3H85A

Molecular basis for the association of pipki gamma-p90 with the clathrin adaptor ap-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
277
structure length
253
Chain Sequence
b'IGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKISIAIDDCTFHQCVRLSRSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 complex subunit mu-1
molecule tags Endocytosis
source organism Rattus norvegicus
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
total genus 53
structure length 253
sequence length 277
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A02
2VGLM 4UQIM 1HESA 4MDRA 4EMZA 2JKRM 1BW8A 2BP5M 1I31A 1H6EA 5C7ZA 2JKTM 2PR9A 3H85A 3L81A 5FPIA 4EN2A 4IKNA 1BXXA
chains in the Genus database with same CATH superfamily
3X13A 4HGKC 1QUNA 3DMMD 2VT0A 3K2MC 3DX7A 4W9HC 2C9PA 2VLRE 1GGTA 2VXUH 4Q6YA 4Z7VA 3KCPB 2NT0A 4KXBA 2UY6A 4LHUG 3B43A 4AGPA 4R5VA 3CVDA 3V4UL 2YRPA 3OAUL 2FLBT 1WWAX 4MQXC 1FC2D 4WEBH 5B1KA 2AANA 3T3MF 5JA9A 4WU7A 4NM4H 5TGBA 5MP6H 4YHLH 3DYMA 4M7ZC 1AFVH 3PDOA 3KLAB 1NOAA 5DHVH 3HLAA 4UTBH 4E9WA 5DFWH 3IWVA 3HUJE 4R7VA 1HFUA 1E4HA 2Y6SD 3TT1H 4G82A 1ETA1 1CU4H 2OMNA 1DSYA 1YQVL 3L17A 1PGRB 3B9AA 4Z77A 1BQHG 2GB2A 4P2OA 3WEBA 4J6RL 1D7FA 2R0ZH 1J48A 4X0KA 3S4SG 3RHWF 4G9FB 1CICB 4XMLH 1ZA3A 4X0KB 3SODB 1OGAB 2F9BT 4D0BA 4OLXL 4P3CH 2OK0H 1G9EA 4LSRL 2J7LA 4Y9EA 1BQLH 5C0CA 3IYLW 3U46A 2AEQL 4PP1C 3W9EA 1AY1H 1XGPB 1CFNB 3B3IB 3LZRA 3GXFA 3QZOA 4G5ZL 4NQCB 3V52H 2PXYD 4PJBF 1J9QA 4JFFB 2VN6A 1IKNC 1CG9A 3MSPA 3PYCA 4PB9L 2ITCA 5LGYA 5C0AB 4TNFA 1BVLB 4M7LH 5C0CE 5HI5D 3O4LD 1QUPA 4MDIA 3L3DB 1TJMA 3M7OA 2H1LM 4JY4B 1K85A 1UH2A 1EERB 4S2SB 5E8DH 1NWPA 2J43A 2OW6A 3MACH 3C5SA 4PMFA 4I1PA 2DWDB 2ZKHL 3FZUC 3DLQR 5BOJA 2UZIL 4HF5H 2ALAA 3C9NB 1FO0B 4I9WE 5EU5B 4I18C 4JFXB 4MDIB 1R3HA 1NEZA 1G7LB 2BW5A 2HJKA 2QQNL 2XFGB 1J5IA 4DSYA 5KAQF 2YAMA 1CG9B 4Y89A 3L3KA 4YXLH 1SDAB 3A67H 1CPUA 2JCCF 3WKQA 1NBYB 4YXKH 4O00A 4PJCB 3KLKA 1UQSA 3E6FB 4UQCA 3BEWB 3GSXB 1HOEA 4MB4A 3O6FC 1JN6B 3MTRA 3QRGH 5SX5K 3VH8G 2CKBH 2FO1A 3C5ZA 3UAAA 3GSNA 35C8H 1I3RA 4LDCA 4PGJA 4M7LT 3UTPE 3O2DA 1QD0A 1IC5H 5CN2A 5DVPA 5TK2A 2WZAA 1C16A 4W6YB 2BRRL 3NJJA 4DOHE 4FADA 5AOKA 1JNNL 1WD8A 4P23A 4K2UH 4GXFA 5TK4A 3B6SB 1AKPA 1ZXKA 3HRZC 3L4CA 3BYYA 4L8SA 1I3UA 5F1IA 4Q58C 2CMRH 3JWOL 1AIFB 3ZKSD 5J1AB 2QFRA 3IGUA 2FLMA 3G5ZB 3RZCD 1CFQA 4ORGB 4ODUA 4I18B 4M4PA 2F54B 1JCVA 4G7RB 4XMXA 4C54A 4YZWA 1MJJB 1DBMH 1SGKA 4TMPA 2W65A 2XV3A 4UV7L 1PX3A 2UY6B 1KJ2B 4RGOH 3Q6FA 1BLIA 2XQYK 4C58B 3ZR5A 1HHJB 4QAMB 1A7NH 5TDOB 4OCXH 5ECGA 2C9UA 2EUWA 2AJZB 1WWWX 4QJ5B 3MVSA 1HVXA 1N26A 2UXTA 2R1XB 2Z91B 1ICTA 5DQ9B 1WF5A 1SEBA 5ITFA 2DWYA 4ETYA 2WXRA 3FN3A 5JOFA 3FO0L 1KXVA 4KX7A 3ZLQC 1NCCH 1JCKA 4LPUA 4XXCC 3KR3H 1GZHA 4QDGA 1DDTA 4N9OB 5BVPL 3OKEA 1RAMA 1E42A 3BHBA 3KBHE 5HVFB 1GS8A 4NP4L 4TNEA 1LGVA 4JZOA 5B1JA 2CDEB 2GCYB 4WNSA 4AWJC 3LEYL 4R96A 3FN0L 2Y06H 4ORGA 5ALCL 3QCTL 5KBDA 2OMXA 3BAYA 3CVHH 1N6QH 1X5FA 3H3BC 5HHNB 5T5FA 2VN5A 2X53A 2EDJA 4NO0D 5MI0C 1FFOB 4W9IC 2WLMA 2V2TB 1ZTMA 1MW0A 2VLKD 5CGTA 8FABA 3F7YB 3TBVA 1P84K 2JKIS 3BC9A 3SDYH 1TTUA 1LO2H 2G30A 2WXOA 2BS9A 2CHNA 2QSCH 4L23A 2AV7A 5GZNA 4BSWB 3QXTA 3GJFH 5I0ZA 3ML8A 5J12B 2OL3B 1ZV2A 4L1LA 3GHEL 2ZP9A 3KVDD 3RKDC 5IBLD 1KWKA 5C0CD 5BS0A 3AY4C 4HS6B 5G2NA 4I3GA 4WWNA 2K3HA 1L9RA 5KSUA 1DJZA 4AXWA 4NWTH 4XPGL 3RB5A 4JFEA 3N5AA 3V55A 5D7JD 1CLZL 2IWEA 1WUZA 3MRNA 5TF1H 4I9XA 4QRUB 2ESVA 3RWEA 4IJTA 3ECUA 2NXYC 1XH3B 5DS8B 1TSRA 3NQIA 4ZMQA 5CP7A 1JGDB 4HC1H 5HD8D 2BVPA 2XICA 3IGAB 1A7QL 3WV0A 4GXUM 4FXGA 4NXKA 1X9RA 