O4BA 5B2HA 1P63A 5BOWA 2P39A 4LO7C 1BFFA 1EV2A 3OGFA 1DQGA 3O3QA 5BQUC 4ZBVB 1I1BA 1YTOA 4FVVA 4I37A 1G9DA 1D0HA 3QYDA 3FJFA 1YBIA 3VEQA 4USOA 1AXMA 3AH2A 4OUJA 3HMYA 2Y9WC 3JRRA 2Z48A 1NUNA 2K43A 4OEFA 2IWTB 4G1RA 4TLPA 3FJBA 3O4OA 1NZKA 1FMMS 3C9ZA 1W3FA 2D43A 2VSAA 3FJ8A 5D61A 5D63A 4QBVA 1G9AA 3N7MA
chains in the Genus database with same CATH superfamily
1JT4A 3AJ5A 4G9NA 4Q91A 2ZR1B 8I1BA 4I4SA 1WD3A 3FJJA 2MC2A 3CA0A 2ZQNA 3BAHA 4A7ZA 3BRGC 2I1BA 5GAQA 3MPPG 1FN0A 3NJ5A 4DEPA 1Z4SA 3VSFA 1JTCA 3IAGC 3CA3A 1W3GA 2Q9XA 2VUAA 1WD4A 3UJ4A 2NZ9A 5E24E 3S8KA 4GAIA 1IRPA 1WBAA 4LO1A 1V6XA 2BEAA 5BXPA 2F8XC 3BB2A 3A21A 1DJSB 4J23B 4I4VA 5EC5A 3CA1A 4OEEA 4WBCA 1S0FA 3HBWA 4I3NA 1OQLB 2FDBM 1SZ6B 3I2XA 3V79C 1TOOA 3P6JA 1KNMA 5BVPI 2NS2A 3SNVA 4ISRA 1PUUB 2WRYA 1AF9A 3NBEA 3WINC 41BIA 2D44A 4I2SA 4X39A 5FNXA 2AQZA 1F31A 1V6WA 4J2SA 3RTIB 5EHAA 3CAHA 3AH1A 1WBCA 5BXTA 3CRIA 3CQAA 2D1ZA 1DZDA 3ZXDA 5JLVA 3QR5A 2D22A 3OBTA 4L4HA 2GO2A 4XKIA 2DRZA 1W3AA 2AAIB 3K1XA 5D62A 2HZ9A 4A7YA 1ISYA 4IYBA 3N7LA 3RMXA 1BFCA 4F34A 1EVTA 3VT1A 2HW9A 4JAWA 3IM5A 4LO8B 3CA5A 3FFZA 1IRAX 3UDAA 1JT5A 3LTQA 3BA5A 2Y9XE 5FNWA 3Q7YA 4ZGRB 2VXTI 1PWAA 2BFHA 3LLPA 3EF2A 4I0YA 1ONKB 1HKNA 3WO2A 2F2FA 3FJIA 1AVUA 3BAUA 1TIEA 2VSEA 4LO3C 1JLXA 21BIA 1FWUA 3O4DA 4ZLBB 4P0LA 1SR4C 4IZEA 2Z49A 1G9BA 5BP5C 2D24A 1V6UA 2GZBA 4H04A 1RG8A 2QN4A 2KKIA 1HWNB 4I4XA 4EEEB 4QD2C 5DUYA 3B9UA 3PUBA 3BRFA 4EFQA 3CRGA 3RTJB 4KC3A 5HPZA 3F1RA 4AN7B 3O5WB 1DLLA 1TP0A 2L5XA 3CU1B 5BQUA 1FQ9A 1TWEA 4QBCA 3ZC8A 1GGPB 1S0GA 4F83A 4PC4A 4HJJA 2ERMA 4X3AA 2FO1A 3W9TA 2D7RA 1FV3A 2RSTA 1MD6A 4GP0A 5F90A 4G9MA 9ILBA 2ZQOA 3BADA 4G6MA 4EKXB 1RZOB 1L2HA 1RMLA 4AN6A 1IHKA 4QKSA 1E0OA 2NTDA 1Z0HA 4R6UB 1G9CA 3ZC9A 1VCLA 4IONA 1M2TB 2KH2A 1BLDA 2FFVA 4IHZA 4JRAA 3P6IA 2D20A 4KEJA 3NBDA 1IILA 3WMVA 2ET2A 3VUOA 3BAOA 4LO7B 1PC8B 2K4AB 4IZXA 1K5UA 1XZZA 1IJTA 4IY9A 4LO2C 4Q9PA 1ABRB 1T9FA 4OWLA 1ITBA 3FGMA 4JKQA 4P6AA 2HWMA 3FJEA 3O4AA 5BXSA 3IM6A 3OGGA 3O44A 4I4RA 5FZZA 5F8SA 3FUQA 4LO0C 4GAFA 1S0EA 3AKGA 3H6RA 2AXMA 1S0CA 4OEGA 4Z8SB 4EB2B 4OW4A 2X2SA 3N0KA 5JMCA 3NBCA 3RSJA 1V6VA 2NVHA 4ZFWB 1BFGA 4QKRA 2D23A 4YOLA 1BFBA 2E4MC 3WO3A 4MZFB 4HR6C 1T4QA 4Z9WB 2MLLB 3FJ9A 3KMVA 1YXWA 2P23A 1IT0A 1FMZA 4JQ0A 3PHZA 3Q7WA 2YUGA 1S0DA 3VSZA 3WINA 3CRHA 4ISQA 4QALA 1TTUA 3CA4A 2NYYA 3AKIA 2KLLA 1EYLA 3BAGA 1AVAC 3PG0A 4QO3A 3OBRA 3H6RB 2IHOA 3BA4A 2DRYA 3S8JA 1I1EA 4ZFYB 3WMUA 1PUMB 3O49A 3ILAA 3IIRA 3R4UA 4HA2A 4I7IA 3TC2A 4I4YA 3V0AA 3N7JA 5F8WA 6I1BA 4J2YA 1M16A 2DREA 3ZX7A 3NBNA 4ENDA 1JQZA 1Q04A 4I4UA 4J2XA 3OJVA 3O4CA 4MZGB 2FGFA 4J2KA 1S0LA 4FGFA 2M49A 4GOYA 1QQLA 3H6QA 3R4SA 3V0BA 1Z2VA 2MIBA 4I4OA 1HWMB 4ZOTA 1R8NA 2VLCA 4LO3A 3UD9A 1BA7A 1SR4A 2Q3NB 4ZFUB 4I96A 3A07A 2HWAA 3OJ2A 4DCKC 5BP5A 3VT2A 1ILR1 4UY4A 3HSMA 5EG6C 1II4A 3AJ6A 1HIBA 3RMYA 2J3PA 3FJHA 4I8MA 3V0AB 1ISVA 1Q1UA 1XHBA 2D7IA 4EFPA 4II0A 2VU9A 1YYNA 5F8YA 5DZUA 1HCDA 1PZZA 3P53A 2RQ9A 2ESUA 1AFCA 3AH4A 3UJ0A 2R9KB 4ZKTB 2NM1A 4MZHA 31BIA 2XOAA 3V0BB 1K5VA 4ZA3B 1Q03A 3PMEA 4XFSA 1AVWB 1FV2A 3T8SA 3BA7A 2WBCA 1IOBA 1DFQA 3F62B 2X2TA 1AVXB 1ISXA 4LO1C 3FJCA 4OWJA 1BARA 4JP0A 3VWCA 2KI4A 4GOVA 4I1EA 4QD2B 3ZXGA 4D0ZA 1CE7B 3FJAA 1QXMA 4G6JA 1BASA 2KI6B 1HCEA 2K8RA 1UPSA 1FWVA 3BX1C 4OWKA 1DQOA 4GP3A 5FZUA 