3H6SE

Structure of clitocypin - cathepsin v complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
150
Chain Sequence
MASLEDGTYRLRAVTTSNPDPGVGGEYATVEGARQPVKAEPSTPPFFERQIWQVTRNSDGQSTIKYQGLNAPFEYGFSYDQEQNAPVAGDPKEYILQLVPSTTDVYIIRAPIQRVGVDVEVGVQGNNLVYKFFPVDGSGGDRPAWRFTRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
molecule keywords Cathepsin L2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 31
structure length 150
sequence length 152
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF10467 Inhibitor_I48 Peptidase inhibitor clitocypin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3h6sE00
3O3QA 3JRRA 1XG6A 3FJ8A 3OGGA 3NBNA 1IHKA 4I4OA 4I4VA 1HKNA 2IHOA 3HSMA 3RTIB 1ISWA 1M16A 2VUAA 3UJ0A 4G6MA 1R8NA 3PG0A 4KC3A 2P23A 31BIA 2D7IA 3D7WB 3PMEA 2QYIB 4LO3C 5DUYA 3C9ZA 3RTJB 4ZGRB 4FGFA 4OEFA 41BIA 5BP5A 3RSJA 1AVXB 4D0ZA 3HOMA 5E24E 4G9NA 2VXTI 3UD8A 4JRAA 4L4IA 1EYLA 2DRYA 4ISQA 1BLAA 3TC2A 5BXRA 4I37A 2HW9A 2ZQNA 1V6XA 4Z8SB 1FWVA 1AVAC 2GZBA 5FNWA 1FN0A 5EC5A 4AN7B 1JQZA 4ENDA 3CRIA 5I1BA 1DQOA 1WBAA 3O5WB 1EPWA 3RMYA 4ZLBB 1YF8B 1E0OA 2RQ9A 3K1XA 4HA2A 1ILR1 4P0JA 2AFGA 4G1RA 3WINA 1YXWA 1JY0A 1IOBA 3KMVA 4IY9A 2F2FC 5FZYA 4D0TA 3WO3A 3FJFA 2MLLB 4I0YA 2X2SA 3H6SE 1DFQA 3BAHA 2FFUA 1AXMA 1TFMB 3FJHA 3P53A 4LO8B 5BVPI 2K8RA 2D1ZA 3CA3A 4QALA 3ZC9A 1V6UA 4QC4A 2KI4A 2QN4A 3BB2A 2D22A 1IILA 4CJMA 3OJVA 3V0AB 3A23A 3NJ5A 1VCLA 2Q3NB 1QQLA 4I3NA 2AAIB 4USPA 3FUQA 4ISRA 1ITBA 1S0GA 4OW4A 4AN6A 4F83A 2Z49A 4IHZA 4LO2C 2P39A 4I4RA 5BOWA 2BEBA 1RZOB 1SR4C 3N7LA 1G9CA 2UUSA 4LO7C 1IT0A 2ET2A 2WRYA 4LO0A 4HJJA 3UJ4A 3N7JA 3NBDA 2HWAA 3W9TA 1Q1UA 1N4KA 1FV2A 4YOLA 3F1RA 3P6IA 4JP0A 1JLYA 1HIBA 1YYNA 4JPZA 1G9DA 2NM1A 4JAWA 1S0DA 1DJSB 1MC9A 3ZXDA 1AFCA 3MALA 1ISZA 1RMLA 1Z4SA 2Y9FA 4QD2C 2LIEA 4I4PA 1S0EA 1W3GA 3Q7WA 4ZBVB 1DZDA 7I1BA 3O4CA 4Q9GA 1DFCA 4GOVA 1JT3A 4I4QA 4JKXB 1P63A 4QKRA 5DVHA 1TWMA 4I7IA 1QQKA 2DREA 3AKFA 3IM5A 3WMVA 3UD9A 3CU1B 3VUOA 3B9UA 3QYDA 3OGFA 1ABRB 1HWOB 3RMXA 3BA7A 3O4AA 2K43A 2FFVA 1SZ6B 4ZA3B 3OBRA 3CA5A 2Z48A 4OWJA 4Q91A 1V6VA 1NUNA 3UD7A 1BASA 1DZCA 3BA5A 4X37A 5EHAA 2GO2A 1K5VA 3BAQA 1M2TB 4ZFYB 3FJEA 3BAOA 1J0SA 2R9KB 1BARA 3FJIA 3R4UA 2ZQOA 4I4YA 2Q9XA 1DIWA 4LO1A 1G9BA 5FZZA 1TIEA 2I1BA 3CAHA 5F8YA 2D44A 2AQZA 1A8DA 3BX1C 4LO7B 4ZFWB 4XFSA 5DZUA 1BFGA 2Y9WC 1K5UA 5G00A 4L4HA 5DSSB 1ISVA 5JLVA 4OEEA 3ILAA 1UPSA 1II4A 4KEKA 4I96A 2L5XA 2F8XC 2MIBA 4USOA 5D61A 3S8JA 1MD6A 2NTDA 1KNMA 3OBTA 1ISYA 2KI6B 3WO4A 1S0CA 3NBCA 2VU9A 3N0KA 1PUMB 2E4MA 2Y9XE 1EVTA 3H6QA 4JKQA 2Y9GA 1Z2VA 5BQUA 2VSAA 2YUGA 1PUUB 3SNVA 1TP0A 1PZZA 2FGFA 3VT0A 1BFBA 3ZX7A 1AF9A 1FMMS 3FJBA 3IM7A 4FVVA 1TOOA 5HPZA 5BP5C 3FJCA 4OEGA 5B2HA 3V0AA 2BFHA 9ILBA 2FDBM 4X3AA 2M49A 1RY7A 4QBCA 3FJ9A 2HWMA 4IZXA 4EEEB 3O4DA 4J2XA 1XZZA 1FMZA 4LO3A 1FQ9A 1T9FA 1CVSA 1GGPB 4HR6C 3JUTA 3HBWA 3BTAA 2NYYA 4KEJA 4GOYA 2D24A 4P0LA 1BLDA 1G82A 1PWAA 3BAUA 3AJ5A 4TLPA 2VLCA 3FGMA 3AZWA 3WINC 1HWNB 1HWMB 4I8MA 1JT7A 2VSEA 3O4OA 3OJ2A 3Q7YA 1JTCA 3BAVA 4DENA 3VSFA 2FO1A 3CA6A 4IONA 4Q9PA 5JMCA 5BXSA 3E8LC 1T4QA 1I1BA 3A22A 1FWUA 1BFCA 4A7ZA 4DEPA 1JLXA 4J2KA 3O44A 3O49A 1Z0HA 1JT4A 3VWCA 4XFTA 4P6AA 1NZKA 2F2FA 1CE7B 4R6UB 3A21A 1XHBA 3BA4A 3CQAA 5F8SA 5EG6C 2D7RA 4II0A 4EFPA 1WD4A 3WMUA 4I6IA 3AJ6A 5BXPA 1I1EA 1W3AA 4I2SA 3CA4A 1YBIA 1HCDA 4PC4A 4X39A 3PUBA 4I1BA 2LIQA 4QKSA 4LO0C 3ZC8A 4ZOTA 1RG8A 3AKHA 4EB2B 5BXTA 3CRGA 1AVUA 4F34A 3O4BA 2D20A 4P0KA 1QXMA 4JQ0A 2RSTA 2NVHA 1YTOA 4XFUA 3F62B 1ONKB 4LO2A 4J2SA 2ERMA 2DRZA 3H6RB 1SR4A 1HCEA 4H9WA 4GP0A 4IZEA 3BRDA 1D0HA 1W3FA 5FZUA 1V6WA 4I4XA 2D43A 3OJMA 3PHZA 3WO2A 3HN1A 3H6RA 3ZXGA 3CA0A 4G9MA 4WBCA 3AKGA 4ZKTB 1S0LA 4H04A 1PC8B 4IQPA 3FJKA 3IM6A 3VT1A 2KKIA 4QD2B 1IRAX 2D23A 3HMYA 1DLLA 2RG9B 5F90A 1F31A 3QR5A 3AZVA 4DCKC 3IAGC 1L2HA 2XOAA 3WA1A 3AH4A 3P6JA 