3H6SE

Structure of clitocypin - cathepsin v complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
150
Chain Sequence
b'MASLEDGTYRLRAVTTSNPDPGVGGEYATVEGARQPVKAEPSTPPFFERQIWQVTRNSDGQSTIKYQGLNAPFEYGFSYDQEQNAPVAGDPKEYILQLVPSTTDVYIIRAPIQRVGVDVEVGVQGNNLVYKFFPVDGSGGDRPAWRFTRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L2
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 150
sequence length 152
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF10467 Inhibitor_I48 Peptidase inhibitor clitocypin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3h6sE00
3A22A 3FUQA 2NZ9A 1P63A 3CA1A 2VU9A 4HJJA 4QBCA 2DRYA 1DZDA 1KNMA 5BXSA 3OJ2A 1N4KA 3FJIA 4I4OA 3S8JA 2QYIB 1Z2VA 1RY7A 3N7KA 4AN6A 3V0AA 4IQPA 3BA7A 3Q7YA 1MC9A 2F2FA 1ISZA 1ITBA 3BTAA 2P23A 1W3GA 2AFGA 4IY8A 1GGPB 4Q91A 4QD2C 1I1EA 3O4AA 3CA4A 3CRIA 4GAIA 2HW9A 4I3NA 1HWNB 4LO3C 1I1BA 1BA7A 5HPZA 3RTIB 1QQLA 3O4BA 3H6SE 5FNWA 1FMZA 1HKNA 4KC3A 2KI6B 3RMYA 1SZ6B 1FWVA 2KLLA 4JRAA 3UJ4A 3FJDA 4G6MA 5DSSB 4I4VA 4I96A 4ZKTB 1WD3A 3TC2A 2ERMA 4J2SA 4LO0A 1BLAA 5G00A 3VT2A 4I4QA 4J23B 4LO7B 5BVPI 1K5VA 3O44A 3FJ9A 3RSJA 2LIEA 3AKHA 1EVTA 2DRZA 3BAGA 2Z49A 4QC4A 3RTJB 1DFQA 1IRPA 4A7YA 5F8SA 4J2KA 1YXWA 4JPZA 3NBEA 4I1BA 4LO2A 2E4MA 3FJBA 1TIEA 3CA6A 4GP3A 1UPSA 1G9AA 4EEEB 3CQAA 3UDAA 3P6JA 1XYFA 1DQOA 1D0HA 3CU1B 4OWKA 3PUBA 1IT0A 4D0TA 2BFHA 3W9TA 3BADA 1S0GA 3LTQA 1HIBA 5E24E 4H9WA 3V79C 1HCEA 2VSAA 4OEEA 4G1RA 4P6AA 4I4XA 4I4UA 3O5WB 4XFSA 1SR4C 1EYLA 3AH1A 1VCLA 3A07A 4OWLA 1FMMS 4USOA 5BXRA 1JQZA 3R4SA 2R9KB 1BFFA 3BB2A 2P39A 4R6UB 2D23A 4ENDA 1V6VA 1ISYA 2YUGA 3F62B 1JT4A 4P0LA 2AAIB 4FGFA 4DCKC 4OUJA 4HR6C 3N0KA 4GAFA 1TTUA 2ZQNA 6I1BA 4ZA3B 3MALA 3VEQA 2ET2A 4ZFUB 5F90A 3H6RA 4LO1C 3D7WB 4J2XA 1FV2A 1Q04A 1Z0HA 1YTOA 1DQGA 2Y9WC 1Q1UA 4F83A 4JAWA 3N7LA 1DIWA 1FV3A 5BP5C 4LO3A 4I0YA 1ILR1 2M49A 3BAHA 3R4UA 4G9MA 3N7MA 3CA3A 4PC4A 1RZOB 4EB2B 3UD9A 3AKFA 3VWCA 2NYYA 3Q7WA 4Z8SB 4I4PA 3H6RB 5JMCA 1W3FA 2HWAA 4L4IA 9ILBA 1S0FA 4KEKA 1RG8A 1R8OA 2RSTA 3FJJA 2ZR1B 4I6IA 4EKXB 1CVSA 3LLPA 4JKQA 4QALA 3SNVA 2K43A 21BIA 2QN4A 4TLPA 4P0KA 3NBDA 1HWOB 4KEIA 1L2HA 1JLXA 3ZXDA 2LIQA 3JUTA 3V0AB 2KI4A 5I1BA 2VUAA 3AH2A 3AKIA 1S0LA 3UJ0A 2DS0A 1G9DA 7I1BA 2D44A 5FZZA 2L5XA 3AZWA 1V6WA 3Q7XA 4HA2A 4ISRA 3VT1A 4QKSA 3A23A 3VSZA 2D22A 2Y9GA 4X3AA 1T9FA 1HWMB 3NJ5A 3OGGA 3V0BA 3OJVA 3EF2A 5FZUA 4G9NA 1FQ9A 4ZFWB 3AKGA 3VSFA 1V6UA 4ZBVB 1FGAA 5JLVA 2MIBA 3FJEA 2X2TA 4OEFA 5D62A 5EG6C 4X38A 4D0ZA 3IIRA 3JRRA 4ZLBB 3FJ8A 4ZFYB 1JY0A 5BQUA 4IYBA 5BXTA 1ISVA 1JT5A 3WA1A 3HSMA 1YF8B 2F2FC 3HALA 4IZXA 1IOBA 2FFVA 3FGMA 2Y9FA 31BIA 4QKRA 3O4OA 3WO3A 1JLYA 2RQ9A 4IONA 4I4SA 3BRDA 1WBAA 2FFUA 3OBTA 4EFPA 3IM5A 1EV2A 2HZ9A 3POKA 1S0CA 4GOVA 3IAGC 2GO2A 2ESUA 3WINA 4IHZA 1HWPB 1IRAX 2XOAA 4XFTA 3F1RA 1BFCA 1AVUA 4LO7C 3BAQA 1OQLB 1G9BA 1II4A 1NUNA 4I4YA 1J0SA 1R8NA 4LO1A 3AJ5A 2WBCA 5D63A 1PC8B 4JP0A 4I8MA 1AVAC 1MD6A 2FDBM 1WBCA 1EPWA 3BRFA 2NP0A 2J3PA 5B2HA 4L4HA 1BLDA 2X2SA 4WBCA 3ILAA 3P6IA 3I2AA 3WMUA 1A8DA 4F34A 3I2XA 4ISQA 1AF9A 2NTDA 4IY9A 3MPPG 2D20A 4I2SA 2I1BA 2DREA 4YOLA 4IZEA 1M16A 3CRGA 3ZXGA 4I4RA 4KBBA 4A7KA 4II0A 3CRHA 4LO2C 1AVWB 2E4MC 1S0EA 4GOYA 1TFMB 2MLLB 4X37A 1PUUB 1DJSB 3AJ6A 4X39A 3RMXA 2FGFA 2NM1A 4JQ0A 1S0DA 5FNXA 4DENA 1CE7B 1S0BA 4I1EA 3CA5A 1JT3A 4EFRA 5GAQA 4OEGA 2UUSA 3BX1C 1JTCA 3AH4A 1ONKB 2VLCA 3WO4A 3FFZA 1PZZA 1XZZA 3BAOA 3HMYA 4CJMA 1YYNA 5EC5A 3E8LC 4QD2B 1IILA 3ZX7A 4FVVA 1AVXB 3I29B 1Q03A 1AFCA 1HCDA 5DVHA 3O49A 2AXMA 2Q3NB 1Z4SA 3S8KA 2D24A 3QR5A 2NVHA 4LO8B 1DZCA 1BARA 3BA4A 3FJHA 4A7ZA 2Q9XA 4J2YA 1PWAA 4I37A 3H6QA 3NBNA 1M2TB 3PHZA 2Z48A 1IHKA 5BXPA 3CA0A 1AXMA 1XHBA 3WO2A 1F31A 1E0OA 3OGFA 1ISWA 3IM6A 1DFCA 2MC2A 1FWUA 4P0JA 3WMVA 3HOMA 1YBIA 3FJCA 2K4AB 2BEAA 3PMEA 5EHAA 3O3QA 4KEJA 5D61A 1DLLA 1T4QA 4ZGRB 2D1ZA 2D43A 