1HWOB 2LIEA 4JKXB 4DENA 4KEIA 4JPZA 4I4QA 4XFTA 5DSSB 3BRDA 1RY7A 2RG9B 4LO2A 3FJDA 1R8OA 2FFUA 1ISWA 4X37A 3AZWA 3FUOA 1TWMA 2QYIB 4H9WA 4P0JA 4Q9GA 5FZYA 3E8LC 4H75A 1DZCA 5G00A 3N7KA 3JUTA 2Y9GA 4LO0A 1A8DA 1ISZA 7I1BA 3HALA 3HOMA 3I29B 1N4KA 3UD8A 5I1BA 2Y9FA 1QQKA 3WA1A 3HN1A 4I6IA 4L4IA 2E4MA 5BXRA 4KEKA 2AFGA 3UD7A 3AZVA 3I2AA 4D8HA 1CVSA 1JY0A 4I1BA 1BLAA 3FJKA 1DIWA 1G82A 3AKFA 1JLYA 3BAVA 1FGAA 4XFUA 2VXRA 3A22A 2BEBA 4KBBA 1JT3A 3IM7A 3OJMA 4IY8A 2F2FC 5DVHA 3VT0A 1TFMB 1MC9A 4I4PA 1JT7A 4IQPA 1XG6A 4USPA 4D0TA 3D7WB 1XYFA 3MALA 3Q7XA 1S0BA 4A7KA 2NP0A 2DS0A 3POKA 4P0KA 3CA6A 3BAQA 4EFRA 3H6SE 1YF8B 4X38A 2LIQA 3WO4A 1DFCA 1HWPB 4QC4A 4CJMA 3AKHA 1J0SA 1EPWA 2UUSA 3A23A 3BTAA 3O4BA 5B2HA 1P63A 5BOWA 2P39A 4LO7C 1BFFA 1EV2A 3OGFA 1DQGA 3O3QA 5BQUC 4ZBVB 1I1BA 1YTOA 4FVVA 4I37A 1G9DA 1D0HA 3QYDA 3FJFA 1YBIA 3VEQA 4USOA 1AXMA 3AH2A 4OUJA 3HMYA 2Y9WC 3JRRA 2Z48A 1NUNA 2K43A 4OEFA 2IWTB 4G1RA 4TLPA 3FJBA 3O4OA 1NZKA 1FMMS 3C9ZA 1W3FA 2D43A 2VSAA 3FJ8A 5D61A 5D63A 4QBVA 1G9AA 3N7MA
chains in the Genus database with same CATH topology
1JT4A 3AJ5A 4G9NA 4Q91A 2ZR1B 8I1BA 4I4SA 1WD3A 3FJJA 2MC2A 3CA0A 2ZQNA 3BAHA 4A7ZA 3BRGC 2I1BA 5GAQA 3MPPG 1FN0A 3NJ5A 4DEPA 1Z4SA 3VSFA 1JTCA 3IAGC 3CA3A 1W3GA 2Q9XA 2VUAA 1WD4A 3UJ4A 2NZ9A 5E24E 3S8KA 4GAIA 1IRPA 1WBAA 4LO1A 1V6XA 2BEAA 5BXPA 2F8XC 3BB2A 3A21A 1DJSB 4J23B 4I4VA 5EC5A 3CA1A 4OEEA 4WBCA 1S0FA 3HBWA 4I3NA 1OQLB 2FDBM 1SZ6B 3I2XA 3V79C 1TOOA 3P6JA 1KNMA 5BVPI 2NS2A 3SNVA 4ISRA 1PUUB 2WRYA 1AF9A 3NBEA 3WINC 41BIA 2D44A 4I2SA 4X39A 5FNXA 2AQZA 1F31A 1V6WA 4J2SA 3RTIB 5EHAA 3CAHA 3AH1A 1WBCA 5BXTA 3CRIA 3CQAA 2D1ZA 1DZDA 3ZXDA 5JLVA 3QR5A 2D22A 3OBTA 4L4HA 2GO2A 4XKIA 2DRZA 1W3AA 2AAIB 3K1XA 5D62A 2HZ9A 4A7YA 1ISYA 4IYBA 3N7LA 3RMXA 1BFCA 4F34A 1EVTA 3VT1A 2HW9A 4JAWA 3IM5A 4LO8B 3CA5A 3FFZA 1IRAX 3UDAA 1JT5A 3LTQA 3BA5A 2Y9XE 5FNWA 3Q7YA 4ZGRB 2VXTI 1PWAA 2BFHA 3LLPA 3EF2A 4I0YA 1ONKB 1HKNA 3WO2A 2F2FA 3FJIA 1AVUA 3BAUA 1TIEA 2VSEA 4LO3C 1JLXA 21BIA 1FWUA 3O4DA 4ZLBB 4P0LA 1SR4C 4IZEA 2Z49A 1G9BA 5BP5C 2D24A 1V6UA 2GZBA 4H04A 1RG8A 2QN4A 2KKIA 1HWNB 4I4XA 4EEEB 4QD2C 5DUYA 3B9UA 3PUBA 3BRFA 4EFQA 3CRGA 3RTJB 4KC3A 5HPZA 3F1RA 4AN7B 3O5WB 1DLLA 1TP0A 2L5XA 3CU1B 5BQUA 1FQ9A 1TWEA 4QBCA 3ZC8A 1GGPB 1S0GA 4F83A 4PC4A 4HJJA 2ERMA 4X3AA 2FO1A 3W9TA 2D7RA 1FV3A 2RSTA 1MD6A 4GP0A 5F90A 4G9MA 9ILBA 2ZQOA 3BADA 4G6MA 4EKXB 1RZOB 1L2HA 1RMLA 4AN6A 1IHKA 4QKSA 1E0OA 2NTDA 1Z0HA 4R6UB 1G9CA 3ZC9A 1VCLA 4IONA 1M2TB 2KH2A 1BLDA 2FFVA 4IHZA 4JRAA 3P6IA 2D20A 4KEJA 3NBDA 1IILA 3WMVA 2ET2A 3VUOA 3BAOA 4LO7B 1PC8B 2K4AB 4IZXA 1K5UA 1XZZA 1IJTA 4IY9A 4LO2C 4Q9PA 1ABRB 1T9FA 4OWLA 1ITBA 3FGMA 4JKQA 4P6AA 2HWMA 3FJEA 3O4AA 5BXSA 3IM6A 3OGGA 3O44A 4I4RA 5FZZA 5F8SA 3FUQA 4LO0C 4GAFA 1S0EA 3AKGA 3H6RA 2AXMA 1S0CA 4OEGA 4Z8SB 4EB2B 4OW4A 2X2SA 3N0KA 5JMCA 3NBCA 3RSJA 1V6VA 2NVHA 4ZFWB 1BFGA 4QKRA 2D23A 4YOLA 1BFBA 2E4MC 3WO3A 4MZFB 4HR6C 1T4QA 4Z9WB 2MLLB 3FJ9A 3KMVA 1YXWA 2P23A 1IT0A 1FMZA 4JQ0A 3PHZA 3Q7WA 2YUGA 1S0DA 3VSZA 3WINA 3CRHA 4ISQA 4QALA 1TTUA 3CA4A 2NYYA 3AKIA 2KLLA 1EYLA 3BAGA 1AVAC 3PG0A 4QO3A 3OBRA 3H6RB 2IHOA 3BA4A 2DRYA 3S8JA 1I1EA 4ZFYB 3WMUA 1PUMB 3O49A 3ILAA 3IIRA 3R4UA 4HA2A 4I7IA 3TC2A 4I4YA 3V0AA 3N7JA 5F8WA 6I1BA 4J2YA 1M16A 2DREA 3ZX7A 3NBNA 4ENDA 1JQZA 