3H7MA

Crystal structure of a histidine kinase sensor domain with similarity to periplasmic binding proteins
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
228
Chain Sequence
RDRHRTIVVGGDRDYPPYEFIDQNGKPAGYNVELTRAIAEVMGMTVEFRLGAWSEMFSALKSGRVDVLQGISWSEKRARQIDFTPPHTIVYHAIFARRDSPPAAGLEDLRGRKVALHRDGIMHEYLAERGYGKDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENRLTNLVPVARSIAAQRYGYAVRQGDAELLARFSEGLAILRKTGQYEAIRAKWLGVLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Crystal structure of a histidine kinase sensor domain with similarity to periplasmic binding proteins.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
total genus 76
structure length 228
sequence length 228
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h7mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h7mA02
4XKPA 3OENA 4EXKA 2BJJX 2O1LA 3BFUA 3SEXA 2H98A 3OO8A 2XX8A 1MRPA 3HCQA 1MXZA 2X7PA 1XHYA 1IITA 3FVKA 1SI1A 4BDLA 3K02A 1SW1A 2D3IA 4XKNA 5H8QA 2R6GE 3RNNA 2Z23A 4NWCA 4C1TA 3R26A 4AQ4A 4EF2A 4Q0CA 2I49A 3LC8A 4H8JA 3MZBA 3H3GA 1B3FA 4EQ9A 3KGCA 2A5SA 3Q27A 2B3BA 3VE1B 1OLAA 4ZZAA 2F7BA 2QJEA 4G8MA 2I4CA 4P11A 1ZTYA 4R72A 1MS7A 2AL5A 1S50A 2DVCA 4LUBA 3IO4A 4ZE8A 1LFIA 1VFEA 3DP6A 4G77A 4TQUQ 1MXYA 3KSXA 4JWXA 3OSQA 4R6HA 4F39A 1WODA 4G68A 2QRYA 5KCJA 3RTFB 4UA8A 3W9WA 3WAEA 4MBPA 1LCFA 1FTJA 2IA4A 5K2YA 2H99A 4G8HA 3T22A 1PB8A 4BDMA 1USYH 3M8UA 2Q9TA 5ELVA 3RN8A 3S9MC 2F34A 3OXNA 5K2XA 1MY4A 2XXWA 4I8CA 3S2VA 4HCWA 3T96B 4XKQA 2YPNA 1Q1KA 1LSTA 4I62A 4MH5A 3MPLA 5CI5A 4R9FA 2ZNUA 4GD5A 1B3GA 3MQ9A 1UTBA 3GBAA 1JQFA 3MPKA 1OIBA 1DSNA 2F36A 3MJNA 2PMSA 4POWA 3N6TA 3GZGA 4GVOA 5IKBA 1LB8A 4YKJA 2NXOA 3BFTA 4KCCA 1EZPA 3HN0A 4OQOA 1UIVA 2OBGA 3CFZA 5HPQA 2NOOA 5AA4A 1AOVA 4GLIA 4XKRA 3U72A 1B7HA 1MXVA 3PGFA 4YB6A 3A09A 5KDTB 1L5TA 2B65A 5H8FB 4XIGQ 3RPWA 3VLUA 2PYYA 1POY1 3P7IA 1EH3A 1B5HA 3SEWA 1IXIA 1LAXA 3ZKKA 4OHNA 4E0XA 2I3VA 4TLLB 2VD2A 1B52A 3QAXA 2HZLA 3TCFA 4WEDA 1B3LA 2O69A 1GVCA 2DQVA 1IXHA 1ZBMA 2XXUA 1WVJA 1IQ7A 3B6TA 3OD7A 5I2KA 2GHBA 2DXYA 5TPAA 3KZGA 1EZOA 2V93A 2F7CA 3PU5A 2RC7A 1FQEA 1P1NA 1ZLQA 2DE3A 4PQJA 2I0BA 3H6VA 1N3WA 2Q89A 4ZE9A 4IGTA 5A5XB 3U93A 4N13A 1XVYA 1A7LA 4YICA 3O66A 4DXCA 4THIA 3SEVA 3O28A 1A54A 2OWTA 4Z0IA 3GLBA 5H8NB 4LZ5A 2F35A 4OERA 3TUSA 5ISUA 1B05A 3DELB 2OWSA 1MXXA 3BKIB 3ZKLA 3C31A 4OETA 1UIUA 2DSFA 1OVTA 5ICQA 4ONYA 4IY6A 4OESA 3PUWE 3PD8A 4ZECA 4ISUA 3IB2A 5F7VA 1QJMA 4JWYA 4RK2A 3PPNA 2ABHA 3CFXA 3RLFE 3PD9A 4IO5A 4H0WA 1Y20A 4IO6A 1SD3A 2VGQA 5AA2B 5EHMA 3OELA 1ZKBA 4RY1A 2OJTA 2OLBA 3FJ7A 5L9SA 5I2NB 1TXFA 2P0SA 2VOZA 1QULA 1D4NA 3T66A 2AL4A 4RK9A 3TODA 1FTLA 3MP6A 3E4RA 4KPTA 4XXUA 1S7YA 4OVJA 1UQWA 1R9LA 4RPOA 3OMBA 1ZMGA 1KWHA 5I57A 1MM6A 2REGA 1A99A 2H5YA 3VXBA 4F31B 4LONB 2QPQA 4POXA 4LA9A 3PPOA 4F2OA 2XD2A 1CB6A 5ITPA 3C9HA 3MVZA 2I58A 3CR9A 3IX1A 3TCHA 4GRKA 4FORA 5DEXA 1M5BA 4Z7EA 3W9VA 4P0IA 4OYVA 5TP9B 2QMXA 4H5GA 4IO7A 3HHFA 2O51A 3ODBA 4OZ9A 3FXUA 1I6QA 4F3GA 1T0KA 5I59B 5JTYA 2E1SA 5DVFA 4YKKA 3C34A 1P1WA 1Y9UA 3PV0E 2Y7IA 4BDQA 1ZJLA 2ANJA 4H8IA 2I48A 4OTEA 1AMFA 2Z8DA 1PEBA 3OEMA 4OEUA 4ESXA 4QF9A 2NWJA 1QKAA 3I3VA 3T9HB 4M4GA 1XS5A 2ZNTA 2CZLA 1H43A 1H76A 2XXQA 4R75A 4QRZA 3O97A 1B4ZA 5BUUA 3VVFA 1M5DA 4QFNA 4F29A 5B70A 2KLFA 3N94A 3VVDA 5ITOA 4OFJA 3V8XB 3CI8A 1IIWA 4X48A 4JBZA 1ELJA 3RQTA 3LR1A 4DCXA 5FHOA 3T93B 3HSTA 1N7WA 4QFPA 1B9JA 3TDJA 3CRBA 1PDAA 3IOVA 1FTMA 1B4HA 1VFDA 1USYE 1NFTA 3PMXA 3C35A 4DCYA 4LQ5A 2X26A 1SVXB 3UN6A 4LZ7A 3UORA 3KBRA 4WKMA 4RXLA 4YB5A 3K1PA 1N3XA 3I6VA 3HV1A 3K2DA 1B40A 3OO9A 2RF1A 3CFLA 3Q26A 4GIZA 2RINA 2Z8EA 4ZEBA 2Z22A 3A3CA 3G3HA 3FZVA 5L9OA 3IR1A 3SKPA 1N84A 3CG3A 1Y3QA 1NL5A 2ZXTA 4DDDA 4OXVA 1D9YA 4OWDA 4BDOA 1PBPA 4NF5B 3TMGA 3L6HA 5J1DA 5CC2A 1FQBA 2GRVA 3VV5A 3C36A 3PMVA 1BP5A 4WEPA 2NUVA 2QS3A 4FE8A 1AL3A 2IEEA 1MY1A 2DYXA 1URSA 3EN3A 1MDP1 1R9QA 3O29A 5IAIA 3QIMA 2XX9A 3G3IA 2PX1A 1SW4A 1IZ1A 4ZEDA 1VR5A 2HXWA 4Q8RA 2HEUA 3IORA 5JEIA 2P2AA 2UXAA 2A5TB 5CMCA 3O6HA 1PB7A 2DP8A 2DVZA 2DWJA 1P1OA 3PUYE 4FATA 4YKIA 3T9UA 2Q88A 2XXIA 1MH3A 1SW5A 4F22A 4ELPA 1SW2A 2QSXA 1WDNA 2H25A 5DTBA 2HCAA 1NNTA 2O6AA 3OEKA 2THIA 4IO4A 5L9MA 4LQ2A 1AIVA 3FVNA 1NNFA 1H3DA 1NH8A 1FQCA 2FYIA 5FHNA 3C33A 3PUVE 4IY5A 1HSEA 4LVQA 1IEJA 4KD5A 1ZU0A 2QL3A 3LBSA 1Y3PA 1Q35A 3H03A 4OENA 1H44A 5CMBA 1Z7NE 5F1QA 2F97A 4KFQA 1OQGA 1TFAA 1FQAA 1LBBA 1M5CA 3TEPA 2DWIA 5KDTA 1B32A 5H8FA 3FATA 1RYXA 2GHAA 2X7QA 3DP4A 2ZNSA 1B7ZA 4GL8A 4ELRA 4NWDA 4R74A 1EZ9A 3LSXA 3TTRA 3LUYA 3U1OA 3QYTA 3RY3A 2QS4A 4GFRA 4M1VA 3RTWB 4X9TA 1BLFA 3OSRA 3FD3A 1A8FA 3G7WA 1XOCA 4F19A 1OQHA 4X1BA 1P1QA 1TFDA 4YMAA 2ZYOA 3MVXA 4I1DA 3ONMA 1LB9A 4EQBA 2XXVA 1DTGA 5AA3A 4BLAA 4Q5TA 1O7TA 1XC1A 1DPEA 3H4ZA 3TTLA 3W15C 1FW0A 4N07A 2O7IA 3SEYA 5A5XA 3GBBA 2V3QA 2RCAA 5CMMA 1B58A 3T9XB 4YAHX 4EDPA 5CMKA 4NF4A 1ZIUA 1POTA 1MM7A 4ECFA 3USDA 3E9XA 3L6GA 1M5FA 4JDFA 5I84A 1TWYA 5H8NA 2HQ0A 4HW8A 4ZZEA 5H8HB 3MVWA 3AXFA 5B7DA 5I56A 4ZEKA 5DVJA 1BIYA 2D5WA 1SDXA 4O3BA 1MPBA 3KN8A 1F9BA 1YPNA 3JYRA 1B51A 2I0CA 5AA2A 3O6IA 4ZS9A 2Z8FA 3SDFA 1SI0A 2OK2A 4ZDMA 4G68C 4HS7A 4H65A 4F3SA 3JZJA 1NMUA 2M8CA 5I2NA 3ZSFA 1D3KA 4R6KA 3EHUA 3PPPA 4BDRA 1A40A 3ECRA 4NF6B 4ESWA 4FECA 1Z7ME 3E3KA 4YMBA 3R6UA 2XXTA 3TYHA 5HM4B 3MP8A 1MY3A 3EHSA 1FTOA 3B6WA 2VD3A 1B5JA 3HO7A 3S9LC 2PT1A 1US4A 4I9DA 4F1UA 3RGYA 2DE4A 4GXSB 4R2BA 3K6VA 4EXLA 2ALUA 4NF8B 3S9NC 1DOTA 3FV2A 5I58B 3U92A 1II5A 1URGA 2F6PA 2F6GA 1US5A 3G3KA 1SQYA 3LSLA 2HZKA 4R2FA 2Y7RA 3TFLA 3S4UA 1B46A 3TQWA 5TP9A 3O2AA 1OLCA 5M2VA 1QW0A 3M3LA 2Y7WA 4U22A 3CIJA 3G3JA 4FIMA 5I59A 4NE4A 5HBCA 1JVXA 3O9PA 2DOJA 3TTKA 1DPPA 3LSWA 2VHAA 3RT8A 2RCBA 3PPRA 4FAJA 3KOTA 2OCUA 3U94A 1B5IA 4ELQA 3N26A 2XXYA 1PC3A 4KHZE 3TTNA 2UVHA 3KN7A 5FTHA 1B1XA 4GL0A 1B1HA 4F3PA 3LSFB 1ATGA 4PFUA 2FNCA 2ZYKA 3THIA 4U4SA 4JB7A 2O84X 4G2ZA 2Y7KA 3MVYA 4H5FA 1UTHB 5BWJA 5FHMA 1LLSA 4EF1A 3SETA 4IB2A 3PMWA 4U23A 3UK4A 3D4CA 1Y1MA 2XD3A 2XX7A 1GTKA 2VP1A 1R1NA 2B3FA 4LP2B 1QUIA 2AYSA 1MY0A 2PT2A 1FQDA 4KR5A 4QFOA 2O7UA 3H6UA 3FV1A 1LAHE 3E13X 3I5OA 3MAMA 4GXAA 1I6AA 4PFYA 3K6WA 1O64A 3IOUA 1HSJA 4U4XA 3IK6B 2H9BA 1LAGE 3IAZA 5CRYA 3TPAA 4YZZA 5EHSA 1P1UA 1S9TA 1QUKA 3K1MA 1LCTA 1M5EA 4PP0A 3G3FA 2OZZA 2ONSA 2AIXA 1NKXA 4L17A 1CE2A 4YKPA 4FEDA 1XT8A 5AA1A 4N6PA 3V5AA 1BTJA 1IXCA 3Q29A 3U8QA 4GOTA 4QSEA 3OO7A 2HAUA 1N76A 5DVIA 4P0GA 3EHTA 1JNFA 3H6WA 1B7UA 2F5XA 3H7MA 1DMBA 2HFBA 4NF5A 5H8QB 1MPDA 2V3TA 4OFLA 4OEVA 1FTKA 3FVOA 2DXRA 3M3FA 4RYAA 4C1UA 1J1NA 3QXMA 3KJ7A 2RC8A 4R73A 4WXJA 4O3CA 4PE5B 4DIGA 2DE2A 1B3EA 3A3UA 1IXGA 2RC9A 4H6DA 3FIRA 1ANFA 3CVGA 3HHGA 4F1VA 3SEUA 2DS9A 4IO2A 1FQFA 3VFJA 4KYDA 4NEDA 3C4MA 3H6TA 4F18A 1PBQA 1GR2A 1I6BA 4R9GA 2DWHA 2O1MA 5TU0A 3K00A 2A5TA 3TQLA 4GF8A 3WAFA 1LAFE 4OMBA 5AA2D 2I3WA 4H1XA 1AH5A 4G68B 5KCJB 4FJPA 2GFEA 3PUZE 4O3AA 4MLVA 4MLQA 2QS1A 4G8NA 4NMYA 3IO6A 1B0LA 1N7XA 2XHDA 3MC2A 1Y4CA 2ZYMA 5FTIA 4F2QA 3Q25A 4KYEA 4JSDA 3HPIA 4EQ7A 3PUXE 4AB6A 3IOWA 4H67A 4ZEFA 1MQDA 1SBPA 3VLVA 2Q2AA 4TLMB 5ICTA 2DWAA 4EUOA 1UTBB 2UVGA 1Y1ZA 2XXHA 2XXXA 1YAEA 3B7DA 4GWOA 5CM6A 4G4PA 2I4BA 1PB9A 4KI0E 3IB1A 5CBRA 3MWBA 4QFLA 3K0VA 4ZEIA 1TT1A 2UYFA 1JVYA 3N5LA 3K4UA 3KOSA 5CBSA 1H45A 1GV8A 2V3UA 3EPEA 1SYHA 5AA4B 3TKDA 1QUJA 3K1NA 3FJGA 2ONRA 2G29A 1LFGA 1QVSA 1MQIA 4TOZA 3EQ1A 3FVGA 2GH9A 2ESNA 1O63A 4U21A 3UP9A 2UVIA 2PVUA 3FUZA 4YU0A 4LZ8A 1MQJA 3EF7A 4HTGA 1MQHA 4PFTA 3MP1A 4KCDA 5LOMA 2F8DA 2V25A 3UA8A 2Q8JA 4X1DA 1RKMA 1D9VA 5H8SA 3KFMA 3SERA 5I2KB 1YTVA 4JSOA 1LGBC 3C32A 4F3BA 2Y84A 4DXBA 3DM0A 5TPAB 2QMWA 5H8HA 1IUDA 1QKBA 3MZ9A 3O6GA 4DZ1A 1N04A 2QS2A 4QSDA 1P99A 3F11A 1N0TA 1DTZA 2D21A 4YB7A 3UIFA 3V89B 1JEVA 5KZTA 4RJZA 4NF4B 1NNPA 3CSGA 4UACA 4C0RA 1Y3NA 4JWOA 3FJMA 3N6UA 2ZMBA 1NNKA 4AB5A 2ONKE 1URDA 1VSOA 4PFWA 1B2HA 1MQGA 3K6XA 1EU8A 1B0HA 1R6ZA 4NF6A 5I56B 3CSBA 1MH4A 3IJOB 2WKYA 2I6EA 3GXAA 1B6HA 3MBPA 1Y4TA 3ILUB 5DYHA 4MF3A 4F1YA 2REJA 1YCJA 4DE8A 4OFOA 3H06B 3MW0A 5AE4A 1BKAA 4ND9A 4NF8A 5I58A 3VLWA 3RUMA 2NVUB 3B6QA 4IO3A 3MUQA 3TTMA 3KSJA 1I69A 3T9VA 3IJXB 1JW5A 4FEBA 2ZYNA 3TAJA 3FGSA 4RNSA 1MG1A 3G3GA 3TCGA 3KEIA 3TZAA 3R7XA 3FASA 3SESA 2Q2CA 3DLNA 2XXPA 5I57B 4GQOA 4LATA 1JETA 3ILTB 4QFKA 4R6YA 3VXCA 2R71A 4NTLA 2UVJA 4QSCA 3D4GA 2YLNA 1XVXA 2O68A 3OOAA 5DEXB 2G93A 1FCKA 3OO6A 3BBRA 4DLDA 1A8EA 4Q30B 3Q28A 1SYIA 5EYFA 2RKMA 4K3FA 4BDNA 3IB0A 1RYOA 4RPNA 3M3KA 1LBCA 3KG2A 5JTYB 1MY2A 2W7YA 1MXUA 2F78A 3CG1A 2H4IA 4IGRA 2F7AA 3V83A 4U2RA 1NH7A 1UTHA 3S9EA 2R9JA 3JV9A 3K6UA 2HAVA 4U1ZA 2FA7A 1MDQA 3UGWA 2Y7PA 2E0SA 3IL1B 1HSLA 4KQPA 4KYSA 3IOTA 3KN3A 1OVBA 3K01A 3QUFA 3QSLA 4RA1A 3TELA 4DXUA 2CMOA 3FXQA 4ELOA 3MZ1A 1JW4A 4MFIA 1LFHA 3RT6B 3VDFA 4PETA 1JEUA 4JXIA 4E0WA 2YJPA 2P1SA 4HCYA 1MPCA 3VVEA 2XXRA 3DP8A 2V84A 5L8DA 1GGGA 1MXWA 1OMPA 3FXRA 3QUJA 1VE4A 5JK4A 1B3HA 3QK6A 2PBWA 4U1OA 1JW1A 2UYEA 1A55A 5DT6A 4QHQA 3ZS6A 2LAOA 4XTCQ 3PPQA 3KJTA