2IWTB 4ZOTA 2KKIA 5F8WA 2D7IA 3ZC9A 1SR4A 4I7IA 3B9UA 3CAHA 4DEPA 1G82A 1K5UA 1TWEA 3OJMA 1TP0A 3FJFA 5F8YA 2FO1A 3V0BB 4OW4A 4Q9GA 1ISXA 1PUMB 4QO3A 1FN0A 2AQZA 1QQKA 3O4DA 3PG0A 3T8SA 3NBCA 3IM7A 3UD7A 3BA5A 1BFGA 4H04A 1TOOA 1BFBA 4XFUA 3KMVA 1TWMA 3O4CA 1BASA 8I1BA 2D7RA 1V6XA 1W3AA 4G6JA 4USPA 1XG6A 3BRGC 3A21A 3P53A 2RG9B 1JT7A 4Q9PA 5DUYA 2VXRA 1G9CA 3FJKA 3AZVA 5BP5A 3UD8A 3ZC8A 4LO0C 2Y9XE 2KH2A 1NZKA 2IHOA 4XKIA 1RMLA 3K1XA 3N7JA 4Z9WB 4EFQA 5BQUC 2VSEA 3BAVA 3C9ZA 3VT0A 3OBRA 2WRYA 3FJAA 1ABRB 1WD4A 5FZYA 2ZQOA 3QYDA 4QBVA 3HN1A 5DZUA 5BOWA 2HWMA 2F8XC 4OWJA 41BIA 3HBWA 4AN7B 1IJTA 3VUOA 2K8RA 2GZBA 2BEBA 4GP0A 4JKXB 3WINC 1QXMA 3BAUA 2VXTI 4D8HA 3FUOA
chains in the Genus database with same CATH superfamily
3A22A 3FUQA 2NZ9A 1P63A 3CA1A 2VU9A 4HJJA 4QBCA 2DRYA 1DZDA 1KNMA 5BXSA 3OJ2A 1N4KA 3FJIA 4I4OA 3S8JA 2QYIB 1Z2VA 1RY7A 3N7KA 4AN6A 3V0AA 4IQPA 3BA7A 3Q7YA 1MC9A 2F2FA 1ISZA 1ITBA 3BTAA 2P23A 1W3GA 2AFGA 4IY8A 1GGPB 4Q91A 4QD2C 1I1EA 3O4AA 3CA4A 3CRIA 4GAIA 2HW9A 4I3NA 1HWNB 4LO3C 1I1BA 1BA7A 5HPZA 3RTIB 1QQLA 4UY4A 3O4BA 3H6SE 5FNWA 1FMZA 1HKNA 4KC3A 2KI6B 3RMYA 1SZ6B 1FWVA 2KLLA 4JRAA 3UJ4A 3FJDA 4G6MA 5DSSB 4I4VA 4I96A 4ZKTB 1WD3A 3TC2A 2ERMA 4J2SA 4LO0A 1BLAA 5G00A 3VT2A 4I4QA 4J23B 4LO7B 5BVPI 1K5VA 3O44A 3FJ9A 3RSJA 2LIEA 3AKHA 1EVTA 2DRZA 3BAGA 2Z49A 4QC4A 3RTJB 1DFQA 1IRPA 4A7YA 5F8SA 4J2KA 1YXWA 4JPZA 3NBEA 4I1BA 4LO2A 2E4MA 3FJBA 1TIEA 3CA6A 4GP3A 1UPSA 1G9AA 4EEEB 3CQAA 3UDAA 3P6JA 4MZGB 1XYFA 1DQOA 1D0HA 3CU1B 4OWKA 3PUBA 1IT0A 4D0TA 2BFHA 3W9TA 3BADA 1S0GA 3LTQA 1HIBA 5E24E 4H9WA 3V79C 1HCEA 2VSAA 4OEEA 4G1RA 4P6AA 4I4XA 4I4UA 3O5WB 4XFSA 1SR4C 1EYLA 3AH1A 1VCLA 3A07A 4OWLA 1FMMS 4USOA 5BXRA 1JQZA 3R4SA 2R9KB 1BFFA 3BB2A 2P39A 4R6UB 2D23A 4ENDA 1V6VA 1ISYA 2YUGA 3F62B 1JT4A 4P0LA 2AAIB 4FGFA 4DCKC 4OUJA 4HR6C 3N0KA 4GAFA 1TTUA 2ZQNA 6I1BA 4ZA3B 3MALA 3VEQA 2ET2A 4ZFUB 5F90A 3H6RA 4LO1C 3D7WB 4J2XA 1FV2A 1Q04A 1Z0HA 1YTOA 1DQGA 2Y9WC 1Q1UA 4F83A 4JAWA 3N7LA 1DIWA 1FV3A 5BP5C 4LO3A 4I0YA 1ILR1 2M49A 3BAHA 3R4UA 4G9MA 3N7MA 3CA3A 4PC4A 1RZOB 4EB2B 3UD9A 3AKFA 3VWCA 2NYYA 3Q7WA 4Z8SB 4I4PA 3H6RB 5JMCA 1W3FA 2HWAA 4L4IA 9ILBA 1S0FA 4KEKA 1RG8A 1R8OA 2RSTA 3FJJA 2ZR1B 4I6IA 4EKXB 1CVSA 3LLPA 4JKQA 4QALA 3SNVA 2K43A 21BIA 2QN4A 4TLPA 4P0KA 3NBDA 1HWOB 4KEIA 1L2HA 1JLXA 3ZXDA 2LIQA 3JUTA 3V0AB 2KI4A 5I1BA 2VUAA 3AH2A 3AKIA 1S0LA 3UJ0A 2DS0A 1G9DA 7I1BA 2D44A 5FZZA 2L5XA 3AZWA 1V6WA 3Q7XA 4HA2A 4ISRA 3VT1A 4QKSA 3A23A 3VSZA 2D22A 2Y9GA 4X3AA 1T9FA 1HWMB 3NJ5A 3OGGA 3V0BA 3OJVA 3EF2A 5FZUA 4G9NA 1FQ9A 4ZFWB 3AKGA 3VSFA 1V6UA 4ZBVB 1FGAA 5JLVA 2MIBA 3FJEA 2X2TA 4OEFA 5D62A 5EG6C 4X38A 4D0ZA 3IIRA 3JRRA 4ZLBB 3FJ8A 4ZFYB 1JY0A 5BQUA 4IYBA 5BXTA 1ISVA 1JT5A 3WA1A 3HSMA 1YF8B 2F2FC 3HALA 4IZXA 1IOBA 2FFVA 3FGMA 2Y9FA 31BIA 4QKRA 3O4OA 3WO3A 1JLYA 2RQ9A 4IONA 4I4SA 3BRDA 1WBAA 2FFUA 3OBTA 4EFPA 3IM5A 1EV2A 2HZ9A 3POKA 1S0CA 4GOVA 3IAGC 2GO2A 2ESUA 3WINA 4IHZA 1HWPB 1IRAX 2XOAA 4XFTA 3F1RA 1BFCA 1AVUA 4LO7C 3BAQA 1OQLB 1G9BA 1II4A 1NUNA 4I4YA 1J0SA 1R8NA 4LO1A 3AJ5A 2WBCA 5D63A 1PC8B 4JP0A 4I8MA 1AVAC 1MD6A 2FDBM 1WBCA 1EPWA 3BRFA 2NP0A 2J3PA 5B2HA 4L4HA 1BLDA 2X2SA 4WBCA 3ILAA 3P6IA 3I2AA 3WMUA 1A8DA 4F34A 3I2XA 4ISQA 4H75A 1AF9A 2NTDA 4IY9A 3MPPG 2D20A 4I2SA 2I1BA 2DREA 4YOLA 4IZEA 1M16A 3CRGA 3ZXGA 4I4RA 4KBBA 4A7KA 4II0A 3CRHA 4LO2C 1AVWB 2E4MC 1S0EA 4GOYA 1TFMB 2MLLB 4X37A 1PUUB 1DJSB 3AJ6A 4X39A 3RMXA 2FGFA 2NM1A 4JQ0A 1S0DA 5FNXA 4DENA 1CE7B 1S0BA 4I1EA 3CA5A 1JT3A 4EFRA 5GAQA 4OEGA 2UUSA 3BX1C 1JTCA 3AH4A 1ONKB 2VLCA 3WO4A 3FFZA 1PZZA 1XZZA 3BAOA 3HMYA 4CJMA 1YYNA 5EC5A 3E8LC 4QD2B 1IILA 3ZX7A 4FVVA 1AVXB 3I29B 1Q03A 1AFCA 1HCDA 5DVHA 3O49A 2AXMA 2Q3NB 1Z4SA 3S8KA 2D24A 3QR5A 2NVHA 4LO8B 1DZCA 1BARA 3BA4A 3FJHA 4A7ZA 2Q9XA 4J2YA 1PWAA 4I37A 3H6QA 3NBNA 1M2TB 3PHZA 2Z48A 1IHKA 