2HMID 4N2CA 3ZDZF 4KZDH 5F89B 4Y4FA 3QULA 5F9AC 5FCUL 3NCBB 3QQ4B 5E8PB 1V3JA 5ESVB 4FHBD 1G0XA 4XI5C 4CW1B 2I9TB 1ILUA 3D5OF 2R0WL 1I1FB 2IWKA 3RGHA 5BXFB 1W0YT 4QXUL 2ARJA 4Q6IC 3I6KB 1G4RA 2L7JA 4XVJL 2DLFL 3U0TA 4DPAX 3ESNA 1M9SA 4IKNA 2G4EA 3CK0H 4GRLD 2WGXA 3MLUH 1KTBA 1ADQA 1M7DB 4RWYH 1JFQL 3TN0D 5I5JA 4MWFB 1BVNP 4N2LA 5F7DA 4U6TA 5DTFA 4OLYH 4XHJC 2WWMD 4MJIB 5EOTB 3OF6A 5GJSL 2LOEA 4JKPH 3BD5A 4FERA 1ETB1 3KYMB 4LSTH 4J1UB 4ENZA 1NJ9B 1OARH 2LV4A 4N2FA 5DVNA 1JK8B 4DP0X 2XPGB 3DBXB 1T0MA 5E94B 1RUQL 2DQIL 3ILEA 4R0LB 3V4VH 4B9KC 4WKZB 3UP1A 2VZOA 1RSFA 1TJIL 5IHUH 2IGFL 3NZHL 2VABA 3UJJL 1JZFA 5LQBH 4N0UA 4E5XG 1I7ZB 1AGBB 3GMMB 4BWWA 4F2MA 5HYIA 1EXHA 3Q2NA 2EVIA 1HEJC 1B6UA 2AQPA 3C6SB 1DCEA 3B9KC 2ARJQ 1CXIA 2F8OA 4IS6A 1XGYL 1X5AA 3K81A 5I6OA 2ODHA 3MRPB 3OAWA 1OAKL 3T4YA 3TN0C 4BEIA 4WSGA 1M71A 2Y7MA 1JWSB 3BIAX 4IHOB 4LB8A 3FU9A 3FYIB 3V6ZB 1JRHI 1I9IL 3GSVA 3UL4A 4LLWA 3EF4A 4F24A 4UU9B 5L6YH 2WNKA 2WYIA 4G80B 5DJDA 2N4IA 4L8CB 1KCKA 1H15B 5D5MA 4QEGA 5AW3B 1XF5A 5HJ3A 3JWOC 4XBEL 3G5XA 4LT7A 2NY7L 3WMQA 4AVIA 2WQUA 2DH2A 1KN4H 1SOKA 2P80A 2Z64C 4HWBL 5LDSA 1ZGLP 1QA9A 1MEXH 3FRPB 5BRZA 2H26B 2OMZA 1CZ8L 5T3ZD 4DPRA 3RIAK 1IARB 3BWSA 3O8XC 4KO7A 4H8QA 4FXGC 2XXCB 3AY2A 4LQ1A 1ZV9A 4NI3A 5DT1H 5KW9L 4Z7WE 3ZE0E 2AKRB 3MNZA 5FKAB 4KMQA 1DJHA 2Z93B 5J13C 5JORB 3UPRB 1DSFH 5KUMA 3WFDL 2IC2A 3VNZA 2H45A 5CZRA 1TPXB 5AOIA 5A7EA 1N2RA 5BS0D 4U7KA 2OMVB 4GUOA 1ZLEA 4KROB 4PWKA 1UC6A 4F8NA 4OGAD 2YAFA 2ZCKH 3T8XA 4PJFE 1MUJB 5D71H 2MNJB 2WBJC 1KJVB 1NCNA 2HH0L 4K8RH 3UJTL 3DARA 3IDMB 2NUPB 2ESVD 4NUMA 3TBYA 2R9HC 1T5WB 2E7HA 5CU9A 1Z9NA 2NY5L 5FW8A 1FVCA 2VQ4A 3FT9A 3BMWA 4IDJH 2FIRT 2K78A 4B3VA 3EOAA 4QHLA 3ABMB 1P5VB 3PGDA 1JE6A 1U21A 3OLIA 5AL0A 5DFAA 4QHMA 4HHGA 4QRRE 4W81A 1HL4A 5I18H 1COBA 5DHEA 1Z9OA 3SCMA 5CEZL 1T6BX 1A9BB 1M6OB 4HBCL 3AROA 4L9LB 3S3PA 43C9A 4K3JH 2J4WL 1FZKB 4CA4A 3E3QE 3HOGA 2E27L 4JQIL 5ESQA 5CWSA 5J13B 1ZLVK 4ATWA 1NMBH 1S9VB 2J1XA 4P04A 5JLZB 3B2UC 4BCZA 3WNNA 2GI7A 1AHWC 1W8EA 2EXSA 4MNQA 3X2QB 1R24B 4R0LA 4YUEH 4AUYA 1GTNA 4U3SA 5JYLA 4Z7WB 2Q7YA 5ID0A 4WFHE 2CHDA 4LEXL 2YWYA 2IAAC 3SKMB 3KE0A 3ELAT 4LOEA 4ZMPA 1H19A 4JDEB 5GS2D 1TEFA 4JVUA 3QA3A 5D1QA 4HDIB 1Z9PA 2D03L 4PGDA 2AC0A 3ILPB 1SQMA 3QUKA 4GI9A 4XVTH 4Z9KB 3RDTD 3EAKA 1A4AA 1YN6B 5CJOL 1WQVT 1U3HC 4YIQA 4EVNA 2EDWA 6FABH 1TZIB 3MRFA 1BBDL 4XAKE 5AZ2H 4OZGB 2EDMA 1X7TA 2YXFA 1SDDB 3O9WD 1IGJB 2AEIT 3II1A 3L7EA 4ONFH 1Z9LA 2Q20A 4TUUA 5LN4A 4DEPC 1FFNA 3GIVA 3QQ9C 4FLSA 4AT6B 3TF7C 1XHHA 3B9KB 3EH1A 3CFUA 1JWMB 3U0TB 2VO5A 3GB7A 5BW7A 3ORJA 4XXDA 4I4WA 1NAKL 1DUZB 4AYFA 3VSVA 1EGJL 5BZWA 3RY4A 5T1DL 3G9AB 4DUXA 3RGVB 1KJ3L 3UAJC 1C12A 4P9ML 1C5DB 5F89A 3RJOA 1A64A 4FXGB 4OQTA 1SLVA 3QO1B 1WV7T 1IM3A 1EEUA 1GL4B 4POUB 5A2JH 4ZUWB 4P06A 1ACYL 4TSCL 1O6VA 1X9LA 4WV1A 1CE1L 5T5NG 1QOKA 3HAEG 5L4JA 2Y36H 3IXAB 2L4OA 3ULSA 3AB0C 1ZVHA 4KROC 4N28A 4Q14A 1F0LA 1J8HB 1H0DA 2CLZA 3MXVH 4FL4B 4JFPA 4P5TD 2ADYA 1ULVA 4FFWD 2KZKA 3I9IA 3FFOA 4PV9A 1MDAA 2HG5A 4FNRA 5KVFL 4L3CB 4P46D 2NY1B 3SDCA 3FCTA 3MA7A 3DGGB 4C55A 2ZSWA 2H3NA 4P9HC 3OKKB 2YEZA 3MLSH 2H32H 3QPXH 4JFVA 3HZKB 1SY6A 3L1OL 1WBXA 3LNIA 2GIMA 4I5BB 5C0AE 2XG4B 1D5BA 4G9FD 1ED3B 1XCTB 4IRJD 1OAQH 2CDGB 4E9VA 3P77B 1FFTB 3BWAA 1AJ7H 1AOHA 4GW5B 1A3QA 2Z7WA 3DGDA 2ZXBA 1I85A 3C08H 1J05B 1YMHB 3WUWB 5H94A 3GLZA 1SJHA 3K6SB 1QHOA 4NCC2 3OVUB 4DZBB 1AS8A 1L9NA 3ZGIA 4RSYA 4RX4D 2DLTA 1F4XH 3M17B 2E7CA 3ZSTA 1UVQA 2GUYA 4DVRH 3CXFA 6TAAA 2EVGA 3LTVA 1A1NA 3ULVE 1F1GA 1GMIA 1MFUA 1T89A 3OKNB 4NZJA 2Q8AL 1CVRA 1MLCA 3L5IA 