1Q04A 4I4UA 4J2XA 3OJVA 3O4CA 4MZGB 2FGFA 4J2KA 1S0LA 4FGFA 2M49A 4GOYA 1QQLA 3H6QA 3R4SA 3V0BA 1Z2VA 2MIBA 4I4OA 1HWMB 4ZOTA 1R8NA 2VLCA 4LO3A 3UD9A 1BA7A 1SR4A 2Q3NB 4ZFUB 4I96A 3A07A 2HWAA 3OJ2A 4DCKC 5BP5A 3VT2A 1ILR1 4UY4A 3HSMA 5EG6C 1II4A 3AJ6A 1HIBA 3RMYA 2J3PA 3FJHA 4I8MA 3V0AB 1ISVA 1Q1UA 1XHBA 2D7IA 4EFPA 4II0A 2VU9A 1YYNA 5F8YA 5DZUA 1HCDA 1PZZA 3P53A 2RQ9A 2ESUA 1AFCA 3AH4A 3UJ0A 2R9KB 4ZKTB 2NM1A 4MZHA 31BIA 2XOAA 3V0BB 1K5VA 4ZA3B 1Q03A 3PMEA 4XFSA 1AVWB 1FV2A 3T8SA 3BA7A 2WBCA 1IOBA 1DFQA 3F62B 2X2TA 1AVXB 1ISXA 4LO1C 3FJCA 4OWJA 1BARA 4JP0A 3VWCA 2KI4A 4GOVA 4I1EA 4QD2B 3ZXGA 4D0ZA 1CE7B 3FJAA 1QXMA 4G6JA 1BASA 2KI6B 1HCEA 2K8RA 1UPSA 1FWVA 3BX1C 4OWKA 1DQOA 4GP3A 5FZUA 1HWOB 2LIEA 4JKXB 4DENA 4KEIA 4JPZA 4I4QA 4XFTA 5DSSB 3BRDA 1RY7A 2RG9B 4LO2A 3FJDA 1R8OA 2FFUA 1ISWA 4X37A 3AZWA 3FUOA 1TWMA 2QYIB 4H9WA 4P0JA 4Q9GA 5FZYA 3E8LC 4H75A 1DZCA 5G00A 3N7KA 3JUTA 2Y9GA 4LO0A 1A8DA 1ISZA 7I1BA 3HALA 3HOMA 3I29B 1N4KA 3UD8A 5I1BA 2Y9FA 1QQKA 3WA1A 3HN1A 4I6IA 4L4IA 2E4MA 5BXRA 4KEKA 2AFGA 3UD7A 3AZVA 3I2AA 4D8HA 1CVSA 1JY0A 4I1BA 1BLAA 3FJKA 1DIWA 1G82A 3AKFA 1JLYA 3BAVA 1FGAA 4XFUA 2VXRA 3A22A 2BEBA 4KBBA 1JT3A 3IM7A 3OJMA 4IY8A 2F2FC 5DVHA 3VT0A 1TFMB 1MC9A 4I4PA 1JT7A 4IQPA 1XG6A 4USPA 4D0TA 3D7WB 1XYFA 3MALA 3Q7XA 1S0BA 4A7KA 2NP0A 2DS0A 3POKA 4P0KA 3CA6A 3BAQA 4EFRA 3H6SE 1YF8B 4X38A 2LIQA 3WO4A 1DFCA 1HWPB 4QC4A 4CJMA 3AKHA 1J0SA 1EPWA 2UUSA 3A23A 3BTAA 3O4BA 5B2HA 1P63A 5BOWA 2P39A 4LO7C 1BFFA 1EV2A 3OGFA 1DQGA 3O3QA 5BQUC 4ZBVB 1I1BA 1YTOA 4FVVA 4I37A 1G9DA 1D0HA 3QYDA 3FJFA 1YBIA 3VEQA 4USOA 1AXMA 3AH2A 4OUJA 3HMYA 2Y9WC 3JRRA 2Z48A 1NUNA 2K43A 4OEFA 2IWTB 4G1RA 4TLPA 3FJBA 3O4OA 1NZKA 1FMMS 3C9ZA 1W3FA 2D43A 2VSAA 3FJ8A 5D61A 5D63A 4QBVA 1G9AA 3N7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT4 A;  3AJ5 A;  4G9N A;  4Q91 A;  2ZR1 B;  8I1B A;  4I4S A;  1WD3 A;  3FJJ A;  2MC2 A;  3CA0 A;  2ZQN A;  3BAH A;  4A7Z A;  3BRG C;  2I1B A;  5GAQ A;  3MPP G;  1FN0 A;  3NJ5 A;  4DEP A;  1Z4S A;  3VSF A;  1JTC A;  3IAG C;  3CA3 A;  1W3G A;  2Q9X A;  2VUA A;  1WD4 A;  3UJ4 A;  2NZ9 A;  5E24 E;  3S8K A;  4GAI A;  1IRP A;  1WBA A;  4LO1 A;  1V6X A;  2BEA A;  5BXP A;  2F8X C;  3BB2 A;  3A21 A;  1DJS B;  4J23 B;  4I4V A;  5EC5 A;  3CA1 A;  4OEE A;  4WBC A;  1S0F A;  3HBW A;  4I3N A;  1OQL B;  2FDB M;  1SZ6 B;  3I2X A;  3V79 C;  1TOO A;  3P6J A;  1KNM A;  5BVP I;  3SNV A;  4ISR A;  1PUU B;  2WRY A;  1AF9 A;  3NBE A;  3WIN C;  41BI A;  2D44 A;  4I2S A;  4X39 A;  5FNX A;  2AQZ A;  1F31 A;  1V6W A;  4J2S A;  3RTI B;  5EHA A;  3CAH A;  3AH1 A;  1WBC A;  5BXT A;  3CRI A;  3CQA A;  2D1Z A;  1DZD A;  3ZXD A;  5JLV A;  3QR5 A;  2D22 A;  3OBT A;  4L4H A;  2GO2 A;  4XKI A;  2DRZ A;  1W3A A;  2AAI B;  3K1X A;  5D62 A;  2HZ9 A;  4A7Y A;  1ISY A;  4IYB A;  3N7L A;  3RMX A;  1BFC A;  4F34 A;  1EVT A;  3VT1 A;  2HW9 A;  4JAW A;  3IM5 A;  4LO8 B;  3CA5 A;  3FFZ A;  1IRA X;  3UDA A;  1JT5 A;  3LTQ A;  3BA5 A;  2Y9X E;  5FNW A;  3Q7Y A;  4ZGR B;  2VXT I;  1PWA A;  2BFH A;  3LLP A;  3EF2 A;  4I0Y A;  1ONK B;  1HKN A;  3WO2 A;  2F2F A;  3FJI A;  1AVU A;  3BAU A;  1TIE A;  2VSE A;  4LO3 C;  1JLX A;  21BI A;  1FWU A;  3O4D A;  4ZLB B;  4P0L A;  1SR4 C;  4IZE A;  2Z49 A;  1G9B A;  5BP5 C;  2D24 A;  1V6U A;  2GZB A;  