1WBCA 2ZR1B 2K4AB 21BIA 1S0FA 3AH1A 3CRHA 4OUJA 3LLPA 4KBBA 2J3PA 3IIRA 2HZ9A 2NZ9A 3HALA 3VT2A 2NP0A 2VXRA 2ESUA 3FJAA 2AXMA 3FUOA 1TWEA 1XYFA 1WD3A 4A7KA 1JT5A 2X2TA 3UDAA 4EKXB 3V79C 1ISXA 5D62A 3R4SA 3VEQA 1TTUA 2DS0A 4X38A 1FV3A 3N7KA 3BRFA 4LO1C 6I1BA 5GAQA 1IJTA 1AVWB 4IY8A 4KEIA 3POKA 3NBEA 3A07A 4J2YA 4I1EA 2KLLA 4EFQA 1BA7A 1S0BA 3Q7XA 4EFRA 4A7YA 1EV2A 3EF2A 8I1BA 4OWLA 4GP3A 4J23B 1BFFA 3I2AA 4OWKA 3VSZA 4I4SA 2IWTB 1HWPB 3AKIA 3MPPG 4I4UA 3BADA 4GAIA 2WBCA 3I2XA 4QBVA 3FJDA 3LTQA 3CA1A 3FJJA 3T8SA 3N7MA 2KH2A 2MC2A 3I29B 3BAGA 3FFZA 3BRGC 3V0BB 1IRPA 4XKIA 1FGAA 1R8OA 3AH2A 2E4MC 4IYBA 1DQGA 3V0BA 4QO3A 5BQUC 1OQLB 4G6JA 5F8WA 5FNXA 1G9AA 3S8KA 4D8HA 1Q03A 4GAFA 2BEAA 5D63A 1Q04A 4ZFUB 4Z9WB
chains in the Genus database with same CATH superfamily
3O3QA 3JRRA 1XG6A 3FJ8A 3OGGA 3NBNA 1IHKA 4I4OA 4I4VA 1HKNA 2IHOA 3HSMA 3RTIB 1ISWA 1M16A 2VUAA 3UJ0A 4G6MA 1R8NA 3PG0A 4KC3A 2P23A 31BIA 2D7IA 3D7WB 3PMEA 2QYIB 4LO3C 5DUYA 3C9ZA 3RTJB 4ZGRB 4FGFA 4OEFA 41BIA 5BP5A 3RSJA 1AVXB 4D0ZA 3HOMA 5E24E 4G9NA 2VXTI 3UD8A 4JRAA 4L4IA 1EYLA 2DRYA 4ISQA 1BLAA 3TC2A 5BXRA 4I37A 2HW9A 2ZQNA 1V6XA 4Z8SB 1FWVA 4MZGB 1AVAC 2GZBA 5FNWA 1FN0A 5EC5A 4AN7B 1JQZA 4ENDA 3CRIA 5I1BA 1DQOA 1WBAA 3O5WB 1EPWA 3RMYA 4ZLBB 1YF8B 1E0OA 2RQ9A 3K1XA 4HA2A 1ILR1 4P0JA 2AFGA 4G1RA 3WINA 1YXWA 1JY0A 1IOBA 3KMVA 4IY9A 2F2FC 5FZYA 4D0TA 3WO3A 3FJFA 2MLLB 4I0YA 2X2SA 3H6SE 1DFQA 3BAHA 2FFUA 1AXMA 1TFMB 3FJHA 3P53A 4LO8B 5BVPI 2K8RA 2D1ZA 3CA3A 4QALA 3ZC9A 1V6UA 4QC4A 2KI4A 2QN4A 3BB2A 2D22A 1IILA 4CJMA 3OJVA 3V0AB 3A23A 3NJ5A 1VCLA 2Q3NB 1QQLA 4I3NA 2AAIB 4USPA 3FUQA 4ISRA 1ITBA 1S0GA 4OW4A 4AN6A 4F83A 2Z49A 4IHZA 4LO2C 2P39A 4I4RA 5BOWA 2BEBA 1RZOB 1SR4C 3N7LA 1G9CA 2UUSA 4LO7C 1IT0A 2ET2A 2WRYA 4LO0A 4HJJA 3UJ4A 3N7JA 3NBDA 2HWAA 3W9TA 1Q1UA 1N4KA 1FV2A 4YOLA 3F1RA 3P6IA 4JP0A 1JLYA 1HIBA 1YYNA 4JPZA 1G9DA 2NM1A 4JAWA 1S0DA 1DJSB 1MC9A 3ZXDA 1AFCA 4MZHA 3MALA 1ISZA 1RMLA 1Z4SA 2Y9FA 4QD2C 2LIEA 4I4PA 1S0EA 1W3GA 3Q7WA 4ZBVB 1DZDA 7I1BA 3O4CA 4Q9GA 1DFCA 2NS2A 4GOVA 1JT3A 4I4QA 4JKXB 1P63A 4QKRA 5DVHA 1TWMA 4I7IA 1QQKA 2DREA 3AKFA 3IM5A 3WMVA 3UD9A 3CU1B 3VUOA 3B9UA 3QYDA 3OGFA 1ABRB 1HWOB 3RMXA 3BA7A 4H75A 3O4AA 2K43A 2FFVA 1SZ6B 4ZA3B 3OBRA 3CA5A 2Z48A 4OWJA 4Q91A 1V6VA 1NUNA 3UD7A 1BASA 1DZCA 3BA5A 4X37A 5EHAA 2GO2A 1K5VA 3BAQA 1M2TB 4ZFYB 3FJEA 3BAOA 1J0SA 2R9KB 1BARA 3FJIA 3R4UA 2ZQOA 4I4YA 2Q9XA 1DIWA 4LO1A 1G9BA 5FZZA 1TIEA 2I1BA 3CAHA 5F8YA 2D44A 2AQZA 1A8DA 3BX1C 4LO7B 4ZFWB 4XFSA 5DZUA 1BFGA 2Y9WC 1K5UA 5G00A 4L4HA 5DSSB 1ISVA 5JLVA 4OEEA 3ILAA 1UPSA 1II4A 4KEKA 4I96A 2L5XA 2F8XC 2MIBA 4USOA 5D61A 3S8JA 1MD6A 2NTDA 1KNMA 3OBTA 1ISYA 2KI6B 3WO4A 1S0CA 3NBCA 2VU9A 3N0KA 1PUMB 2E4MA 2Y9XE 1EVTA 3H6QA 4JKQA 2Y9GA 1Z2VA 5BQUA 2VSAA 2YUGA 1PUUB 3SNVA 1TP0A 1PZZA 2FGFA 3VT0A 1BFBA 3ZX7A 1AF9A 1FMMS 3FJBA 3IM7A 4FVVA 1TOOA 5HPZA 5BP5C 3FJCA 4MZFB 4OEGA 5B2HA 3V0AA 2BFHA 9ILBA 2FDBM 4X3AA 2M49A 1RY7A 4QBCA 3FJ9A 2HWMA 4IZXA 4EEEB 3O4DA 4J2XA 1XZZA 1FMZA 4LO3A 1FQ9A 1T9FA 1CVSA 1GGPB 4HR6C 3JUTA 3HBWA 3BTAA 2NYYA 4KEJA 4GOYA 2D24A 4P0LA 1BLDA 1G82A 1PWAA 3BAUA 3AJ5A 4TLPA 2VLCA 3FGMA 3AZWA 3WINC 1HWNB 1HWMB 4I8MA 1JT7A 2VSEA 3O4OA 3OJ2A 3Q7YA 1JTCA 3BAVA 4DENA 3VSFA 2FO1A 3CA6A 4IONA 4Q9PA 5JMCA 5BXSA 3E8LC 1T4QA 1I1BA 3A22A 1FWUA 1BFCA 4A7ZA 4DEPA 1JLXA 4J2KA 3O44A 3O49A 1Z0HA 1JT4A 3VWCA 4XFTA 4P6AA 1NZKA 2F2FA 1CE7B 4R6UB 3A21A 1XHBA 3BA4A 3CQAA 5F8SA 5EG6C 2D7RA 4II0A 4EFPA 1WD4A 3WMUA 4I6IA 3AJ6A 5BXPA 1I1EA 1W3AA 4I2SA 3CA4A 1YBIA 1HCDA 4PC4A 4X39A 4UY4A 3PUBA 4I1BA 2LIQA 4QKSA 4LO0C 3ZC8A 4ZOTA 1RG8A 3AKHA 4EB2B 5BXTA 3CRGA 1AVUA 4F34A 3O4BA 2D20A 4P0KA 1QXMA 4JQ0A 2RSTA 2NVHA 1YTOA 4XFUA 3F62B 1ONKB 4LO2A 4J2SA 2ERMA 2DRZA 3H6RB 1SR4A 1HCEA 4H9WA 4GP0A 4IZEA 3BRDA 1D0HA 1W3FA 5FZUA 1V6WA 4I4XA 2D43A 3OJMA 3PHZA 3WO2A 3HN1A 3H6RA 