5F3HA 4HWEL 5IBLC 5B39A 1QRNB 4ZTEA 1KJ2H 3HFMH 3K4AA 5I1JL 5DJ2B 2QGEA 3J8F7 5HI4C 3ZTJH 2BY0A 3PS6A 3VFOB 4MMZB 4NM4L 1LEKA 2ZKYA 5HYJE 1B0RB 2NY1D 2EYSB 2P8PA 2PNDA 2GKIA 3QUYC 4JPVL 2WVTA 1SEBB 2FWLB 1UT9A 1BD2E 3LPWA 5GGQL 4BK5C 4UT6H 4QRPD 3FOMA 3NCYS 1LYQA 5DU7A 3VXUA 2B7DT 1MVYA 1NBVL 5AZEL 5HGDB 1G7PA 3JV5A 4L3ED 3MRGA 1QAWA 1NAMA 3IU4H 7FABH 1FYTE 4OM0H 1ECYA 2GYSA 4F80A 1IEBA 4V1DA 2MWCA 2DYPB 3L3OC 3EFDH 4WV1C 4KTEH 2HTKC 2Y25A 5E99H 2YWZA 3VE0B 3MRMA 2F5BL 3UTOA 1G0DA 2YGOA 5AW9B 1SMDA 1HJCA 4IEFA 1EXUB 4JY5H 3ZK0A 2F54E 1G7QA 1AP2A 2F7QA 1MY5A 2HG0A 2ENYA 2FO4B 5DMJB 3FTSA 1VACA 1UZ8B 3WIFB 1DVFB 4GKSA 1U2CA 5DUBB 3O11A 4HIQA 1SN0A 2DQEH 2F7IA 5AAMA 2JCCA 3MRBA 4E9SA 1W91A 5BV7L 5JHLA 5D6DA 3FSOA 1AANA 2IV8A 1XGRA 3DSFL 3V4PL 5KVGH 4TSBL 1T7YA 3P73A 3BEWA 2E4TA 3PHOA 3VXTB 5I1DB 5HJDA 1HCYA 1H8LA 1I7UA 3ASNB 1XMEB 4URKA 2AS5M 4FQXB 2XWJB 3EW3B 4YHPA 3V95A 1XIWB 4F8PA 3B5HA 1EO8L 1JYVA 3JV6A 1IJ9A 5HHQB 5L8LB 2UVFA 4R2GD 1MZYA 4K94C 3TBBA 5I6KA 2Q6WA 1P6FA 5CJ8A 3GZKA 2RB8A 4ZXBA 5EU7C 2GJ6D 2E75C 1HWHB 5IBTH 4WFFE 1A8ZA 1KTLB 4BFGA 4UNIA 3O6FD 2NY3D 3HG1B 1QRNE 4RMVA 1XF4A 2E9BA 4EBQH 3BH9B 5SWSE 1TQVA 4BBWA 4NC0B 3FQ2A 1ZHNB 1EUUA 4ZW3A 4ISVA 1QKZL 1BVLA 2NNFA 1E4WH 1DVXA 2YA1A 1V10A 2AJ3A 4UV4H 1UURA 5I1HL 4XC3L 3KWUA 3VFWA 1CDUA 1WVZA 3FU0A 1PZSA 2FBJH 2V0AA 3JWOH 4YLQT 3CV5A 1NINA 4PJ8A 2XWDA 1NUNB 4LLVB 1N0XL 2X9ZA 3SIKA 4XTRD 3A6OA 5IEHB 5I17A 3GBEA 1PDKA 3HN8A 2H1XA 2EKSA 1KIPB 1PKQB 4G9FA 4C59B 1M3IA 1QLEH 5MI0B 1A02N 3GKZA 3MROB 4NJ9L 4Y16C 3FFCA 4X4KA 3X3GL 1N5AA 2HYMA 1H8NA 4UBDC 4APQD 1IFHH 2Y2YA 2JKRM 5GS1C 4NRXA 1FZMA 3I75B 4KY1H 4JFTA 1HH6B 5EUOA 4LXFA 4PLKC 3AREA 4OLXH 4P3CL 2NY3C 2TAAA 1KGXA 3LIZL 4FDWA 1P7HL 3VXUB 4X7EC 4ICXA 1G6RL 2YUZA 4LRIC 5TJWK 1J18A 4WNJA 3H9ZA 5I15L 4DERA 5GS1B 1A7OH 4PAZA 4W9DC 1CD9B 3HRZB 1NFIA 2IQAB 4FQIH 2DQTL 1B0RA 2NY2C 4YBLB 5LGJB 4NQEE 3WJJA 4D0DA 1LEIA 4H8WH 5E2VH 4D3CH 5D70H 1SN2A 4XT1C 1ZJAA 1FNEA 3QDAA 3NP3A 4WI6A 2V9TA 1L9QA 5AWNL 5HI3D 3B37A 1Y07A 1LO5B 2HT2D 4KKBD 4OFPA 1SHMA 4QRTB 1ROCA 4EUPB 5B7MA 3N50A 2B08A 3RYMA 3BKYH 1AIZA 2VQ1A 2W9LA 1PG7L 5DSCA 3MNVB 1UJ3A 2NYKA 2PTTB 2Z4QB 4OIAA 1OGSA 5GGRB 5IVOA 1T3FB 1JXJA 4DUWA 4M7ZB 1U8IB 3OKKA 1S7UB 2CKBL 4TVSa 3S6CA 1DVSA 2W9EH 4UMGA 1A3LL 5AYUH 3ZZQA 3ZUCA 3U1QA 3LDBC 3KPMB 5IF0A 1U3YA 4ODTL 4KJWD 1PY9A 3L8QA 5EU3A 5ELIA 2AJYL 5FW6A 2PXYA 1NCGA 1ZAGA 5E6UB 2FB4L 1W72A 1XR9A 3QZWB 1KCWA 4XWGL 2CM5A 1MHEA 2D7MA 1Q72L 1TZHB 1AGFA 3IVKA 5J89A 4QXUH 1D5ZA 3JUZA 1GHFH 1L4IA 2ZICA 2FEEL 4F8LA 2RFXB 2ICWB 4IRZA 4E0RA 1LNUA 3WIHH 4OCXL 1BZ9A 3C60B 4XNUL 4FI7A 1QWNA 2X4TB 5AOLA 1A4KA 2NY6D 1EX0A 3IJSA 4GI6A 4H8HA 3ZQ9A 4X7CC 3NA9L 5I8CA 2BIQA 4PJEB 1L6XA 4FFWC 4EXPX 1JGIA 1FHNA 3L7EB 4N0FB 3UERA 3CHSA 1UTDA 3P2DA 3U4BH 4O02L 3MROA 4FG6C 3ZQWA 2OKMA 1OSZB 1VADB 3IN2A 1AXSB 5JDJA 2K70A 1SLUA 1YUHA 1KGYE 4RLDA 1SMAA 2BHZA 4CVXA 2F2HA 1FNGB 4R2GB 4QTHA 3KDMB 3DI2B 3MA9H 3CN1A 3TZVD 1TJGL 1GRWA 1YYCA 2ZYRA 5IB2B 1TJIH 4GW4B 3ZDZE 3KGTA 4S1SL 4ZMAT 1IIIA 1YN7B 4H7VA 4YGAB 1FP5A 2Q7YB 4KKAC 4BA8A 4JR9L 4ZOCA 4AGLA 4WZ9A 1RXLA 3WEOA 2AABH 3IDUA 1VFUA 2WLLB 3UADA 1XF4B 4MXWL 2F8XC 4YHIA 4L0PB 1M7IB 5MEND 1XF3B 3BAIA 5BUAA 1U95B 2BNQE 2DM7A 4H20H 4HS3B 3JSSA 4PRHE 4YO0B 1GPOH 1VDGA 2G2NA 3BPNC 4IOSD 3IFNL 5FK9A 1DJGA 2YO3A 1UWEL 3TVMB 3CPUA 4HOZA 4LKCB 5K9JH 1OHQA 3LRKA 4MGXA 1R4XA 4RDBA 3WFEH 3MBED 4HSAC 1LNUB 3K6DA 3F65A 2XA8H 4K9JA 5BCAA 3H7BB 3QC5X 2WLIA 4X98B 1MCKA 2W81C 1CZ8H 4PS4L 1TQCC 5C0DA 3R8QA 1E50A 3IFPA 3NUKA 5IW6A 1EO7A 2HPOA 1FVEA 4HKJA 3H56A 