5BXPA 3CA0A 1AXMA 1XHBA 3WO2A 1F31A 1E0OA 3OGFA 1ISWA 3IM6A 1DFCA 2MC2A 1FWUA 4MZFB 4P0JA 3WMVA 3HOMA 1YBIA 3FJCA 2K4AB 2BEAA 3PMEA 5EHAA 3O3QA 4KEJA 5D61A 1DLLA 1T4QA 4ZGRB 2D1ZA 2D43A 2IWTB 4ZOTA 2KKIA 5F8WA 2D7IA 3ZC9A 1SR4A 4I7IA 3B9UA 3CAHA 4DEPA 1G82A 1K5UA 1TWEA 3OJMA 1TP0A 3FJFA 5F8YA 2FO1A 3V0BB 4OW4A 4Q9GA 1ISXA 1PUMB 4QO3A 1FN0A 2AQZA 1QQKA 3O4DA 3PG0A 3T8SA 4MZHA 3NBCA 3IM7A 3UD7A 3BA5A 1BFGA 4H04A 1TOOA 1BFBA 4XFUA 3KMVA 1TWMA 3O4CA 1BASA 8I1BA 2D7RA 1V6XA 1W3AA 4G6JA 4USPA 1XG6A 3BRGC 3A21A 3P53A 2RG9B 1JT7A 4Q9PA 5DUYA 2VXRA 1G9CA 3FJKA 3AZVA 5BP5A 3UD8A 3ZC8A 4LO0C 2Y9XE 2KH2A 1NZKA 2IHOA 4XKIA 1RMLA 3K1XA 3N7JA 4Z9WB 4EFQA 5BQUC 2VSEA 3BAVA 3C9ZA 3VT0A 3OBRA 2WRYA 3FJAA 1ABRB 1WD4A 5FZYA 2ZQOA 3QYDA 4QBVA 3HN1A 5DZUA 5BOWA 2HWMA 2F8XC 4OWJA 41BIA 3HBWA 4AN7B 1IJTA 3VUOA 2K8RA 2GZBA 2BEBA 4GP0A 4JKXB 3WINC 1QXMA 3BAUA 2VXTI 4D8HA 2NS2A 3FUOA
chains in the Genus database with same CATH topology
3A22A 3FUQA 2NZ9A 1P63A 3CA1A 2VU9A 4HJJA 4QBCA 2DRYA 1DZDA 1KNMA 5BXSA 3OJ2A 1N4KA 3FJIA 4I4OA 3S8JA 2QYIB 1Z2VA 1RY7A 3N7KA 4AN6A 3V0AA 4IQPA 3BA7A 3Q7YA 1MC9A 2F2FA 1ISZA 1ITBA 3BTAA 2P23A 1W3GA 2AFGA 4IY8A 1GGPB 4Q91A 4QD2C 1I1EA 3O4AA 3CA4A 3CRIA 4GAIA 2HW9A 4I3NA 1HWNB 4LO3C 1I1BA 1BA7A 5HPZA 3RTIB 1QQLA 4UY4A 3O4BA 3H6SE 5FNWA 1FMZA 1HKNA 4KC3A 2KI6B 3RMYA 1SZ6B 1FWVA 2KLLA 4JRAA 3UJ4A 3FJDA 4G6MA 5DSSB 4I4VA 4I96A 4ZKTB 1WD3A 3TC2A 2ERMA 4J2SA 4LO0A 1BLAA 5G00A 3VT2A 4I4QA 4J23B 4LO7B 5BVPI 1K5VA 3O44A 3FJ9A 3RSJA 2LIEA 3AKHA 1EVTA 2DRZA 3BAGA 2Z49A 4QC4A 3RTJB 1DFQA 1IRPA 4A7YA 5F8SA 4J2KA 1YXWA 4JPZA 3NBEA 4I1BA 4LO2A 2E4MA 3FJBA 1TIEA 3CA6A 4GP3A 1UPSA 1G9AA 4EEEB 3CQAA 3UDAA 3P6JA 4MZGB 1XYFA 1DQOA 1D0HA 3CU1B 4OWKA 3PUBA 1IT0A 4D0TA 2BFHA 3W9TA 3BADA 1S0GA 3LTQA 1HIBA 5E24E 4H9WA 3V79C 1HCEA 2VSAA 4OEEA 4G1RA 4P6AA 4I4XA 4I4UA 3O5WB 4XFSA 1SR4C 1EYLA 3AH1A 1VCLA 3A07A 4OWLA 1FMMS 4USOA 5BXRA 1JQZA 3R4SA 2R9KB 1BFFA 3BB2A 2P39A 4R6UB 2D23A 4ENDA 1V6VA 1ISYA 2YUGA 3F62B 1JT4A 4P0LA 2AAIB 4FGFA 4DCKC 4OUJA 4HR6C 3N0KA 4GAFA 1TTUA 2ZQNA 6I1BA 4ZA3B 3MALA 3VEQA 2ET2A 4ZFUB 5F90A 3H6RA 4LO1C 3D7WB 4J2XA 1FV2A 1Q04A 1Z0HA 1YTOA 1DQGA 2Y9WC 1Q1UA 4F83A 4JAWA 3N7LA 1DIWA 1FV3A 5BP5C 4LO3A 4I0YA 1ILR1 2M49A 3BAHA 3R4UA 4G9MA 3N7MA 3CA3A 4PC4A 1RZOB 4EB2B 3UD9A 3AKFA 3VWCA 2NYYA 3Q7WA 4Z8SB 4I4PA 3H6RB 5JMCA 1W3FA 2HWAA 4L4IA 9ILBA 1S0FA 4KEKA 1RG8A 1R8OA 2RSTA 3FJJA 2ZR1B 4I6IA 4EKXB 1CVSA 3LLPA 4JKQA 4QALA 3SNVA 2K43A 21BIA 2QN4A 4TLPA 4P0KA 3NBDA 1HWOB 4KEIA 1L2HA 1JLXA 3ZXDA 2LIQA 3JUTA 3V0AB 2KI4A 5I1BA 2VUAA 3AH2A 3AKIA 1S0LA 3UJ0A 2DS0A 1G9DA 7I1BA 2D44A 5FZZA 2L5XA 3AZWA 1V6WA 3Q7XA 4HA2A 4ISRA 3VT1A 4QKSA 3A23A 3VSZA 2D22A 2Y9GA 4X3AA 1T9FA 1HWMB 3NJ5A 3OGGA 3V0BA 3OJVA 3EF2A 5FZUA 4G9NA 1FQ9A 4ZFWB 3AKGA 3VSFA 1V6UA 4ZBVB 1FGAA 5JLVA 2MIBA 3FJEA 2X2TA 4OEFA 5D62A 5EG6C 4X38A 4D0ZA 3IIRA 3JRRA 4ZLBB 3FJ8A 4ZFYB 1JY0A 5BQUA 4IYBA 5BXTA 1ISVA 1JT5A 3WA1A 3HSMA 1YF8B 2F2FC 3HALA 4IZXA 1IOBA 2FFVA 3FGMA 2Y9FA 31BIA 4QKRA 3O4OA 3WO3A 1JLYA 2RQ9A 4IONA 4I4SA 3BRDA 1WBAA 2FFUA 3OBTA 4EFPA 3IM5A 1EV2A 2HZ9A 3POKA 1S0CA 4GOVA 3IAGC 2GO2A 2ESUA 3WINA 4IHZA 1HWPB 1IRAX 2XOAA 4XFTA 3F1RA 1BFCA 1AVUA 4LO7C 3BAQA 1OQLB 1G9BA 1II4A 1NUNA 4I4YA 1J0SA 1R8NA 4LO1A 3AJ5A 2WBCA 5D63A 1PC8B 4JP0A 4I8MA 1AVAC 1MD6A 2FDBM 1WBCA 1EPWA 3BRFA 2NP0A 2J3PA 5B2HA 4L4HA 1BLDA 2X2SA 4WBCA 3ILAA 3P6IA 3I2AA 3WMUA 1A8DA 4F34A 3I2XA 4ISQA 4H75A 1AF9A 2NTDA 4IY9A 3MPPG 2D20A 4I2SA 2I1BA 2DREA 4YOLA 4IZEA 1M16A 3CRGA 3ZXGA 4I4RA 4KBBA 4A7KA 4II0A 3CRHA 4LO2C 1AVWB 2E4MC 1S0EA 4GOYA 1TFMB 2MLLB 4X37A 1PUUB 1DJSB 3AJ6A 4X39A 3RMXA 2FGFA 2NM1A 4JQ0A 1S0DA 5FNXA 4DENA 1CE7B 1S0BA 4I1EA 3CA5A 1JT3A 4EFRA 5GAQA 4OEGA 2UUSA 3BX1C 1JTCA 3AH4A 1ONKB 2VLCA 3WO4A 3FFZA 1PZZA 1XZZA 3BAOA 3HMYA 4CJMA 1YYNA 5EC5A 3E8LC 4QD2B 1IILA 3ZX7A 