3ZXGA 3CA0A 4G9MA 4WBCA 3AKGA 4ZKTB 1S0LA 4H04A 1PC8B 4IQPA 3FJKA 3IM6A 3VT1A 2KKIA 4QD2B 1IRAX 2D23A 3HMYA 1DLLA 2RG9B 5F90A 1F31A 3QR5A 3AZVA 4DCKC 3IAGC 1L2HA 2XOAA 3WA1A 3AH4A 3P6JA 1WBCA 2ZR1B 2K4AB 21BIA 1S0FA 3AH1A 3CRHA 4OUJA 3LLPA 4KBBA 2J3PA 3IIRA 2HZ9A 2NZ9A 3HALA 3VT2A 2NP0A 2VXRA 2ESUA 3FJAA 2AXMA 3FUOA 1TWEA 1XYFA 1WD3A 4A7KA 1JT5A 2X2TA 3UDAA 4EKXB 3V79C 1ISXA 5D62A 3R4SA 3VEQA 1TTUA 2DS0A 4X38A 1FV3A 3N7KA 3BRFA 4LO1C 6I1BA 5GAQA 1IJTA 1AVWB 4IY8A 4KEIA 3POKA 3NBEA 3A07A 4J2YA 4I1EA 2KLLA 4EFQA 1BA7A 1S0BA 3Q7XA 4EFRA 4A7YA 1EV2A 3EF2A 8I1BA 4OWLA 4GP3A 4J23B 1BFFA 3I2AA 4OWKA 3VSZA 4I4SA 2IWTB 1HWPB 3AKIA 3MPPG 4I4UA 3BADA 4GAIA 2WBCA 3I2XA 4QBVA 3FJDA 3LTQA 3CA1A 3FJJA 3T8SA 3N7MA 2KH2A 2MC2A 3I29B 3BAGA 3FFZA 3BRGC 3V0BB 1IRPA 4XKIA 1FGAA 1R8OA 3AH2A 2E4MC 4IYBA 1DQGA 3V0BA 4QO3A 5BQUC 1OQLB 4G6JA 5F8WA 5FNXA 1G9AA 3S8KA 4D8HA 1Q03A 4GAFA 2BEAA 5D63A 1Q04A 4ZFUB 4Z9WB
chains in the Genus database with same CATH topology
3O3QA 3JRRA 1XG6A 3FJ8A 3OGGA 3NBNA 1IHKA 4I4OA 4I4VA 1HKNA 2IHOA 3HSMA 3RTIB 1ISWA 1M16A 2VUAA 3UJ0A 4G6MA 1R8NA 3PG0A 4KC3A 2P23A 31BIA 2D7IA 3D7WB 3PMEA 2QYIB 4LO3C 5DUYA 3C9ZA 3RTJB 4ZGRB 4FGFA 4OEFA 41BIA 5BP5A 3RSJA 1AVXB 4D0ZA 3HOMA 5E24E 4G9NA 2VXTI 3UD8A 4JRAA 4L4IA 1EYLA 2DRYA 4ISQA 1BLAA 3TC2A 5BXRA 4I37A 2HW9A 2ZQNA 1V6XA 4Z8SB 1FWVA 4MZGB 1AVAC 2GZBA 5FNWA 1FN0A 5EC5A 4AN7B 1JQZA 4ENDA 3CRIA 5I1BA 1DQOA 1WBAA 3O5WB 1EPWA 3RMYA 4ZLBB 1YF8B 1E0OA 2RQ9A 3K1XA 4HA2A 1ILR1 4P0JA 2AFGA 4G1RA 3WINA 1YXWA 1JY0A 1IOBA 3KMVA 4IY9A 2F2FC 5FZYA 4D0TA 3WO3A 3FJFA 2MLLB 4I0YA 2X2SA 3H6SE 1DFQA 3BAHA 2FFUA 1AXMA 1TFMB 3FJHA 3P53A 4LO8B 5BVPI 2K8RA 2D1ZA 3CA3A 4QALA 3ZC9A 1V6UA 4QC4A 2KI4A 2QN4A 3BB2A 2D22A 1IILA 4CJMA 3OJVA 3V0AB 3A23A 3NJ5A 1VCLA 2Q3NB 1QQLA 4I3NA 2AAIB 4USPA 3FUQA 4ISRA 1ITBA 1S0GA 4OW4A 4AN6A 4F83A 2Z49A 4IHZA 4LO2C 2P39A 4I4RA 5BOWA 2BEBA 1RZOB 1SR4C 3N7LA 1G9CA 2UUSA 4LO7C 1IT0A 2ET2A 2WRYA 4LO0A 4HJJA 3UJ4A 3N7JA 3NBDA 2HWAA 3W9TA 1Q1UA 1N4KA 1FV2A 4YOLA 3F1RA 3P6IA 4JP0A 1JLYA 1HIBA 1YYNA 4JPZA 1G9DA 2NM1A 4JAWA 1S0DA 1DJSB 1MC9A 3ZXDA 1AFCA 4MZHA 3MALA 1ISZA 1RMLA 1Z4SA 2Y9FA 4QD2C 2LIEA 4I4PA 1S0EA 1W3GA 3Q7WA 4ZBVB 1DZDA 7I1BA 3O4CA 4Q9GA 1DFCA 2NS2A 4GOVA 1JT3A 4I4QA 4JKXB 1P63A 4QKRA 5DVHA 1TWMA 4I7IA 1QQKA 2DREA 3AKFA 3IM5A 3WMVA 3UD9A 3CU1B 3VUOA 3B9UA 3QYDA 3OGFA 1ABRB 1HWOB 3RMXA 3BA7A 4H75A 3O4AA 2K43A 2FFVA 1SZ6B 4ZA3B 3OBRA 3CA5A 2Z48A 4OWJA 4Q91A 1V6VA 1NUNA 3UD7A 1BASA 1DZCA 3BA5A 4X37A 5EHAA 2GO2A 1K5VA 3BAQA 1M2TB 4ZFYB 3FJEA 3BAOA 1J0SA 2R9KB 1BARA 3FJIA 3R4UA 2ZQOA 4I4YA 2Q9XA 1DIWA 4LO1A 1G9BA 5FZZA 1TIEA 2I1BA 3CAHA 5F8YA 2D44A 2AQZA 1A8DA 3BX1C 4LO7B 4ZFWB 4XFSA 5DZUA 1BFGA 2Y9WC 1K5UA 5G00A 4L4HA 5DSSB 1ISVA 5JLVA 4OEEA 3ILAA 1UPSA 1II4A 4KEKA 4I96A 2L5XA 2F8XC 2MIBA 4USOA 5D61A 3S8JA 1MD6A 2NTDA 1KNMA 3OBTA 1ISYA 2KI6B 3WO4A 1S0CA 3NBCA 2VU9A 3N0KA 1PUMB 2E4MA 2Y9XE 1EVTA 3H6QA 4JKQA 2Y9GA 1Z2VA 5BQUA 2VSAA 2YUGA 1PUUB 3SNVA 1TP0A 1PZZA 2FGFA 3VT0A 1BFBA 3ZX7A 1AF9A 1FMMS 3FJBA 3IM7A 4FVVA 1TOOA 5HPZA 5BP5C 3FJCA 4MZFB 4OEGA 5B2HA 3V0AA 2BFHA 9ILBA 2FDBM 4X3AA 2M49A 1RY7A 4QBCA 3FJ9A 2HWMA 4IZXA 4EEEB 3O4DA 4J2XA 1XZZA 1FMZA 4LO3A 1FQ9A 1T9FA 1CVSA 1GGPB 4HR6C 3JUTA 3HBWA 3BTAA 2NYYA 4KEJA 4GOYA 2D24A 4P0LA 1BLDA 1G82A 1PWAA 3BAUA 3AJ5A 4TLPA 2VLCA 3FGMA 3AZWA 3WINC 1HWNB 1HWMB 4I8MA 1JT7A 2VSEA 3O4OA 3OJ2A 3Q7YA 1JTCA 3BAVA 4DENA 3VSFA 2FO1A 3CA6A 4IONA 4Q9PA 5JMCA 5BXSA 3E8LC 1T4QA 1I1BA 3A22A 1FWUA 1BFCA 4A7ZA 4DEPA 1JLXA 4J2KA 3O44A 3O49A 1Z0HA 1JT4A 3VWCA 4XFTA 4P6AA 1NZKA 2F2FA 1CE7B 4R6UB 3A21A 1XHBA 3BA4A 3CQAA 5F8SA 5EG6C 2D7RA 4II0A 4EFPA 1WD4A 3WMUA 4I6IA 3AJ6A 5BXPA 1I1EA 1W3AA 4I2SA 3CA4A 1YBIA 1HCDA 4PC4A 4X39A 4UY4A 3PUBA 4I1BA 2LIQA 4QKSA 4LO0C 3ZC8A 4ZOTA 1RG8A 3AKHA 4EB2B 5BXTA 3CRGA 1AVUA 4F34A 3O4BA 2D20A 