3T8XB 1UACH 3VFPA 3J27A 2G5UA 4B9GA 4RRPG 2R0WH 3E8UL 3SEPA 1SXZA 4ZTPL 3TO4C 1CGUA 2FH6A 4BZ1A 1RIHH 5K9QG 4OZHA 1Z5LB 3PNWA 3II2A 2YR3A 3W57A 3D0LB 3LQMA 4BQCA 4RWYL 3GBNL 3JV0A 4NO0B 1IQDA 4UQDA 2P8LA 3FQNA 2HH0H 4K8RL 3UJTH 1RZJL 1T7ZA 2XJKA 3PWNA 5A2AA 3S5LG 5CIPB 1OP4A 1ASOA 2MJWA 3UBGA 3D0LA 4G71B 3A21A 1XGQB 1NGPL 1QLFB 2DDQH 2X40A 4AQAB 2WTOA 4KDVA 5DZVA 3OJMB 4APQB 2FUQA 3FU3A 3HPLB 3VFTA 1J5OL 1XH2A 1D9KC 3DRTB 5AG8A 5D2NE 3GUTA 4M6NH 3A4DA 1WC7B 1FBIH 4DN3L 2NUTB 4HWNA 1QI3A 1U3HB 3FB5B 5F9JB 3IFPB 2I07A 3QEHB 3VSTA 3TCTA 2JNZA 2ZIDA 3MX0B 3QIWD 2YD9A 4I9WD 4QT5B 5IY5B 4CVWA 5B39B 2A74A 3G6JB 2H41A 2XHNA 3A4AA 1OTUD 4NERA 1BM3L 4IU2A 3RVUC 4DW2L 1BOGA 3F64A 3L7FA 3O2VH 5B8CC 2H6OA 5FM8A 4XZUA 1HHKB 4RFNB 1NFIB 2IQAA 2GTWB 2M8XA 1IQWH 3D8MA 4LVHB 5HGAB 1S9XB 2V33A 1OLZA 4XXWA 3TESA 3EYQC 5D1ZC 3N1FC 3GMNA 4XHQA 3DIFA 2XOTA 1A1OB 5JYMA 3BISA 2VR6A 1IAIH 5GGUB 2D03H 4N0YH 2AV1B 4KK5D 4UNUA 3T0WA 1JK8A 2BWIA 4HJ0D 3S36H 3NFSL 2B3IA 3QIUA 3JTSA 2QMJA 3LSOA 4HG4J 4K3HA 4Z7AA 1YYML 1DN2A 2CDFA 2WLZA 3DGGA 3TZVA 2I85A 2OXHB 1PD6A 1IO4C 4NUJB 1F2XK 3MLZH 4TSAH 4GQZA 3CN4A 4DKFL 1XH0A 3DO4A 2EKSB 4OCYL 4OZFB 3NABL 5AVQB 4AL8H 2NNAB 1L9TA 2A83B 5KVEH 3RILA 1QATA 3MJ8A 1P7KB 2BFGA 2PETA 2PO6B 4P46C 5DT1L 5MEOB 3FTWA 4GS7B 1IRAY 4QPEA 3R06A 4YK4B 4CVXB 3U4EB 2Z8VC 3MLRH 4OM1L 1PY0A 3VFWB 1DVUA 3LHAA 1V3LA 1YCSA 4LF3A 3H0TA 5I74C 3QUXA 4WTZG 5B4MD 2CJSA 3UOAB 3ZHNA 5IJDC 5C0DB 1S7VA 1C5DA 5EIVA 2E6QA 5J6GA 2BVQB 4YSUA 2AVGA 5DLML 2FR4B 3OKDB 1IGIH 1OCRB 3PWUB 3MR9B 4PRPD 4WI2A 3UTSB 5H2BA 2Y36L 1AMXA 4I0PD 4F92B 4S1DC 4BE6A 5JQHC 1JGVL 3HE6C 4JPQA 3CX5K 1CYWA 2RH0A 5C8JA 1EHLH 1Y6NR 1H3PL 1EFXB 2XZCH 3BN9D 2L8AA 3M8OH 2PKDA 3WY3A 2PW2B 3BAWA 4DKAA 1JZDC 4BZ2H 5KVGE 2EECA 1D9KA 4HAFA 2B8OT 4AXWB 3SQRA 3CSYB 4WWOA 4YHKL 3MJ6A 4AKOA 2WLLA 4LARL 3GJEA 2XZAH 1J8RA 4ZQTA 1EEYA 2HVJB 2OSLB 5EC2B 2X41A 3FSAA 3SGEI 1Y6KR 2P80D 5AENA 2F53A 3DX8A 3CVHB 2CGRH 3QEGL 4Y88A 3L95B 4HFUL 5IB2A 1I8AA 3QPKA 4Y19A 3WFCH 1TUPA 5K9KB 4XNAA 1OF0A 2FBRA 3LXBA 2FQFA 4QRRB 4PGEB 2A6IB 5IFAH 4OIBA 3NMEA 5CWSB 4HSQA 1Q0XL 4FI6A 4HK3J 4HOWA 3VWKA 5HDQL 1GCFA 1DLHA 4ACPA 1QHPA 4HISA 2VTFA 4IKLA 1G5GA 2V9RA 1A2YB 3DYOA 4QUOA 3DX2A 1JVKA 1N6UA 2J44A 3MUGA 1QR1A 2FE0A 3CWGA 3LPPA 5PCYA 4JHAL 1LO5A 3C87A 3TOPA 3EOAB 3BESR 1KGWA 4F3FA 4PJHB 4FMKA 3AUWB 1URLA 4LNVA 5L88H 1JGLH 4XN7A 2FHBA 4LASH 3UDWC 1S3KH 3HI6H 4WEBL 3SGJA 1U2HA 1Z5YD 1YHPA 2FT7A 1YEHL 2HX8A 1NCAH 2R2HB 3UG3A 3RI5K 2XY1A 4B9FA 6PAZA 1MG2C 3L6FA 2DIEA 1MJUL 4JY5L 2YS4A 3DVGA 4ZS6C 2XJLA 1W2KT 4FULA 4W70A 2YC1A 2VXQL 3O6ML 1HXMB 3OLEA 3ULVF 5CEYB 5E6ZA 4N26A 5C9JB 5L2JA 3AREB 1H3WM 2GBVA 4EUPH 4TSCH 2C34A 1GKOA 3E1F1 3RHWK 4FMFA 3WTXA 4MLSA 3K6SA 4OFVA 3BVNB 3LXCA 4HJGA 4Y1AE 2VDRL 1HTYA 1WHOA 2XKSA 2OK0L 2OXGA 4F93B 2XWCA 5DJYA 4M9PA 2Z8RA 2PYFB 2ADFL 3S8GB 1BZ8A 4YDJB 4MJ6A 5EF3A 4CSPA 1DP0A 2B5IB 3H4HA 2IQ9H 1OF2B 3BPCA 4WJ5A 3JWDH 3C5ZB 3MLSL 3RDTA 3WAJA 3MRRB 4PB9H 1TTAA 2HA1A 1CDYA 2M83A 3UAJD 4DP6X 1W9XA 3A24A 4OFIA 4PJ8B 2NXZB 1R19A 4X7DC 5E5MB 4A1RA 3QUXD 1BYNA 1AHKA 3NEOA 4N2AA 2GSIA 3T4YB 1OW0C 1R1CA 1VZGA 2UV3A 1Z5HA 4R4ND 3F5WB 2X6MA 1ZGLM 1QSEE 4G1MB 3AS1A 1G6RA 5J6HB 3I84A 4PN6A 1BDYA 3S3DB 1A65A 3GMMA 1DBAH 4NNXA 5C6TH 4F2MB 5DA0B 4E5XA 4I0PA 4JQXA 5IMKA 3S34L 4UB0L 4N0UB 3S37X 5BO1L 1D6EA 4MA1B 1QLEB 3C12A 1RERA 1YDPA 3MO1B 1OLLA 4X4ME 3U2JA 3VRLE 1B4RA 2B15A 1OTSD 2ED7A 2P5WB 2RIKA 2KZBA 4M1GH 3V6BR 4AGOA 5EZIL 1QMUA 2MQ0A 2Q5BA 3S37L 4KVCL 3VXRE 1VKXB 1D9KD 3HZ3A 4FQJL 2XY2A 2EDYA 2VLLB 1SQ2N 5ICUA 5C09B 1DFBH 1LE9A 