chains in the Genus database with same CATH superfamily
1KZ8A 4XKPA 3OENA 4O8MA 1YZ0A 4EXKA 2BJJX 2O1LA 1FBPA 3BFUA 3SEXA 2H98A 3OO8A 2XX8A 1MRPA 3HCQA 1MXZA 2X7PA 1XHYA 1IITA 3FVKA 1SI1A 4BDLA 3K02A 2L5VA 1SW1A 2CZIA 4DI4B 2D3IA 2OX3A 4XKNA 5H8QA 2R6GE 3RNNA 2Z23A 4NWCA 4C1TA 3R26A 4AQ4A 4EF2A 4Q0CA 2I49A 3LC8A 2B4LA 4H8JA 3MZBA 5I3SA 2WYPA 3H3GA 1B3FA 4EQ9A 3KGCA 2A5SA 3Q27A 1Q9DA 2B3BA 3VE1B 1OLAA 4ZZAA 2F7BA 1FPFA 2QJEA 4G8MA 2I4CA 4P11A 1ZTYA 4PGPA 1MS7A 2AL5A 2WX9A 1S50A 4R72A 4UABA 4AS5A 4NGUA 2DVCA 4HE1A 4LUBA 3GYYA 1LBVA 3IO4A 4JVDA 4ZE8A 1LFIA 1VFEA 3DP6A 4GWUA 4TQUQ 4G77A 1MXYA 3KSXA 5EYGA 4JWXA 3OSQA 4R6HA 4F39A 1WODA 4G68A 2QRYA 5KCJA 4KXPA 3RTFB 4UA8A 3W9WA 3WAEA 4MBPA 1LCFA 1FTJA 2WBDA 2IA4A 5K2YA 4I40A 2H99A 4G8HA 3T22A 2PFZA 1FSAA 1PB8A 4BDMA 1USYH 3M8UA 2Q9TA 5ELVA 3RN8A 3S9MC 2F34A 3OXNA 5K2XA 1MY4A 2XXWA 4I8CA 3S2VA 4HCWA 5IM2A 4O7IA 3T96B 3RPLA 4XKQA 4H45A 2YPNA 1Q1KA 2R8TA 1LSTA 4I62A 4MH5A 3MPLA 5CI5A 4R9FA 2ZNUA 4GD5A 1B3GA 3MQ9A 1UTBA 3GBAA 1EYKA 1JQFA 2JJKA 3MPKA 1OIBA 1DSNA 2F36A 3MJNA 2XA5A 2PMSA 5ET8A 4POWA 3N6TA 2Y5LA 3GZGA 4GVOA 5IKBA 1LB8A 4MJOA 2PCRA 2CEXA 5EQ8A 4YKJA 2NXOA 4NX1A 3BFTA 4GWSA 4KCCA 1EZPA 3HN0A 4HE0A 4OQOA 1UIVA 2OBGA 3CFZA 5HPQA 2NOOA 5AA4A 1AOVA 4GLIA 4XKRA 3U72A 1B7HA 1MXVA 3PGFA 4YB6A 3A09A 3LV0A 1NV2A 5KDTB 3QMFA 4P47A 1IMBA 1L5TA 2B65A 5H8FB 4XIGQ 3RPWA 3VLUA 2PYYA 1VDWA 1POY1 3P7IA 4GWWA 1EH3A 1B5HA 4GBWA 3SEWA 3IFCA 1IXIA 1LAXA 3ZKKA 4OHNA 4E0XA 2I3VA 4TLLB 2VD2A 1B52A 3QAXA 2HZLA 3TCFA 4WEDA 1B3LA 2O69A 1GVCA 2DQVA 1IXHA 1ZBMA 2XXUA 1WVJA 1IQ7A 3B6TA 3OD7A 5I2KA 3T1BA 2GHBA 2DXYA 5TPAA 3KZGA 1FPKA 1EZOA 3NOHA 2V93A 3BIGA 2F7CA 3PU5A 2RC7A 1FQEA 1P1NA 1ZLQA 2DE3A 4PQJA 2I0BA 3H6VA 1N3WA 2Q89A 4ZE9A 4GWZA 4IGTA 5A5XB 3U93A 4N13A 1XVYA 1A7LA 4YICA 4PAFA 3O66A 4DXCA 4THIA 3SEVA 3O28A 1A54A 2OWTA 4Z0IA 3GLBA 5H8NB 3EKIA 4LZ5A 2F35A 4OERA 3TUSA 5ISUA 1B05A 3DELB 2OWSA 2Q8MA 1MXXA 3BKIB 3ZKLA 3C31A 4OETA 1UIUA 2DSFA 1OVTA 3D1RA 5ICQA 4ONYA 1FBHA 5IZ1A 2HPGA 4IY6A 4OESA 3PUWE 3PD8A 4ZECA 4ISUA 3IB2A 5F7VA 1QJMA 4JWYA 4RK2A 3PPNA 2ABHA 3CFXA 3RLFE 3PD9A 4IO5A 2GQ1A 4H0WA 1Y20A 4IO6A 1SD3A 2VGQA 5AA2B 1FJ6A 1DCUA 5EHMA 3OELA 1ZKBA 4RY1A 4N17A 2OJTA 2OLBA 3FJ7A 5L9SA 5I2NB 1TXFA 2P0SA 2VOZA 1QULA 1D4NA 3T66A 2AL4A 4PF8A 4RK9A 3TODA 1SPIA 1FTLA 3MP6A 3E4RA 4KPTA 4XXUA 1S7YA 4OVJA 1UQWA 1R9LA 5I5PA 4RPOA 3OMBA 1ZMGA 1KWHA 2XWOA 5I57A 1MM6A 2REGA 1A99A 4N15A 2H5YA 3VXBA 4F31B 4LONB 2CZHA 2QPQA 4P56A 4POXA 1NV0A 5ET7A 4LA9A 3PPOA 4F2OA 1LBYA 2XD2A 1CB6A 5ITPA 3C9HA 3MVZA 2I58A 3CR9A 3IX1A 3TCHA 4GRKA 4FORA 5DEXA 5EQ7A 1M5BA 3IFAA 4Z7EA 3W9VA 4P0IA 4OYVA 5TP9B 4LN5A 2QMXA 5IZ3B 4H5GA 4IO7A 4OVSA 3HHFA 2O51A 3ODBA 4OZ9A 3FXUA 1I6QA 4F3GA 1T0KA 5I59B 5JTYA 2BJIA 2E1SA 5DVFA 4YKKA 3C34A 1P1WA 1Y9UA 3PV0E 2Y7IA 4BDQA 1ZJLA 4X04A 2ANJA 4H8IA 2I48A 4OTEA 1AMFA 2Z8DA 4QBAA 1PEBA 3OEMA 4OEUA 4ESXA 4JVIA 4QF9A 2NWJA 1QKAA 3I3VA 3T9HB 4M4GA 1XS5A 2ZNTA 2CZLA 2WBBA 1H43A 2QFLA 1H76A 2MKZA 2XXQA 4GWYA 1NV1A 4R75A 4QRZA 3SZPA 3O97A 1B4ZA 5BUUA 3VVFA 4NF0A 1M5DA 3E78A 4QFNA 4F29A 5B70A 2KLFA 3N94A 3VVDA 5ITOA 4OFJA 3V8XB 3CI8A 1IIWA 4X48A 4JBZA 4N91A 1IMCA 1ELJA 3RQTA 4MNIA 3LR1A 1DBZA 4DCXA 5FHOA 3T93B 3HSTA 1N7WA 4QFPA 4O7MA 1B9JA 3TDJA 3CRBA 1PDAA 3IOVA 1FTMA 1NUXA 1B4HA 2KQZA 1VFDA 1USYE 1NFTA 3PMXA 3C35A 4DCYA 4LQ5A 2X26A 1SVXB 3UN6A 1FPBA 4LZ7A 3UORA 4PDHA 3KBRA 4WKMA 4RXLA 4I3YA 4YB5A 3K1PA 1N3XA 1NV5A 1KA0A 3I6VA 3HV1A 3K2DA 1B40A 3OO9A 2RF1A 3CFLA 3Q26A 4GIZA 2RINA 4GWXA 2Z8EA 4ZEBA 2Z22A 1LEVA 3A3CA 2F3DA 3G3HA 3FZVA 4MMPA 5L9OA 3IR1A 3SKPA 1CNQA 1N84A 3CG3A 1Y3QA 1NL5A 2ZXTA 4DDDA 4OXVA 1D9YA 4OWDA 4BDOA 1PBPA 4NF5B 3B8BA 3TMGA 4PE3A 3L6HA 5J1DA 1G0IA 5CC2A 2ZZVA 1FQBA 2GRVA 3VV5A 3C36A 3PMVA 1NV3A 1BP5A 4WEPA 2NUVA 2QS3A 4FE8A 1AL3A 2IEEA 1MY1A 2DYXA 1URSA 3EN3A 1MDP1 1R9QA 3O29A 5IAIA 1JP4A 4G61A 3QIMA 2XX9A 3G3IA 2B4MA 2PX1A 1SW4A 1IZ1A 4ZEDA 1VR5A 5IGAA 2HXWA 4Q8RA 2HEUA 3IORA 5JEIA 2P2AA 2UXAA 2A5TB 5CMCA 1FPEA 3O6HA 1PB7A 2DP8A 2DVZA 2DWJA 2ZZXA 1RDXA 1P1OA 3PUYE 4FATA 4YKIA 4OVRA 3T9UA 2Q88A 2XXIA 1MH3A 1SW5A 4F22A 4ELPA 1SW2A 2QSXA 1WDNA 2H25A 5DTBA 1NUYA 2HCAA 1NNTA 2O6AA 3OEKA 2THIA 4IO4A 5L9MA 4LQ2A 1AIVA 3FVNA 1NNFA 1H3DA 2Y5KA 1NH8A 2WEFA 1FQCA 2FYIA 5FHNA 3C33A 3ROJA 3PUVE 4IY5A 1HSEA 2OWZA 4LVQA 4MCOA 1IEJA 5ET5A 4KD5A 1FBEA 1ZU0A 2QL3A 3LBSA 1Y3PA 1Q35A 3H03A 4OENA 1H44A 1NV7A 5CMBA 1Z7NE 5F1QA 2F97A 4KFQA 1OQGA 1TFAA 5T3JA 1FQAA 1LBBA 1M5CA 3TEPA 2DWIA 5KDTA 1B32A 5H8FA 3FATA 1RYXA 2GHAA 2X7QA 3DP4A 2ZNSA 1B7ZA 4GL8A 4ELRA 4NWDA 4R74A 1EZ9A 3LSXA 3TTRA 3LUYA 3U1OA 3QYTA 3RY3A 2QS4A 4GFRA 4M1VA 3RTWB 4X9TA 4PFRA 1BLFA 3OSRA 3ISPA 3FD3A 1A8FA 3G7WA 1XOCA 4F19A 1OQHA 4P3LA 4X1BA 1P1QA 1TFDA 4YMAA 2ZYOA 3MVXA 4I1DA 3ONMA 1IMEA 1LB9A 4EQBA 2XWKA 2XXVA 1DTGA 5AA3A 5EQ9A 4BLAA 4Q5TA 1O7TA 1XC1A 1DPEA 2PFYA 3H4ZA 3TTLA 3W15C 1FW0A 4N07A 2O7IA 3SEYA 5A5XA 4N6KA 3GBBA 2V3QA 2RCAA 5CMMA 1B58A 3T9XB 4YAHX 4EDPA 5CMKA 4NF4A 1ZIUA 1POTA 1MM7A 4ECFA 3USDA 3E9XA 3L6GA 4PAIA 1IMAA 1M5FA 2QVVA 4JDFA 5I84A 1TWYA 4HE2A 5A5LA 5H8NA 4I3EA 1FPIA 2HQ0A 4NHBA 4HW8A 4ZZEA 5H8HB 3MVWA 3AXFA 5B7DA 4GX6A 2HXRA 1NUWA 5I56A 4ZEKA 5DVJA 4N6DA 1BIYA 2D5WA 1SDXA 4O3BA 1MPBA 3KN8A 1F9BA 1YPNA 3JYRA 1B51A 2I0CA 1EYIA 5AA2A 3O6IA 4ZS9A 2Z8FA 3SDFA 1SI0A 2OK2A 4ZDMA 4G68C 4HS7A 4H65A 4F3SA 2FBPA 3JZJA 1NMUA 2M8CA 4FBPA 5I2NA 3ZSFA 1D3KA 4R6KA 3EHUA 3PPPA 4BDRA 5ET6A 1A40A 3ECRA 4NF6B 4ESWA 4FECA 2Q74A 1Z7ME 3E3KA 2VPOA 4YMBA 3R6UA 4X8RA 2XXTA 3LUZA 4XF5A 3TYHA 5HM4B 3MP8A 1MY3A 3EHSA 1FTOA 3B6WA 2VD3A 1B5JA 3HO7A 3S9LC 2PT1A 1US4A 4PGNA 4I9DA 4F1UA 3RGYA 2DE4A 4GXSB 4R2BA 3K6VA 4EXLA 2ALUA 4NF8B 3S9NC 1DOTA 3FV2A 5I58B 3E79A 3U92A 1II5A 1URGA 2F6PA 2F6GA 1US5A 3G3KA 1SQYA 3LSLA 2HZKA 4R2FA 4MIJA 2Y7RA 3TFLA 3S4UA 1B46A 3TQWA 5TP9A 5IZ3A 3O2AA 1OLCA 5M2VA 1QW0A 3M3LA 2Y7WA 4U22A 3CIJA 3G3JA 4FIMA 5I59A 4NE4A 5HBCA 1JVXA 3O9PA 2DOJA 3TTKA 1DPPA 3LSWA 2VHAA 4XEQA 5EYHA 3RT8A 2RCBA 3PPRA 4FAJA 3KOTA 2OCUA 3U94A 1B5IA 4ELQA 3N26A 2XXKA 2XXYA 1PC3A 4KHZE 3TTNA 2FVZA 2UVHA 3U65A 3KN7A 5FTHA 1B1XA 4GL0A 1B1HA 4F3PA 3LSFB 1ATGA 4PFUA 2FNCA 2ZYKA 3THIA 4U4SA 4JB7A 2O84X 4G2ZA 2Y7KA 3MVYA 4H5FA 1YYZA 1UTHB 4PTKA 5BWJA 5ESYA 5FHMA 1LLSA 4EF1A 3SETA 4IB2A 3PMWA 4U23A 3UK4A 5I7IA 5LTCA 3D4CA 1Y1MA 1LBWA 2XD3A 2XX7A 4O94A 1GTKA 4QXDA 2VP1A 1R1NA 2B3FA 4LP2B 2DDKA 4OVTA 1QUIA 2AYSA 1MY0A 2PT2A 1FQDA 4KR5A 4QFOA 2O7UA 3H6UA 3FV1A 1NI9A 1LAHE 1BK4A 3E13X 3I5OA 3MAMA 4JVCA 4GXAA 1I6AA 4PFYA 3K6WA 1O64A 4GX4A 3IOUA 1HSJA 3FXBA 4U4XA 3IK6B 5F24A 2H9BA 1LAGE 3IAZA 5CRYA 3TPAA 4YZZA 5EHSA 1P1UA 1S9TA 1QUKA 3K1MA 1K9ZA 4MX6A 1LCTA 1M5EA 4H46A 4PP0A 3G3FA 1FBDA 2OZZA 2ONSA 2AIXA 1IMFA 1NKXA 4L17A 1CE2A 4YKPA 4FEDA 2KR0A 1XT8A 1QGXA 5AA1A 4N6PA 3V5AA 1BTJA 3KBZA 1IXCA 3Q29A 3U8QA 4GOTA 4QSEA 3OO7A 2HAUA 4NAPA 1N76A 5DVIA 3T0JA 4MNPA 4P0GA 3EHTA 3MYUA 1JNFA 3H6WA 1B7UA 2F5XA 3H7MA 4PFBA 1DMBA 2HFBA 4MHFA 4NF5A 1MPDA 5H8QB 2CZKA 2V3TA 4OFLA 4OEVA 4PCDA 3A29A 1YXIA 1LBZA 1FTKA 3FVOA 2DXRA 3M3FA 4RYAA 4C1UA 4GBVA 1J1NA 4HXVA 1IMDA 2ZZWA 3QXMA 3KJ7A 2RC8A 4R73A 4WXJA 4O3CA 4PE5B 4N81A 4DIGA 2DE2A 1B3EA 3A3UA 1IXGA 2RC9A 4P9KA 4H6DA 3FIRA 1ANFA 4PFIA 3CVGA 3HHGA 1FRPA 4F1VA 3SEUA 2DS9A 4IO2A 1FQFA 3VFJA 4KYDA 4NEDA 3C4MA 3H6TA 4F18A 1PBQA 1GR2A 1I6BA 1RDYA 4R9GA 2DWHA 2O1MA 5TU0A 3K00A 2A5TA 3TQLA 4GF8A 4NQ8A 3WAFA 1LAFE 4OMBA 5AA2D 2I3WA 4H1XA 1AH5A 4G68B 5KCJB 1FPLA 4FJPA 1FBFA 2GFEA 3PUZE 4O3AA 4MLVA 4MLQA 2QS1A 4G8NA 2P3VA 4NMYA 3IO6A 4N8GA 1B0LA 1N7XA 2XHDA 3MC2A 1Y4CA 2ZYMA 5J16A 5FTIA 4F2QA 3Q25A 4KYEA 4JSDA 3HPIA 4EQ7A 3PUXE 4AB6A 3IOWA 4H67A 4ZEFA 1MQDA 3RPLB 1SBPA 3VLVA 2Q2AA 4TLMB 5ICTA 2DWAA 4EUOA 1UTBB 