4H04 A;  1RG8 A;  2QN4 A;  2KKI A;  1HWN B;  4I4X A;  4EEE B;  4QD2 C;  5DUY A;  3B9U A;  3PUB A;  3BRF A;  4EFQ A;  3CRG A;  3RTJ B;  4KC3 A;  5HPZ A;  3F1R A;  4AN7 B;  3O5W B;  1DLL A;  1TP0 A;  2L5X A;  3CU1 B;  5BQU A;  1FQ9 A;  1TWE A;  4QBC A;  3ZC8 A;  1GGP B;  1S0G A;  4F83 A;  4PC4 A;  4HJJ A;  2ERM A;  4X3A A;  2FO1 A;  3W9T A;  2D7R A;  1FV3 A;  2RST A;  1MD6 A;  4GP0 A;  5F90 A;  4G9M A;  9ILB A;  2ZQO A;  3BAD A;  4G6M A;  4EKX B;  1RZO B;  1L2H A;  1RML A;  4AN6 A;  1IHK A;  4QKS A;  1E0O A;  2NTD A;  1Z0H A;  4R6U B;  1G9C A;  3ZC9 A;  1VCL A;  4ION A;  1M2T B;  2KH2 A;  1BLD A;  2FFV A;  4IHZ A;  4JRA A;  3P6I A;  2D20 A;  4KEJ A;  3NBD A;  1IIL A;  3WMV A;  2ET2 A;  3VUO A;  3BAO A;  4LO7 B;  1PC8 B;  2K4A B;  4IZX A;  1K5U A;  1XZZ A;  1IJT A;  4IY9 A;  4LO2 C;  4Q9P A;  1ABR B;  1T9F A;  4OWL A;  1ITB A;  3FGM A;  4JKQ A;  4P6A A;  2HWM A;  3FJE A;  3O4A A;  5BXS A;  3IM6 A;  3OGG A;  3O44 A;  4I4R A;  5FZZ A;  5F8S A;  3FUQ A;  4LO0 C;  4GAF A;  1S0E A;  3AKG A;  3H6R A;  2AXM A;  1S0C A;  4OEG A;  4Z8S B;  4EB2 B;  4OW4 A;  2X2S A;  3N0K A;  5JMC A;  3NBC A;  3RSJ A;  1V6V A;  2NVH A;  4ZFW B;  1BFG A;  4QKR A;  2D23 A;  4YOL A;  1BFB A;  2E4M C;  3WO3 A;  4HR6 C;  1T4Q A;  4Z9W B;  2MLL B;  3FJ9 A;  3KMV A;  1YXW A;  2P23 A;  1IT0 A;  1FMZ A;  4JQ0 A;  3PHZ A;  3Q7W A;  2YUG A;  1S0D A;  3VSZ A;  3WIN A;  3CRH A;  4ISQ A;  4QAL A;  1TTU A;  3CA4 A;  2NYY A;  3AKI A;  2KLL A;  1EYL A;  3BAG A;  1AVA C;  3PG0 A;  4QO3 A;  3OBR A;  3H6R B;  2IHO A;  3BA4 A;  2DRY A;  3S8J A;  1I1E A;  4ZFY B;  3WMU A;  1PUM B;  3O49 A;  3ILA A;  3IIR A;  3R4U A;  4HA2 A;  4I7I A;  3TC2 A;  4I4Y A;  3V0A A;  3N7J A;  5F8W A;  6I1B A;  4J2Y A;  1M16 A;  2DRE A;  3ZX7 A;  3NBN A;  4END A;  1JQZ A;  1Q04 A;  4I4U A;  4J2X A;  3OJV A;  3O4C A;  2FGF A;  4J2K A;  1S0L A;  4FGF A;  2M49 A;  4GOY A;  1QQL A;  3H6Q A;  3R4S A;  3V0B A;  1Z2V A;  2MIB A;  4I4O A;  1HWM B;  4ZOT A;  1R8N A;  2VLC A;  4LO3 A;  3UD9 A;  1BA7 A;  1SR4 A;  2Q3N B;  4ZFU B;  4I96 A;  3A07 A;  2HWA A;  3OJ2 A;  4DCK C;  5BP5 A;  3VT2 A;  1ILR 1;  3HSM A;  5EG6 C;  1II4 A;  3AJ6 A;  1HIB A;  3RMY A;  2J3P A;  3FJH A;  4I8M A;  3V0A B;  1ISV A;  1Q1U A;  1XHB A;  2D7I A;  4EFP A;  4II0 A;  2VU9 A;  1YYN A;  5F8Y A;  5DZU A;  1HCD A;  1PZZ A;  3P53 A;  2RQ9 A;  2ESU A;  1AFC A;  3AH4 A;  3UJ0 A;  2R9K B;  4ZKT B;  2NM1 A;  31BI A;  2XOA A;  3V0B B;  1K5V A;  4ZA3 B;  1Q03 A;  3PME A;  4XFS A;  1AVW B;  1FV2 A;  3T8S A;  3BA7 A;  2WBC A;  1IOB A;  1DFQ A;  3F62 B;  2X2T A;  1AVX B;  1ISX A;  4LO1 C;  3FJC A;  4OWJ A;  1BAR A;  4JP0 A;  3VWC A;  2KI4 A;  4GOV A;  4I1E A;  4QD2 B;  3ZXG A;  4D0Z A;  1CE7 B;  3FJA A;  1QXM A;  4G6J A;  1BAS A;  2KI6 B;  1HCE A;  2K8R A;  1UPS A;  1FWV A;  3BX1 C;  4OWK A;  1DQO A;  4GP3 A;  5FZU A;  1HWO B;  2LIE A;  4JKX B;  4DEN A;  4KEI A;  4JPZ A;  4I4Q A;  4XFT A;  5DSS B;  3BRD A;  1RY7 A;  2RG9 B;  4LO2 A;  3FJD A;  1R8O A;  2FFU A;  1ISW A;  4X37 A;  3AZW A;  3FUO A;  1TWM A;  2QYI B;  4H9W A;  4P0J A;  4Q9G A;  5FZY A;  3E8L C;  1DZC A;  5G00 A;  3N7K A;  3JUT A;  2Y9G A;  4LO0 A;  1A8D A;  1ISZ A;  7I1B A;  3HAL A;  3HOM A;  3I29 B;  1N4K A;  3UD8 A;  5I1B A;  2Y9F A;  1QQK A;  3WA1 A;  3HN1 A;  4I6I