4P0KA 1QXMA 4JQ0A 2RSTA 2NVHA 1YTOA 4XFUA 3F62B 1ONKB 4LO2A 4J2SA 2ERMA 2DRZA 3H6RB 1SR4A 1HCEA 4H9WA 4GP0A 4IZEA 3BRDA 1D0HA 1W3FA 5FZUA 1V6WA 4I4XA 2D43A 3OJMA 3PHZA 3WO2A 3HN1A 3H6RA 3ZXGA 3CA0A 4G9MA 4WBCA 3AKGA 4ZKTB 1S0LA 4H04A 1PC8B 4IQPA 3FJKA 3IM6A 3VT1A 2KKIA 4QD2B 1IRAX 2D23A 3HMYA 1DLLA 2RG9B 5F90A 1F31A 3QR5A 3AZVA 4DCKC 3IAGC 1L2HA 2XOAA 3WA1A 3AH4A 3P6JA 1WBCA 2ZR1B 2K4AB 21BIA 1S0FA 3AH1A 3CRHA 4OUJA 3LLPA 4KBBA 2J3PA 3IIRA 2HZ9A 2NZ9A 3HALA 3VT2A 2NP0A 2VXRA 2ESUA 3FJAA 2AXMA 3FUOA 1TWEA 1XYFA 1WD3A 4A7KA 1JT5A 2X2TA 3UDAA 4EKXB 3V79C 1ISXA 5D62A 3R4SA 3VEQA 1TTUA 2DS0A 4X38A 1FV3A 3N7KA 3BRFA 4LO1C 6I1BA 5GAQA 1IJTA 1AVWB 4IY8A 4KEIA 3POKA 3NBEA 3A07A 4J2YA 4I1EA 2KLLA 4EFQA 1BA7A 1S0BA 3Q7XA 4EFRA 4A7YA 1EV2A 3EF2A 8I1BA 4OWLA 4GP3A 4J23B 1BFFA 3I2AA 4OWKA 3VSZA 4I4SA 2IWTB 1HWPB 3AKIA 3MPPG 4I4UA 3BADA 4GAIA 2WBCA 3I2XA 4QBVA 3FJDA 3LTQA 3CA1A 3FJJA 3T8SA 3N7MA 2KH2A 2MC2A 3I29B 3BAGA 3FFZA 3BRGC 3V0BB 1IRPA 4XKIA 1FGAA 1R8OA 3AH2A 2E4MC 4IYBA 1DQGA 3V0BA 4QO3A 5BQUC 1OQLB 4G6JA 5F8WA 5FNXA 1G9AA 3S8KA 4D8HA 1Q03A 4GAFA 2BEAA 5D63A 1Q04A 4ZFUB 4Z9WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O3Q A;  3JRR A;  1XG6 A;  3FJ8 A;  3OGG A;  3NBN A;  1IHK A;  4I4O A;  4I4V A;  1HKN A;  2IHO A;  3HSM A;  3RTI B;  1ISW A;  1M16 A;  2VUA A;  3UJ0 A;  4G6M A;  1R8N A;  3PG0 A;  4KC3 A;  2P23 A;  31BI A;  2D7I A;  3D7W B;  3PME A;  2QYI B;  4LO3 C;  5DUY A;  3C9Z A;  3RTJ B;  4ZGR B;  4FGF A;  4OEF A;  41BI A;  5BP5 A;  3RSJ A;  1AVX B;  4D0Z A;  3HOM A;  5E24 E;  4G9N A;  2VXT I;  3UD8 A;  4JRA A;  4L4I A;  1EYL A;  2DRY A;  4ISQ A;  1BLA A;  3TC2 A;  5BXR A;  4I37 A;  2HW9 A;  2ZQN A;  1V6X A;  4Z8S B;  1FWV A;  1AVA C;  2GZB A;  5FNW A;  1FN0 A;  5EC5 A;  4AN7 B;  1JQZ A;  4END A;  3CRI A;  5I1B A;  1DQO A;  1WBA A;  3O5W B;  1EPW A;  3RMY A;  4ZLB B;  1YF8 B;  1E0O A;  2RQ9 A;  3K1X A;  4HA2 A;  1ILR 1;  4P0J A;  2AFG A;  4G1R A;  3WIN A;  1YXW A;  1JY0 A;  1IOB A;  3KMV A;  4IY9 A;  2F2F C;  5FZY A;  4D0T A;  3WO3 A;  3FJF A;  2MLL B;  4I0Y A;  2X2S A;  3H6S E;  1DFQ A;  3BAH A;  2FFU A;  1AXM A;  1TFM B;  3FJH A;  3P53 A;  4LO8 B;  5BVP I;  2K8R A;  2D1Z A;  3CA3 A;  4QAL A;  3ZC9 A;  1V6U A;  4QC4 A;  2KI4 A;  2QN4 A;  3BB2 A;  2D22 A;  1IIL A;  4CJM A;  3OJV A;  3V0A B;  3A23 A;  3NJ5 A;  1VCL A;  2Q3N B;  1QQL A;  4I3N A;  2AAI B;  4USP A;  3FUQ A;  4ISR A;  1ITB A;  1S0G A;  4OW4 A;  4AN6 A;  4F83 A;  2Z49 A;  4IHZ A;  4LO2 C;  2P39 A;  4I4R A;  5BOW A;  2BEB A;  1RZO B;  1SR4 C;  3N7L A;  1G9C A;  2UUS A;  4LO7 C;  1IT0 A;  2ET2 A;  2WRY A;  4LO0 A;  4HJJ A;  3UJ4 A;  3N7J A;  3NBD A;  2HWA A;  3W9T A;  1Q1U A;  1N4K A;  1FV2 A;  4YOL A;  3F1R A;  3P6I A;  4JP0 A;  1JLY A;  1HIB A;  1YYN A;  4JPZ A;  1G9D A;  2NM1 A;  4JAW A;  1S0D A;  1DJS B;  1MC9 A;  3ZXD A;  1AFC A;  3MAL A;  1ISZ A;  1RML A;  1Z4S A;  2Y9F A;  4QD2 C;  2LIE A;  4I4P A;  1S0E A;  1W3G A;  3Q7W A;  4ZBV B;  1DZD A;  7I1B A;  3O4C A;  4Q9G A;  1DFC A;  4GOV A;  1JT3 A;  4I4Q A;  4JKX B;  1P63 A;  4QKR A;  5DVH A;  1TWM A;  4I7I A;  1QQK A;  2DRE A;  3AKF A;  3IM5 A;  3WMV A;  3UD9 A;  3CU1 B;  3VUO A;  3B9U A;  3QYD A;  3OGF A;  1ABR B;  1HWO B;  3RMX A;  3BA7 A;  3O4A A;  2K43 A;  2FFV A;  1SZ6 B;  4ZA3 B;  3OBR A;  3CA5 A;  2Z48 A;  4OWJ A;  4Q91 A;  1V6V A;  1NUN A;  3UD7 A;  1BAS A;  1DZC A;  3BA5 A;  4X37 A;  5EHA A;  2GO2 A;  1K5V A;  3BAQ A;  1M2T B;  4ZFY B;  3FJE A;  3BAO A;  1J0S A;  2R9K B;  1BAR A;  3FJI A;  3R4U A;  2ZQO A;  4I4Y A;  2Q9X A;  1DIW A;  4LO1 A;  1G9B A;  5FZZ A;  1TIE A;  2I1B A;  3CAH A;  5F8Y A;  2D44 A;  2AQZ A;  1A8D A;  3BX1 C;  4LO7 B;  4ZFW B;  4XFS A;  5DZU A;  1BFG A;  2Y9W C;  1K5U A;  5G00 A;  4L4H A;  5DSS B;  1ISV A;  5JLV A;  4OEE A;  3ILA A;  1UPS A;  1II4 A;  4KEK