4WDIB 2YJQA 5CINL 3PRZA 3RAJH 1WUNT 4NRXB 2QPDB 4NYLA 1MZZA 2E76C 2EO7A 2Y7OA 4UIMB 2P7TB 5F6IB 2BC4A 3STLA 3BKJL 4D0BB 3VCLB 1YNKH 4F37K 3IMTA 4EIBA 2AJUH 4OJAA 4P46A 4NO5A 2WNXA 5ACZB 2D7PA 4QTIL 4Z7VE 1XTLA 2YD4A 4QRFA 2VIRB 2SEBA 3REVA 2HKFL 4ZOAA 4GBXB 1E3FA 3D69A 2SEBB 4XAWH 3REVB 4N9GB 1TF4A 2YMXL 1CWVA 1G7QB 3O3BA 5JW5A 5L9DH 1CFTA 2ZUQB 3CFCH 4Q4IA 1Z9SA 4PR5B 5JNYA 3QUYD 1IV8A 2VQTA 4RX4A 3K8KA 1X9QA 4KKRA 1E6OH 1ZA6B 2Y7LA 3LRLA 1A4BA 3MRDB 4MRCA 2IFFL 1R46A 4DKEH 1INDH 2CCLA 4JHUA 4KQ3L 3LRMA 4PWFA 1QSEB 2EEAA 4K73A 1KTLA 3SE6A 1IM9D 2DEXX 3VXMA 1P6WA 5SX5H 3D18B 3T5WA 4GSQA 1J1PH 2O6FA 4F7KA 1QUNB 4AV0A 4ZMVA 4X6FB 1KTDB 4QRRD 5A40E 5HHQA 2DBLH 2KS0A 1LWRA 1YDPB 2AW2A 3DWTA 1HHIB 1OB0A 1WZ1L 3AMKA 2GEEA 4JM2F 3RFZA 1HCVA 2Y7SA 1MI5D 1JV5B 3V0VA 2EJ1A 1WZKA 2OTUA 3AXLB 1JFHA 1TNMA 4K5PA 4YSSA 2EC9U 4R5XA 5EIIA 1XV8A 2JH2A 1PMYA 3F12A 4HS6A 5D2NA 3PGCB 1B88A 3HAEB 3WTTA 4CVZB 3CE1A 5I1LA 3CMOH 4A7GA 3QXAA 5IQOA 4RBPH 4HW6A 4EDXA 1ZLWK 4OQTL 4BSWA 3RWJB 1T4WA 5IMLB 3MC0A 4WFHD 1NA8A 3H2QA 2EDTA 2CR0A 2F1BA 4IGBB 4P5TC 3WUWA 1OCWH 3IFOB 4BQBA 1MCOL 4U1MB 3GNMH 1UD4A 4IEFB 2YSTA 3UPRA 1JHKH 2H0JA 4FABH 1H3VA 1KBKA 3M45A 4PRIA 1C8PA 1OD7A 1XXFC 4I77L 5IBUB 4XPGH 1N0XH 1QG3A 1SN5A 5GRZA 1CXEA 3JBG7 3UAJA 2X05A 4UQ2B 4M62H 1NC4B 3V6OE 5KBNC 4M00A 5SWSB 4I89A 5ICZA 5CP3H 1A5FL 4TUKL 1CTNA 3UPCA 4JFPB 1UFGA 1OCZB 1H6UA 4F15B 2P4AB 3VW3H 3OV6A 1QBBA 5F1SA 2YK1H 2A2QT 2G60L 2IPTL 2WBWB 2XFXA 2NY6C 3K8LA 4Z7UE 4APXA 4F8TA 1N10A 1BAFH 4OJDH 5HYSB 3QNYA 1E65A 2HLFD 2ORBL 2BHFA 3NJHA 4B3EA 2VL5B 2VMCA 4ANVA 4RNRB 1CICC 2J5WA 1S7WB 4JW3A 5DEGA 2W60A 2I60H 2OX5B 1K5NB 3AZUA 3P30L 3PP4L 1CLYL 4AM0Q 4IGBD 4YH6A 1QRNA 1HKLH 2KLTA 3BKMH 3C8KB 2DQTH 4L1TA 4X5PA 2CNYA 3BP6B 3VH8B 2H32B 2D3VA 1U58B 1DEDA 1LTXA 2EEBA 5B38G 3ZIMA 1E30A 2D31B 4WAFA 2B2XH 2YFOA 1X6NA 2YLKA 2IF7A 3N06B 3LRGA 5I24A 1HOCB 4POZC 3SD2A 1J1OH 4OLEA 4QD2E 1U30A 3TTSA 3RUGF 3WKNA 5KS9B 3BWAB 1WBYA 3CFBB 3DOSB 4U49A 5GXBB 5JR1L 1BG9A 4FN0A 1S2EA 2B4CL 3VDBA 3QJVB 3VO0A 5CEZE 4PLOB 4A2GA 1XAKA 5D1XB 3OB8A 4BA0A 5IV2A 3AXHA 4P2QB 2AEPH 2VAAA 5D1XA 3E6FA 3FCTB 5KSAB 3MLTB 4IKIA 2APSA 5K9JL 1U8HA 4CSZA 1VFOA 3MOAH 3HKFA 3HR5A 4U1LB 5T33H 2X89D 3MJ9A 5EUKA 4F7TA 2FJGB 5GS0D 4U3SB 5FO7B 3CN2A 4RMUA 5E4OA 1G43A 1EEYB 2HVJA 3L3JB 4PWIA 1A6UL 2XTJE 4WK2B 1E9OB 3F7VA 3MJ7A 3MBEC 1JZ5A 2BH0A 1A22B 4KC3B 1CYXA 2F6AA 1AR1C 1AXIB 2OCFD 3LEXA 4LVOB 4PSRA 5T8IA 4WO4B 1CI5A 4U1IA 2MSPA 3H55A 3SCMB 4ZUUB 4H26B 4U1IB 1Q8MA 4FMVA 5IB5A 3ZL4H 5BZWB 1Q72H 3VJ6B 1HZLA 1WH0A 2YD2A 3QJOA 2ZUQC 9CGTA 4ZAKC 1MI5A 5M95B 3BVVA 4OU3A 2CPUA 1G7HB 4YSDA 1YAZA 4FXKA 4AYDC 3CZSA 3EO1B 5L2KE 3QT2A 1BF8A 1L0PA 1XGPA 1YEJH 2GJPA 2ZOKB 4GBXC 4WWKD 3WS3B 1U8JA 4Q9CA 5FECB 4PJEF 1AR1D 1KN4L 2X4SB 2NQ3A 5E2WH 5IJKC 3ZDYF 1PKQE 4MQSB 4YHNB 1LK3L 3QI9C 4NBYB 2N0MA 5HHPA 1OGAA 2C1PA 4XRCA 1IB5A 4KKAD 3MLXH 2YLHA 4OJFL 2FJUB 2PXYC 3F04A 1BZDA 1E3ZA 1K3IA 4NZTH 3FCSA 2OPCA 4XB8A 5FFLA 3VXQA 3NPSB 1WICA 3HC2A 1WHPA 1CR9L 1XSKA 4RISL 3NP4A 4OV5B 2VISA 2NW3A 2IFGA 5ILTH 4N8CL 4C4KT 3FCBA 3BCFA 3QO0B 1M53A 1P1ZB 2A5UA 3VA2C 1K9TA 4YJZL 3QRFM 4TOYH 4BZ2A 2C1OA 5F7LB 4TQIA 5DMYA 4FG6D 3R18A 3ATDA 5DMGD 3A22A 3RUGE 2DQJL 1A14H 5DK0B 2WIMA 1HOCA 4LVEA 3IDJB 2R7EA 3T3PE 1XX9C 4NQEB 3QORB 4OJEH 4M1CD 1S46A 3UZQA 2OL3H 4BFKA 3VYPA 1LLAA 2YPVH 2VDOH 1ZGLA 5I1LB 3NACH 2H32A 4WHYG 4ZYKA 1SNRA 2AQTA 5IFJA 2YUXA 4XP4H 3RBGA 3N85L 2X09A 4YSRA 2X3BA 4J23A 4HHWA 4BRVA 5D1ZI 1CDCA 3DK2A 3ECVA 3CIAA 4H44C 4RAUA 3S2CA 1T03L 2OP4H 1N18A 1IGMH 1XGZA 4YHYB 2DL2A 4FFTA 