4FVVA 1AVXB 3I29B 1Q03A 1AFCA 1HCDA 5DVHA 3O49A 2AXMA 2Q3NB 1Z4SA 3S8KA 2D24A 3QR5A 2NVHA 4LO8B 1DZCA 1BARA 3BA4A 3FJHA 4A7ZA 2Q9XA 4J2YA 1PWAA 4I37A 3H6QA 3NBNA 1M2TB 3PHZA 2Z48A 1IHKA 5BXPA 3CA0A 1AXMA 1XHBA 3WO2A 1F31A 1E0OA 3OGFA 1ISWA 3IM6A 1DFCA 2MC2A 1FWUA 4MZFB 4P0JA 3WMVA 3HOMA 1YBIA 3FJCA 2K4AB 2BEAA 3PMEA 5EHAA 3O3QA 4KEJA 5D61A 1DLLA 1T4QA 4ZGRB 2D1ZA 2D43A 2IWTB 4ZOTA 2KKIA 5F8WA 2D7IA 3ZC9A 1SR4A 4I7IA 3B9UA 3CAHA 4DEPA 1G82A 1K5UA 1TWEA 3OJMA 1TP0A 3FJFA 5F8YA 2FO1A 3V0BB 4OW4A 4Q9GA 1ISXA 1PUMB 4QO3A 1FN0A 2AQZA 1QQKA 3O4DA 3PG0A 3T8SA 4MZHA 3NBCA 3IM7A 3UD7A 3BA5A 1BFGA 4H04A 1TOOA 1BFBA 4XFUA 3KMVA 1TWMA 3O4CA 1BASA 8I1BA 2D7RA 1V6XA 1W3AA 4G6JA 4USPA 1XG6A 3BRGC 3A21A 3P53A 2RG9B 1JT7A 4Q9PA 5DUYA 2VXRA 1G9CA 3FJKA 3AZVA 5BP5A 3UD8A 3ZC8A 4LO0C 2Y9XE 2KH2A 1NZKA 2IHOA 4XKIA 1RMLA 3K1XA 3N7JA 4Z9WB 4EFQA 5BQUC 2VSEA 3BAVA 3C9ZA 3VT0A 3OBRA 2WRYA 3FJAA 1ABRB 1WD4A 5FZYA 2ZQOA 3QYDA 4QBVA 3HN1A 5DZUA 5BOWA 2HWMA 2F8XC 4OWJA 41BIA 3HBWA 4AN7B 1IJTA 3VUOA 2K8RA 2GZBA 2BEBA 4GP0A 4JKXB 3WINC 1QXMA 3BAUA 2VXTI 4D8HA 2NS2A 3FUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A22 A;  3FUQ A;  2NZ9 A;  1P63 A;  3CA1 A;  2VU9 A;  4HJJ A;  4QBC A;  2DRY A;  1DZD A;  1KNM A;  5BXS A;  3OJ2 A;  1N4K A;  3FJI A;  4I4O A;  3S8J A;  2QYI B;  1Z2V A;  1RY7 A;  3N7K A;  4AN6 A;  3V0A A;  4IQP A;  3BA7 A;  3Q7Y A;  1MC9 A;  2F2F A;  1ISZ A;  1ITB A;  3BTA A;  2P23 A;  1W3G A;  2AFG A;  4IY8 A;  1GGP B;  4Q91 A;  4QD2 C;  1I1E A;  3O4A A;  3CA4 A;  3CRI A;  4GAI A;  2HW9 A;  4I3N A;  1HWN B;  4LO3 C;  1I1B A;  1BA7 A;  5HPZ A;  3RTI B;  1QQL A;  3O4B A;  3H6S E;  5FNW A;  1FMZ A;  1HKN A;  4KC3 A;  2KI6 B;  3RMY A;  1SZ6 B;  1FWV A;  2KLL A;  4JRA A;  3UJ4 A;  3FJD A;  4G6M A;  5DSS B;  4I4V A;  4I96 A;  4ZKT B;  1WD3 A;  3TC2 A;  2ERM A;  4J2S A;  4LO0 A;  1BLA A;  5G00 A;  3VT2 A;  4I4Q A;  4J23 B;  4LO7 B;  5BVP I;  1K5V A;  3O44 A;  3FJ9 A;  3RSJ A;  2LIE A;  3AKH A;  1EVT A;  2DRZ A;  3BAG A;  2Z49 A;  4QC4 A;  3RTJ B;  1DFQ A;  1IRP A;  4A7Y A;  5F8S A;  4J2K A;  1YXW A;  4JPZ A;  3NBE A;  4I1B A;  4LO2 A;  2E4M A;  3FJB A;  1TIE A;  3CA6 A;  4GP3 A;  1UPS A;  1G9A A;  4EEE B;  3CQA A;  3UDA A;  3P6J A;  1XYF A;  1DQO A;  1D0H A;  3CU1 B;  4OWK A;  3PUB A;  1IT0 A;  4D0T A;  2BFH A;  3W9T A;  3BAD A;  1S0G A;  3LTQ A;  1HIB A;  5E24 E;  4H9W A;  3V79 C;  1HCE A;  2VSA A;  4OEE A;  4G1R A;  4P6A A;  4I4X A;  4I4U A;  3O5W B;  4XFS A;  1SR4 C;  1EYL A;  3AH1 A;  1VCL A;  3A07 A;  4OWL A;  1FMM S;  4USO A;  5BXR A;  1JQZ A;  3R4S A;  2R9K B;  1BFF A;  3BB2 A;  2P39 A;  4R6U B;  2D23 A;  4END A;  1V6V A;  1ISY A;  2YUG A;  3F62 B;  1JT4 A;  4P0L A;  2AAI B;  4FGF A;  4DCK C;  4OUJ A;  4HR6 C;  3N0K A;  4GAF A;  1TTU A;  2ZQN A;  6I1B A;  4ZA3 B;  3MAL A;  3VEQ A;  2ET2 A;  4ZFU B;  5F90 A;  3H6R A;  4LO1 C;  3D7W B;  4J2X A;  1FV2 A;  1Q04 A;  1Z0H A;  1YTO A;  1DQG A;  2Y9W C;  1Q1U A;  4F83 A;  4JAW A;  3N7L A;  1DIW A;  1FV3 A;  5BP5 C;  4LO3 A;  4I0Y A;  1ILR 1;  2M49 A;  3BAH A;  3R4U A;  4G9M A;  3N7M A;  3CA3 A;  4PC4 A;  1RZO B;  4EB2 B;  3UD9 A;  3AKF A;  3VWC A;  2NYY A;  3Q7W A;  4Z8S B;  4I4P A;  3H6R B;  5JMC A;  1W3F A;  2HWA A;  4L4I A;  9ILB A;  1S0F A;  4KEK A;  1RG8 A;  1R8O A;  2RST A;  3FJJ A;  2ZR1 B;  4I6I A;  4EKX B;  1CVS A;  3LLP A;  4JKQ A;  4QAL A;  3SNV A;  2K43 A;  21BI A;  2QN4 A;  4TLP A;  4P0K A;  3NBD A;  1HWO B;  4KEI A;  1L2H A;  1JLX A;  3ZXD A;  2LIQ A;  3JUT A;  3V0A B;  2KI4 A;  5I1B A;  2VUA A;  3AH2 A;  3AKI A;  1S0L A;  3UJ0 A;  2DS0 A;  1G9D A;  7I1B A;  2D44 A;  5FZZ A;  2L5X A;  3AZW A;  1V6W A;  3Q7X A;  4HA2 A;  4ISR A;  3VT1 A;  4QKS A;  3A23 A;  3VSZ A;  2D22 A;  2Y9G A;  4X3A A;  1T9F A;  1HWM B;  3NJ5 A;  3OGG A;  3V0B A;  3OJV A;  3EF2 A;  