A;  4I96 A;  2L5X A;  2F8X C;  2MIB A;  4USO A;  5D61 A;  3S8J A;  1MD6 A;  2NTD A;  1KNM A;  3OBT A;  1ISY A;  2KI6 B;  3WO4 A;  1S0C A;  3NBC A;  2VU9 A;  3N0K A;  1PUM B;  2E4M A;  2Y9X E;  1EVT A;  3H6Q A;  4JKQ A;  2Y9G A;  1Z2V A;  5BQU A;  2VSA A;  2YUG A;  1PUU B;  3SNV A;  1TP0 A;  1PZZ A;  2FGF A;  3VT0 A;  1BFB A;  3ZX7 A;  1AF9 A;  1FMM S;  3FJB A;  3IM7 A;  4FVV A;  1TOO A;  5HPZ A;  5BP5 C;  3FJC A;  4OEG A;  5B2H A;  3V0A A;  2BFH A;  9ILB A;  2FDB M;  4X3A A;  2M49 A;  1RY7 A;  4QBC A;  3FJ9 A;  2HWM A;  4IZX A;  4EEE B;  3O4D A;  4J2X A;  1XZZ A;  1FMZ A;  4LO3 A;  1FQ9 A;  1T9F A;  1CVS A;  1GGP B;  4HR6 C;  3JUT A;  3HBW A;  3BTA A;  2NYY A;  4KEJ A;  4GOY A;  2D24 A;  4P0L A;  1BLD A;  1G82 A;  1PWA A;  3BAU A;  3AJ5 A;  4TLP A;  2VLC A;  3FGM A;  3AZW A;  3WIN C;  1HWN B;  1HWM B;  4I8M A;  1JT7 A;  2VSE A;  3O4O A;  3OJ2 A;  3Q7Y A;  1JTC A;  3BAV A;  4DEN A;  3VSF A;  2FO1 A;  3CA6 A;  4ION A;  4Q9P A;  5JMC A;  5BXS A;  3E8L C;  1T4Q A;  1I1B A;  3A22 A;  1FWU A;  1BFC A;  4A7Z A;  4DEP A;  1JLX A;  4J2K A;  3O44 A;  3O49 A;  1Z0H A;  1JT4 A;  3VWC A;  4XFT A;  4P6A A;  1NZK A;  2F2F A;  1CE7 B;  4R6U B;  3A21 A;  1XHB A;  3BA4 A;  3CQA A;  5F8S A;  5EG6 C;  2D7R A;  4II0 A;  4EFP A;  1WD4 A;  3WMU A;  4I6I A;  3AJ6 A;  5BXP A;  1I1E A;  1W3A A;  4I2S A;  3CA4 A;  1YBI A;  1HCD A;  4PC4 A;  4X39 A;  3PUB A;  4I1B A;  2LIQ A;  4QKS A;  4LO0 C;  3ZC8 A;  4ZOT A;  1RG8 A;  3AKH A;  4EB2 B;  5BXT A;  3CRG A;  1AVU A;  4F34 A;  3O4B A;  2D20 A;  4P0K A;  1QXM A;  4JQ0 A;  2RST A;  2NVH A;  1YTO A;  4XFU A;  3F62 B;  1ONK B;  4LO2 A;  4J2S A;  2ERM A;  2DRZ A;  3H6R B;  1SR4 A;  1HCE A;  4H9W A;  4GP0 A;  4IZE A;  3BRD A;  1D0H A;  1W3F A;  5FZU A;  1V6W A;  4I4X A;  2D43 A;  3OJM A;  3PHZ A;  3WO2 A;  3HN1 A;  3H6R A;  3ZXG A;  3CA0 A;  4G9M A;  4WBC A;  3AKG A;  4ZKT B;  1S0L A;  4H04 A;  1PC8 B;  4IQP A;  3FJK A;  3IM6 A;  3VT1 A;  2KKI A;  4QD2 B;  1IRA X;  2D23 A;  3HMY A;  1DLL A;  2RG9 B;  5F90 A;  1F31 A;  3QR5 A;  3AZV A;  4DCK C;  3IAG C;  1L2H A;  2XOA A;  3WA1 A;  3AH4 A;  3P6J A;  1WBC A;  2ZR1 B;  2K4A B;  21BI A;  1S0F A;  3AH1 A;  3CRH A;  4OUJ A;  3LLP A;  4KBB A;  2J3P A;  3IIR A;  2HZ9 A;  2NZ9 A;  3HAL A;  3VT2 A;  2NP0 A;  2VXR A;  2ESU A;  3FJA A;  2AXM A;  3FUO A;  1TWE A;  1XYF A;  1WD3 A;  4A7K A;  1JT5 A;  2X2T A;  3UDA A;  4EKX B;  3V79 C;  1ISX A;  5D62 A;  3R4S A;  3VEQ A;  1TTU A;  2DS0 A;  4X38 A;  1FV3 A;  3N7K A;  3BRF A;  4LO1 C;  6I1B A;  5GAQ A;  1IJT A;  1AVW B;  4IY8 A;  4KEI A;  3POK A;  3NBE A;  3A07 A;  4J2Y A;  4I1E A;  2KLL A;  4EFQ A;  1BA7 A;  1S0B A;  3Q7X A;  4EFR A;  4A7Y A;  1EV2 A;  3EF2 A;  8I1B A;  4OWL A;  4GP3 A;  4J23 B;  1BFF A;  3I2A A;  4OWK A;  3VSZ A;  4I4S A;  2IWT B;  1HWP B;  3AKI A;  3MPP G;  4I4U A;  3BAD A;  4GAI A;  2WBC A;  3I2X A;  4QBV A;  3FJD A;  3LTQ A;  3CA1 A;  3FJJ A;  3T8S A;  3N7M A;  2KH2 A;  2MC2 A;  3I29 B;  3BAG A;  3FFZ A;  3BRG C;  3V0B B;  1IRP A;  4XKI A;  1FGA A;  1R8O A;  3AH2 A;  2E4M C;  4IYB A;  1DQG A;  3V0B A;  4QO3 A;  5BQU C;  1OQL B;  4G6J A;  5F8W A;  5FNX A;  1G9A A;  3S8K A;  4D8H A;  1Q03 A;  4GAF A;  2BEA A;  5D63 A;  1Q04 A;  4ZFU B;  4Z9W B; 
#chains in the Genus database with same CATH topology