4IU2B 2E27H 4JQIH 2BNRE 3SDAC 1QRND 2WCPA 1NEZG 2J1YA 1ZIBA 2UX6A 2D9QB 1U36A 2NW2B 3KJ6H 3H42H 2DQCL 3GTVA 4NPYB 1TQSA 2J72A 3REWB 3U7WH 3VFNB 4DN4L 1QSEA 3DHPA 1SDYA 2VGLM 2W65B 2X2UA 5CEZD 3NABH 3E8VA 3SKOB 2AMUA 4Z8FL 5TE4L 3T1FA 4X6CB 2MNWA 4M93C 1QFWH 5DVLA 3TYFA 2A1WL 1I1YB 3G5ZA 4Y1SA 5E94A 2DMKA 4NAMA 4HJEA 1UWXH 2A77L 2W07A 1MQKH 1AE6L 3WCYA 4AMXA 1EJ8A 1NJ9A 4CAGA 2RGSA 2UWEF 4H0IA 5D8JH 5MENE 1NWOA 5BRZB 4KWUA 3JV4B 5TH2B 1JPFA 4MD0B 4S11A 5DLMH 2X4RB 4IMKA 2BSSA 2PPDA 4JPKL 4PTUB 2X89A 1HINL 5IG7B 4K9EL 3IFLH 4JAMA 4XCYA 4AVHA 5MENA 4Y5VB 3OX8B 4AMWA 5IHZB 5D2NB 1OCOB 2WSKA 4MJ4A 4BKLA 1BREA 4KO6A 5FUZH 3VX0A 1ZSHA 3H9YA 3UABA 3MCYA 5IW6B 5BRQA 3U9PL 3ZE0B 2W38A 4PWGA 4EI5A 4XMKH 1A66A 3DV4B 1RZKC 4IBSA 5CGYC 3WO4B 5EEWA 1EDYA 2VLKB 2X1PA 1R3HB 1ACYH 3MO1A 1FBIL 1BYOA 4DN3H 4H0GA 4F7EB 2APXA 4JPIB 5IMKB 4HULB 4O58L 3CDZA 4S2SA 2OTWA 5AVTB 3F6LA 4Y1AB 5CP7B 2GBUA 3B7YA 2B1AH 3QEGH 4PW3A 2XZZA 4UBDD 4X83A 3ULUC 1U8KB 4TLKA 4F27A 4TV3A 2WXIA 5EC1A 3HHSA 3QGVA 1MRFH 2YKLL 4M1DL 5IFAL 3QPXL 4HS3A 4W4OA 2HKHL 4A37A 2F5AH 1IQWL 4N8VA 5FLVA 3ARWA 2CCWA 1NFKA 4AEFA 1ZHLB 1F8TH 2WLKA 4OLZH 2C9VA 5JOEA 1RZIA 5CLTA 3T04D 2P42B 2RHEA 4UILL 2EYRA 1VRSA 4PGCB 5AAMC 5BS0B 4LSRH 1UEYA 1E8YA 1P4LB 2BNQB 2QMKA 3FBQA 5DZAA 4EN2A 3RFZB 2A38A 2DS4A 1MJ8H 1B2WH 5FKPB 3IGLA 1KCSL 3O8XA 3R7RA 4MJ6B 4U31A 4O5LL 3PP3H 1SJXA 1BD2A 4DVRL 1OL0A 2PYFA 1YYMH 1JPGB 4H2CA 1KB5H 4NQTA 4Z77B 4LPYA 3B2XA 3I3EA 2IG2L 3NSYA 4QHNB 3TBVB 2P7TA 3CTTA 2UZXB 1GH7A 3W1ZA 5B1CA 4DKFH 4HWEH 4KVNH 5ALBH 1CGSH 3GSNH 1KT2A 4AYMC 2YAQA 3U2IA 1ASPA 4YDIH 4ABUA 4V1DE 3KEHA 4R96B 2R0KH 2QVTA 4HIIB 3QVAA 3O9WB 4DCQB 5C08D 2ZP8A 3MLRL 3S5ZA 2AJVH 4HMCA 1A6VH 2GT9A 4M3HA 1A6TA 4PJEA 5C09E 4H0LC 1DZBA 4OCSL 2VERN 1GZQB 4HOXA 1W16A 2BVPB 4YR6A 3EJUA 3N55A 4L2YA 2PO6C 1G1KA 3GJFB 5EU4B 3LMJH 3F5WA 5T1KD 1KPUB 1JWUA 4HVBA 3AITA 1MAJA 1FORH 1IGCL 3Q8EA 4RAHA 1XEDA 1FG9C 3ES6B 1AYRA 1FHGA 4HEPA 1HCFX 5FEBA 1ET5A 3HZVB 3P0VL 4FD0A 2WLNA 2F5BH 35C8L 5KYUA 2WINB 1H3PH 2HJLA 2J8HA 1IGFL 3N40P 5KN5B 1INQB 5E9AA 5ESAA 5J3HC 3O41A 3PWPE 4U6YA 3EXJA 3GRWA 3OAZK 3BPCB 2WCSA 1F42A 4OZIB 1MVUB 4MYPA 2AV7B 3ZT6A 3MOBH 3B7RL 4U6HA 3W9DB 1RIVH 4PJIE 4J3SA 2JJTA 5DQJB 3RPKA 1GR7A 2OXGB 3O4LB 4YXHL 4MHHI 1LO4H 1K5WA 4PRBA 3AU1B 2BZ7A 2VM9A 4NKDB 2VL4A 3FXIC 3D3VD 2XWZA 4JFDA 1T3FA 3CFDA 5FYJE 3UZEC 3LNHA 4S10A 1UJ3B 2PTTA 2OS7A 1XFPA 1LDPH 1ZS8A 1DBAL 1KLFA 3VACA 1HXMA 3B2UD 3FT1A 4M8QA 1E9QB 3IPFA 2KL6A 4Z0BH 1JERA 3QIUC 4U6YB 3QUZC 5BO1H 4J7RA 1MFAL 4TVPL 5IROC 3QUMB 5T3ZH 2FT8A 3QORD 3MTXA 2ZWKA 1JXFA 1D9KB 3X1GA 4PRPA 1QSFE 4K94L 3GSQB 5JHAA 4PLNC 3WNOA 4QHUB 1MCWW 1BEYH 4MSWA 4RA3A 5CINH 5FGSA 5HGBB 4Z18A 4YDVB 3CVBA 4ZSOA 4DQAA 4J27A 5EEZA 1EUTA 4ELKA 2AJZA 3FN0H 3BDYL 1RUPH 1SXCA 5FA3A 4DP1X 2YD6A 1E40A 1E4WL 2YEVB 1NEUA 3GHBH 3EO9H 4LSUH 2WAHA 4GRLB 5DUMH 1JGLL 1FCGA 2R39A 5EO9A 3UAEA 1MHHB 3BH8A 1OAUH 1OM9A 3O0RL 1ZA6A 4LE8A 1U4FA 1SMOA 4I2XA 3P0YH 2CA3A 3L4TA 3RIKA 3V0DA 3ZE2F 5JNYB 1XR8B 4GRWF 4CKVX 1AXTH 3OXRA 2IBZY 4XP9H 1HEHC 3K80A 4PJAE 2BVYA 3MQIA 4IRZH 2LTQC 4F58H 2DBJA 3B2PA 2VZ3A 1ZANL 1QLEL 1HI6B 5IJCC 3CFMA 4PBDA 3GHEH 1N5AB 1NCDH 4P4KA 4MVBD 3DUUA 1FL5B 3X3GH 1TQBC 3LJ3A 3GMOA 3NFNB 3W2DL 3MBEB 1ZA3B 1F3DJ 3O8XD 1ESOA 4ELME 2VZSA 2F53B 2DQ6A 2ENPA 2DMBA 3DX8B 4C4BA 2EXWC 4EDWH 4L37A 4ODXB 4GKNB 1SVCP 5EHFA 5EC2A 3TBTA 3DUUB 5I1IL 3WKMH 2ZUWA 5MEQB 2CDFB 2DPKA 3E3QC 3IGFA 5E00A 4PP2A 3RKPA 3TZVB 2EVHA 1UXMA 3EZ8A 5E1HB 1CE6B 3WN5C 2YAPA 3CSYA 1A7OL 3MJ9L 4JO4L 1CGXA 2DKUA 1T1WB 3PHQB 1WO2A 5KSVB 4QR7A 1P4BL 