5FZU A;  4G9N A;  1FQ9 A;  4ZFW B;  3AKG A;  3VSF A;  1V6U A;  4ZBV B;  1FGA A;  5JLV A;  2MIB A;  3FJE A;  2X2T A;  4OEF A;  5D62 A;  5EG6 C;  4X38 A;  4D0Z A;  3IIR A;  3JRR A;  4ZLB B;  3FJ8 A;  4ZFY B;  1JY0 A;  5BQU A;  4IYB A;  5BXT A;  1ISV A;  1JT5 A;  3WA1 A;  3HSM A;  1YF8 B;  2F2F C;  3HAL A;  4IZX A;  1IOB A;  2FFV A;  3FGM A;  2Y9F A;  31BI A;  4QKR A;  3O4O A;  3WO3 A;  1JLY A;  2RQ9 A;  4ION A;  4I4S A;  3BRD A;  1WBA A;  2FFU A;  3OBT A;  4EFP A;  3IM5 A;  1EV2 A;  2HZ9 A;  3POK A;  1S0C A;  4GOV A;  3IAG C;  2GO2 A;  2ESU A;  3WIN A;  4IHZ A;  1HWP B;  1IRA X;  2XOA A;  4XFT A;  3F1R A;  1BFC A;  1AVU A;  4LO7 C;  3BAQ A;  1OQL B;  1G9B A;  1II4 A;  1NUN A;  4I4Y A;  1J0S A;  1R8N A;  4LO1 A;  3AJ5 A;  2WBC A;  5D63 A;  1PC8 B;  4JP0 A;  4I8M A;  1AVA C;  1MD6 A;  2FDB M;  1WBC A;  1EPW A;  3BRF A;  2NP0 A;  2J3P A;  5B2H A;  4L4H A;  1BLD A;  2X2S A;  4WBC A;  3ILA A;  3P6I A;  3I2A A;  3WMU A;  1A8D A;  4F34 A;  3I2X A;  4ISQ A;  1AF9 A;  2NTD A;  4IY9 A;  3MPP G;  2D20 A;  4I2S A;  2I1B A;  2DRE A;  4YOL A;  4IZE A;  1M16 A;  3CRG A;  3ZXG A;  4I4R A;  4KBB A;  4A7K A;  4II0 A;  3CRH A;  4LO2 C;  1AVW B;  2E4M C;  1S0E A;  4GOY A;  1TFM B;  2MLL B;  4X37 A;  1PUU B;  1DJS B;  3AJ6 A;  4X39 A;  3RMX A;  2FGF A;  2NM1 A;  4JQ0 A;  1S0D A;  5FNX A;  4DEN A;  1CE7 B;  1S0B A;  4I1E A;  3CA5 A;  1JT3 A;  4EFR A;  5GAQ A;  4OEG A;  2UUS A;  3BX1 C;  1JTC A;  3AH4 A;  1ONK B;  2VLC A;  3WO4 A;  3FFZ A;  1PZZ A;  1XZZ A;  3BAO A;  3HMY A;  4CJM A;  1YYN A;  5EC5 A;  3E8L C;  4QD2 B;  1IIL A;  3ZX7 A;  4FVV A;  1AVX B;  3I29 B;  1Q03 A;  1AFC A;  1HCD A;  5DVH A;  3O49 A;  2AXM A;  2Q3N B;  1Z4S A;  3S8K A;  2D24 A;  3QR5 A;  2NVH A;  4LO8 B;  1DZC A;  1BAR A;  3BA4 A;  3FJH A;  4A7Z A;  2Q9X A;  4J2Y A;  1PWA A;  4I37 A;  3H6Q A;  3NBN A;  1M2T B;  3PHZ A;  2Z48 A;  1IHK A;  5BXP A;  3CA0 A;  1AXM A;  1XHB A;  3WO2 A;  1F31 A;  1E0O A;  3OGF A;  1ISW A;  3IM6 A;  1DFC A;  2MC2 A;  1FWU A;  4P0J A;  3WMV A;  3HOM A;  1YBI A;  3FJC A;  2K4A B;  2BEA A;  3PME A;  5EHA A;  3O3Q A;  4KEJ A;  5D61 A;  1DLL A;  1T4Q A;  4ZGR B;  2D1Z A;  2D43 A;  2IWT B;  4ZOT A;  2KKI A;  5F8W A;  2D7I A;  3ZC9 A;  1SR4 A;  4I7I A;  3B9U A;  3CAH A;  4DEP A;  1G82 A;  1K5U A;  1TWE A;  3OJM A;  1TP0 A;  3FJF A;  5F8Y A;  2FO1 A;  3V0B B;  4OW4 A;  4Q9G A;  1ISX A;  1PUM B;  4QO3 A;  1FN0 A;  2AQZ A;  1QQK A;  3O4D A;  3PG0 A;  3T8S A;  3NBC A;  3IM7 A;  3UD7 A;  3BA5 A;  1BFG A;  4H04 A;  1TOO A;  1BFB A;  4XFU A;  3KMV A;  1TWM A;  3O4C A;  1BAS A;  8I1B A;  2D7R A;  1V6X A;  1W3A A;  4G6J A;  4USP A;  1XG6 A;  3BRG C;  3A21 A;  3P53 A;  2RG9 B;  1JT7 A;  4Q9P A;  5DUY A;  2VXR A;  1G9C A;  3FJK A;  3AZV A;  5BP5 A;  3UD8 A;  3ZC8 A;  4LO0 C;  2Y9X E;  2KH2 A;  1NZK A;  2IHO A;  4XKI A;  1RML A;  3K1X A;  3N7J A;  4Z9W B;  4EFQ A;  5BQU C;  2VSE A;  3BAV A;  3C9Z A;  3VT0 A;  3OBR A;  2WRY A;  3FJA A;  1ABR B;  1WD4 A;  5FZY A;  2ZQO A;  3QYD A;  4QBV A;  3HN1 A;  5DZU A;  5BOW A;  2HWM A;  2F8X C;  4OWJ A;  41BI A;  3HBW A;  4AN7 B;  1IJT A;  3VUO A;  2K8R A;  2GZB A;  2BEB A;  4GP0 A;  4JKX B;  3WIN C;  1QXM A;  3BAU A;  2VXT I;  4D8H A;  3FUO A; 
#chains in the Genus database with same CATH topology