A;  4L4I A;  2E4M A;  5BXR A;  4KEK A;  2AFG A;  3UD7 A;  3AZV A;  3I2A A;  4D8H A;  1CVS A;  1JY0 A;  4I1B A;  1BLA A;  3FJK A;  1DIW A;  1G82 A;  3AKF A;  1JLY A;  3BAV A;  1FGA A;  4XFU A;  2VXR A;  3A22 A;  2BEB A;  4KBB A;  1JT3 A;  3IM7 A;  3OJM A;  4IY8 A;  2F2F C;  5DVH A;  3VT0 A;  1TFM B;  1MC9 A;  4I4P A;  1JT7 A;  4IQP A;  1XG6 A;  4USP A;  4D0T A;  3D7W B;  1XYF A;  3MAL A;  3Q7X A;  1S0B A;  4A7K A;  2NP0 A;  2DS0 A;  3POK A;  4P0K A;  3CA6 A;  3BAQ A;  4EFR A;  3H6S E;  1YF8 B;  4X38 A;  2LIQ A;  3WO4 A;  1DFC A;  1HWP B;  4QC4 A;  4CJM A;  3AKH A;  1J0S A;  1EPW A;  2UUS A;  3A23 A;  3BTA A;  3O4B A;  5B2H A;  1P63 A;  5BOW A;  2P39 A;  4LO7 C;  1BFF A;  1EV2 A;  3OGF A;  1DQG A;  3O3Q A;  5BQU C;  4ZBV B;  1I1B A;  1YTO A;  4FVV A;  4I37 A;  1G9D A;  1D0H A;  3QYD A;  3FJF A;  1YBI A;  3VEQ A;  4USO A;  1AXM A;  3AH2 A;  4OUJ A;  3HMY A;  2Y9W C;  3JRR A;  2Z48 A;  1NUN A;  2K43 A;  4OEF A;  2IWT B;  4G1R A;  4TLP A;  3FJB A;  3O4O A;  1NZK A;  1FMM S;  3C9Z A;  1W3F A;  2D43 A;  2VSA A;  3FJ8 A;  5D61 A;  5D63 A;  4QBV A;  1G9A A;  3N7M A; 
#chains in the Genus database with same CATH topology
 1JT4 A;  3AJ5 A;  4G9N A;  4Q91 A;  2ZR1 B;  8I1B A;  4I4S A;  1WD3 A;  3FJJ A;  2MC2 A;  3CA0 A;  2ZQN A;  3BAH A;  4A7Z A;  3BRG C;  2I1B A;  5GAQ A;  3MPP G;  1FN0 A;  3NJ5 A;  4DEP A;  1Z4S A;  3VSF A;  1JTC A;  3IAG C;  3CA3 A;  1W3G A;  2Q9X A;  2VUA A;  1WD4 A;  3UJ4 A;  2NZ9 A;  5E24 E;  3S8K A;  4GAI A;  1IRP A;  1WBA A;  4LO1 A;  1V6X A;  2BEA A;  5BXP A;  2F8X C;  3BB2 A;  3A21 A;  1DJS B;  4J23 B;  4I4V A;  5EC5 A;  3CA1 A;  4OEE A;  4WBC A;  1S0F A;  3HBW A;  4I3N A;  1OQL B;  2FDB M;  1SZ6 B;  3I2X A;  3V79 C;  1TOO A;  3P6J A;  1KNM A;  5BVP I;  2NS2 A;  3SNV A;  4ISR A;  1PUU B;  2WRY A;  1AF9 A;  3NBE A;  3WIN C;  41BI A;  2D44 A;  4I2S A;  4X39 A;  5FNX A;  2AQZ A;  1F31 A;  1V6W A;  4J2S A;  3RTI B;  5EHA A;  3CAH A;  3AH1 A;  1WBC A;  5BXT A;  3CRI A;  3CQA A;  2D1Z A;  1DZD A;  3ZXD A;  5JLV A;  3QR5 A;  2D22 A;  3OBT A;  4L4H A;  2GO2 A;  4XKI A;  2DRZ A;  1W3A A;  2AAI B;  3K1X A;  5D62 A;  2HZ9 A;  4A7Y A;  1ISY A;  4IYB A;  3N7L A;  3RMX A;  1BFC A;  4F34 A;  1EVT A;  3VT1 A;  2HW9 A;  4JAW A;  3IM5 A;  4LO8 B;  3CA5 A;  3FFZ A;  1IRA X;  3UDA A;  1JT5 A;  3LTQ A;  3BA5 A;  2Y9X E;  5FNW A;  3Q7Y A;  4ZGR B;  2VXT I;  1PWA A;  2BFH A;  3LLP A;  3EF2 A;  4I0Y A;  1ONK B;  1HKN A;  3WO2 A;  2F2F A;  3FJI A;  1AVU A;  3BAU A;  1TIE A;  2VSE A;  4LO3 C;  1JLX A;  21BI A;  1FWU A;  3O4D A;  4ZLB B;  4P0L A;  1SR4 C;  4IZE A;  2Z49 A;  1G9B A;  5BP5 C;  2D24 A;  1V6U A;  2GZB A;  4H04 A;  1RG8 A;  2QN4 A;  2KKI A;  1HWN B;  4I4X A;  4EEE B;  4QD2 C;  5DUY A;  3B9U A;  3PUB A;  3BRF A;  4EFQ A;  3CRG A;  3RTJ B;  4KC3 A;  5HPZ A;  3F1R A;  4AN7 B;  3O5W B;  1DLL A;  1TP0 A;  2L5X A;  3CU1 B;  5BQU A;  1FQ9 A;  1TWE A;  4QBC A;  3ZC8 A;  1GGP B;  1S0G A;  4F83 A;  4PC4 A;  4HJJ A;  2ERM A;  4X3A A;  2FO1 A;  3W9T A;  2D7R A;  1FV3 A;  2RST A;  1MD6 A;  4GP0 A;  5F90 A;  4G9M A;  9ILB A;  2ZQO A;  3BAD A;  4G6M A;  4EKX B;  1RZO B;  1L2H A;  1RML A;  4AN6 A;  1IHK A;  4QKS A;  1E0O A;  2NTD A;  1Z0H A;  4R6U B;  1G9C A;  3ZC9 A;  1VCL A;  4ION A;  1M2T B;  2KH2 A;  1BLD A;  2FFV