2UVGA 1Y1ZA 4PAKA 2XXHA 2XXXA 1YAEA 3B7DA 4GWOA 5CM6A 4G4PA 2I4BA 4OA4A 4P1LA 1PB9A 4KI0E 3IB1A 5CBRA 3MWBA 4QFLA 3K0VA 2QVRA 4ZEIA 1TT1A 2UYFA 1JVYA 3N5LA 4PBHA 3K4UA 3KOSA 5CBSA 1H45A 1GV8A 2V3UA 1LBXA 4GX3A 3EPEA 1SYHA 5AA4B 3TKDA 1QUJA 3K1NA 3FJGA 2ONRA 1FTAA 3MSTA 2G29A 1LFGA 1QVSA 1MQIA 5IZZA 4TOZA 3CHGA 3EQ1A 3FVGA 2GH9A 2ESNA 1O63A 4U21A 3UP9A 2UVIA 2PVUA 3FUZA 4YU0A 4LZ8A 3KC0A 1MQJA 2FHYA 3EF7A 4OVQA 4HTGA 1MQHA 4PFTA 3MP1A 4KCDA 5LOMA 2F8DA 2V25A 3UA8A 2Q8JA 4X1DA 1RKMA 1D9VA 5H8SA 3KFMA 3SERA 5I2KB 1YTVA 4JSOA 1LGBC 3C32A 4F3BA 2Y84A 2V4CA 4DXBA 3DM0A 5TPAB 3BIHA 2QMWA 5H8HA 1IUDA 1QKBA 3MZ9A 3O6GA 4DZ1A 1N04A 2QS2A 1FPGA 1NV6A 4QSDA 1KA1A 2QVUA 1P99A 4N4UA 3F11A 1N0TA 1DTZA 2D21A 4YB7A 3UIFA 3V89B 1JEVA 5KZTA 4RJZA 4NF4B 1NNPA 3CSGA 4UACA 4C0RA 4PF6A 4AS4A 4N8YA 4MNCA 1Y3NA 1FPDA 4JWOA 3FJMA 3N6UA 2ZMBA 1NNKA 4AB5A 2ONKE 1DK4A 1URDA 2FIEA 1VSOA 4PFWA 1B2HA 1MQGA 3K6XA 2P3NA 1EU8A 1B0HA 1R6ZA 4NF6A 5I56B 3CSBA 1MH4A 3IJOB 2FIXA 4OVPA 2WKYA 2I6EA 1INPA 3GXAA 1B6HA 1XI6A 3MBPA 1Y4TA 3ILUB 5DYHA 4MF3A 4F1YA 2REJA 1YCJA 4DE8A 1EYJA 4OFOA 5DW8A 3H06B 3MW0A 4PDDA 2VT5A 5AE4A 1BKAA 4ND9A 2VPNA 4NF8A 5I58A 4OANA 3VLWA 2XWVA 3RUMA 2NVUB 3B6QA 4IO3A 3MUQA 3TTMA 3KSJA 4PC9A 1I69A 3T9VA 3IJXB 3HFUA 1JW5A 4FEBA 1FPJA 2ZYNA 3TAJA 3FGSA 4RNSA 1MG1A 3G3GA 3TCGA 3KEIA 3TZAA 3R7XA 3FASA 1RDZA 3SESA 2Q2CA 3DLNA 2XXPA 5I57B 1AWBA 4GQOA 4LATA 1JETA 1FBCA 3ILTB 4QFKA 4R6YA 4XFEA 3VXCA 2R71A 4NTLA 3FBPA 2UVJA 4QSCA 3D4GA 2CEYA 4DI3D 2YLNA 3B50A 1XVXA 4IR8A 2O68A 3OOAA 5DEXB 2G93A 1FCKA 3OO6A 3BBRA 4DLDA 1A8EA 4Q30B 3Q28A 1NUZA 1SYIA 2HHMA 5EYFA 2RKMA 4K3FA 4BDNA 1D9QA 3IB0A 4NN3A 1RYOA 4RPNA 3M3KA 1LBCA 3RYDA 5FBPA 2XWIA 3KG2A 5JTYB 1MY2A 2W7YA 1NV4A 1MXUA 2F78A 3CG1A 2H4IA 4IGRA 2F7AA 3V83A 4U2RA 1NH7A 1UTHA 3S9EA 2R9JA 3JV9A 3K6UA 2HAVA 4U1ZA 2FA7A 1MDQA 3UGWA 2Y7PA 2E0SA 3IL1B 1HSLA 4KQPA 4KYSA 3IOTA 2F3BA 3KN3A 1OVBA 3K01A 3QUFA 3QSLA 4RA1A 3TELA 4DXUA 2CMOA 5LDZA 3FXQA 4ELOA 3MZ1A 1JW4A 4MFIA 4P1EA 3RT6B 1LFHA 3VDFA 1FBGA 4PETA 1JEUA 4JXIA 4E0WA 2YJPA 2P1SA 4HCYA 1G0HA 1MPCA 2WYKA 3DP8A 2XXRA 5L8DA 2V84A 3VVEA 3KC1A 4MEVA 1GGGA 1MXWA 1OMPA 3FXRA 4NG7A 4MAGA 3QUJA 1FJ9A 1K9YA 1VE4A 1B3HA 5JK4A 4PBQA 3PTYA 3QK6A 2PBWA 5EQAA 4U1OA 1JW1A 2UYEA 1A55A 5DT6A 4QHQA 3ZS6A 4P8BA 2LAOA 4XTCQ 3PPQA 3KJTA
chains in the Genus database with same CATH topology
4XKPA 3OENA 4EXKA 2BJJX 2O1LA 3BFUA 3SEXA 2H98A 3OO8A 2XX8A 1MRPA 3HCQA 1MXZA 2X7PA 1XHYA 1IITA 3FVKA 1SI1A 4BDLA 3K02A 1SW1A 2D3IA 4XKNA 5H8QA 2R6GE 3RNNA 2Z23A 4NWCA 4C1TA 3R26A 4AQ4A 4EF2A 4Q0CA 2I49A 3LC8A 4H8JA 3MZBA 3H3GA 1B3FA 4EQ9A 3KGCA 2A5SA 3Q27A 2B3BA 3VE1B 1OLAA 4ZZAA 2F7BA 2QJEA 4G8MA 2I4CA 4P11A 1ZTYA 4R72A 1MS7A 2AL5A 1S50A 2DVCA 4LUBA 3IO4A 4ZE8A 1LFIA 1VFEA 3DP6A 4G77A 4TQUQ 1MXYA 3KSXA 4JWXA 3OSQA 4R6HA 4F39A 1WODA 4G68A 2QRYA 5KCJA 3RTFB 4UA8A 3W9WA 3WAEA 4MBPA 1LCFA 1FTJA 2IA4A 5K2YA 2H99A 4G8HA 3T22A 1PB8A 4BDMA 1USYH 3M8UA 2Q9TA 5ELVA 3RN8A 3S9MC 2F34A 3OXNA 5K2XA 1MY4A 2XXWA 4I8CA 3S2VA 4HCWA 3T96B 4XKQA 2YPNA 1Q1KA 1LSTA 4I62A 4MH5A 3MPLA 5CI5A 4R9FA 2ZNUA 4GD5A 1B3GA 3MQ9A 1UTBA 3GBAA 1JQFA 3MPKA 1OIBA 1DSNA 2F36A 3MJNA 2PMSA 4POWA 3N6TA 3GZGA 4GVOA 5IKBA 1LB8A 4YKJA 2NXOA 3BFTA 4KCCA 1EZPA 3HN0A 4OQOA 1UIVA 2OBGA 3CFZA 5HPQA 2NOOA 5AA4A 1AOVA 4GLIA 4XKRA 3U72A 1B7HA 1MXVA 3PGFA 4YB6A 3A09A 5KDTB 1L5TA 2B65A 5H8FB 4XIGQ 3RPWA 3VLUA 2PYYA 1POY1 3P7IA 1EH3A 1B5HA 3SEWA 1IXIA 1LAXA 3ZKKA 4OHNA 4E0XA 2I3VA 4TLLB 2VD2A 1B52A 3QAXA 2HZLA 3TCFA 4WEDA 1B3LA 2O69A 1GVCA 2DQVA 1IXHA 1ZBMA 2XXUA 1WVJA 1IQ7A 3B6TA 3OD7A 5I2KA 2GHBA 2DXYA 5TPAA 3KZGA 1EZOA 2V93A 2F7CA 3PU5A 2RC7A 1FQEA 1P1NA 1ZLQA 2DE3A 4PQJA 2I0BA 3H6VA 1N3WA 2Q89A 4ZE9A 4IGTA 5A5XB 3U93A 4N13A 1XVYA 1A7LA 4YICA 3O66A 4DXCA 4THIA 3SEVA 3O28A 1A54A 2OWTA 4Z0IA 3GLBA 5H8NB 4LZ5A 2F35A 4OERA 3TUSA 5ISUA 1B05A 3DELB 2OWSA 1MXXA 3BKIB 3ZKLA 3C31A 4OETA 1UIUA 2DSFA 1OVTA 5ICQA 4ONYA 4IY6A 4OESA 3PUWE 3PD8A 4ZECA 4ISUA 3IB2A 5F7VA 1QJMA 4JWYA 4RK2A 3PPNA 2ABHA 3CFXA 3RLFE 3PD9A 4IO5A 4H0WA 1Y20A 4IO6A 1SD3A 2VGQA 5AA2B 5EHMA 3OELA 1ZKBA 4RY1A 2OJTA 2OLBA 3FJ7A 5L9SA 5I2NB 1TXFA 2P0SA 2VOZA 1QULA 1D4NA 3T66A 2AL4A 4RK9A 3TODA 1FTLA 3MP6A 3E4RA 4KPTA 4XXUA 1S7YA 4OVJA 1UQWA 1R9LA 4RPOA 3OMBA 1ZMGA 1KWHA 5I57A 1MM6A 2REGA 1A99A 2H5YA 3VXBA 4F31B 4LONB 2QPQA 4POXA 4LA9A 3PPOA 4F2OA 2XD2A 1CB6A 5ITPA 3C9HA 3MVZA 2I58A 3CR9A 3IX1A 3TCHA 4GRKA 4FORA 5DEXA 1M5BA 4Z7EA 3W9VA 4P0IA 4OYVA 5TP9B 2QMXA 4H5GA 4IO7A 3HHFA 2O51A 3ODBA 4OZ9A 3FXUA 1I6QA 4F3GA 1T0KA 5I59B 5JTYA 2E1SA 5DVFA 4YKKA 3C34A 1P1WA 1Y9UA 3PV0E 2Y7IA 4BDQA 1ZJLA 2ANJA 4H8IA 2I48A 4OTEA 1AMFA 2Z8DA 1PEBA 3OEMA 4OEUA 4ESXA 4QF9A 2NWJA 1QKAA 3I3VA 3T9HB 4M4GA 1XS5A 2ZNTA 2CZLA 1H43A 1H76A 2XXQA 4R75A 4QRZA 3O97A 1B4ZA 5BUUA 3VVFA 1M5DA 4QFNA 4F29A 5B70A 2KLFA 3N94A 3VVDA 5ITOA 4OFJA 3V8XB 3CI8A 1IIWA 4X48A 4JBZA 1ELJA 3RQTA 3LR1A 4DCXA 5FHOA 3T93B 3HSTA 1N7WA 4QFPA 1B9JA 3TDJA 3CRBA 1PDAA 3IOVA 1FTMA 1B4HA 1VFDA 1USYE 1NFTA 3PMXA 3C35A 4DCYA 4LQ5A 2X26A 1SVXB 3UN6A 4LZ7A 3UORA 3KBRA 4WKMA 4RXLA 4YB5A 3K1PA 1N3XA 3I6VA 3HV1A 3K2DA 1B40A 3OO9A 2RF1A 3CFLA 3Q26A 4GIZA 2RINA 2Z8EA 4ZEBA 2Z22A 3A3CA 3G3HA 3FZVA 5L9OA 3IR1A 3SKPA 1N84A 3CG3A 1Y3QA 1NL5A 2ZXTA 4DDDA 4OXVA 1D9YA 4OWDA 4BDOA 1PBPA 4NF5B 3TMGA 3L6HA 5J1DA 5CC2A 1FQBA 2GRVA 3VV5A 3C36A 3PMVA 1BP5A 4WEPA 2NUVA 2QS3A 4FE8A 1AL3A 2IEEA 1MY1A 2DYXA 1URSA 3EN3A 1MDP1 1R9QA 3O29A 5IAIA 3QIMA 2XX9A 3G3IA 2PX1A 1SW4A 1IZ1A 4ZEDA 1VR5A 2HXWA 4Q8RA 2HEUA 3IORA 5JEIA 2P2AA 2UXAA 2A5TB 5CMCA 3O6HA 1PB7A 2DP8A 2DVZA 2DWJA 1P1OA 3PUYE 4FATA 4YKIA 3T9UA 2Q88A 2XXIA 1MH3A 1SW5A 4F22A 4ELPA 1SW2A 2QSXA 1WDNA 2H25A 5DTBA 2HCAA 1NNTA 2O6AA 3OEKA 2THIA 4IO4A 5L9MA 4LQ2A 1AIVA 3FVNA 1NNFA 1H3DA 1NH8A 1FQCA 2FYIA 5FHNA 3C33A 3PUVE 4IY5A 1HSEA 4LVQA 1IEJA 4KD5A 1ZU0A 2QL3A 3LBSA 1Y3PA 1Q35A 3H03A 4OENA 1H44A 5CMBA 1Z7NE 5F1QA 2F97A 4KFQA 1OQGA 1TFAA 1FQAA 1LBBA 1M5CA 3TEPA 2DWIA 5KDTA 1B32A 5H8FA 3FATA 1RYXA 2GHAA 2X7QA 3DP4A 2ZNSA 1B7ZA 4GL8A 4ELRA 4NWDA 4R74A 1EZ9A 3LSXA 3TTRA 3LUYA 3U1OA 3QYTA 3RY3A 2QS4A 4GFRA 4M1VA 3RTWB 4X9TA 1BLFA 3OSRA 3FD3A 1A8FA 3G7WA 1XOCA 4F19A 1OQHA 4X1BA 1P1QA 1TFDA 4YMAA 2ZYOA 3MVXA 4I1DA 3ONMA 1LB9A 4EQBA 2XXVA 1DTGA 5AA3A 4BLAA 4Q5TA 1O7TA 1XC1A 1DPEA 3H4ZA 3TTLA 3W15C 1FW0A 4N07A 2O7IA 3SEYA 5A5XA 3GBBA 2V3QA 2RCAA 5CMMA 1B58A 3T9XB 4YAHX 4EDPA 5CMKA 4NF4A 1ZIUA 1POTA 1MM7A 4ECFA 3USDA 3E9XA 3L6GA 1M5FA 4JDFA 5I84A 1TWYA 5H8NA 2HQ0A 4HW8A 4ZZEA 5H8HB 3MVWA 3AXFA 5B7DA 5I56A 4ZEKA 5DVJA 1BIYA 2D5WA 1SDXA 4O3BA 1MPBA 3KN8A 1F9BA 1YPNA 3JYRA 1B51A 2I0CA 5AA2A 3O6IA 4ZS9A 2Z8FA 3SDFA 1SI0A 2OK2A 4ZDMA 4G68C 4HS7A 4H65A 4F3SA 3JZJA 1NMUA 2M8CA 5I2NA 3ZSFA 1D3KA 4R6KA 3EHUA 3PPPA 4BDRA 1A40A 3ECRA 4NF6B 4ESWA 4FECA 1Z7ME 3E3KA 4YMBA 3R6UA 2XXTA 3TYHA 5HM4B 3MP8A 1MY3A 3EHSA 1FTOA 3B6WA 2VD3A 1B5JA 3HO7A 3S9LC 2PT1A 1US4A 4I9DA 4F1UA 3RGYA 2DE4A 4GXSB 4R2BA 3K6VA 4EXLA 2ALUA 4NF8B 3S9NC 1DOTA 3FV2A 5I58B 3U92A 1II5A 1URGA 2F6PA 2F6GA 1US5A 3G3KA 1SQYA 3LSLA 2HZKA 4R2FA 2Y7RA 3TFLA 3S4UA 1B46A 3TQWA 5TP9A 3O2AA 1OLCA 5M2VA 1QW0A 3M3LA 2Y7WA 4U22A 3CIJA 3G3JA 4FIMA 5I59A 4NE4A 5HBCA 1JVXA 3O9PA 2DOJA 3TTKA 1DPPA 3LSWA 2VHAA 3RT8A 2RCBA 3PPRA 4FAJA 3KOTA 2OCUA 3U94A 1B5IA 4ELQA 3N26A 2XXYA 1PC3A 4KHZE 3TTNA 2UVHA 3KN7A 5FTHA 1B1XA 4GL0A 1B1HA 4F3PA 3LSFB 1ATGA 4PFUA 2FNCA 2ZYKA 3THIA 4U4SA 4JB7A 2O84X 4G2ZA 2Y7KA 3MVYA 4H5FA 1UTHB 5BWJA 5FHMA 1LLSA 4EF1A 3SETA 4IB2A 3PMWA 4U23A 3UK4A 3D4CA 1Y1MA 2XD3A 2XX7A 1GTKA 2VP1A 1R1NA 2B3FA 4LP2B 1QUIA 2AYSA 1MY0A 2PT2A 1FQDA 4KR5A 4QFOA 2O7UA 3H6UA 3FV1A 1LAHE 3E13X 3I5OA 3MAMA 4GXAA 1I6AA 4PFYA 3K6WA 1O64A 3IOUA 1HSJA 4U4XA 3IK6B 2H9BA 1LAGE 3IAZA 5CRYA 3TPAA 4YZZA 5EHSA 1P1UA 1S9TA 1QUKA 3K1MA 1LCTA 1M5EA 4PP0A 3G3FA 2OZZA 2ONSA 2AIXA 1NKXA 4L17A 1CE2A 4YKPA 4FEDA 1XT8A 5AA1A 4N6PA 3V5AA 1BTJA 1IXCA 3Q29A 3U8QA 4GOTA 4QSEA 3OO7A 2HAUA 1N76A 5DVIA 4P0GA 3EHTA 1JNFA 3H6WA 1B7UA 2F5XA 3H7MA 1DMBA 2HFBA 4NF5A 5H8QB 1MPDA 2V3TA 4OFLA 4OEVA 1FTKA 3FVOA 2DXRA 3M3FA 4RYAA 4C1UA 1J1NA 3QXMA 3KJ7A 2RC8A 4R73A 4WXJA 4O3CA 4PE5B 4DIGA 2DE2A 1B3EA 3A3UA 1IXGA 2RC9A 4H6DA 3FIRA 1ANFA 3CVGA 3HHGA 4F1VA 3SEUA 2DS9A 4IO2A 1FQFA 3VFJA 4KYDA 4NEDA 3C4MA 3H6TA 4F18A 1PBQA 1GR2A 1I6BA 4R9GA 2DWHA 2O1MA 5TU0A 3K00A 2A5TA 3TQLA 