 3O3Q A;  3JRR A;  1XG6 A;  3FJ8 A;  3OGG A;  3NBN A;  1IHK A;  4I4O A;  4I4V A;  1HKN A;  2IHO A;  3HSM A;  3RTI B;  1ISW A;  1M16 A;  2VUA A;  3UJ0 A;  4G6M A;  1R8N A;  3PG0 A;  4KC3 A;  2P23 A;  31BI A;  2D7I A;  3D7W B;  3PME A;  2QYI B;  4LO3 C;  5DUY A;  3C9Z A;  3RTJ B;  4ZGR B;  4FGF A;  4OEF A;  41BI A;  5BP5 A;  3RSJ A;  1AVX B;  4D0Z A;  3HOM A;  5E24 E;  4G9N A;  2VXT I;  3UD8 A;  4JRA A;  4L4I A;  1EYL A;  2DRY A;  4ISQ A;  1BLA A;  3TC2 A;  5BXR A;  4I37 A;  2HW9 A;  2ZQN A;  1V6X A;  4Z8S B;  1FWV A;  4MZG B;  1AVA C;  2GZB A;  5FNW A;  1FN0 A;  5EC5 A;  4AN7 B;  1JQZ A;  4END A;  3CRI A;  5I1B A;  1DQO A;  1WBA A;  3O5W B;  1EPW A;  3RMY A;  4ZLB B;  1YF8 B;  1E0O A;  2RQ9 A;  3K1X A;  4HA2 A;  1ILR 1;  4P0J A;  2AFG A;  4G1R A;  3WIN A;  1YXW A;  1JY0 A;  1IOB A;  3KMV A;  4IY9 A;  2F2F C;  5FZY A;  4D0T A;  3WO3 A;  3FJF A;  2MLL B;  4I0Y A;  2X2S A;  3H6S E;  1DFQ A;  3BAH A;  2FFU A;  1AXM A;  1TFM B;  3FJH A;  3P53 A;  4LO8 B;  5BVP I;  2K8R A;  2D1Z A;  3CA3 A;  4QAL A;  3ZC9 A;  1V6U A;  4QC4 A;  2KI4 A;  2QN4 A;  3BB2 A;  2D22 A;  1IIL A;  4CJM A;  3OJV A;  3V0A B;  3A23 A;  3NJ5 A;  1VCL A;  2Q3N B;  1QQL A;  4I3N A;  2AAI B;  4USP A;  3FUQ A;  4ISR A;  1ITB A;  1S0G A;  4OW4 A;  4AN6 A;  4F83 A;  2Z49 A;  4IHZ A;  4LO2 C;  2P39 A;  4I4R A;  5BOW A;  2BEB A;  1RZO B;  1SR4 C;  3N7L A;  1G9C A;  2UUS A;  4LO7 C;  1IT0 A;  2ET2 A;  2WRY A;  4LO0 A;  4HJJ A;  3UJ4 A;  3N7J A;  3NBD A;  2HWA A;  3W9T A;  1Q1U A;  1N4K A;  1FV2 A;  4YOL A;  3F1R A;  3P6I A;  4JP0 A;  1JLY A;  1HIB A;  1YYN A;  4JPZ A;  1G9D A;  2NM1 A;  4JAW A;  1S0D A;  1DJS B;  1MC9 A;  3ZXD A;  1AFC A;  4MZH A;  3MAL A;  1ISZ A;  1RML A;  1Z4S A;  2Y9F A;  4QD2 C;  2LIE A;  4I4P A;  1S0E A;  1W3G A;  3Q7W A;  4ZBV B;  1DZD A;  7I1B A;  3O4C A;  4Q9G A;  1DFC A;  2NS2 A;  4GOV A;  1JT3 A;  4I4Q A;  4JKX B;  1P63 A;  4QKR A;  5DVH A;  1TWM A;  4I7I A;  1QQK A;  2DRE A;  3AKF A;  3IM5 A;  3WMV A;  3UD9 A;  3CU1 B;  3VUO A;  3B9U A;  3QYD A;  3OGF A;  1ABR B;  1HWO B;  3RMX A;  3BA7 A;  4H75 A;  3O4A A;  2K43 A;  2FFV A;  1SZ6 B;  4ZA3 B;  3OBR A;  3CA5 A;  2Z48 A;  4OWJ A;  4Q91 A;  1V6V A;  1NUN A;  3UD7 A;  1BAS A;  1DZC A;  3BA5 A;  4X37 A;  5EHA A;  2GO2 A;  1K5V A;  3BAQ A;  1M2T B;  4ZFY B;  3FJE A;  3BAO A;  1J0S A;  2R9K B;  1BAR A;  3FJI A;  3R4U A;  2ZQO A;  4I4Y A;  2Q9X A;  1DIW A;  4LO1 A;  1G9B A;  5FZZ A;  1TIE A;  2I1B A;  3CAH A;  5F8Y A;  2D44 A;  2AQZ A;  1A8D A;  3BX1 C;  4LO7 B;  4ZFW B;  4XFS A;  5DZU A;  1BFG A;  2Y9W C;  1K5U A;  5G00 A;  4L4H A;  5DSS B;  1ISV A;  5JLV A;  4OEE A;  3ILA A;  1UPS A;  1II4 A;  4KEK A;  4I96 A;  2L5X A;  2F8X C;  2MIB A;  4USO A;  5D61 A;  3S8J A;  1MD6 A;  2NTD A;  1KNM A;  3OBT A;  1ISY A;  2KI6 B;  3WO4 A;  1S0C A;  3NBC A;  2VU9 A;  3N0K A;  1PUM B;  2E4M A;  2Y9X E;  1EVT A;  3H6Q A;  4JKQ A;  2Y9G A;  1Z2V A;  5BQU A;  2VSA A;  2YUG A;  1PUU B;  3SNV A;  1TP0 A;  1PZZ A;  2FGF A;  3VT0 A;  1BFB A;  3ZX7 A;  1AF9 A;  1FMM S;  3FJB A;  3IM7 A;  4FVV A;  1TOO A;  5HPZ A;  5BP5 C;  3FJC A;  4MZF B;  4OEG A;  5B2H A;  3V0A A;  2BFH A;  9ILB A;  2FDB M;  4X3A A;  2M49 A;  1RY7 A;  4QBC A;  3FJ9 A;  2HWM A;  4IZX A;  4EEE B;  3O4D A;  4J2X A;  1XZZ A;  1FMZ A;  4LO3 A;  1FQ9 A;  1T9F A;  1CVS A;  1GGP B;  4HR6 C;  3JUT A;  3HBW A;  3BTA A;  2NYY A;  4KEJ A;  4GOY A;  2D24 A;  4P0L A;  1BLD A;  1G82 A;  1PWA A;  3BAU A;  3AJ5 A;  4TLP A;  2VLC A;  3FGM A;  3AZW A;  3WIN C;  1HWN B;  1HWM B;  4I8M A;  1JT7 A;  2VSE A;  3O4O A;  3OJ2 A;  3Q7Y A;  1JTC A;  3BAV A;  4DEN A;  3VSF A;  2FO1 A;  3CA6 A;  4ION A;  4Q9P A;  5JMC A;  5BXS A;  3E8L C;  1T4Q A;  1I1B A;  3A22 A;  1FWU A;  1BFC A;  4A7Z A;  4DEP A;  1JLX A;  4J2K A;  3O44 A;  3O49 A;  1Z0H A;  1JT4 A;  3VWC A;  4XFT A;  4P6A A;  1NZK A;  2F2F A;  1CE7 B;  4R6U B;  3A21 A;  1XHB A;  3BA4 A;  3CQA A;  5F8S A;  5EG6 C;  2D7R A;  4II0 A;  4EFP A;  1WD4 A;  3WMU A;  4I6I A;  3AJ6 A;  5BXP A;  1I1E A;  1W3A A;  4I2S A;  3CA4 A;  1YBI A;  1HCD A;  4PC4 A;  4X39 A;  4UY4 A;  3PUB A;  4I1B A;  2LIQ A;  4QKS A;  4LO0 C;  3ZC8 A;  4ZOT A;  1RG8 A;  3AKH A;  4EB2 B;  5BXT A;  3CRG A;  1AVU A;  4F34 A;  3O4B A;  2D20 A;  4P0K A;  1QXM A;  4JQ0 A;  2RST A;  2NVH A;  1YTO A;  4XFU A;  3F62 B;  1ONK B;  4LO2 A;  4J2S