 3A22 A;  3FUQ A;  2NZ9 A;  1P63 A;  3CA1 A;  2VU9 A;  4HJJ A;  4QBC A;  2DRY A;  1DZD A;  1KNM A;  5BXS A;  3OJ2 A;  1N4K A;  3FJI A;  4I4O A;  3S8J A;  2QYI B;  1Z2V A;  1RY7 A;  3N7K A;  4AN6 A;  3V0A A;  4IQP A;  3BA7 A;  3Q7Y A;  1MC9 A;  2F2F A;  1ISZ A;  1ITB A;  3BTA A;  2P23 A;  1W3G A;  2AFG A;  4IY8 A;  1GGP B;  4Q91 A;  4QD2 C;  1I1E A;  3O4A A;  3CA4 A;  3CRI A;  4GAI A;  2HW9 A;  4I3N A;  1HWN B;  4LO3 C;  1I1B A;  1BA7 A;  5HPZ A;  3RTI B;  1QQL A;  4UY4 A;  3O4B A;  3H6S E;  5FNW A;  1FMZ A;  1HKN A;  4KC3 A;  2KI6 B;  3RMY A;  1SZ6 B;  1FWV A;  2KLL A;  4JRA A;  3UJ4 A;  3FJD A;  4G6M A;  5DSS B;  4I4V A;  4I96 A;  4ZKT B;  1WD3 A;  3TC2 A;  2ERM A;  4J2S A;  4LO0 A;  1BLA A;  5G00 A;  3VT2 A;  4I4Q A;  4J23 B;  4LO7 B;  5BVP I;  1K5V A;  3O44 A;  3FJ9 A;  3RSJ A;  2LIE A;  3AKH A;  1EVT A;  2DRZ A;  3BAG A;  2Z49 A;  4QC4 A;  3RTJ B;  1DFQ A;  1IRP A;  4A7Y A;  5F8S A;  4J2K A;  1YXW A;  4JPZ A;  3NBE A;  4I1B A;  4LO2 A;  2E4M A;  3FJB A;  1TIE A;  3CA6 A;  4GP3 A;  1UPS A;  1G9A A;  4EEE B;  3CQA A;  3UDA A;  3P6J A;  4MZG B;  1XYF A;  1DQO A;  1D0H A;  3CU1 B;  4OWK A;  3PUB A;  1IT0 A;  4D0T A;  2BFH A;  3W9T A;  3BAD A;  1S0G A;  3LTQ A;  1HIB A;  5E24 E;  4H9W A;  3V79 C;  1HCE A;  2VSA A;  4OEE A;  4G1R A;  4P6A A;  4I4X A;  4I4U A;  3O5W B;  4XFS A;  1SR4 C;  1EYL A;  3AH1 A;  1VCL A;  3A07 A;  4OWL A;  1FMM S;  4USO A;  5BXR A;  1JQZ A;  3R4S A;  2R9K B;  1BFF A;  3BB2 A;  2P39 A;  4R6U B;  2D23 A;  4END A;  1V6V A;  1ISY A;  2YUG A;  3F62 B;  1JT4 A;  4P0L A;  2AAI B;  4FGF A;  4DCK C;  4OUJ A;  4HR6 C;  3N0K A;  4GAF A;  1TTU A;  2ZQN A;  6I1B A;  4ZA3 B;  3MAL A;  3VEQ A;  2ET2 A;  4ZFU B;  5F90 A;  3H6R A;  4LO1 C;  3D7W B;  4J2X A;  1FV2 A;  1Q04 A;  1Z0H A;  1YTO A;  1DQG A;  2Y9W C;  1Q1U A;  4F83 A;  4JAW A;  3N7L A;  1DIW A;  1FV3 A;  5BP5 C;  4LO3 A;  4I0Y A;  1ILR 1;  2M49 A;  3BAH A;  3R4U A;  4G9M A;  3N7M A;  3CA3 A;  4PC4 A;  1RZO B;  4EB2 B;  3UD9 A;  3AKF A;  3VWC A;  2NYY A;  3Q7W A;  4Z8S B;  4I4P A;  3H6R B;  5JMC A;  1W3F A;  2HWA A;  4L4I A;  9ILB A;  1S0F A;  4KEK A;  1RG8 A;  1R8O A;  2RST A;  3FJJ A;  2ZR1 B;  4I6I A;  4EKX B;  1CVS A;  3LLP A;  4JKQ A;  4QAL A;  3SNV A;  2K43 A;  21BI A;  2QN4 A;  4TLP A;  4P0K A;  3NBD A;  1HWO B;  4KEI A;  1L2H A;  1JLX A;  3ZXD A;  2LIQ A;  3JUT A;  3V0A B;  2KI4 A;  5I1B A;  2VUA A;  3AH2 A;  3AKI A;  1S0L A;  3UJ0 A;  2DS0 A;  1G9D A;  7I1B A;  2D44 A;  5FZZ A;  2L5X A;  3AZW A;  1V6W A;  3Q7X A;  4HA2 A;  4ISR A;  3VT1 A;  4QKS A;  3A23 A;  3VSZ A;  2D22 A;  2Y9G A;  4X3A A;  1T9F A;  1HWM B;  3NJ5 A;  3OGG A;  3V0B A;  3OJV A;  3EF2 A;  5FZU A;  4G9N A;  1FQ9 A;  4ZFW B;  3AKG A;  3VSF A;  1V6U A;  4ZBV B;  1FGA A;  5JLV A;  2MIB A;  3FJE A;  2X2T A;  4OEF A;  5D62 A;  5EG6 C;  4X38 A;  4D0Z A;  3IIR A;  3JRR A;  4ZLB B;  3FJ8 A;  4ZFY B;  1JY0 A;  5BQU A;  4IYB A;  5BXT A;  1ISV A;  1JT5 A;  3WA1 A;  3HSM A;  1YF8 B;  2F2F C;  3HAL A;  4IZX A;  1IOB A;  2FFV A;  3FGM A;  2Y9F A;  31BI A;  4QKR A;  3O4O A;  3WO3 A;  1JLY A;  2RQ9 A;  4ION A;  4I4S A;  3BRD A;  1WBA A;  2FFU A;  3OBT A;  4EFP A;  3IM5 A;  1EV2 A;  2HZ9 A;  3POK A;  1S0C A;  4GOV A;  3IAG C;  2GO2 A;  2ESU A;  3WIN A;  4IHZ A;  1HWP B;  1IRA X;  2XOA A;  4XFT A;  3F1R A;  1BFC A;  1AVU A;  4LO7 C;  3BAQ A;  1OQL B;  1G9B A;  1II4 A;  1NUN A;  4I4Y A;  1J0S A;  1R8N A;  4LO1 A;  3AJ5 A;  2WBC A;  5D63 A;  1PC8 B;  4JP0 A;  4I8M A;  1AVA C;  1MD6 A;  2FDB M;  1WBC A;  1EPW A;  3BRF A;  2NP0 A;  2J3P A;  5B2H A;  4L4H A;  1BLD A;  2X2S A;  4WBC A;  3ILA A;  3P6I A;  3I2A A;  3WMU A;  1A8D A;  4F34 A;  3I2X A;  4ISQ A;  4H75 A;  1AF9 A;  2NTD A;  4IY9 A;  3MPP G;  2D20 A;  4I2S A;  2I1B A;  2DRE A;  4YOL A;  4IZE A;  1M16 A;  3CRG A;  3ZXG A;  4I4R A;  4KBB A;  4A7K A;  4II0 A;  3CRH A;  4LO2 C;  1AVW B;  2E4M C;  1S0E A;  4GOY A;  1TFM B;  2MLL B;  4X37 A;  1PUU B;  1DJS B;  3AJ6 A;  4X39 A;  3RMX A;  2FGF A;  2NM1 A;  4JQ0 A;  1S0D A;  5FNX A;  4DEN A;  1CE7 B;  1S0B A;  4I1E A;  3CA5 A;  1JT3 A;  4EFR A;  5GAQ A;  4OEG A;  2UUS A;  3BX1 C;  1JTC A;  3AH4 A;  1ONK B;  2VLC A;  3WO4 A;  3FFZ A;  1PZZ A;  1XZZ A;  3BAO A;  3HMY A;  4CJM A;  1YYN A;  5EC5 A;  3E8L C;  4QD2 B;  1IIL A;  3ZX7 A;  4FVV A;  1AVX B;  3I29 B;  1Q03 A;  1AFC A;  1HCD A;  5DVH A;  