4GF8A 3WAFA 1LAFE 4OMBA 5AA2D 2I3WA 4H1XA 1AH5A 4G68B 5KCJB 4FJPA 2GFEA 3PUZE 4O3AA 4MLVA 4MLQA 2QS1A 4G8NA 4NMYA 3IO6A 1B0LA 1N7XA 2XHDA 3MC2A 1Y4CA 2ZYMA 5FTIA 4F2QA 3Q25A 4KYEA 4JSDA 3HPIA 4EQ7A 3PUXE 4AB6A 3IOWA 4H67A 4ZEFA 1MQDA 1SBPA 3VLVA 2Q2AA 4TLMB 5ICTA 2DWAA 4EUOA 1UTBB 2UVGA 1Y1ZA 2XXHA 2XXXA 1YAEA 3B7DA 4GWOA 5CM6A 4G4PA 2I4BA 1PB9A 4KI0E 3IB1A 5CBRA 3MWBA 4QFLA 3K0VA 4ZEIA 1TT1A 2UYFA 1JVYA 3N5LA 3K4UA 3KOSA 5CBSA 1H45A 1GV8A 2V3UA 3EPEA 1SYHA 5AA4B 3TKDA 1QUJA 3K1NA 3FJGA 2ONRA 2G29A 1LFGA 1QVSA 1MQIA 4TOZA 3EQ1A 3FVGA 2GH9A 2ESNA 1O63A 4U21A 3UP9A 2UVIA 2PVUA 3FUZA 4YU0A 4LZ8A 1MQJA 3EF7A 4HTGA 1MQHA 4PFTA 3MP1A 4KCDA 5LOMA 2F8DA 2V25A 3UA8A 2Q8JA 4X1DA 1RKMA 1D9VA 5H8SA 3KFMA 3SERA 5I2KB 1YTVA 4JSOA 1LGBC 3C32A 4F3BA 2Y84A 4DXBA 3DM0A 5TPAB 2QMWA 5H8HA 1IUDA 1QKBA 3MZ9A 3O6GA 4DZ1A 1N04A 2QS2A 4QSDA 1P99A 3F11A 1N0TA 1DTZA 2D21A 4YB7A 3UIFA 3V89B 1JEVA 5KZTA 4RJZA 4NF4B 1NNPA 3CSGA 4UACA 4C0RA 1Y3NA 4JWOA 3FJMA 3N6UA 2ZMBA 1NNKA 4AB5A 2ONKE 1URDA 1VSOA 4PFWA 1B2HA 1MQGA 3K6XA 1EU8A 1B0HA 1R6ZA 4NF6A 5I56B 3CSBA 1MH4A 3IJOB 2WKYA 2I6EA 3GXAA 1B6HA 3MBPA 1Y4TA 3ILUB 5DYHA 4MF3A 4F1YA 2REJA 1YCJA 4DE8A 4OFOA 3H06B 3MW0A 5AE4A 1BKAA 4ND9A 4NF8A 5I58A 3VLWA 3RUMA 2NVUB 3B6QA 4IO3A 3MUQA 3TTMA 3KSJA 1I69A 3T9VA 3IJXB 1JW5A 4FEBA 2ZYNA 3TAJA 3FGSA 4RNSA 1MG1A 3G3GA 3TCGA 3KEIA 3TZAA 3R7XA 3FASA 3SESA 2Q2CA 3DLNA 2XXPA 5I57B 4GQOA 4LATA 1JETA 3ILTB 4QFKA 4R6YA 3VXCA 2R71A 4NTLA 2UVJA 4QSCA 3D4GA 2YLNA 1XVXA 2O68A 3OOAA 5DEXB 2G93A 1FCKA 3OO6A 3BBRA 4DLDA 1A8EA 4Q30B 3Q28A 1SYIA 5EYFA 2RKMA 4K3FA 4BDNA 3IB0A 1RYOA 4RPNA 3M3KA 1LBCA 3KG2A 5JTYB 1MY2A 2W7YA 1MXUA 2F78A 3CG1A 2H4IA 4IGRA 2F7AA 3V83A 4U2RA 1NH7A 1UTHA 3S9EA 2R9JA 3JV9A 3K6UA 2HAVA 4U1ZA 2FA7A 1MDQA 3UGWA 2Y7PA 2E0SA 3IL1B 1HSLA 4KQPA 4KYSA 3IOTA 3KN3A 1OVBA 3K01A 3QUFA 3QSLA 4RA1A 3TELA 4DXUA 2CMOA 3FXQA 4ELOA 3MZ1A 1JW4A 4MFIA 1LFHA 3RT6B 3VDFA 4PETA 1JEUA 4JXIA 4E0WA 2YJPA 2P1SA 4HCYA 1MPCA 3VVEA 2XXRA 3DP8A 2V84A 5L8DA 1GGGA 1MXWA 1OMPA 3FXRA 3QUJA 1VE4A 5JK4A 1B3HA 3QK6A 2PBWA 4U1OA 1JW1A 2UYEA 1A55A 5DT6A 4QHQA 3ZS6A 2LAOA 4XTCQ 3PPQA 3KJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKP A;  3OEN A;  4EXK A;  2BJJ X;  2O1L A;  3BFU A;  3SEX A;  2H98 A;  3OO8 A;  2XX8 A;  1MRP A;  3HCQ A;  1MXZ A;  2X7P A;  1XHY A;  1IIT A;  3FVK A;  1SI1 A;  4BDL A;  3K02 A;  1SW1 A;  2D3I A;  4XKN A;  5H8Q A;  2R6G E;  3RNN A;  2Z23 A;  4NWC A;  4C1T A;  3R26 A;  4AQ4 A;  4EF2 A;  4Q0C A;  2I49 A;  3LC8 A;  4H8J A;  3MZB A;  3H3G A;  1B3F A;  4EQ9 A;  3KGC A;  2A5S A;  3Q27 A;  2B3B A;  3VE1 B;  1OLA A;  4ZZA A;  2F7B A;  2QJE A;  4G8M A;  2I4C A;  4P11 A;  1ZTY A;  4R72 A;  1MS7 A;  2AL5 A;  1S50 A;  2DVC A;  4LUB A;  3IO4 A;  4ZE8 A;  1LFI A;  1VFE A;  3DP6 A;  4G77 A;  4TQU Q;  1MXY A;  3KSX A;  4JWX A;  3OSQ A;  4R6H A;  4F39 A;  1WOD A;  4G68 A;  2QRY A;  5KCJ A;  3RTF B;  4UA8 A;  3W9W A;  3WAE A;  4MBP A;  1LCF A;  1FTJ A;  2IA4 A;  5K2Y A;  2H99 A;  4G8H A;  3T22 A;  1PB8 A;  4BDM A;  1USY H;  3M8U A;  2Q9T A;  5ELV A;  3RN8 A;  3S9M C;  2F34 A;  3OXN A;  5K2X A;  1MY4 A;  2XXW A;  4I8C A;  3S2V A;  4HCW A;  3T96 B;  4XKQ A;  2YPN A;  1Q1K A;  1LST A;  4I62 A;  4MH5 A;  3MPL A;  5CI5 A;  4R9F A;  2ZNU A;  4GD5 A;  1B3G A;  3MQ9 A;  1UTB A;  3GBA A;  1JQF A;  3MPK A;  1OIB A;  1DSN A;  2F36 A;  3MJN A;  2PMS A;  4POW A;  3N6T A;  3GZG A;  4GVO A;  5IKB A;  1LB8 A;  4YKJ A;  2NXO A;  3BFT A;  4KCC A;  1EZP A;  3HN0 A;  4OQO A;  1UIV A;  2OBG A;  3CFZ A;  5HPQ A;  2NOO A;  5AA4 A;  1AOV A;  4GLI A;  4XKR A;  3U72 A;  1B7H A;  1MXV A;  3PGF A;  4YB6 A;  3A09 A;  5KDT B;  1L5T A;  2B65 A;  5H8F B;  4XIG Q;  3RPW A;  3VLU A;  2PYY A;  1POY 1;  3P7I A;  1EH3 A;  1B5H A;  3SEW A;  1IXI A;  1LAX A;  3ZKK A;  4OHN A;  4E0X A;  2I3V A;  4TLL B;  2VD2 A;  1B52 A;  3QAX A;  2HZL A;  3TCF A;  4WED A;  1B3L A;  2O69 A;  1GVC A;  2DQV A;  1IXH A;  1ZBM A;  2XXU A;  1WVJ A;  1IQ7 A;  3B6T A;  3OD7 A;  5I2K A;  2GHB A;  2DXY A;  5TPA A;  3KZG A;  1EZO A;  2V93 A;  2F7C A;  3PU5 A;  2RC7 A;  1FQE A;  1P1N A;  1ZLQ A;  2DE3 A;  4PQJ A;  2I0B A;  3H6V A;  1N3W A;  2Q89 A;  4ZE9 A;  4IGT A;  5A5X B;  3U93 A;  4N13 A;  1XVY A;  1A7L A;  4YIC A;  3O66 A;  4DXC A;  4THI A;  3SEV A;  3O28 A;  1A54 A;  2OWT A;  4Z0I A;  3GLB A;  5H8N B;  4LZ5 A;  2F35 A;  4OER A;  3TUS A;  5ISU A;  1B05 A;  3DEL B;  2OWS A;  1MXX A;  3BKI B;  3ZKL A;  3C31 A;  4OET A;  1UIU A;  2DSF A;  1OVT A;  5ICQ A;  4ONY A;  4IY6 A;  4OES A;  3PUW E;  3PD8 A;  4ZEC A;  4ISU A;  3IB2 A;  5F7V A;  1QJM A;  4JWY A;  4RK2 A;  3PPN A;  2ABH A;  3CFX A;  3RLF E;  3PD9 A;  4IO5 A;  4H0W A;  1Y20 A;  4IO6 A;  1SD3 A;  2VGQ A;  5AA2 B;  5EHM A;  3OEL A;  1ZKB A;  4RY1 A;  2OJT A;  2OLB A;  3FJ7 A;  5L9S A;  5I2N B;  1TXF A;  2P0S A;  2VOZ A;  1QUL A;  1D4N A;  3T66 A;  2AL4 A;  4RK9 A;  3TOD A;  1FTL A;  3MP6 A;  3E4R A;  4KPT A;  4XXU A;  1S7Y A;  4OVJ A;  1UQW A;  1R9L A;  4RPO A;  3OMB A;  1ZMG A;  1KWH A;  5I57 A;  1MM6 A;  2REG A;  1A99 A;  2H5Y A;  3VXB A;  4F31 B;  4LON B;  2QPQ A;  4POX A;  4LA9 A;  3PPO A;  4F2O A;  2XD2 A;  1CB6 A;  5ITP A;  3C9H A;  3MVZ A;  2I58 A;  3CR9 A;  3IX1 A;  3TCH A;  4GRK A;  4FOR A;  5DEX A;  1M5B A;  4Z7E A;  3W9V A;  4P0I A;  4OYV A;  5TP9 B;  2QMX A;  4H5G A;  4IO7 A;  3HHF A;  2O51 A;  3ODB A;  4OZ9 A;  3FXU A;  1I6Q A;  4F3G A;  1T0K A;  5I59 B;  5JTY A;  2E1S A;  5DVF A;  4YKK A;  3C34 A;  1P1W A;  1Y9U A;  3PV0 E;  2Y7I A;  4BDQ A;  1ZJL A;  2ANJ A;  4H8I A;  2I48 A;  4OTE A;  1AMF A;  2Z8D A;  1PEB A;  3OEM A;  4OEU A;  4ESX A;  4QF9 A;  2NWJ A;  1QKA A;  3I3V A;  3T9H B;  4M4G A;  1XS5 A;  2ZNT A;  2CZL A;  1H43 A;  1H76 A;  2XXQ A;  4R75 A;  4QRZ A;  3O97 A;  1B4Z A;  5BUU A;  3VVF A;  1M5D A;  4QFN A;  4F29 A;  5B70 A;  2KLF A;  3N94 A;  3VVD A;  5ITO A;  4OFJ A;  3V8X B;  3CI8 A;  1IIW A;  4X48 A;  4JBZ A;  1ELJ A;  3RQT A;  3LR1 A;  4DCX A;  5FHO A;  3T93 B;  3HST A;  1N7W A;  4QFP A;  1B9J A;  3TDJ A;  3CRB A;  1PDA A;  3IOV A;  1FTM A;  1B4H A;  1VFD A;  1USY E;  1NFT A;  3PMX A;  3C35 A;  4DCY A;  4LQ5 A;  2X26 A;  1SVX B;  3UN6 A;  4LZ7 A;  3UOR A;  3KBR A;  4WKM A;  4RXL A;  4YB5 A;  3K1P A;  1N3X A;  3I6V A;  3HV1 A;  3K2D A;  1B40 A;  3OO9 A;  2RF1 A;  3CFL A;  3Q26 A;  4GIZ A;  2RIN A;  2Z8E A;  4ZEB A;  2Z22 A;  3A3C A;  3G3H A;  3FZV A;  5L9O A;  3IR1 A;  3SKP A;  1N84 A;  3CG3 A;  1Y3Q A;  1NL5 A;  2ZXT A;  4DDD A;  4OXV A;  1D9Y A;  4OWD A;  4BDO A;  1PBP A;  4NF5 B;  3TMG A;  3L6H A;  5J1D A;  5CC2 A;  1FQB A;  2GRV A;  3VV5 A;  3C36 A;  3PMV A;  1BP5 A;  4WEP A;  2NUV A;  2QS3 A;  4FE8 A;  1AL3 A;  2IEE A;  1MY1 A;  2DYX A;  1URS A;  3EN3 A;  1MDP 1;  1R9Q A;  3O29 A;  5IAI A;  3QIM A;  2XX9 A;  3G3I A;  2PX1 A;  1SW4 A;  1IZ1 A;  4ZED A;  1VR5 A;  2HXW A;  4Q8R A;  2HEU A;  3IOR A;  5JEI A;  2P2A A;  2UXA A;  2A5T B;  5CMC A;  3O6H A;  1PB7 A;  2DP8 A;  2DVZ A;  2DWJ A;  1P1O A;  3PUY E;  4FAT A;  4YKI A;  3T9U A;  2Q88 A;  2XXI A;  1MH3 A;  1SW5 A;  4F22 A;  4ELP A;  1SW2 A;  2QSX A;  1WDN A;  2H25 A;  5DTB A;  2HCA A;  1NNT A;  2O6A A;  3OEK A;  2THI A;  4IO4 A;  5L9M A;  4LQ2 A;  1AIV A;  3FVN A;  1NNF A;  1H3D A;  1NH8 A;  1FQC A;  2FYI A;  5FHN A;  3C33 A;  3PUV E;  4IY5 A;  1HSE A;  4LVQ A;  1IEJ A;  4KD5 A;  1ZU0 A;  2QL3 A;  3LBS A;  1Y3P A;  1Q35 A;  3H03 A;  4OEN A;  1H44 A;  5CMB A;  1Z7N E;  5F1Q A;  2F97 A;  4KFQ A;  1OQG A;  1TFA A;  1FQA A;  1LBB A;  1M5C A;  3TEP A;  2DWI A;  5KDT A;  1B32 A;  5H8F A;  3FAT A;  1RYX A;  2GHA A;  2X7Q A;  3DP4 A;  2ZNS A;  1B7Z A;  4GL8 A;  4ELR A;  4NWD A;  4R74 A;  1EZ9 A;  3LSX A;  3TTR A;  3LUY A;  3U1O A;  3QYT A;  3RY3 A;  2QS4 A;  4GFR A;  4M1V A;  3RTW B;  4X9T A;  1BLF A;  3OSR A;  3FD3 A;  1A8F A;  3G7W A;  1XOC A;  4F19 A;  1OQH A;  4X1B A;  1P1Q A;  1TFD A;  4YMA A;  2ZYO A;  3MVX A;  4I1D A;  3ONM A;  1LB9 A;  4EQB A;  2XXV A;  1DTG A;  5AA3 A;  4BLA A;  4Q5T A;  1O7T A;  1XC1 A;  1DPE A;  3H4Z A;  3TTL A;  3W15 C;  1FW0 A;  4N07 A;  2O7I A;  3SEY A;  5A5X A;  3GBB A;  2V3Q A;  2RCA A;  5CMM A;  1B58 A;  3T9X B;  4YAH X;  4EDP A;  5CMK A;  4NF4 A;  1ZIU A;  1POT A;  1MM7 A;  4ECF A;  3USD A;  3E9X A;  3L6G A;  1M5F A;  4JDF A;  5I84 