A;  2ERM A;  2DRZ A;  3H6R B;  1SR4 A;  1HCE A;  4H9W A;  4GP0 A;  4IZE A;  3BRD A;  1D0H A;  1W3F A;  5FZU A;  1V6W A;  4I4X A;  2D43 A;  3OJM A;  3PHZ A;  3WO2 A;  3HN1 A;  3H6R A;  3ZXG A;  3CA0 A;  4G9M A;  4WBC A;  3AKG A;  4ZKT B;  1S0L A;  4H04 A;  1PC8 B;  4IQP A;  3FJK A;  3IM6 A;  3VT1 A;  2KKI A;  4QD2 B;  1IRA X;  2D23 A;  3HMY A;  1DLL A;  2RG9 B;  5F90 A;  1F31 A;  3QR5 A;  3AZV A;  4DCK C;  3IAG C;  1L2H A;  2XOA A;  3WA1 A;  3AH4 A;  3P6J A;  1WBC A;  2ZR1 B;  2K4A B;  21BI A;  1S0F A;  3AH1 A;  3CRH A;  4OUJ A;  3LLP A;  4KBB A;  2J3P A;  3IIR A;  2HZ9 A;  2NZ9 A;  3HAL A;  3VT2 A;  2NP0 A;  2VXR A;  2ESU A;  3FJA A;  2AXM A;  3FUO A;  1TWE A;  1XYF A;  1WD3 A;  4A7K A;  1JT5 A;  2X2T A;  3UDA A;  4EKX B;  3V79 C;  1ISX A;  5D62 A;  3R4S A;  3VEQ A;  1TTU A;  2DS0 A;  4X38 A;  1FV3 A;  3N7K A;  3BRF A;  4LO1 C;  6I1B A;  5GAQ A;  1IJT A;  1AVW B;  4IY8 A;  4KEI A;  3POK A;  3NBE A;  3A07 A;  4J2Y A;  4I1E A;  2KLL A;  4EFQ A;  1BA7 A;  1S0B A;  3Q7X A;  4EFR A;  4A7Y A;  1EV2 A;  3EF2 A;  8I1B A;  4OWL A;  4GP3 A;  4J23 B;  1BFF A;  3I2A A;  4OWK A;  3VSZ A;  4I4S A;  2IWT B;  1HWP B;  3AKI A;  3MPP G;  4I4U A;  3BAD A;  4GAI A;  2WBC A;  3I2X A;  4QBV A;  3FJD A;  3LTQ A;  3CA1 A;  3FJJ A;  3T8S A;  3N7M A;  2KH2 A;  2MC2 A;  3I29 B;  3BAG A;  3FFZ A;  3BRG C;  3V0B B;  1IRP A;  4XKI A;  1FGA A;  1R8O A;  3AH2 A;  2E4M C;  4IYB A;  1DQG A;  3V0B A;  4QO3 A;  5BQU C;  1OQL B;  4G6J A;  5F8W A;  5FNX A;  1G9A A;  3S8K A;  4D8H A;  1Q03 A;  4GAF A;  2BEA A;  5D63 A;  1Q04 A;  4ZFU B;  4Z9W B; 
#chains in the Genus database with same CATH homology
 3O3Q A;  3JRR A;  1XG6 A;  3FJ8 A;  3OGG A;  3NBN A;  1IHK A;  4I4O A;  4I4V A;  1HKN A;  2IHO A;  3HSM A;  3RTI B;  1ISW A;  1M16 A;  2VUA A;  3UJ0 A;  4G6M A;  1R8N A;  3PG0 A;  4KC3 A;  2P23 A;  31BI A;  2D7I A;  3D7W B;  3PME A;  2QYI B;  4LO3 C;  5DUY A;  3C9Z A;  3RTJ B;  4ZGR B;  4FGF A;  4OEF A;  41BI A;  5BP5 A;  3RSJ A;  1AVX B;  4D0Z A;  3HOM A;  5E24 E;  4G9N A;  2VXT I;  3UD8 A;  4JRA A;  4L4I A;  1EYL A;  2DRY A;  4ISQ A;  1BLA A;  3TC2 A;  5BXR A;  4I37 A;  2HW9 A;  2ZQN A;  1V6X A;  4Z8S B;  1FWV A;  4MZG B;  1AVA C;  2GZB A;  5FNW A;  1FN0 A;  5EC5 A;  4AN7 B;  1JQZ A;  4END A;  3CRI A;  5I1B A;  1DQO A;  1WBA A;  3O5W B;  1EPW A;  3RMY A;  4ZLB B;  1YF8 B;  1E0O A;  2RQ9 A;  3K1X A;  4HA2 A;  1ILR 1;  4P0J A;  2AFG A;  4G1R A;  3WIN A;  1YXW A;  1JY0 A;  1IOB A;  3KMV A;  4IY9 A;  2F2F C;  5FZY A;  4D0T A;  3WO3 A;  3FJF A;  2MLL B;  4I0Y A;  2X2S A;  3H6S E;  1DFQ A;  3BAH A;  2FFU A;  1AXM A;  1TFM B;  3FJH A;  3P53 A;  4LO8 B;  5BVP I;  2K8R A;  2D1Z A;  3CA3 A;  4QAL A;  3ZC9 A;  1V6U A;  4QC4 A;  2KI4 A;  2QN4 A;  3BB2 A;  2D22 A;  1IIL A;  4CJM A;  3OJV A;  3V0A B;  3A23 A;  3NJ5 A;  1VCL A;  2Q3N B;  1QQL A;  4I3N A;  2AAI B;  4USP A;  3FUQ A;  4ISR A;  1ITB A;  1S0G A;  4OW4 A;  4AN6 A;  4F83 A;  2Z49 A;  4IHZ A;  4LO2 C;  2P39 A;  4I4R A;  5BOW A;  2BEB A;  1RZO B;  1SR4 C;  3N7L A;  1G9C A;  2UUS A;  4LO7 C;  1IT0 A;  2ET2 A;  2WRY A;  4LO0 A;  4HJJ A;  3UJ4 A;  3N7J A;  3NBD A;  2HWA A;  3W9T A;  1Q1U A;  1N4K A;  1FV2 A;  4YOL A;  3F1R A;  3P6I A;  4JP0 A;  1JLY A;  1HIB A;  1YYN A;  4JPZ A;  1G9D A;  2NM1 A;  4JAW A;  1S0D A;  1DJS B;  1MC9 A;  3ZXD A;  1AFC A;  4MZH A;  3MAL A;  1ISZ A;  1RML A;  1Z4S A;  2Y9F A;  4QD2 C;  2LIE A;  4I4P A;  1S0E A;  1W3G A;  3Q7W A;  4ZBV B;  1DZD A;  7I1B A;  3O4C A;  4Q9G A;  1DFC A;  2NS2 A;  4GOV A;  1JT3 A;  4I4Q A;  4JKX B;  1P63 A;  4QKR A;  5DVH A;  1TWM A;  4I7I A;  1QQK A;  2DRE A;  3AKF A;  3IM5 A;  3WMV A;  3UD9 A;  3CU1 B;  3VUO A;  3B9U A;  3QYD A;  3OGF A;  1ABR B;  1HWO B;  3RMX A;  3BA7 A;  4H75 A;  3O4A A;  2K43 A;  2FFV A;  1SZ6 B;  4ZA3 B;  3OBR A;  3CA5 A;  2Z48 