4HJUA 1M1SA 5IK3A 1BZQK 2X42A 5C08A 4JRYE 2F19H 1QNZL 3UC2A 1PTZA 4W4OC 5F7YC 1JP5A 2I7SA 3ILQC 3EJTA 3L1GA 1J11A 4E5XB 3G04A 4MD4A 1ET7A 2YPKB 5D7LD 4ELKB 4XVJH 4AQEA 4CC4C 1ANUA 2NZ9D 1N3NA 15C8H 3PU7A 5HGBA 3TH3T 4QT5A 3EGDB 1JGUL 1P69B 4X5QA 3LPOA 3BVUA 2DYPD 4O2FB 4UB0H 1R0AL 1FIGL 3RDTC 5CKGA 4OKVB 1TZGL 4QCIA 1D5IL 4Y1AD 3RL2A 3QJQB 2IH1A 3ZYJA 2ZAHA 4JKPL 4R4FL 1HL9A 1T66D 2C9SA 3TBTB 25C8H 5GRVK 5MEQA 2NNAA 4M8QB 5E8EB 4M62L 2FAUA 3FFDA 4UAOC 3D33A 3HE7D 3KWXA 1L7IH 1R5IA 5DJ8A 1BAGA 4AQAA 2UWEE 3ZRFC 1NH6A 4YDJA 4TUKH 4ZG1A 3SE3A 1AC0A 1U3ZA 5D6CB 2IDSA 4U2ZA 4X8XA 5EEVA 1QFPA 1YNKL 4P2QD 4YDKH 1H3TA 1IBFA 4LO9A 4FFVC 2Q0ZX 4RQQB 2WP3O 3VD9A 2GIYA 3UJJH 2APTA 4PJ7F 1F56A 3VG9C 3JWNG 3KYOB 3S96B 3KW7A 3SYCA 4FLOA 1BIIB 4XE0A 5HD8C 1Q9OA 3IETA 1OGTA 3PE9A 1CLYH 4HCFA 5KN5A 3TPUB 4F8QA 1ZHKB 2X6BA 3OZLA 3TNMA 5KYUB 2K8MA 3KCPA 2XDHA 4KJYA 3JTBA 1UOKA 5DRWB 1E9PA 4NZUH 4GMTL 3VGAB 4G83A 2C7UB 4HH9B 4DPCX 4DKEL 1M2VB 3ULUL 2IFFH 1RULH 5JTWA 4DHLA 2B2XL 3VXRD 1EPFA 2HJFA 2R29H 3Q3GA 4YQXL 3MX0A 3RTQC 4E41E 1TTCA 4PWEA 1JI2A 4UAHA 3AS2A 5DC4B 1U3HD 4C4KO 5E9NA 2XKNA 1PZ3A 4KRMB 3CH1A 1GXEA 1KLGA 1R75A 3DRTA 2KPNA 4W9JC 1EWHA 1CTOA 5SWZE 1M1XB 4OD3H 2Q8BH 3UIYA 3EKCA 1RP9A 5E9DD 1SLXA 2J73A 1T20B 3Q5TA 3NCXA 1IBGL 5J11C 2XBTA 2J57A 1KDIA 3W3BA 1ZS8B 1T1YB 1TOXA 1QLFA 4XGZB 1UH3A 4A6YL 3KDPB 3BVTA 4NQEA 1DQKA 4GFXA 5T1MB 2KQMA 3T0BA 2R56L 5EF2A 4PBXA 5I1KH 2ZWZA 3AU1A 4NKDA 3V0EA 5IOPA 4OI9A 2XBZA 3BQUD 3Q9PA 1XAUA 2FCBA 4DZ8A 3OMNB 2FJSA 3ZN6A 4OZHB 1J0YA 2WMPB 2VWEE 3PV6A 5H37G 3E6HA 3F01A 4JZJC 1KCUL 3NZ8A 3VU1A 4YX2H 2VISB 2G4GA 3MA7B 5I19L 4OGZA 3DJRA 4PI2A 3QUYA 2HJLB 4MDJA 4PJDF 4R8WH 3RVTD 5C0EA 4BGDA 4JRXD 3VFPB 5C71A 5DD0L 2Z31A 4OKDA 2EDEA 3S5YA 4QXTB 3IDGB 4JRWA 4L3EB 1WZMA 5MHSD 5EBWB 4F2EA 3IDNA 1UM5L 4JPSA 5K93A 3UGXA 2ZCLH 1TYJA 2Y2TA 3DMMB 3CN0A 1LK3H 3CC5B 3SJVB 5GIRA 2GJZB 1UGNA 1XZ0A 2J2ZB 3QZBA 4NRYA 3LH8A 2YK1L 4JO2H 3X3FH 4LBEB 4EUPG 1MPAL 3KBEA 2FDBP 4FXKC 1ZT1B 2JI3A 2EDLA 3MODL 1JV2B 2W9DL 5F0JB 1NFDA 4J2QA 4BQ9A 4HOMA 1XEUA 4MASA 1PNCA 4N8CH 5EN2A 3UO1L 1TZHA 2BFVL 2VDPH 3N41F 1M3JA 2CK0L 5E0QA 1R3KA 2QGBA 1RIHL 2NR6D 5C0EB 4ZS7L 4EIGB 2FHFA 4G8IA 4XH2B 1TO5A 1F58H 4X4YB 1SLWA 1SDDA 2Y24A 1D6VH 2X7LA 4TM9A 1SYVB 2CO4A 3RWIA 3U6XA 3KLHD 1FYHB 2FEJA 4ZW6A 1CGTA 2BSBA 3HE7A 4Y4KA 5EUKB 5GS0C 3TFKD 1U8OB 1JGEB 1X5IA 5FF6B 2K6ZA 1XIWD 3TBSB 2AK4E 2R4SH 4P2QA 2VCOA 4XCFH 1P84J 1EGJA 2OQJA 3N85H 5ADPH 3QIUB 5DCCA 1H6FA 1J5OH 4DIXA 4TUJA 3FSZA 4N85A 2EDDA 5EU6B 4LAJH 1VADA 4FZ8H 4R5TA 2D0GA 2V7HA 1V55B 3BXNA 2VW4A 3DDFA 4PJ8C 1AS7A 1W72L 2V2WA 3B3BA 3W0WB 3K72B 5A3IC 2ATPB 3QCUH 1YEDB 3IJHB 4TVUA 1QPXA 4ANWA 1XIWC 2XC8A 5FV1L 3S48A 2QHLA 3REWA 1RZFH 4E41D 3LKNA 3KYAA 2CBTA 4XWOD 1DUYB 3C2SA 2HTLC 4Y5XB 3KL3A 3DPBA 1A6UH 4F7CA 3GXUB 3O45A 2BX5A 5AALA 1KB5A 2NTFB 2PCFB 3U7WL 2QADC 3HPJB 4KHXH 4WWID 3QJZA 4AQ1C 2R83A 4WFFD 4O4YH 1MFNA 3BUYB 4O2EA 2VL5A 4LNRA 4EJ1C 1U3HA 4DGIH 1ZK9A 4FG0A 1TYEB 2BSTB 4NGHL 4BZYA 3MRCB 3UC0H 4XCNB 3TP4A 4R7DA 1IBYA 3K1DA 5F8RC 2EDRA 4PB0H 2WB7A 4G5AA 4ZYKB 1KUMA 1OIOA 4ZD3L 1G9HA 2G3MA 2Z0BA 1HHGA 2DWTA 4L1SA 5INDB 1G9NH 1I8MA 3ECBB 5DD6A 2J5LB 4OCYH 1FZMB 2AQNA 3I75A 4MNGA 3O3DA 4PJ7A 4DTGH 2OZNA 3IDJA 4HJ1A 4FXLA 3VTTA 4K9EH 2ZXQA 2CIIA 1BLNA 2GK0A 4P3WA 5DFTA 4E9XA 2FZ3A 4FHJA 3VFVB 2XCMC 4CGTA 5INCA 3JWDC 1RK7A 2WCGA 3CDGB 4GJTB 2I32A 5HYJB 1Q94B 1XMWA 3CVIL 3KGSA 3GGWB 1MCPH 1QWHA 5I1EL 1H9VA 1PDKB 2AEOA 2OJZH 5F7EH 4GQQA 2CUIA 3X11A 1JYXA 1S7QA 3HG5A 2VQ1B 1K4DB 1RK1B 4Z76A 1U93B 1FAKT 4GAFB 2JKSA 4Y4HD 