3O49 A;  2AXM A;  2Q3N B;  1Z4S A;  3S8K A;  2D24 A;  3QR5 A;  2NVH A;  4LO8 B;  1DZC A;  1BAR A;  3BA4 A;  3FJH A;  4A7Z A;  2Q9X A;  4J2Y A;  1PWA A;  4I37 A;  3H6Q A;  3NBN A;  1M2T B;  3PHZ A;  2Z48 A;  1IHK A;  5BXP A;  3CA0 A;  1AXM A;  1XHB A;  3WO2 A;  1F31 A;  1E0O A;  3OGF A;  1ISW A;  3IM6 A;  1DFC A;  2MC2 A;  1FWU A;  4MZF B;  4P0J A;  3WMV A;  3HOM A;  1YBI A;  3FJC A;  2K4A B;  2BEA A;  3PME A;  5EHA A;  3O3Q A;  4KEJ A;  5D61 A;  1DLL A;  1T4Q A;  4ZGR B;  2D1Z A;  2D43 A;  2IWT B;  4ZOT A;  2KKI A;  5F8W A;  2D7I A;  3ZC9 A;  1SR4 A;  4I7I A;  3B9U A;  3CAH A;  4DEP A;  1G82 A;  1K5U A;  1TWE A;  3OJM A;  1TP0 A;  3FJF A;  5F8Y A;  2FO1 A;  3V0B B;  4OW4 A;  4Q9G A;  1ISX A;  1PUM B;  4QO3 A;  1FN0 A;  2AQZ A;  1QQK A;  3O4D A;  3PG0 A;  3T8S A;  4MZH A;  3NBC A;  3IM7 A;  3UD7 A;  3BA5 A;  1BFG A;  4H04 A;  1TOO A;  1BFB A;  4XFU A;  3KMV A;  1TWM A;  3O4C A;  1BAS A;  8I1B A;  2D7R A;  1V6X A;  1W3A A;  4G6J A;  4USP A;  1XG6 A;  3BRG C;  3A21 A;  3P53 A;  2RG9 B;  1JT7 A;  4Q9P A;  5DUY A;  2VXR A;  1G9C A;  3FJK A;  3AZV A;  5BP5 A;  3UD8 A;  3ZC8 A;  4LO0 C;  2Y9X E;  2KH2 A;  1NZK A;  2IHO A;  4XKI A;  1RML A;  3K1X A;  3N7J A;  4Z9W B;  4EFQ A;  5BQU C;  2VSE A;  3BAV A;  3C9Z A;  3VT0 A;  3OBR A;  2WRY A;  3FJA A;  1ABR B;  1WD4 A;  5FZY A;  2ZQO A;  3QYD A;  4QBV A;  3HN1 A;  5DZU A;  5BOW A;  2HWM A;  2F8X C;  4OWJ A;  41BI A;  3HBW A;  4AN7 B;  1IJT A;  3VUO A;  2K8R A;  2GZB A;  2BEB A;  4GP0 A;  4JKX B;  3WIN C;  1QXM A;  3BAU A;  2VXT I;  4D8H A;  2NS2 A;  3FUO A; 
#chains in the Genus database with same CATH homology
 3A22 A;  3FUQ A;  2NZ9 A;  1P63 A;  3CA1 A;  2VU9 A;  4HJJ A;  4QBC A;  2DRY A;  1DZD A;  1KNM A;  5BXS A;  3OJ2 A;  1N4K A;  3FJI A;  4I4O A;  3S8J A;  2QYI B;  1Z2V A;  1RY7 A;  3N7K A;  4AN6 A;  3V0A A;  4IQP A;  3BA7 A;  3Q7Y A;  1MC9 A;  2F2F A;  1ISZ A;  1ITB A;  3BTA A;  2P23 A;  1W3G A;  2AFG A;  4IY8 A;  1GGP B;  4Q91 A;  4QD2 C;  1I1E A;  3O4A A;  3CA4 A;  3CRI A;  4GAI A;  2HW9 A;  4I3N A;  1HWN B;  4LO3 C;  1I1B A;  1BA7 A;  5HPZ A;  3RTI B;  1QQL A;  4UY4 A;  3O4B A;  3H6S E;  5FNW A;  1FMZ A;  1HKN A;  4KC3 A;  2KI6 B;  3RMY A;  1SZ6 B;  1FWV A;  2KLL A;  4JRA A;  3UJ4 A;  3FJD A;  4G6M A;  5DSS B;  4I4V A;  4I96 A;  4ZKT B;  1WD3 A;  3TC2 A;  2ERM A;  4J2S A;  4LO0 A;  1BLA A;  5G00 A;  3VT2 A;  4I4Q A;  4J23 B;  4LO7 B;  5BVP I;  1K5V A;  3O44 A;  3FJ9 A;  3RSJ A;  2LIE A;  3AKH A;  1EVT A;  2DRZ A;  3BAG A;  2Z49 A;  4QC4 A;  3RTJ B;  1DFQ A;  1IRP A;  4A7Y A;  5F8S A;  4J2K A;  1YXW A;  4JPZ A;  3NBE A;  4I1B A;  4LO2 A;  2E4M A;  3FJB A;  1TIE A;  3CA6 A;  4GP3 A;  1UPS A;  1G9A A;  4EEE B;  3CQA A;  3UDA A;  3P6J A;  4MZG B;  1XYF A;  1DQO A;  1D0H A;  3CU1 B;  4OWK A;  3PUB A;  1IT0 A;  4D0T A;  2BFH A;  3W9T A;  3BAD A;  1S0G A;  3LTQ A;  1HIB A;  5E24 E;  4H9W A;  3V79 C;  1HCE A;  2VSA A;  4OEE A;  4G1R A;  4P6A A;  4I4X A;  4I4U A;  3O5W B;  4XFS A;  1SR4 C;  1EYL A;  3AH1 A;  1VCL A;  3A07 A;  4OWL A;  1FMM S;  4USO A;  5BXR A;  1JQZ A;  3R4S A;  2R9K B;  1BFF A;  3BB2 A;  2P39 A;  4R6U B;  2D23 A;  4END A;  1V6V A;  1ISY A;  2YUG A;  3F62 B;  1JT4 A;  4P0L A;  2AAI B;  4FGF A;  4DCK C;  4OUJ A;  4HR6 C;  3N0K A;  4GAF A;  1TTU A;  2ZQN A;  6I1B A;  4ZA3 B;  3MAL A;  3VEQ A;  2ET2 A;  4ZFU B;  5F90 A;  3H6R A;  4LO1 C;  3D7W B;  4J2X A;  1FV2 A;  1Q04 A;  1Z0H A;  1YTO A;  1DQG A;  2Y9W C;  1Q1U A;  4F83 A;  4JAW A;  3N7L A;  1DIW A;  1FV3 A;  5BP5 C;  4LO3 A;  4I0Y A;  1ILR 1;  2M49 A;  3BAH A;  3R4U A;  4G9M A;  3N7M A;  3CA3 A;  4PC4 A;  1RZO B;  4EB2 B;  3UD9 A;  3AKF A;  3VWC A;  2NYY A;  3Q7W A;  4Z8S B;  4I4P A;  3H6R B;  5JMC A;  1W3F A;  2HWA A;  4L4I A;  9ILB A;  1S0F A;  4KEK A;  1RG8 A;  1R8O A;  2RST A;  3FJJ A;  