A;  4IHZ A;  4JRA A;  3P6I A;  2D20 A;  4KEJ A;  3NBD A;  1IIL A;  3WMV A;  2ET2 A;  3VUO A;  3BAO A;  4LO7 B;  1PC8 B;  2K4A B;  4IZX A;  1K5U A;  1XZZ A;  1IJT A;  4IY9 A;  4LO2 C;  4Q9P A;  1ABR B;  1T9F A;  4OWL A;  1ITB A;  3FGM A;  4JKQ A;  4P6A A;  2HWM A;  3FJE A;  3O4A A;  5BXS A;  3IM6 A;  3OGG A;  3O44 A;  4I4R A;  5FZZ A;  5F8S A;  3FUQ A;  4LO0 C;  4GAF A;  1S0E A;  3AKG A;  3H6R A;  2AXM A;  1S0C A;  4OEG A;  4Z8S B;  4EB2 B;  4OW4 A;  2X2S A;  3N0K A;  5JMC A;  3NBC A;  3RSJ A;  1V6V A;  2NVH A;  4ZFW B;  1BFG A;  4QKR A;  2D23 A;  4YOL A;  1BFB A;  2E4M C;  3WO3 A;  4MZF B;  4HR6 C;  1T4Q A;  4Z9W B;  2MLL B;  3FJ9 A;  3KMV A;  1YXW A;  2P23 A;  1IT0 A;  1FMZ A;  4JQ0 A;  3PHZ A;  3Q7W A;  2YUG A;  1S0D A;  3VSZ A;  3WIN A;  3CRH A;  4ISQ A;  4QAL A;  1TTU A;  3CA4 A;  2NYY A;  3AKI A;  2KLL A;  1EYL A;  3BAG A;  1AVA C;  3PG0 A;  4QO3 A;  3OBR A;  3H6R B;  2IHO A;  3BA4 A;  2DRY A;  3S8J A;  1I1E A;  4ZFY B;  3WMU A;  1PUM B;  3O49 A;  3ILA A;  3IIR A;  3R4U A;  4HA2 A;  4I7I A;  3TC2 A;  4I4Y A;  3V0A A;  3N7J A;  5F8W A;  6I1B A;  4J2Y A;  1M16 A;  2DRE A;  3ZX7 A;  3NBN A;  4END A;  1JQZ A;  1Q04 A;  4I4U A;  4J2X A;  3OJV A;  3O4C A;  4MZG B;  2FGF A;  4J2K A;  1S0L A;  4FGF A;  2M49 A;  4GOY A;  1QQL A;  3H6Q A;  3R4S A;  3V0B A;  1Z2V A;  2MIB A;  4I4O A;  1HWM B;  4ZOT A;  1R8N A;  2VLC A;  4LO3 A;  3UD9 A;  1BA7 A;  1SR4 A;  2Q3N B;  4ZFU B;  4I96 A;  3A07 A;  2HWA A;  3OJ2 A;  4DCK C;  5BP5 A;  3VT2 A;  1ILR 1;  4UY4 A;  3HSM A;  5EG6 C;  1II4 A;  3AJ6 A;  1HIB A;  3RMY A;  2J3P A;  3FJH A;  4I8M A;  3V0A B;  1ISV A;  1Q1U A;  1XHB A;  2D7I A;  4EFP A;  4II0 A;  2VU9 A;  1YYN A;  5F8Y A;  5DZU A;  1HCD A;  1PZZ A;  3P53 A;  2RQ9 A;  2ESU A;  1AFC A;  3AH4 A;  3UJ0 A;  2R9K B;  4ZKT B;  2NM1 A;  4MZH A;  31BI A;  2XOA A;  3V0B B;  1K5V A;  4ZA3 B;  1Q03 A;  3PME A;  4XFS A;  1AVW B;  1FV2 A;  3T8S A;  3BA7 A;  2WBC A;  1IOB A;  1DFQ A;  3F62 B;  2X2T A;  1AVX B;  1ISX A;  4LO1 C;  3FJC A;  4OWJ A;  1BAR A;  4JP0 A;  3VWC A;  2KI4 A;  4GOV A;  4I1E A;  4QD2 B;  3ZXG A;  4D0Z A;  1CE7 B;  3FJA A;  1QXM A;  4G6J A;  1BAS A;  2KI6 B;  1HCE A;  2K8R A;  1UPS A;  1FWV A;  3BX1 C;  4OWK A;  1DQO A;  4GP3 A;  5FZU A;  1HWO B;  2LIE A;  4JKX B;  4DEN A;  4KEI A;  4JPZ A;  4I4Q A;  4XFT A;  5DSS B;  3BRD A;  1RY7 A;  2RG9 B;  4LO2 A;  3FJD A;  1R8O A;  2FFU A;  1ISW A;  4X37 A;  3AZW A;  3FUO A;  1TWM A;  2QYI B;  4H9W A;  4P0J A;  4Q9G A;  5FZY A;  3E8L C;  4H75 A;  1DZC A;  5G00 A;  3N7K A;  3JUT A;  2Y9G A;  4LO0 A;  1A8D A;  1ISZ A;  7I1B A;  3HAL A;  3HOM A;  3I29 B;  1N4K A;  3UD8 A;  5I1B A;  2Y9F A;  1QQK A;  3WA1 A;  3HN1 A;  4I6I A;  4L4I A;  2E4M A;  5BXR A;  4KEK A;  2AFG A;  3UD7 A;  3AZV A;  3I2A A;  4D8H A;  1CVS A;  1JY0 A;  4I1B A;  1BLA A;  3FJK A;  1DIW A;  1G82 A;  3AKF A;  1JLY A;  3BAV A;  1FGA A;  4XFU A;  2VXR A;  3A22 A;  2BEB A;  4KBB A;  1JT3 A;  3IM7 A;  3OJM A;  4IY8 A;  2F2F C;  5DVH A;  3VT0 A;  1TFM B;  1MC9 A;  4I4P A;  1JT7 A;  4IQP A;  1XG6 A;  4USP A;  4D0T A;  3D7W B;  1XYF A;  3MAL A;  3Q7X A;  1S0B A;  4A7K A;  2NP0 A;  2DS0 A;  3POK A;  4P0K A;  3CA6 A;  3BAQ A;  4EFR A;  3H6S E;  1YF8 B;  4X38 A;  2LIQ A;  3WO4 A;  1DFC A;  1HWP B;  4QC4 A;  4CJM A;  