A;  1TWY A;  5H8N A;  2HQ0 A;  4HW8 A;  4ZZE A;  5H8H B;  3MVW A;  3AXF A;  5B7D A;  5I56 A;  4ZEK A;  5DVJ A;  1BIY A;  2D5W A;  1SDX A;  4O3B A;  1MPB A;  3KN8 A;  1F9B A;  1YPN A;  3JYR A;  1B51 A;  2I0C A;  5AA2 A;  3O6I A;  4ZS9 A;  2Z8F A;  3SDF A;  1SI0 A;  2OK2 A;  4ZDM A;  4G68 C;  4HS7 A;  4H65 A;  4F3S A;  3JZJ A;  1NMU A;  2M8C A;  5I2N A;  3ZSF A;  1D3K A;  4R6K A;  3EHU A;  3PPP A;  4BDR A;  1A40 A;  3ECR A;  4NF6 B;  4ESW A;  4FEC A;  1Z7M E;  3E3K A;  4YMB A;  3R6U A;  2XXT A;  3TYH A;  5HM4 B;  3MP8 A;  1MY3 A;  3EHS A;  1FTO A;  3B6W A;  2VD3 A;  1B5J A;  3HO7 A;  3S9L C;  2PT1 A;  1US4 A;  4I9D A;  4F1U A;  3RGY A;  2DE4 A;  4GXS B;  4R2B A;  3K6V A;  4EXL A;  2ALU A;  4NF8 B;  3S9N C;  1DOT A;  3FV2 A;  5I58 B;  3U92 A;  1II5 A;  1URG A;  2F6P A;  2F6G A;  1US5 A;  3G3K A;  1SQY A;  3LSL A;  2HZK A;  4R2F A;  2Y7R A;  3TFL A;  3S4U A;  1B46 A;  3TQW A;  5TP9 A;  3O2A A;  1OLC A;  5M2V A;  1QW0 A;  3M3L A;  2Y7W A;  4U22 A;  3CIJ A;  3G3J A;  4FIM A;  5I59 A;  4NE4 A;  5HBC A;  1JVX A;  3O9P A;  2DOJ A;  3TTK A;  1DPP A;  3LSW A;  2VHA A;  3RT8 A;  2RCB A;  3PPR A;  4FAJ A;  3KOT A;  2OCU A;  3U94 A;  1B5I A;  4ELQ A;  3N26 A;  2XXY A;  1PC3 A;  4KHZ E;  3TTN A;  2UVH A;  3KN7 A;  5FTH A;  1B1X A;  4GL0 A;  1B1H A;  4F3P A;  3LSF B;  1ATG A;  4PFU A;  2FNC A;  2ZYK A;  3THI A;  4U4S A;  4JB7 A;  2O84 X;  4G2Z A;  2Y7K A;  3MVY A;  4H5F A;  1UTH B;  5BWJ A;  5FHM A;  1LLS A;  4EF1 A;  3SET A;  4IB2 A;  3PMW A;  4U23 A;  3UK4 A;  3D4C A;  1Y1M A;  2XD3 A;  2XX7 A;  1GTK A;  2VP1 A;  1R1N A;  2B3F A;  4LP2 B;  1QUI A;  2AYS A;  1MY0 A;  2PT2 A;  1FQD A;  4KR5 A;  4QFO A;  2O7U A;  3H6U A;  3FV1 A;  1LAH E;  3E13 X;  3I5O A;  3MAM A;  4GXA A;  1I6A A;  4PFY A;  3K6W A;  1O64 A;  3IOU A;  1HSJ A;  4U4X A;  3IK6 B;  2H9B A;  1LAG E;  3IAZ A;  5CRY A;  3TPA A;  4YZZ A;  5EHS A;  1P1U A;  1S9T A;  1QUK A;  3K1M A;  1LCT A;  1M5E A;  4PP0 A;  3G3F A;  2OZZ A;  2ONS A;  2AIX A;  1NKX A;  4L17 A;  1CE2 A;  4YKP A;  4FED A;  1XT8 A;  5AA1 A;  4N6P A;  3V5A A;  1BTJ A;  1IXC A;  3Q29 A;  3U8Q A;  4GOT A;  4QSE A;  3OO7 A;  2HAU A;  1N76 A;  5DVI A;  4P0G A;  3EHT A;  1JNF A;  3H6W A;  1B7U A;  2F5X A;  3H7M A;  1DMB A;  2HFB A;  4NF5 A;  5H8Q B;  1MPD A;  2V3T A;  4OFL A;  4OEV A;  1FTK A;  3FVO A;  2DXR A;  3M3F A;  4RYA A;  4C1U A;  1J1N A;  3QXM A;  3KJ7 A;  2RC8 A;  4R73 A;  4WXJ A;  4O3C A;  4PE5 B;  4DIG A;  2DE2 A;  1B3E A;  3A3U A;  1IXG A;  2RC9 A;  4H6D A;  3FIR A;  1ANF A;  3CVG A;  3HHG A;  4F1V A;  3SEU A;  2DS9 A;  4IO2 A;  1FQF A;  3VFJ A;  4KYD A;  4NED A;  3C4M A;  3H6T A;  4F18 A;  1PBQ A;  1GR2 A;  1I6B A;  4R9G A;  2DWH A;  2O1M A;  5TU0 A;  3K00 A;  2A5T A;  3TQL A;  4GF8 A;  3WAF A;  1LAF E;  4OMB A;  5AA2 D;  2I3W A;  4H1X A;  1AH5 A;  4G68 B;  5KCJ B;  4FJP A;  2GFE A;  3PUZ E;  4O3A A;  4MLV A;  4MLQ A;  2QS1 A;  4G8N A;  4NMY A;  3IO6 A;  1B0L A;  1N7X A;  2XHD A;  3MC2 A;  1Y4C A;  2ZYM A;  5FTI A;  4F2Q A;  3Q25 A;  4KYE A;  4JSD A;  3HPI A;  4EQ7 A;  3PUX E;  4AB6 A;  3IOW A;  4H67 A;  4ZEF A;  1MQD A;  1SBP A;  3VLV A;  2Q2A A;  4TLM B;  5ICT A;  2DWA A;  4EUO A;  1UTB B;  2UVG A;  1Y1Z A;  2XXH A;  2XXX A;  1YAE A;  3B7D A;  4GWO A;  5CM6 A;  4G4P A;  2I4B A;  1PB9 A;  4KI0 E;  3IB1 A;  5CBR A;  3MWB A;  4QFL A;  3K0V A;  4ZEI A;  1TT1 A;  2UYF A;  1JVY A;  3N5L A;  3K4U A;  3KOS A;  5CBS A;  1H45 A;  1GV8 A;  2V3U A;  3EPE A;  1SYH A;  5AA4 B;  3TKD A;  1QUJ A;  3K1N A;  3FJG A;  2ONR A;  2G29 A;  1LFG A;  1QVS A;  1MQI A;  4TOZ A;  3EQ1 A;  3FVG A;  2GH9 A;  2ESN A;  1O63 A;  4U21 A;  3UP9 A;  2UVI A;  2PVU A;  3FUZ A;  4YU0 A;  4LZ8 A;  1MQJ A;  3EF7 A;  4HTG A;  1MQH A;  4PFT A;  3MP1 A;  4KCD A;  5LOM A;  2F8D A;  2V25 A;  3UA8 A;  2Q8J A;  4X1D A;  1RKM A;  1D9V A;  5H8S A;  3KFM A;  3SER A;  5I2K B;  1YTV A;  4JSO A;  1LGB C;  3C32 A;  4F3B A;  2Y84 A;  4DXB A;  3DM0 A;  5TPA B;  2QMW A;  5H8H A;  1IUD A;  1QKB A;  3MZ9 A;  3O6G A;  4DZ1 A;  1N04 A;  2QS2 A;  4QSD A;  1P99 A;  3F11 A;  1N0T A;  1DTZ A;  2D21 A;  4YB7 A;  3UIF A;  3V89 B;  1JEV A;  5KZT A;  4RJZ A;  4NF4 B;  1NNP A;  3CSG A;  4UAC A;  4C0R A;  1Y3N A;  4JWO A;  3FJM A;  3N6U A;  2ZMB A;  1NNK A;  4AB5 A;  2ONK E;  1URD A;  1VSO A;  4PFW A;  1B2H A;  1MQG A;  3K6X A;  1EU8 A;  1B0H A;  1R6Z A;  4NF6 A;  5I56 B;  3CSB A;  1MH4 A;  3IJO B;  2WKY A;  2I6E A;  3GXA A;  1B6H A;  3MBP A;  1Y4T A;  3ILU B;  5DYH A;  4MF3 A;  4F1Y A;  2REJ A;  1YCJ A;  4DE8 A;  4OFO A;  3H06 B;  3MW0 A;  5AE4 A;  1BKA A;  4ND9 A;  4NF8 A;  5I58 A;  3VLW A;  3RUM A;  2NVU B;  3B6Q A;  4IO3 A;  3MUQ A;  3TTM A;  3KSJ A;  1I69 A;  3T9V A;  3IJX B;  1JW5 A;  4FEB A;  2ZYN A;  3TAJ A;  3FGS A;  4RNS A;  1MG1 A;  3G3G A;  3TCG A;  3KEI A;  3TZA A;  3R7X A;  3FAS A;  3SES A;  2Q2C A;  3DLN A;  2XXP A;  5I57 B;  4GQO A;  4LAT A;  1JET A;  3ILT B;  4QFK A;  4R6Y A;  3VXC A;  2R71 A;  4NTL A;  2UVJ A;  4QSC A;  3D4G A;  2YLN A;  1XVX A;  2O68 A;  3OOA A;  5DEX B;  2G93 A;  1FCK A;  3OO6 A;  3BBR A;  4DLD A;  1A8E A;  4Q30 B;  3Q28 A;  1SYI A;  5EYF A;  2RKM A;  4K3F A;  4BDN A;  3IB0 A;  1RYO A;  4RPN A;  3M3K A;  1LBC A;  3KG2 A;  5JTY B;  1MY2 A;  2W7Y A;  1MXU A;  2F78 A;  3CG1 A;  2H4I A;  4IGR A;  2F7A A;  3V83 A;  4U2R A;  1NH7 A;  1UTH A;  3S9E A;  2R9J A;  3JV9 A;  3K6U A;  2HAV A;  4U1Z A;  2FA7 A;  1MDQ A;  3UGW A;  2Y7P A;  2E0S A;  3IL1 B;  1HSL A;  4KQP A;  4KYS A;  3IOT A;  3KN3 A;  1OVB A;  3K01 A;  3QUF A;  3QSL A;  4RA1 A;  3TEL A;  4DXU A;  2CMO A;  3FXQ A;  4ELO A;  3MZ1 A;  1JW4 A;  4MFI A;  1LFH A;  3RT6 B;  3VDF A;  4PET A;  1JEU A;  4JXI A;  4E0W A;  2YJP A;  2P1S A;  4HCY A;  1MPC A;  3VVE A;  2XXR A;  3DP8 A;  2V84 A;  5L8D A;  1GGG A;  1MXW A;  1OMP A;  3FXR A;  3QUJ A;  1VE4 A;  5JK4 A;  1B3H A;  3QK6 A;  2PBW A;  4U1O A;  1JW1 A;  2UYE A;  1A55 A;  5DT6 A;  4QHQ A;  3ZS6 A;  2LAO A;  4XTC Q;  3PPQ A;  3KJT A; 
#chains in the Genus database with same CATH topology
 1KZ8 A;  4XKP A;  3OEN A;  4O8M A;  1YZ0 A;  4EXK A;  2BJJ X;  2O1L A;  1FBP A;  3BFU A;  3SEX A;  2H98 A;  3OO8 A;  2XX8 A;  1MRP A;  3HCQ A;  1MXZ A;  2X7P A;  1XHY A;  1IIT A;  3FVK A;  1SI1 A;  4BDL A;  3K02 A;  2L5V A;  1SW1 A;  2CZI A;  4DI4 B;  2D3I A;  2OX3 A;  4XKN A;  5H8Q A;  2R6G E;  3RNN A;  2Z23 A;  4NWC A;  4C1T A;  3R26 A;  4AQ4 A;  4EF2 A;  4Q0C A;  2I49 A;  3LC8 A;  2B4L A;  4H8J A;  3MZB A;  5I3S A;  2WYP A;  3H3G A;  1B3F A;  4EQ9 A;  3KGC A;  2A5S A;  3Q27 A;  1Q9D A;  2B3B A;  3VE1 B;  1OLA A;  4ZZA A;  2F7B A;  1FPF A;  2QJE A;  4G8M A;  2I4C A;  4P11 A;  1ZTY A;  4PGP A;  1MS7 A;  2AL5 A;  2WX9 A;  1S50 A;  4R72 A;  4UAB A;  4AS5 A;  4NGU A;  2DVC A;  4HE1 A;  4LUB A;  3GYY A;  1LBV A;  3IO4 A;  4JVD A;  4ZE8 A;  1LFI A;  1VFE A;  3DP6 A;  4GWU A;  4TQU Q;  4G77 A;  1MXY A;  3KSX A;  5EYG A;  4JWX A;  3OSQ A;  4R6H A;  4F39 A;  1WOD A;  4G68 A;  2QRY A;  5KCJ A;  4KXP A;  3RTF B;  4UA8 A;  3W9W A;  3WAE A;  4MBP A;  1LCF A;  1FTJ A;  2WBD A;  2IA4 A;  5K2Y A;  4I40 A;  2H99 A;  4G8H A;  3T22 A;  2PFZ A;  1FSA A;  1PB8 A;  4BDM A;  1USY H;  3M8U A;  2Q9T A;  5ELV A;  3RN8 A;  3S9M C;  2F34 A;  3OXN A;  5K2X A;  1MY4 A;  2XXW A;  4I8C A;  3S2V A;  4HCW A;  5IM2 A;  4O7I A;  3T96 B;  3RPL A;  4XKQ A;  4H45 A;  2YPN A;  1Q1K A;  2R8T A;  1LST A;  4I62 A;  4MH5 A;  3MPL A;  5CI5 A;  4R9F A;  2ZNU A;  4GD5 A;  1B3G A;  3MQ9 A;  1UTB A;  3GBA A;  1EYK A;  1JQF A;  2JJK A;  3MPK A;  1OIB A;  1DSN A;  2F36 A;  3MJN A;  2XA5 A;  2PMS A;  5ET8 A;  4POW A;  3N6T A;  2Y5L A;  3GZG A;  4GVO A;  5IKB A;  1LB8 A;  4MJO A;  2PCR A;  2CEX A;  5EQ8 A;  4YKJ A;  2NXO A;  4NX1 A;  3BFT A;  4GWS A;  4KCC A;  1EZP A;  3HN0 A;  4HE0 A;  4OQO A;  1UIV A;  2OBG A;  3CFZ A;  5HPQ A;  2NOO A;  5AA4 A;  1AOV A;  4GLI A;  4XKR A;  3U72 A;  1B7H A;  1MXV A;  3PGF A;  4YB6 A;  3A09 A;  3LV0 A;  1NV2 A;  5KDT B;  3QMF A;  4P47 A;  1IMB A;  1L5T A;  2B65 A;  5H8F B;  4XIG Q;  3RPW A;  3VLU A;  2PYY A;  1VDW A;  1POY 1;  3P7I A;  4GWW A;  1EH3 A;  1B5H A;  4GBW A;  3SEW A;  3IFC A;  1IXI A;  1LAX A;  3ZKK A;  4OHN A;  4E0X A;  2I3V A;  4TLL B;  2VD2 A;  1B52 A;  3QAX A;  2HZL A;  3TCF A;  4WED A;  1B3L A;  2O69 A;  1GVC