A;  4OWJ A;  4Q91 A;  1V6V A;  1NUN A;  3UD7 A;  1BAS A;  1DZC A;  3BA5 A;  4X37 A;  5EHA A;  2GO2 A;  1K5V A;  3BAQ A;  1M2T B;  4ZFY B;  3FJE A;  3BAO A;  1J0S A;  2R9K B;  1BAR A;  3FJI A;  3R4U A;  2ZQO A;  4I4Y A;  2Q9X A;  1DIW A;  4LO1 A;  1G9B A;  5FZZ A;  1TIE A;  2I1B A;  3CAH A;  5F8Y A;  2D44 A;  2AQZ A;  1A8D A;  3BX1 C;  4LO7 B;  4ZFW B;  4XFS A;  5DZU A;  1BFG A;  2Y9W C;  1K5U A;  5G00 A;  4L4H A;  5DSS B;  1ISV A;  5JLV A;  4OEE A;  3ILA A;  1UPS A;  1II4 A;  4KEK A;  4I96 A;  2L5X A;  2F8X C;  2MIB A;  4USO A;  5D61 A;  3S8J A;  1MD6 A;  2NTD A;  1KNM A;  3OBT A;  1ISY A;  2KI6 B;  3WO4 A;  1S0C A;  3NBC A;  2VU9 A;  3N0K A;  1PUM B;  2E4M A;  2Y9X E;  1EVT A;  3H6Q A;  4JKQ A;  2Y9G A;  1Z2V A;  5BQU A;  2VSA A;  2YUG A;  1PUU B;  3SNV A;  1TP0 A;  1PZZ A;  2FGF A;  3VT0 A;  1BFB A;  3ZX7 A;  1AF9 A;  1FMM S;  3FJB A;  3IM7 A;  4FVV A;  1TOO A;  5HPZ A;  5BP5 C;  3FJC A;  4MZF B;  4OEG A;  5B2H A;  3V0A A;  2BFH A;  9ILB A;  2FDB M;  4X3A A;  2M49 A;  1RY7 A;  4QBC A;  3FJ9 A;  2HWM A;  4IZX A;  4EEE B;  3O4D A;  4J2X A;  1XZZ A;  1FMZ A;  4LO3 A;  1FQ9 A;  1T9F A;  1CVS A;  1GGP B;  4HR6 C;  3JUT A;  3HBW A;  3BTA A;  2NYY A;  4KEJ A;  4GOY A;  2D24 A;  4P0L A;  1BLD A;  1G82 A;  1PWA A;  3BAU A;  3AJ5 A;  4TLP A;  2VLC A;  3FGM A;  3AZW A;  3WIN C;  1HWN B;  1HWM B;  4I8M A;  1JT7 A;  2VSE A;  3O4O A;  3OJ2 A;  3Q7Y A;  1JTC A;  3BAV A;  4DEN A;  3VSF A;  2FO1 A;  3CA6 A;  4ION A;  4Q9P A;  5JMC A;  5BXS A;  3E8L C;  1T4Q A;  1I1B A;  3A22 A;  1FWU A;  1BFC A;  4A7Z A;  4DEP A;  1JLX A;  4J2K A;  3O44 A;  3O49 A;  1Z0H A;  1JT4 A;  3VWC A;  4XFT A;  4P6A A;  1NZK A;  2F2F A;  1CE7 B;  4R6U B;  3A21 A;  1XHB A;  3BA4 A;  3CQA A;  5F8S A;  5EG6 C;  2D7R A;  4II0 A;  4EFP A;  1WD4 A;  3WMU A;  4I6I A;  3AJ6 A;  5BXP A;  1I1E A;  1W3A A;  4I2S A;  3CA4 A;  1YBI A;  1HCD A;  4PC4 A;  4X39 A;  4UY4 A;  3PUB A;  4I1B A;  2LIQ A;  4QKS A;  4LO0 C;  3ZC8 A;  4ZOT A;  1RG8 A;  3AKH A;  4EB2 B;  5BXT A;  3CRG A;  1AVU A;  4F34 A;  3O4B A;  2D20 A;  4P0K A;  1QXM A;  4JQ0 A;  2RST A;  2NVH A;  1YTO A;  4XFU A;  3F62 B;  1ONK B;  4LO2 A;  4J2S A;  2ERM A;  2DRZ A;  3H6R B;  1SR4 A;  1HCE A;  4H9W A;  4GP0 A;  4IZE A;  3BRD A;  1D0H A;  1W3F A;  5FZU A;  1V6W A;  4I4X A;  2D43 A;  3OJM A;  3PHZ A;  3WO2 A;  3HN1 A;  3H6R A;  3ZXG A;  3CA0 A;  4G9M A;  4WBC A;  3AKG A;  4ZKT B;  1S0L A;  4H04 A;  1PC8 B;  4IQP A;  3FJK A;  3IM6 A;  3VT1 A;  2KKI A;  4QD2 B;  1IRA X;  2D23 A;  3HMY A;  1DLL A;  2RG9 B;  5F90 A;  1F31 A;  3QR5 A;  3AZV A;  4DCK C;  3IAG C;  1L2H A;  2XOA A;  3WA1 A;  3AH4 A;  3P6J A;  1WBC A;  2ZR1 B;  2K4A B;  21BI A;  1S0F A;  3AH1 A;  3CRH A;  4OUJ A;  3LLP A;  4KBB A;  2J3P A;  3IIR A;  2HZ9 A;  2NZ9 A;  3HAL A;  3VT2 A;  2NP0 A;  2VXR A;  2ESU A;  3FJA A;  2AXM A;  3FUO A;  1TWE A;  1XYF A;  1WD3 A;  4A7K A;  1JT5 A;  2X2T A;  3UDA A;  4EKX B;  3V79 C;  1ISX A;  5D62 A;  3R4S A;  3VEQ A;  1TTU A;  2DS0 A;  4X38 A;  1FV3 A;  3N7K A;  3BRF A;  4LO1 C;  6I1B A;  5GAQ A;  1IJT A;  1AVW B;  4IY8 A;  4KEI A;  3POK A;  3NBE A;  3A07 A;  4J2Y A;  4I1E A;  2KLL A;  4EFQ A;  1BA7 A;  1S0B A;  3Q7X A;  4EFR A;  4A7Y A;  1EV2 A;  3EF2 A;  8I1B A;  4OWL A;  4GP3 A;  4J23 B;  1BFF A;  3I2A A;  4OWK A;  3VSZ A;  4I4S A;  2IWT B;  1HWP B;  3AKI A;  3MPP G;  4I4U A;  3BAD A;  4GAI A;  2WBC A;  3I2X A;  4QBV A;  3FJD A;  3LTQ A;  3CA1 A;  3FJJ A;  3T8S A;  3N7M A;  2KH2 A;  2MC2 A;  3I29 B;  3BAG A;  3FFZ A;  3BRG C;  3V0B B;  1IRP A;  4XKI A;  1FGA A;  1R8O A;  3AH2 A;  2E4M C;  4IYB A;  1DQG A;  3V0B A;  4QO3 A;  5BQU C;  1OQL B;  4G6J A;  5F8W A;  5FNX A;  1G9A A;  3S8K A;  4D8H A;  1Q03 A;  4GAF A;  2BEA A;  5D63 A;  1Q04 A;  4ZFU B;  4Z9W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...