3AKH A;  1J0S A;  1EPW A;  2UUS A;  3A23 A;  3BTA A;  3O4B A;  5B2H A;  1P63 A;  5BOW A;  2P39 A;  4LO7 C;  1BFF A;  1EV2 A;  3OGF A;  1DQG A;  3O3Q A;  5BQU C;  4ZBV B;  1I1B A;  1YTO A;  4FVV A;  4I37 A;  1G9D A;  1D0H A;  3QYD A;  3FJF A;  1YBI A;  3VEQ A;  4USO A;  1AXM A;  3AH2 A;  4OUJ A;  3HMY A;  2Y9W C;  3JRR A;  2Z48 A;  1NUN A;  2K43 A;  4OEF A;  2IWT B;  4G1R A;  4TLP A;  3FJB A;  3O4O A;  1NZK A;  1FMM S;  3C9Z A;  1W3F A;  2D43 A;  2VSA A;  3FJ8 A;  5D61 A;  5D63 A;  4QBV A;  1G9A A;  3N7M A; 
#chains in the Genus database with same CATH homology
 1JT4 A;  3AJ5 A;  4G9N A;  4Q91 A;  2ZR1 B;  8I1B A;  4I4S A;  1WD3 A;  3FJJ A;  2MC2 A;  3CA0 A;  2ZQN A;  3BAH A;  4A7Z A;  3BRG C;  2I1B A;  5GAQ A;  3MPP G;  1FN0 A;  3NJ5 A;  4DEP A;  1Z4S A;  3VSF A;  1JTC A;  3IAG C;  3CA3 A;  1W3G A;  2Q9X A;  2VUA A;  1WD4 A;  3UJ4 A;  2NZ9 A;  5E24 E;  3S8K A;  4GAI A;  1IRP A;  1WBA A;  4LO1 A;  1V6X A;  2BEA A;  5BXP A;  2F8X C;  3BB2 A;  3A21 A;  1DJS B;  4J23 B;  4I4V A;  5EC5 A;  3CA1 A;  4OEE A;  4WBC A;  1S0F A;  3HBW A;  4I3N A;  1OQL B;  2FDB M;  1SZ6 B;  3I2X A;  3V79 C;  1TOO A;  3P6J A;  1KNM A;  5BVP I;  2NS2 A;  3SNV A;  4ISR A;  1PUU B;  2WRY A;  1AF9 A;  3NBE A;  3WIN C;  41BI A;  2D44 A;  4I2S A;  4X39 A;  5FNX A;  2AQZ A;  1F31 A;  1V6W A;  4J2S A;  3RTI B;  5EHA A;  3CAH A;  3AH1 A;  1WBC A;  5BXT A;  3CRI A;  3CQA A;  2D1Z A;  1DZD A;  3ZXD A;  5JLV A;  3QR5 A;  2D22 A;  3OBT A;  4L4H A;  2GO2 A;  4XKI A;  2DRZ A;  1W3A A;  2AAI B;  3K1X A;  5D62 A;  2HZ9 A;  4A7Y A;  1ISY A;  4IYB A;  3N7L A;  3RMX A;  1BFC A;  4F34 A;  1EVT A;  3VT1 A;  2HW9 A;  4JAW A;  3IM5 A;  4LO8 B;  3CA5 A;  3FFZ A;  1IRA X;  3UDA A;  1JT5 A;  3LTQ A;  3BA5 A;  2Y9X E;  5FNW A;  3Q7Y A;  4ZGR B;  2VXT I;  1PWA A;  2BFH A;  3LLP A;  3EF2 A;  4I0Y A;  1ONK B;  1HKN A;  3WO2 A;  2F2F A;  3FJI A;  1AVU A;  3BAU A;  1TIE A;  2VSE A;  4LO3 C;  1JLX A;  21BI A;  1FWU A;  3O4D A;  4ZLB B;  4P0L A;  1SR4 C;  4IZE A;  2Z49 A;  1G9B A;  5BP5 C;  2D24 A;  1V6U A;  2GZB A;  4H04 A;  1RG8 A;  2QN4 A;  2KKI A;  1HWN B;  4I4X A;  4EEE B;  4QD2 C;  5DUY A;  3B9U A;  3PUB A;  3BRF A;  4EFQ A;  3CRG A;  3RTJ B;  4KC3 A;  5HPZ A;  3F1R A;  4AN7 B;  3O5W B;  1DLL A;  1TP0 A;  2L5X A;  3CU1 B;  5BQU A;  1FQ9 A;  1TWE A;  4QBC A;  3ZC8 A;  1GGP B;  1S0G A;  4F83 A;  4PC4 A;  4HJJ A;  2ERM A;  4X3A A;  2FO1 A;  3W9T A;  2D7R A;  1FV3 A;  2RST A;  1MD6 A;  4GP0 A;  5F90 A;  4G9M A;  9ILB A;  2ZQO A;  3BAD A;  4G6M A;  4EKX B;  1RZO B;  1L2H A;  1RML A;  4AN6 A;  1IHK A;  4QKS A;  1E0O A;  2NTD A;  1Z0H A;  4R6U B;  1G9C A;  3ZC9 A;  1VCL A;  4ION A;  1M2T B;  2KH2 A;  1BLD A;  2FFV A;  4IHZ A;  4JRA A;  3P6I A;  2D20 A;  4KEJ A;  3NBD A;  1IIL A;  3WMV A;  2ET2 A;  3VUO A;  3BAO A;  4LO7 B;  1PC8 B;  2K4A B;  4IZX A;  1K5U A;  1XZZ A;  1IJT A;  4IY9 A;  4LO2 C;  4Q9P A;  1ABR B;  1T9F A;  4OWL A;  1ITB A;  3FGM A;  4JKQ A;  4P6A A;  2HWM A;  3FJE A;  3O4A A;  5BXS A;  3IM6 A;  3OGG A;  3O44 A;  4I4R A;  5FZZ A;  5F8S A;  3FUQ A;  4LO0 C;  4GAF A;  1S0E A;  3AKG A;  3H6R A;  2AXM A;  1S0C A;  4OEG A;  4Z8S B;  4EB2 B;  4OW4 A;  2X2S A;  3N0K A;  5JMC A;  3NBC A;  3RSJ A;  1V6V A;  2NVH A;  4ZFW B;  1BFG A;  4QKR A;  2D23 A;  4YOL A;  