A;  2DQV A;  1IXH A;  1ZBM A;  2XXU A;  1WVJ A;  1IQ7 A;  3B6T A;  3OD7 A;  5I2K A;  3T1B A;  2GHB A;  2DXY A;  5TPA A;  3KZG A;  1FPK A;  1EZO A;  3NOH A;  2V93 A;  3BIG A;  2F7C A;  3PU5 A;  2RC7 A;  1FQE A;  1P1N A;  1ZLQ A;  2DE3 A;  4PQJ A;  2I0B A;  3H6V A;  1N3W A;  2Q89 A;  4ZE9 A;  4GWZ A;  4IGT A;  5A5X B;  3U93 A;  4N13 A;  1XVY A;  1A7L A;  4YIC A;  4PAF A;  3O66 A;  4DXC A;  4THI A;  3SEV A;  3O28 A;  1A54 A;  2OWT A;  4Z0I A;  3GLB A;  5H8N B;  3EKI A;  4LZ5 A;  2F35 A;  4OER A;  3TUS A;  5ISU A;  1B05 A;  3DEL B;  2OWS A;  2Q8M A;  1MXX A;  3BKI B;  3ZKL A;  3C31 A;  4OET A;  1UIU A;  2DSF A;  1OVT A;  3D1R A;  5ICQ A;  4ONY A;  1FBH A;  5IZ1 A;  2HPG A;  4IY6 A;  4OES A;  3PUW E;  3PD8 A;  4ZEC A;  4ISU A;  3IB2 A;  5F7V A;  1QJM A;  4JWY A;  4RK2 A;  3PPN A;  2ABH A;  3CFX A;  3RLF E;  3PD9 A;  4IO5 A;  2GQ1 A;  4H0W A;  1Y20 A;  4IO6 A;  1SD3 A;  2VGQ A;  5AA2 B;  1FJ6 A;  1DCU A;  5EHM A;  3OEL A;  1ZKB A;  4RY1 A;  4N17 A;  2OJT A;  2OLB A;  3FJ7 A;  5L9S A;  5I2N B;  1TXF A;  2P0S A;  2VOZ A;  1QUL A;  1D4N A;  3T66 A;  2AL4 A;  4PF8 A;  4RK9 A;  3TOD A;  1SPI A;  1FTL A;  3MP6 A;  3E4R A;  4KPT A;  4XXU A;  1S7Y A;  4OVJ A;  1UQW A;  1R9L A;  5I5P A;  4RPO A;  3OMB A;  1ZMG A;  1KWH A;  2XWO A;  5I57 A;  1MM6 A;  2REG A;  1A99 A;  4N15 A;  2H5Y A;  3VXB A;  4F31 B;  4LON B;  2CZH A;  2QPQ A;  4P56 A;  4POX A;  1NV0 A;  5ET7 A;  4LA9 A;  3PPO A;  4F2O A;  1LBY A;  2XD2 A;  1CB6 A;  5ITP A;  3C9H A;  3MVZ A;  2I58 A;  3CR9 A;  3IX1 A;  3TCH A;  4GRK A;  4FOR A;  5DEX A;  5EQ7 A;  1M5B A;  3IFA A;  4Z7E A;  3W9V A;  4P0I A;  4OYV A;  5TP9 B;  4LN5 A;  2QMX A;  5IZ3 B;  4H5G A;  4IO7 A;  4OVS A;  3HHF A;  2O51 A;  3ODB A;  4OZ9 A;  3FXU A;  1I6Q A;  4F3G A;  1T0K A;  5I59 B;  5JTY A;  2BJI A;  2E1S A;  5DVF A;  4YKK A;  3C34 A;  1P1W A;  1Y9U A;  3PV0 E;  2Y7I A;  4BDQ A;  1ZJL A;  4X04 A;  2ANJ A;  4H8I A;  2I48 A;  4OTE A;  1AMF A;  2Z8D A;  4QBA A;  1PEB A;  3OEM A;  4OEU A;  4ESX A;  4JVI A;  4QF9 A;  2NWJ A;  1QKA A;  3I3V A;  3T9H B;  4M4G A;  1XS5 A;  2ZNT A;  2CZL A;  2WBB A;  1H43 A;  2QFL A;  1H76 A;  2MKZ A;  2XXQ A;  4GWY A;  1NV1 A;  4R75 A;  4QRZ A;  3SZP A;  3O97 A;  1B4Z A;  5BUU A;  3VVF A;  4NF0 A;  1M5D A;  3E78 A;  4QFN A;  4F29 A;  5B70 A;  2KLF A;  3N94 A;  3VVD A;  5ITO A;  4OFJ A;  3V8X B;  3CI8 A;  1IIW A;  4X48 A;  4JBZ A;  4N91 A;  1IMC A;  1ELJ A;  3RQT A;  4MNI A;  3LR1 A;  1DBZ A;  4DCX A;  5FHO A;  3T93 B;  3HST A;  1N7W A;  4QFP A;  4O7M A;  1B9J A;  3TDJ A;  3CRB A;  1PDA A;  3IOV A;  1FTM A;  1NUX A;  1B4H A;  2KQZ A;  1VFD A;  1USY E;  1NFT A;  3PMX A;  3C35 A;  4DCY A;  4LQ5 A;  2X26 A;  1SVX B;  3UN6 A;  1FPB A;  4LZ7 A;  3UOR A;  4PDH A;  3KBR A;  4WKM A;  4RXL A;  4I3Y A;  4YB5 A;  3K1P A;  1N3X A;  1NV5 A;  1KA0 A;  3I6V A;  3HV1 A;  3K2D A;  1B40 A;  3OO9 A;  2RF1 A;  3CFL A;  3Q26 A;  4GIZ A;  2RIN A;  4GWX A;  2Z8E A;  4ZEB A;  2Z22 A;  1LEV A;  3A3C A;  2F3D A;  3G3H A;  3FZV A;  4MMP A;  5L9O A;  3IR1 A;  3SKP A;  1CNQ A;  1N84 A;  3CG3 A;  1Y3Q A;  1NL5 A;  2ZXT A;  4DDD A;  4OXV A;  1D9Y A;  4OWD A;  4BDO A;  1PBP A;  4NF5 B;  3B8B A;  3TMG A;  4PE3 A;  3L6H A;  5J1D A;  1G0I A;  5CC2 A;  2ZZV A;  1FQB A;  2GRV A;  3VV5 A;  3C36 A;  3PMV A;  1NV3 A;  1BP5 A;  4WEP A;  2NUV A;  2QS3 A;  4FE8 A;  1AL3 A;  2IEE A;  1MY1 A;  2DYX A;  1URS A;  3EN3 A;  1MDP 1;  1R9Q A;  3O29 A;  5IAI A;  1JP4 A;  4G61 A;  3QIM A;  2XX9 A;  3G3I A;  2B4M A;  2PX1 A;  1SW4 A;  1IZ1 A;  4ZED A;  1VR5 A;  5IGA A;  2HXW A;  4Q8R A;  2HEU A;  3IOR A;  5JEI A;  2P2A A;  2UXA A;  2A5T B;  5CMC A;  1FPE A;  3O6H A;  1PB7 A;  2DP8 A;  2DVZ A;  2DWJ A;  2ZZX A;  1RDX A;  1P1O A;  3PUY E;  4FAT A;  4YKI A;  4OVR A;  3T9U A;  2Q88 A;  2XXI A;  1MH3 A;  1SW5 A;  4F22 A;  4ELP A;  1SW2 A;  2QSX A;  1WDN A;  2H25 A;  5DTB A;  1NUY A;  2HCA A;  1NNT A;  2O6A A;  3OEK A;  2THI A;  4IO4 A;  5L9M A;  4LQ2 A;  1AIV A;  3FVN A;  1NNF A;  1H3D A;  2Y5K A;  1NH8 A;  2WEF A;  1FQC A;  2FYI A;  5FHN A;  3C33 A;  3ROJ A;  3PUV E;  4IY5 A;  1HSE A;  2OWZ A;  4LVQ A;  4MCO A;  1IEJ A;  5ET5 A;  4KD5 A;  1FBE A;  1ZU0 A;  2QL3 A;  3LBS A;  1Y3P A;  1Q35 A;  3H03 A;  4OEN A;  1H44 A;  1NV7 A;  5CMB A;  1Z7N E;  5F1Q A;  2F97 A;  4KFQ A;  1OQG A;  1TFA A;  5T3J A;  1FQA A;  1LBB A;  1M5C A;  3TEP A;  2DWI A;  5KDT A;  1B32 A;  5H8F A;  3FAT A;  1RYX A;  2GHA A;  2X7Q A;  3DP4 A;  2ZNS A;  1B7Z A;  4GL8 A;  4ELR A;  4NWD A;  4R74 A;  1EZ9 A;  3LSX A;  3TTR A;  3LUY A;  3U1O A;  3QYT A;  3RY3 A;  2QS4 A;  4GFR A;  4M1V A;  3RTW B;  4X9T A;  4PFR A;  1BLF A;  3OSR A;  3ISP A;  3FD3 A;  1A8F A;  3G7W A;  1XOC A;  4F19 A;  1OQH A;  4P3L A;  4X1B A;  1P1Q A;  1TFD A;  4YMA A;  2ZYO A;  3MVX A;  4I1D A;  3ONM A;  1IME A;  1LB9 A;  4EQB A;  2XWK A;  2XXV A;  1DTG A;  5AA3 A;  5EQ9 A;  4BLA A;  4Q5T A;  1O7T A;  1XC1 A;  1DPE A;  2PFY A;  3H4Z A;  3TTL A;  3W15 C;  1FW0 A;  4N07 A;  2O7I A;  3SEY A;  5A5X A;  4N6K A;  3GBB A;  2V3Q A;  2RCA A;  5CMM A;  1B58 A;  3T9X B;  4YAH X;  4EDP A;  5CMK A;  4NF4 A;  1ZIU A;  1POT A;  1MM7 A;  4ECF A;  3USD A;  3E9X A;  3L6G A;  4PAI A;  1IMA A;  1M5F A;  2QVV A;  4JDF A;  5I84 A;  1TWY A;  4HE2 A;  5A5L A;  5H8N A;  4I3E A;  1FPI A;  2HQ0 A;  4NHB A;  4HW8 A;  4ZZE A;  5H8H B;  3MVW A;  3AXF A;  5B7D A;  4GX6 A;  2HXR A;  1NUW A;  5I56 A;  4ZEK A;  5DVJ A;  4N6D A;  1BIY A;  2D5W A;  1SDX A;  4O3B A;  1MPB A;  3KN8 A;  1F9B A;  1YPN A;  3JYR A;  1B51 A;  2I0C A;  1EYI A;  5AA2 A;  3O6I A;  4ZS9 A;  2Z8F A;  3SDF A;  1SI0 A;  2OK2 A;  4ZDM A;  4G68 C;  4HS7 A;  4H65 A;  4F3S A;  2FBP A;  3JZJ A;  1NMU A;  2M8C A;  4FBP A;  5I2N A;  3ZSF A;  1D3K A;  4R6K A;  3EHU A;  3PPP A;  4BDR A;  5ET6 A;  1A40 A;  3ECR A;  4NF6 B;  4ESW A;  4FEC A;  2Q74 A;  1Z7M E;  3E3K A;  2VPO A;  4YMB A;  3R6U A;  4X8R A;  2XXT A;  3LUZ A;  4XF5 A;  3TYH A;  5HM4 B;  3MP8 A;  1MY3 A;  3EHS A;  1FTO A;  3B6W A;  2VD3 A;  1B5J A;  3HO7 A;  3S9L C;  2PT1 A;  1US4 A;  4PGN A;  4I9D A;  4F1U A;  3RGY A;  2DE4 A;  4GXS B;  4R2B A;  3K6V A;  4EXL A;  2ALU A;  4NF8 B;  3S9N C;  1DOT A;  3FV2 A;  5I58 B;  3E79 A;  3U92 A;  1II5 A;  1URG A;  2F6P A;  2F6G A;  1US5 A;  3G3K A;  1SQY A;  3LSL A;  2HZK A;  4R2F A;  4MIJ A;  2Y7R A;  3TFL A;  3S4U A;  1B46 A;  3TQW A;  5TP9 A;  5IZ3 A;  3O2A A;  1OLC A;  5M2V A;  1QW0 A;  3M3L A;  2Y7W A;  4U22 A;  3CIJ A;  3G3J A;  4FIM A;  5I59 A;  4NE4 A;  5HBC A;  1JVX A;  3O9P A;  2DOJ A;  3TTK A;  1DPP A;  3LSW A;  2VHA A;  4XEQ A;  5EYH A;  3RT8 A;  2RCB A;  3PPR A;  4FAJ A;  3KOT A;  2OCU A;  3U94 A;  1B5I A;  4ELQ A;  3N26 A;  2XXK A;  2XXY A;  1PC3 A;  4KHZ E;  3TTN A;  2FVZ A;  2UVH A;  3U65 A;  3KN7 A;  5FTH A;  1B1X A;  4GL0 A;  1B1H A;  4F3P A;  3LSF B;  1ATG A;  4PFU A;  2FNC A;  2ZYK A;  3THI A;  4U4S A;  4JB7 A;  2O84 X;  4G2Z A;  2Y7K A;  3MVY A;  4H5F A;  1YYZ A;  1UTH B;  4PTK A;  5BWJ A;  5ESY A;  5FHM A;  1LLS A;  4EF1 A;  3SET A;  4IB2 A;  3PMW A;  4U23 A;  3UK4 A;  5I7I A;  5LTC A;  3D4C A;  1Y1M A;  1LBW A;  2XD3 A;  2XX7 A;  4O94 A;  1GTK A;  4QXD A;  2VP1 A;  1R1N A;  2B3F A;  4LP2 B;  2DDK A;  4OVT A;  1QUI A;  2AYS A;  1MY0 A;  2PT2 A;  1FQD A;  4KR5 A;  4QFO A;  2O7U A;  3H6U A;  3FV1 A;  1NI9 A;  1LAH E;  1BK4 A;  3E13 X;  3I5O A;  3MAM A;  4JVC A;  4GXA A;  1I6A A;  4PFY A;  3K6W A;  1O64 A;  4GX4 A;  3IOU A;  1HSJ A;  3FXB A;  4U4X A;  3IK6 B;  5F24 A;  2H9B A;  1LAG E;  3IAZ A;  5CRY A;  3TPA A;  4YZZ A;  5EHS A;  1P1U A;  1S9T A;  1QUK A;  3K1M A;  1K9Z A;  4MX6 A;  1LCT A;  1M5E A;  4H46 A;  4PP0 A;  3G3F A;  1FBD A;  2OZZ A;  2ONS A;  2AIX A;  1IMF A;  1NKX A;  4L17 A;  1CE2 A;  4YKP A;  4FED A;  2KR0 A;  1XT8 A;  1QGX A;  5AA1 A;  4N6P A;  3V5A A;  1BTJ A;  3KBZ A;  1IXC A;  3Q29 A;  3U8Q A;  4GOT A;  4QSE A;  3OO7 A;  2HAU A;  4NAP A;  1N76 A;  5DVI A;  3T0J A;  4MNP A;  4P0G A;  3EHT A;  3MYU A;  1JNF A;  3H6W A;  1B7U A;  2F5X A;  3H7M A;  4PFB A;  1DMB A;  2HFB A;  4MHF A;  4NF5 A;  1MPD A;  5H8Q B;  2CZK A;  2V3T A;  4OFL A;  4OEV A;  4PCD A;  3A29 A;  1YXI A;  1LBZ A;  1FTK A;  3FVO A;  2DXR A;  3M3F A;  4RYA A;  4C1U A;  4GBV A;  1J1N A;  4HXV A;  1IMD A;  2ZZW A;  3QXM A;  3KJ7 A;  2RC8 