2ZR1 B;  4I6I A;  4EKX B;  1CVS A;  3LLP A;  4JKQ A;  4QAL A;  3SNV A;  2K43 A;  21BI A;  2QN4 A;  4TLP A;  4P0K A;  3NBD A;  1HWO B;  4KEI A;  1L2H A;  1JLX A;  3ZXD A;  2LIQ A;  3JUT A;  3V0A B;  2KI4 A;  5I1B A;  2VUA A;  3AH2 A;  3AKI A;  1S0L A;  3UJ0 A;  2DS0 A;  1G9D A;  7I1B A;  2D44 A;  5FZZ A;  2L5X A;  3AZW A;  1V6W A;  3Q7X A;  4HA2 A;  4ISR A;  3VT1 A;  4QKS A;  3A23 A;  3VSZ A;  2D22 A;  2Y9G A;  4X3A A;  1T9F A;  1HWM B;  3NJ5 A;  3OGG A;  3V0B A;  3OJV A;  3EF2 A;  5FZU A;  4G9N A;  1FQ9 A;  4ZFW B;  3AKG A;  3VSF A;  1V6U A;  4ZBV B;  1FGA A;  5JLV A;  2MIB A;  3FJE A;  2X2T A;  4OEF A;  5D62 A;  5EG6 C;  4X38 A;  4D0Z A;  3IIR A;  3JRR A;  4ZLB B;  3FJ8 A;  4ZFY B;  1JY0 A;  5BQU A;  4IYB A;  5BXT A;  1ISV A;  1JT5 A;  3WA1 A;  3HSM A;  1YF8 B;  2F2F C;  3HAL A;  4IZX A;  1IOB A;  2FFV A;  3FGM A;  2Y9F A;  31BI A;  4QKR A;  3O4O A;  3WO3 A;  1JLY A;  2RQ9 A;  4ION A;  4I4S A;  3BRD A;  1WBA A;  2FFU A;  3OBT A;  4EFP A;  3IM5 A;  1EV2 A;  2HZ9 A;  3POK A;  1S0C A;  4GOV A;  3IAG C;  2GO2 A;  2ESU A;  3WIN A;  4IHZ A;  1HWP B;  1IRA X;  2XOA A;  4XFT A;  3F1R A;  1BFC A;  1AVU A;  4LO7 C;  3BAQ A;  1OQL B;  1G9B A;  1II4 A;  1NUN A;  4I4Y A;  1J0S A;  1R8N A;  4LO1 A;  3AJ5 A;  2WBC A;  5D63 A;  1PC8 B;  4JP0 A;  4I8M A;  1AVA C;  1MD6 A;  2FDB M;  1WBC A;  1EPW A;  3BRF A;  2NP0 A;  2J3P A;  5B2H A;  4L4H A;  1BLD A;  2X2S A;  4WBC A;  3ILA A;  3P6I A;  3I2A A;  3WMU A;  1A8D A;  4F34 A;  3I2X A;  4ISQ A;  4H75 A;  1AF9 A;  2NTD A;  4IY9 A;  3MPP G;  2D20 A;  4I2S A;  2I1B A;  2DRE A;  4YOL A;  4IZE A;  1M16 A;  3CRG A;  3ZXG A;  4I4R A;  4KBB A;  4A7K A;  4II0 A;  3CRH A;  4LO2 C;  1AVW B;  2E4M C;  1S0E A;  4GOY A;  1TFM B;  2MLL B;  4X37 A;  1PUU B;  1DJS B;  3AJ6 A;  4X39 A;  3RMX A;  2FGF A;  2NM1 A;  4JQ0 A;  1S0D A;  5FNX A;  4DEN A;  1CE7 B;  1S0B A;  4I1E A;  3CA5 A;  1JT3 A;  4EFR A;  5GAQ A;  4OEG A;  2UUS A;  3BX1 C;  1JTC A;  3AH4 A;  1ONK B;  2VLC A;  3WO4 A;  3FFZ A;  1PZZ A;  1XZZ A;  3BAO A;  3HMY A;  4CJM A;  1YYN A;  5EC5 A;  3E8L C;  4QD2 B;  1IIL A;  3ZX7 A;  4FVV A;  1AVX B;  3I29 B;  1Q03 A;  1AFC A;  1HCD A;  5DVH A;  3O49 A;  2AXM A;  2Q3N B;  1Z4S A;  3S8K A;  2D24 A;  3QR5 A;  2NVH A;  4LO8 B;  1DZC A;  1BAR A;  3BA4 A;  3FJH A;  4A7Z A;  2Q9X A;  4J2Y A;  1PWA A;  4I37 A;  3H6Q A;  3NBN A;  1M2T B;  3PHZ A;  2Z48 A;  1IHK A;  5BXP A;  3CA0 A;  1AXM A;  1XHB A;  3WO2 A;  1F31 A;  1E0O A;  3OGF A;  1ISW A;  3IM6 A;  1DFC A;  2MC2 A;  1FWU A;  4MZF B;  4P0J A;  3WMV A;  3HOM A;  1YBI A;  3FJC A;  2K4A B;  2BEA A;  3PME A;  5EHA A;  3O3Q A;  4KEJ A;  5D61 A;  1DLL A;  1T4Q A;  4ZGR B;  2D1Z A;  2D43 A;  2IWT B;  4ZOT A;  2KKI A;  5F8W A;  2D7I A;  3ZC9 A;  1SR4 A;  4I7I A;  3B9U A;  3CAH A;  4DEP A;  1G82 A;  1K5U A;  1TWE A;  3OJM A;  1TP0 A;  3FJF A;  5F8Y A;  2FO1 A;  3V0B B;  4OW4 A;  4Q9G A;  1ISX A;  1PUM B;  4QO3 A;  1FN0 A;  2AQZ A;  1QQK A;  3O4D A;  3PG0 A;  3T8S A;  4MZH A;  3NBC A;  3IM7 A;  3UD7 A;  3BA5 A;  1BFG A;  4H04 A;  1TOO A;  1BFB A;  4XFU A;  3KMV A;  1TWM A;  3O4C A;  1BAS A;  8I1B A;  2D7R A;  1V6X A;  1W3A A;  4G6J A;  4USP A;  1XG6 A;  3BRG C;  3A21 A;  3P53 A;  2RG9 B;  1JT7 A;  4Q9P A;  5DUY A;  2VXR A;  1G9C A;  3FJK A;  3AZV A;  5BP5 A;  3UD8 A;  3ZC8 A;  4LO0 C;  2Y9X E;  2KH2 A;  1NZK A;  2IHO A;  4XKI A;  1RML A;  3K1X A;  3N7J A;  4Z9W B;  4EFQ A;  5BQU C;  2VSE A;  3BAV A;  3C9Z A;  3VT0 A;  3OBR A;  2WRY A;  3FJA A;  1ABR B;  1WD4 A;  5FZY A;  2ZQO A;  3QYD A;  4QBV A;  3HN1 A;  5DZU A;  5BOW A;  2HWM A;  2F8X C;  4OWJ A;  41BI A;  3HBW A;  4AN7 B;  1IJT A;  3VUO A;  2K8R A;  2GZB A;  2BEB A;  4GP0 A;  4JKX B;  3WIN C;  1QXM A;  3BAU A;  2VXT I;  4D8H A;  2NS2 A;  3FUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...