1BFB A;  2E4M C;  3WO3 A;  4MZF B;  4HR6 C;  1T4Q A;  4Z9W B;  2MLL B;  3FJ9 A;  3KMV A;  1YXW A;  2P23 A;  1IT0 A;  1FMZ A;  4JQ0 A;  3PHZ A;  3Q7W A;  2YUG A;  1S0D A;  3VSZ A;  3WIN A;  3CRH A;  4ISQ A;  4QAL A;  1TTU A;  3CA4 A;  2NYY A;  3AKI A;  2KLL A;  1EYL A;  3BAG A;  1AVA C;  3PG0 A;  4QO3 A;  3OBR A;  3H6R B;  2IHO A;  3BA4 A;  2DRY A;  3S8J A;  1I1E A;  4ZFY B;  3WMU A;  1PUM B;  3O49 A;  3ILA A;  3IIR A;  3R4U A;  4HA2 A;  4I7I A;  3TC2 A;  4I4Y A;  3V0A A;  3N7J A;  5F8W A;  6I1B A;  4J2Y A;  1M16 A;  2DRE A;  3ZX7 A;  3NBN A;  4END A;  1JQZ A;  1Q04 A;  4I4U A;  4J2X A;  3OJV A;  3O4C A;  4MZG B;  2FGF A;  4J2K A;  1S0L A;  4FGF A;  2M49 A;  4GOY A;  1QQL A;  3H6Q A;  3R4S A;  3V0B A;  1Z2V A;  2MIB A;  4I4O A;  1HWM B;  4ZOT A;  1R8N A;  2VLC A;  4LO3 A;  3UD9 A;  1BA7 A;  1SR4 A;  2Q3N B;  4ZFU B;  4I96 A;  3A07 A;  2HWA A;  3OJ2 A;  4DCK C;  5BP5 A;  3VT2 A;  1ILR 1;  4UY4 A;  3HSM A;  5EG6 C;  1II4 A;  3AJ6 A;  1HIB A;  3RMY A;  2J3P A;  3FJH A;  4I8M A;  3V0A B;  1ISV A;  1Q1U A;  1XHB A;  2D7I A;  4EFP A;  4II0 A;  2VU9 A;  1YYN A;  5F8Y A;  5DZU A;  1HCD A;  1PZZ A;  3P53 A;  2RQ9 A;  2ESU A;  1AFC A;  3AH4 A;  3UJ0 A;  2R9K B;  4ZKT B;  2NM1 A;  4MZH A;  31BI A;  2XOA A;  3V0B B;  1K5V A;  4ZA3 B;  1Q03 A;  3PME A;  4XFS A;  1AVW B;  1FV2 A;  3T8S A;  3BA7 A;  2WBC A;  1IOB A;  1DFQ A;  3F62 B;  2X2T A;  1AVX B;  1ISX A;  4LO1 C;  3FJC A;  4OWJ A;  1BAR A;  4JP0 A;  3VWC A;  2KI4 A;  4GOV A;  4I1E A;  4QD2 B;  3ZXG A;  4D0Z A;  1CE7 B;  3FJA A;  1QXM A;  4G6J A;  1BAS A;  2KI6 B;  1HCE A;  2K8R A;  1UPS A;  1FWV A;  3BX1 C;  4OWK A;  1DQO A;  4GP3 A;  5FZU A;  1HWO B;  2LIE A;  4JKX B;  4DEN A;  4KEI A;  4JPZ A;  4I4Q A;  4XFT A;  5DSS B;  3BRD A;  1RY7 A;  2RG9 B;  4LO2 A;  3FJD A;  1R8O A;  2FFU A;  1ISW A;  4X37 A;  3AZW A;  3FUO A;  1TWM A;  2QYI B;  4H9W A;  4P0J A;  4Q9G A;  5FZY A;  3E8L C;  4H75 A;  1DZC A;  5G00 A;  3N7K A;  3JUT A;  2Y9G A;  4LO0 A;  1A8D A;  1ISZ A;  7I1B A;  3HAL A;  3HOM A;  3I29 B;  1N4K A;  3UD8 A;  5I1B A;  2Y9F A;  1QQK A;  3WA1 A;  3HN1 A;  4I6I A;  4L4I A;  2E4M A;  5BXR A;  4KEK A;  2AFG A;  3UD7 A;  3AZV A;  3I2A A;  4D8H A;  1CVS A;  1JY0 A;  4I1B A;  1BLA A;  3FJK A;  1DIW A;  1G82 A;  3AKF A;  1JLY A;  3BAV A;  1FGA A;  4XFU A;  2VXR A;  3A22 A;  2BEB A;  4KBB A;  1JT3 A;  3IM7 A;  3OJM A;  4IY8 A;  2F2F C;  5DVH A;  3VT0 A;  1TFM B;  1MC9 A;  4I4P A;  1JT7 A;  4IQP A;  1XG6 A;  4USP A;  4D0T A;  3D7W B;  1XYF A;  3MAL A;  3Q7X A;  1S0B A;  4A7K A;  2NP0 A;  2DS0 A;  3POK A;  4P0K A;  3CA6 A;  3BAQ A;  4EFR A;  3H6S E;  1YF8 B;  4X38 A;  2LIQ A;  3WO4 A;  1DFC A;  1HWP B;  4QC4 A;  4CJM A;  3AKH A;  1J0S A;  1EPW A;  2UUS A;  3A23 A;  3BTA A;  3O4B A;  5B2H A;  1P63 A;  5BOW A;  2P39 A;  4LO7 C;  1BFF A;  1EV2 A;  3OGF A;  1DQG A;  3O3Q A;  5BQU C;  4ZBV B;  1I1B A;  1YTO A;  4FVV A;  4I37 A;  1G9D A;  1D0H A;  3QYD A;  3FJF A;  1YBI A;  3VEQ A;  4USO A;  1AXM A;  3AH2 A;  4OUJ A;  3HMY A;  2Y9W C;  3JRR A;  2Z48 A;  1NUN A;  2K43 A;  4OEF A;  2IWT B;  4G1R A;  4TLP A;  3FJB A;  3O4O A;  1NZK A;  1FMM S;  3C9Z A;  1W3F A;  2D43 A;  2VSA A;  3FJ8 A;  5D61 A;  5D63 A;  4QBV A;  1G9A A;  3N7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...