A;  4R73 A;  4WXJ A;  4O3C A;  4PE5 B;  4N81 A;  4DIG A;  2DE2 A;  1B3E A;  3A3U A;  1IXG A;  2RC9 A;  4P9K A;  4H6D A;  3FIR A;  1ANF A;  4PFI A;  3CVG A;  3HHG A;  1FRP A;  4F1V A;  3SEU A;  2DS9 A;  4IO2 A;  1FQF A;  3VFJ A;  4KYD A;  4NED A;  3C4M A;  3H6T A;  4F18 A;  1PBQ A;  1GR2 A;  1I6B A;  1RDY A;  4R9G A;  2DWH A;  2O1M A;  5TU0 A;  3K00 A;  2A5T A;  3TQL A;  4GF8 A;  4NQ8 A;  3WAF A;  1LAF E;  4OMB A;  5AA2 D;  2I3W A;  4H1X A;  1AH5 A;  4G68 B;  5KCJ B;  1FPL A;  4FJP A;  1FBF A;  2GFE A;  3PUZ E;  4O3A A;  4MLV A;  4MLQ A;  2QS1 A;  4G8N A;  2P3V A;  4NMY A;  3IO6 A;  4N8G A;  1B0L A;  1N7X A;  2XHD A;  3MC2 A;  1Y4C A;  2ZYM A;  5J16 A;  5FTI A;  4F2Q A;  3Q25 A;  4KYE A;  4JSD A;  3HPI A;  4EQ7 A;  3PUX E;  4AB6 A;  3IOW A;  4H67 A;  4ZEF A;  1MQD A;  3RPL B;  1SBP A;  3VLV A;  2Q2A A;  4TLM B;  5ICT A;  2DWA A;  4EUO A;  1UTB B;  2UVG A;  1Y1Z A;  4PAK A;  2XXH A;  2XXX A;  1YAE A;  3B7D A;  4GWO A;  5CM6 A;  4G4P A;  2I4B A;  4OA4 A;  4P1L A;  1PB9 A;  4KI0 E;  3IB1 A;  5CBR A;  3MWB A;  4QFL A;  3K0V A;  2QVR A;  4ZEI A;  1TT1 A;  2UYF A;  1JVY A;  3N5L A;  4PBH A;  3K4U A;  3KOS A;  5CBS A;  1H45 A;  1GV8 A;  2V3U A;  1LBX A;  4GX3 A;  3EPE A;  1SYH A;  5AA4 B;  3TKD A;  1QUJ A;  3K1N A;  3FJG A;  2ONR A;  1FTA A;  3MST A;  2G29 A;  1LFG A;  1QVS A;  1MQI A;  5IZZ A;  4TOZ A;  3CHG A;  3EQ1 A;  3FVG A;  2GH9 A;  2ESN A;  1O63 A;  4U21 A;  3UP9 A;  2UVI A;  2PVU A;  3FUZ A;  4YU0 A;  4LZ8 A;  3KC0 A;  1MQJ A;  2FHY A;  3EF7 A;  4OVQ A;  4HTG A;  1MQH A;  4PFT A;  3MP1 A;  4KCD A;  5LOM A;  2F8D A;  2V25 A;  3UA8 A;  2Q8J A;  4X1D A;  1RKM A;  1D9V A;  5H8S A;  3KFM A;  3SER A;  5I2K B;  1YTV A;  4JSO A;  1LGB C;  3C32 A;  4F3B A;  2Y84 A;  2V4C A;  4DXB A;  3DM0 A;  5TPA B;  3BIH A;  2QMW A;  5H8H A;  1IUD A;  1QKB A;  3MZ9 A;  3O6G A;  4DZ1 A;  1N04 A;  2QS2 A;  1FPG A;  1NV6 A;  4QSD A;  1KA1 A;  2QVU A;  1P99 A;  4N4U A;  3F11 A;  1N0T A;  1DTZ A;  2D21 A;  4YB7 A;  3UIF A;  3V89 B;  1JEV A;  5KZT A;  4RJZ A;  4NF4 B;  1NNP A;  3CSG A;  4UAC A;  4C0R A;  4PF6 A;  4AS4 A;  4N8Y A;  4MNC A;  1Y3N A;  1FPD A;  4JWO A;  3FJM A;  3N6U A;  2ZMB A;  1NNK A;  4AB5 A;  2ONK E;  1DK4 A;  1URD A;  2FIE A;  1VSO A;  4PFW A;  1B2H A;  1MQG A;  3K6X A;  2P3N A;  1EU8 A;  1B0H A;  1R6Z A;  4NF6 A;  5I56 B;  3CSB A;  1MH4 A;  3IJO B;  2FIX A;  4OVP A;  2WKY A;  2I6E A;  1INP A;  3GXA A;  1B6H A;  1XI6 A;  3MBP A;  1Y4T A;  3ILU B;  5DYH A;  4MF3 A;  4F1Y A;  2REJ A;  1YCJ A;  4DE8 A;  1EYJ A;  4OFO A;  5DW8 A;  3H06 B;  3MW0 A;  4PDD A;  2VT5 A;  5AE4 A;  1BKA A;  4ND9 A;  2VPN A;  4NF8 A;  5I58 A;  4OAN A;  3VLW A;  2XWV A;  3RUM A;  2NVU B;  3B6Q A;  4IO3 A;  3MUQ A;  3TTM A;  3KSJ A;  4PC9 A;  1I69 A;  3T9V A;  3IJX B;  3HFU A;  1JW5 A;  4FEB A;  1FPJ A;  2ZYN A;  3TAJ A;  3FGS A;  4RNS A;  1MG1 A;  3G3G A;  3TCG A;  3KEI A;  3TZA A;  3R7X A;  3FAS A;  1RDZ A;  3SES A;  2Q2C A;  3DLN A;  2XXP A;  5I57 B;  1AWB A;  4GQO A;  4LAT A;  1JET A;  1FBC A;  3ILT B;  4QFK A;  4R6Y A;  4XFE A;  3VXC A;  2R71 A;  4NTL A;  3FBP A;  2UVJ A;  4QSC A;  3D4G A;  2CEY A;  4DI3 D;  2YLN A;  3B50 A;  1XVX A;  4IR8 A;  2O68 A;  3OOA A;  5DEX B;  2G93 A;  1FCK A;  3OO6 A;  3BBR A;  4DLD A;  1A8E A;  4Q30 B;  3Q28 A;  1NUZ A;  1SYI A;  2HHM A;  5EYF A;  2RKM A;  4K3F A;  4BDN A;  1D9Q A;  3IB0 A;  4NN3 A;  1RYO A;  4RPN A;  3M3K A;  1LBC A;  3RYD A;  5FBP A;  2XWI A;  3KG2 A;  5JTY B;  1MY2 A;  2W7Y A;  1NV4 A;  1MXU A;  2F78 A;  3CG1 A;  2H4I A;  4IGR A;  2F7A A;  3V83 A;  4U2R A;  1NH7 A;  1UTH A;  3S9E A;  2R9J A;  3JV9 A;  3K6U A;  2HAV A;  4U1Z A;  2FA7 A;  1MDQ A;  3UGW A;  2Y7P A;  2E0S A;  3IL1 B;  1HSL A;  4KQP A;  4KYS A;  3IOT A;  2F3B A;  3KN3 A;  1OVB A;  3K01 A;  3QUF A;  3QSL A;  4RA1 A;  3TEL A;  4DXU A;  2CMO A;  5LDZ A;  3FXQ A;  4ELO A;  3MZ1 A;  1JW4 A;  4MFI A;  4P1E A;  3RT6 B;  1LFH A;  3VDF A;  1FBG A;  4PET A;  1JEU A;  4JXI A;  4E0W A;  2YJP A;  2P1S A;  4HCY A;  1G0H A;  1MPC A;  2WYK A;  3DP8 A;  2XXR A;  5L8D A;  2V84 A;  3VVE A;  3KC1 A;  4MEV A;  1GGG A;  1MXW A;  1OMP A;  3FXR A;  4NG7 A;  4MAG A;  3QUJ A;  1FJ9 A;  1K9Y A;  1VE4 A;  1B3H A;  5JK4 A;  4PBQ A;  3PTY A;  3QK6 A;  2PBW A;  5EQA A;  4U1O A;  1JW1 A;  2UYE A;  1A55 A;  5DT6 A;  4QHQ A;  3ZS6 A;  4P8B A;  2LAO A;  4XTC Q;  3PPQ A;  3KJT A; 
#chains in the Genus database with same CATH homology
 4XKP A;  3OEN A;  4EXK A;  2BJJ X;  2O1L A;  3BFU A;  3SEX A;  2H98 A;  3OO8 A;  2XX8 A;  1MRP A;  3HCQ A;  1MXZ A;  2X7P A;  1XHY A;  1IIT A;  3FVK A;  1SI1 A;  4BDL A;  3K02 A;  1SW1 A;  2D3I A;  4XKN A;  5H8Q A;  2R6G E;  3RNN A;  2Z23 A;  4NWC A;  4C1T A;  3R26 A;  4AQ4 A;  4EF2 A;  4Q0C A;  2I49 A;  3LC8 A;  4H8J A;  3MZB A;  3H3G A;  1B3F A;  4EQ9 A;  3KGC A;  2A5S A;  3Q27 A;  2B3B A;  3VE1 B;  1OLA A;  4ZZA A;  2F7B A;  2QJE A;  4G8M A;  2I4C A;  4P11 A;  1ZTY A;  4R72 A;  1MS7 A;  2AL5 A;  1S50 A;  2DVC A;  4LUB A;  3IO4 A;  4ZE8 A;  1LFI A;  1VFE A;  3DP6 A;  4G77 A;  4TQU Q;  1MXY A;  3KSX A;  4JWX A;  3OSQ A;  4R6H A;  4F39 A;  1WOD A;  4G68 A;  2QRY A;  5KCJ A;  3RTF B;  4UA8 A;  3W9W A;  3WAE A;  4MBP A;  1LCF A;  1FTJ A;  2IA4 A;  5K2Y A;  2H99 A;  4G8H A;  3T22 A;  1PB8 A;  4BDM A;  1USY H;  3M8U A;  2Q9T A;  5ELV A;  3RN8 A;  3S9M C;  2F34 A;  3OXN A;  5K2X A;  1MY4 A;  2XXW A;  4I8C A;  3S2V A;  4HCW A;  3T96 B;  4XKQ A;  2YPN A;  1Q1K A;  1LST A;  4I62 A;  4MH5 A;  3MPL A;  5CI5 A;  4R9F A;  2ZNU A;  4GD5 A;  1B3G A;  3MQ9 A;  1UTB A;  3GBA A;  1JQF A;  3MPK A;  1OIB A;  1DSN A;  2F36 A;  3MJN A;  2PMS A;  4POW A;  3N6T A;  3GZG A;  4GVO A;  5IKB A;  1LB8 A;  4YKJ A;  2NXO A;  3BFT A;  4KCC A;  1EZP A;  3HN0 A;  4OQO A;  1UIV A;  2OBG A;  3CFZ A;  5HPQ A;  2NOO A;  5AA4 A;  1AOV A;  4GLI A;  4XKR A;  3U72 A;  1B7H A;  1MXV A;  3PGF A;  4YB6 A;  3A09 A;  5KDT B;  1L5T A;  2B65 A;  5H8F B;  4XIG Q;  3RPW A;  3VLU A;  2PYY A;  1POY 1;  3P7I A;  1EH3 A;  1B5H A;  3SEW A;  1IXI A;  1LAX A;  3ZKK A;  4OHN A;  4E0X A;  2I3V A;  4TLL B;  2VD2 A;  1B52 A;  3QAX A;  2HZL A;  3TCF A;  4WED A;  1B3L A;  2O69 A;  1GVC A;  2DQV A;  1IXH A;  1ZBM A;  2XXU A;  1WVJ A;  1IQ7 A;  3B6T A;  3OD7 A;  5I2K A;  2GHB A;  2DXY A;  5TPA A;  3KZG A;  1EZO A;  2V93 A;  2F7C A;  3PU5 A;  2RC7 A;  1FQE A;  1P1N A;  1ZLQ A;  2DE3 A;  4PQJ A;  2I0B A;  3H6V A;  1N3W A;  2Q89 A;  4ZE9 A;  4IGT A;  5A5X B;  3U93 A;  4N13 A;  1XVY A;  1A7L A;  4YIC A;  3O66 A;  4DXC A;  4THI A;  3SEV A;  3O28 A;  1A54 A;  2OWT A;  4Z0I A;  3GLB A;  5H8N B;  4LZ5 A;  2F35 A;  4OER A;  3TUS A;  5ISU A;  1B05 A;  3DEL B;  2OWS A;  1MXX A;  3BKI B;  3ZKL A;  3C31 A;  4OET A;  1UIU A;  2DSF A;  1OVT A;  5ICQ A;  4ONY A;  4IY6 A;  4OES A;  3PUW E;  3PD8 A;  4ZEC A;  4ISU A;  3IB2 A;  5F7V A;  1QJM A;  4JWY A;  4RK2 A;  3PPN A;  2ABH A;  3CFX A;  3RLF E;  3PD9 A;  4IO5 A;  4H0W A;  1Y20 A;  4IO6 A;  1SD3 A;  2VGQ A;  5AA2 B;  5EHM A;  3OEL A;  1ZKB A;  4RY1 A;  2OJT A;  2OLB A;  3FJ7 A;  5L9S A;  5I2N B;  1TXF A;  2P0S A;  2VOZ A;  1QUL A;  1D4N A;  3T66 A;  2AL4 A;  4RK9 A;  3TOD A;  1FTL A;  3MP6 A;  3E4R A;  4KPT A;  4XXU A;  1S7Y A;  4OVJ A;  1UQW A;  1R9L A;  4RPO A;  3OMB A;  1ZMG A;  1KWH A;  5I57 A;  1MM6 A;  2REG A;  1A99 A;  2H5Y A;  3VXB A;  4F31 B;  4LON B;  2QPQ A;  4POX A;  4LA9 A;  3PPO A;  4F2O A;  2XD2 A;  1CB6 A;  5ITP A;  3C9H A;  3MVZ A;  2I58 A;  3CR9 A;  3IX1 A;  3TCH A;  4GRK A;  4FOR A;  5DEX A;  1M5B A;  4Z7E A;  3W9V A;  4P0I A;  4OYV A;  5TP9 B;  2QMX A;  4H5G A;  4IO7 A;  3HHF A;  2O51 A;  3ODB A;  4OZ9 A;  3FXU A;  1I6Q A;  4F3G A;  1T0K A;  5I59 B;  5JTY A;  2E1S A;  5DVF A;  4YKK A;  3C34 A;  1P1W A;  1Y9U A;  3PV0 E;  2Y7I A;  4BDQ A;  1ZJL A;  2ANJ A;  4H8I A;  2I48 A;  4OTE A;  1AMF A;  2Z8D A;  1PEB A;  3OEM A;  4OEU A;  4ESX A;  4QF9 A;  2NWJ A;  1QKA A;  3I3V A;  3T9H B;  4M4G A;  1XS5 A;  2ZNT A;  2CZL A;  1H43 A;  1H76 A;  2XXQ A;  4R75 A;  4QRZ A;  3O97 A;  1B4Z A;  5BUU A;  3VVF A;  1M5D A;  4QFN A;  4F29 A;  5B70 A;  2KLF A;  3N94 A;  3VVD A;  5ITO A;  4OFJ A;  3V8X B;  3CI8 A;  1IIW A;  4X48 A;  4JBZ A;  1ELJ A;  3RQT A;  3LR1 A;  4DCX A;  5FHO A;  3T93 B;  3HST A;  1N7W A;  4QFP A;  1B9J A;  3TDJ A;  3CRB A;  1PDA A;  3IOV A;  1FTM A;  1B4H A;  1VFD A;  1USY E;  1NFT A;  3PMX A;  3C35 A;  4DCY A;  4LQ5 A;  2X26 A;  1SVX B;  3UN6 A;  4LZ7 A;  3UOR A;  3KBR A;  4WKM A;  4RXL A;  4YB5 A;  3K1P A;  1N3X A;  3I6V A;  3HV1 A;  3K2D A;  1B40 A;  3OO9 A;  2RF1 A;  3CFL A;  3Q26 A;  4GIZ A;  2RIN A;  2Z8E A;  4ZEB A;  2Z22 A;  3A3C A;  3G3H A;  3FZV A;  5L9O A;  3IR1 A;  3SKP A;  1N84 A;  3CG3 A;  1Y3Q A;  1NL5 A;  2ZXT A;  4DDD A;  4OXV A;  1D9Y A;  4OWD A;  4BDO A;  1PBP A;  4NF5 B;  3TMG A;  3L6H A;  5J1D A;  5CC2 A;  1FQB A;  2GRV A;  3VV5 A;  3C36 A;  3PMV A;  1BP5 A;  4WEP A;  2NUV A;  2QS3 A;  4FE8 A;  1AL3 A;  2IEE A;  1MY1 A;  2DYX A;  1URS A;  3EN3 A;  1MDP 1;  1R9Q A;  3O29 A;  5IAI A;  3QIM A;  2XX9 A;  3G3I A;  2PX1 A;  1SW4 A;  1IZ1 A;  4ZED A;  1VR5 A;  2HXW A;  4Q8R A;  2HEU A;  3IOR A;  5JEI A;  2P2A A;  2UXA A;  2A5T B;  5CMC A;  3O6H A;  1PB7 A;  2DP8 A;  2DVZ A;  2DWJ A;  1P1O A;  3PUY E;  4FAT A;  4YKI A;  3T9U A;  2Q88 A;  2XXI A;  1MH3 A;  1SW5 A;  4F22 A;  4ELP A;  1SW2 A;  2QSX A;  1WDN A;  2H25 A;  5DTB A;  2HCA A;  1NNT A;  2O6A A;  3OEK A;  2THI A;  4IO4 A;  5L9M A;  4LQ2 A;  1AIV A;  3FVN A;  1NNF A;  1H3D A;  1NH8 A;  1FQC A;  2FYI A;  5FHN A;  3C33 A;  3PUV E;  4IY5 A;  1HSE A;  4LVQ A;  1IEJ A;  4KD5 A;  1ZU0 A;  2QL3 A;  3LBS A;  1Y3P A;  1Q35 A;  3H03 A;  4OEN A;  1H44 A;  5CMB A;  1Z7N E;  5F1Q A;  2F97 A;  4KFQ A;  1OQG A;  1TFA A;  1FQA A;  1LBB A;  1M5C A;  3TEP A;  2DWI A;  5KDT A;  1B32 A;  5H8F A;  3FAT A;  1RYX A;  2GHA A;  2X7Q A;  3DP4 A;  2ZNS A;  1B7Z A;  4GL8 A;  4ELR A;  4NWD A;  4R74 A;  1EZ9 A;  3LSX A;  3TTR A;  3LUY A;  3U1O A;  3QYT A;  3RY3 A;  2QS4 A;  4GFR A;  4M1V A;  3RTW B;  4X9T A;  1BLF A;  3OSR A;  3FD3 A;  1A8F A;  3G7W A;  1XOC A;  4F19 A;  1OQH A;  4X1B A;  1P1Q A;  1TFD A;  4YMA A;  2ZYO A;  3MVX A;  4I1D A;  3ONM A;  1LB9 A;  4EQB A;  2XXV A;  1DTG A;  5AA3 A;  4BLA A;  4Q5T A;  1O7T A;  1XC1 A;  1DPE A;  3H4Z A;  3TTL A;  3W15 C;  1FW0 A;  4N07 A;  2O7I A;  3SEY A;  5A5X A;  3GBB A;  2V3Q A;  2RCA A;  5CMM A;  1B58 A;  3T9X B;  4YAH X;  4EDP A;  5CMK A;  4NF4 A;  1ZIU A;  1POT A;  1MM7 A;  4ECF A;  3USD A;  3E9X A;  3L6G A;  1M5F A;  4JDF A;  5I84 A;  1TWY A;  5H8N A;  2HQ0 A;  4HW8 A;  4ZZE A;  5H8H B;  3MVW A;  3AXF A;  5B7D A;  5I56 A;  4ZEK A;  5DVJ A;  1BIY A;  2D5W A;  1SDX A;  4O3B A;  1MPB A;  3KN8 A;  1F9B A;  1YPN A;  3JYR A;  1B51 A;  2I0C A;  5AA2 A;  3O6I A;  4ZS9 A;  2Z8F A;  3SDF A;  1SI0 A;  2OK2 A;  4ZDM A;  4G68 C;  4HS7 A;  4H65 A;  4F3S A;  3JZJ A;  1NMU A;  2M8C A;  5I2N A;  3ZSF A;  1D3K A;  4R6K A;  3EHU A;  3PPP A;  4BDR A;  1A40 A;  3ECR A;  4NF6 B;  4ESW A;  4FEC A;  1Z7M E;  3E3K A;  4YMB A;  3R6U A;  2XXT A;  3TYH A;  5HM4 B;  3MP8 A;  1MY3 A;  3EHS A;  1FTO A;  3B6W A;  2VD3 A;  1B5J A;  3HO7 A;  3S9L C;  2PT1 A;  1US4 A;  4I9D A;  4F1U A;  3RGY A;  2DE4 A;  4GXS B;  4R2B A;  3K6V A;  4EXL A;  2ALU A;  4NF8 B;  3S9N C;  1DOT A;  3FV2 A;  5I58 B;  3U92 A;  1II5 A;  1URG A;  2F6P A;  2F6G A;  1US5 A;  3G3K A;  1SQY A;  3LSL A;  2HZK A;  4R2F A;  2Y7R A;  3TFL A;  3S4U A;  1B46 A;  3TQW A;  5TP9 A;  3O2A A;  1OLC A;  5M2V A;  1QW0 A;  3M3L A;  2Y7W A;  4U22 A;  3CIJ A;  3G3J A;  4FIM A;  5I59 A;  4NE4 A;  5HBC A;  1JVX A;  3O9P A;  2DOJ A;  3TTK A;  1DPP A;  3LSW A;  2VHA A;  3RT8 A;  2RCB A;  3PPR A;  4FAJ A;  3KOT A;  2OCU A;  3U94 A;  1B5I A;  4ELQ A;  3N26 A;  2XXY A;  1PC3 A;  4KHZ E;  3TTN A;  2UVH A;  3KN7 A;  5FTH A;  1B1X A;  4GL0 A;  1B1H A;  4F3P A;  3LSF B;  1ATG A;  4PFU A;  2FNC A;  2ZYK A;  3THI A;  4U4S A;  4JB7 A;  2O84 X;  4G2Z A;  2Y7K A;  3MVY A;  4H5F A;  1UTH B;  5BWJ A;  5FHM A;  1LLS A;  4EF1 A;  3SET A;  4IB2 A;  3PMW A;  4U23 A;  3UK4 A;  3D4C A;  1Y1M A;  2XD3 A;  2XX7 A;  1GTK A;  2VP1 A;  1R1N A;  2B3F A;  4LP2 B;  1QUI A;  2AYS A;  1MY0 A;  2PT2 A;  1FQD A;  4KR5 A;  4QFO A;  2O7U A;  3H6U A;  3FV1 A;  1LAH E;  3E13 X;  3I5O A;  3MAM A;  4GXA A;  1I6A A;  4PFY A;  3K6W A;  1O64 A;  3IOU A;  1HSJ A;  4U4X A;  3IK6 B;  2H9B A;  1LAG E;  3IAZ A;  5CRY A;  3TPA A;  4YZZ A;  5EHS A;  1P1U A;  1S9T A;  1QUK A;  3K1M A;  1LCT A;  1M5E A;  4PP0 A;  3G3F A;  2OZZ A;  2ONS A;  2AIX A;  1NKX A;  4L17 A;  1CE2 A;  4YKP A;  4FED A;  1XT8 A;  5AA1 A;  4N6P A;  3V5A A;  1BTJ A;  1IXC A;  3Q29 A;  3U8Q A;  4GOT A;  4QSE A;  3OO7 A;  2HAU A;  1N76 A;  5DVI A;  4P0G A;  3EHT A;  1JNF A;  3H6W A;  1B7U A;  2F5X A;  3H7M A;  1DMB A;  2HFB A;  4NF5 A;  5H8Q B;  1MPD A;  2V3T A;  4OFL A;  4OEV A;  1FTK A;  3FVO A;  2DXR A;  3M3F A;  4RYA A;  4C1U A;  1J1N A;  3QXM A;  3KJ7 A;  2RC8 A;  4R73 A;  4WXJ A;  4O3C A;  4PE5 B;  4DIG A;  2DE2 A;  1B3E A;  3A3U A;  1IXG A;  2RC9 A;  4H6D A;  3FIR A;  1ANF A;  3CVG A;  3HHG A;  4F1V A;  3SEU A;  2DS9 A;  4IO2 A;  1FQF A;  3VFJ A;  4KYD A;  4NED A;  3C4M A;  3H6T A;  4F18 A;  1PBQ A;  1GR2 A;  1I6B A;  4R9G A;  2DWH A;  2O1M A;  5TU0 A;  3K00 A;  2A5T A;  3TQL A;  4GF8 A;  3WAF A;  1LAF E;  4OMB A;  5AA2 D;  2I3W A;  4H1X A;  1AH5 A;  4G68 B;  5KCJ B;  4FJP A;  2GFE A;  3PUZ E;  4O3A A;  4MLV A;  4MLQ A;  2QS1 A;  4G8N A;  4NMY A;  3IO6 A;  1B0L A;  1N7X A;  2XHD A;  3MC2 A;  1Y4C A;  2ZYM A;  5FTI A;  4F2Q A;  3Q25 A;  4KYE A;  4JSD A;  3HPI A;  4EQ7 A;  3PUX E;  4AB6 A;  3IOW A;  4H67 A;  4ZEF A;  1MQD A;  1SBP A;  3VLV A;  2Q2A A;  4TLM B;  5ICT A;  2DWA A;  4EUO A;  1UTB B;  2UVG A;  1Y1Z A;  2XXH A;  2XXX A;  1YAE A;  3B7D A;  4GWO A;  5CM6 A;  4G4P A;  2I4B A;  1PB9 A;  4KI0 E;  3IB1 A;  5CBR A;  3MWB A;  4QFL A;  3K0V A;  4ZEI A;  1TT1 A;  2UYF A;  1JVY A;  3N5L A;  3K4U A;  3KOS A;  5CBS A;  1H45 A;  1GV8 A;  2V3U A;  3EPE A;  1SYH A;  5AA4 B;  3TKD A;  1QUJ A;  3K1N A;  3FJG A;  2ONR A;  2G29 A;  1LFG A;  1QVS A;  1MQI A;  4TOZ A;  3EQ1 A;  3FVG A;  2GH9 A;  2ESN A;  1O63 A;  4U21 A;  3UP9 A;  2UVI A;  2PVU A;  3FUZ A;  4YU0 A;  4LZ8 A;  1MQJ A;  3EF7 A;  4HTG A;  1MQH A;  4PFT A;  3MP1 A;  4KCD A;  5LOM A;  2F8D A;  2V25 A;  3UA8 A;  2Q8J A;  4X1D A;  1RKM A;  1D9V A;  5H8S A;  3KFM A;  3SER A;  5I2K B;  1YTV A;  4JSO A;  1LGB C;  3C32 A;  4F3B A;  2Y84 A;  4DXB A;  3DM0 A;  5TPA B;  2QMW A;  5H8H A;  1IUD A;  1QKB A;  3MZ9 A;  3O6G A;  4DZ1 A;  1N04 A;  2QS2 A;  4QSD A;  1P99 A;  3F11 A;  1N0T A;  1DTZ A;  2D21 A;  4YB7 A;  3UIF A;  3V89 B;  1JEV A;  5KZT A;  4RJZ A;  4NF4 B;  1NNP A;  3CSG A;  4UAC A;  4C0R A;  1Y3N A;  4JWO A;  3FJM A;  3N6U A;  2ZMB A;  1NNK A;  4AB5 A;  2ONK E;  1URD A;  1VSO A;  4PFW A;  1B2H A;  1MQG A;  3K6X A;  1EU8 A;  1B0H A;  1R6Z A;  4NF6 A;  5I56 B;  3CSB A;  1MH4 A;  3IJO B;  2WKY A;  2I6E A;  3GXA A;  1B6H A;  3MBP A;  1Y4T A;  3ILU B;  5DYH A;  4MF3 A;  4F1Y A;  2REJ A;  1YCJ A;  4DE8 A;  4OFO A;  3H06 B;  3MW0 A;  5AE4 A;  1BKA A;  4ND9 A;  4NF8 A;  5I58 A;  3VLW A;  3RUM A;  2NVU B;  3B6Q A;  4IO3 A;  3MUQ A;  3TTM A;  3KSJ A;  1I69 A;  3T9V A;  3IJX B;  1JW5 A;  4FEB A;  2ZYN A;  3TAJ A;  3FGS A;  4RNS A;  1MG1 A;  3G3G A;  3TCG A;  3KEI A;  3TZA A;  3R7X A;  3FAS A;  3SES A;  2Q2C A;  3DLN A;  2XXP A;  5I57 B;  4GQO A;  4LAT A;  1JET A;  3ILT B;  4QFK A;  4R6Y A;  3VXC A;  2R71 A;  4NTL A;  2UVJ A;  4QSC A;  3D4G A;  2YLN A;  1XVX A;  2O68 A;  3OOA A;  5DEX B;  2G93 A;  1FCK A;  3OO6 A;  3BBR A;  4DLD A;  1A8E A;  4Q30 B;  3Q28 A;  1SYI A;  5EYF A;  2RKM A;  4K3F A;  4BDN A;  3IB0 A;  1RYO A;  4RPN A;  3M3K A;  1LBC A;  3KG2 A;  5JTY B;  1MY2 A;  2W7Y A;  1MXU A;  2F78 A;  3CG1 A;  2H4I A;  4IGR A;  2F7A A;  3V83 A;  4U2R A;  1NH7 A;  1UTH A;  3S9E A;  2R9J A;  3JV9 A;  3K6U A;  2HAV A;  4U1Z A;  2FA7 A;  1MDQ A;  3UGW A;  2Y7P A;  2E0S A;  3IL1 B;  1HSL A;  4KQP A;  4KYS A;  3IOT A;  3KN3 A;  1OVB A;  3K01 A;  3QUF A;  3QSL A;  4RA1 A;  3TEL A;  4DXU A;  2CMO A;  3FXQ A;  4ELO A;  3MZ1 A;  1JW4 A;  4MFI A;  1LFH A;  3RT6 B;  3VDF A;  4PET A;  1JEU A;  4JXI A;  4E0W A;  2YJP A;  2P1S A;  4HCY A;  1MPC A;  3VVE A;  2XXR A;  3DP8 A;  2V84 A;  5L8D A;  1GGG A;  1MXW A;  1OMP A;  3FXR A;  3QUJ A;  1VE4 A;  5JK4 A;  1B3H A;  3QK6 A;  2PBW A;  4U1O A;  1JW1 A;  2UYE A;  1A55 A;  5DT6 A;  4QHQ A;  3ZS6 A;  2LAO A;  4XTC Q;  3PPQ A;  3KJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...