3CXDL 4LAQH 4LESA 3EDDA 2G5BB 3VU2A 3DJ9A 3FCSB 4UIKL 1XXDC 3T65B 1QP1A 4R4BA 5IR1A 4XB3A 4YHML 4HKJB 1X5XA 2DQJH 4BKSC 2E7BA 1OZTG 1MCDA 1EJFA 5FPIA 1T2JA 1S7RB 3R4RA 4WHTB 2R1WB 3WY4A 3EOTL 2B1AL 1PLGH 3T2LA 5CUSL 3STZA 1LL1A 3BRFA 2A73A 3M8OL 2IXQB 3KWWA 2VDOL 4IBYA 2V5MA 2UXFA 4Q97A 3D52A 1FAIH 2BXYA 3CZEA 3QDMA 4XOCA 1MRFL 1JWSA 3W0WE 3V4VB 2RAMA 3WHE1 1SUHA 5AZEH 2L0DA 2YA2A 1KXQE 1UA3A 4M8VA 5BRPA 4OTXL 1NLDH 3APDA 1F8TL 1Y0LB 2CKBB 2X9WA 5IB5B 2VN7A 5TQ2H 4X9BA 1KENH 43CAA 3MU3A 2VXTH 3P9LA 3C09C 5FK9B 3TVMA 2NY2D 3C6SA 3SDDB 4HIXL 4ODHL 2AEWA 1XL4A 4KTEL 1T22B 4BDVA 4J6IA 1PZUB 3PWVA 1OSYA 3MCKA 1LDSA 1M7IA 1TDQA 3TFBA 1FGVH 2IPKB 1OGAD 4O5LH 1OAXH 3KL5A 3M07A 1UD8A 2DQGL 2P49B 3GKWL 4NZFA 2R59A 3L3IB 3FJTA 4PWJA 2FT6A 4N90D 1SM3L 1Z3GH 3L45A 4XNXH 4PR5A 3L4UA 3P54A 3TCXA 3ARDD 2C9RA 5CD3B 3QCVH 5HGGS 2DQMA 2GG1A 1KPVA 5TQ0L 1HZKA 4Z3JA 3B83A 1HEZB 4HZLA 1E8XA 2KI6A 1LWHA 4OV5A 3DSFH 4JMNA 4S1QL 4TSBH 5DK2A 3V4PH 3NIFE 1EJ6A 5JZ7C 2C9AA 4Y5YC 1ZK5A 1MELA 4JG1L 2DB8A 1A6VL 3SYAA 3US0A 2AXGB 4P46B 5FO2A 2VJXA 4GXUN 4Y2DC 2NTSP 4LFHD 4EN3D 2JJTC 4PJXA 4PY8I 2ZOKA 5FECA 3O2DH 3PL6D 3GSRB 4JJHA 5K59E 1AI1L 2OV0A 3N44B 2ARJB 1CLOL 1X3DA 3R1GL 4CILA 1JF6A 3FU7B 4DEPB 2XVKA 4HWZA 3P0VH 4PMEA 3S0PA 2BINA 3VI4A 4N24A 1YECL 5DZ9A 1U92B 5DO2D 4MSWB 1MJUH 5FUZL 1IGYA 4ZBJA 1Y6MR 4BKTC 4UI2A 1WYJA 4CBZA 1QQDA 4YHPB 4RNRA 4LDOB 2ZG2A 4FRWA 4ZPTA 3US9A 4I0PB 2J88H 5EFIA 1I7UB 1U6AL 4FA7B 5KYXB 1HHHA 4PVNA 4W9KC 1XR9B 2E9JA 1KBWA 3B5TA 4IBZA 1CFSB 2TRHA 3WIAA 3QFJA 3RWEB 2JIXB 1XGRB 3INOA 4J2XA 3GXIA 3V9FA 1DLFL 1FWXA 2DI9A 5JMOC 2VB5A 4D9QD 4FC3E 5D2LA 3B4NA 1WISA 3ZKXB 2JCCB 3T0EC 1P7BA 1AHWB 3I02A 2GC7C 2EDBA 3O11B 1JTPA 4B9IA 1DQDH 4LCYA 1SJHB 1T4KA 3M88A 2OZ4H 4JHWH 2HKHH 1N68A 1EAQA 4I3RH 5EZJB 5E1IA 3QE5A 5HDRA 2D7NA 4TNGA 3QJFA 4Y2LA 2J56A 3RVXC 1EA9C 3DIVA 5PAZA 2WTRB 2AGJH 2O5YL 1I7RA 4M56A 1T4KB 2FWOB 2R4RH 2W1NA 4HJGB 2ZSWB 3NEEA 8FABB 5EULV 3I3BA 3QEUA 2B59A 5IJBC 1RCYA 3VXOA 4D94A 3NBNA 5IB4B 5JXEC 4PRHD 5GGSY 3LPFA 3MFGB 2FEDC 4XPTL 1E67A 3BDYH 1WS7A 4X6CF 3W0WD 3WJJC 1W80A 3V0HA 1KPUA 2F8IA 5I2IB 1FSKC 2DM4A 3DBSA 3KW8A 5D70L 5D4QA 2VLJA 1MAMH 4LCUB 3L6FB 4EI5D 2VDNB 5AAWA 1OP3H 4RGMB 1E4XL 4N8VG 3P0YL 1AZZC 3FH5A 5E4EC 5EA0H 1IC7L 3RDJA 3EOYG 1P7QB 2QADD 2QQKH 4G70B 5J5EA 1U8LB 4F58L 2XFXB 2RTTA 5E8NB 1SJEA 5IGXL 2Z91A 3TVMD 4BFEA 5B7FA 2ZXEB 1UUNA 2DTML 2QBWA 2MH4A 1WFMA 1UUSA 4ACTA 3NSFA 4PS7A 1MFVA 3CFEA 1R5WB 4GKLA 3K2UH 4PW4A 5DVMA 4ZX3A 4ZX5A 1N59B 4XMLL 3UZVB 2FGZA 3N40F 5IEKB 2IVFC 4G8FB 1F90L 5TE6L 2AXJA 5AVYB 4JO5A 1N8OE 2BZDA 2BNRB 1FNAA 1FGNL 5EV7A 5DUPL 2BOBA 2FH8A 5JIQA 3EFFB 4OD1L 4YC2B 3WIHA 1ETZA 2IANA 1O7SA 4LVOC 2XG4A 4D8PA 3SOBL 3BIBX 3BAXA 3GMPB 2PP7A 3U2SB 3HG1D 1AVAA 3ILPA 4JFQB 1N4XH 2Y5TA 1DDHB 2ZOTA 4ODSL 2CE6A 3MV8B 1GJWA 1ORSB 3SE3C 1LMIA 4M7LL 4LFHG 2EYRB 1E6OL 1BFTA 2WBKA 4FNUA 4RVBA 3L95A 1ZHLA 2CBOA 2QVFB 3FU8A 1DVYA 4ZFZB 3X1NA 4W9GC 4XX1E 5AW1B 1BSIA 1KJMA 8PAZA 2OSYA 2LFEA 3O3UN 3HHSB 3HAEA 1P0SE 4G6MH 4KKQA 1E28B 4HETA 4AK1A 5KSAC 5DMKA 4UOW0 2FX9H 2A4EA 3N1PC 2BIMA 2CHZA 3IMBA 1D7BA 2VLLA 5DZPA 3ETBJ 1OCCB 1JPSH 3IJYA 4IOFD 4LP5A 2EIEA 3UMTA 5JMRA 4KV5E 2UY7B 1VPOH 4L4VB 2EVJA 3CVCA 2WW8A 4JFXA 3EYSH 2AQSA 4KTDH 3RTLA 3D3VB 2QGCA 4J3OC 2EZ0C 3D18A 3FQ1A 4MJID 4PJ9B 4WTQA 3HI1A 4P57B 4Z95H 2ZQKA 3U0WL 1Q38A 1E2WA 2A73B 2OA9A 3B9KA 3QR0A 4JREB 4YFLI 3TYGL 4ERSL 1YZZA 1HNYA 5DMKB 1O6SB 1OP3K 1YPZB 1IBBA 3HN3A 3ZYOA 3NCCB 3G6AB 1RUPL 4BWTA 4DPBX 2JQMA 1DL7L 5BUGA 3RX8A 3C60C 1KBVA 1LJMA 1NBZB 3P4LA 4LSUL 2W0PA 4MZ3A 4K2UL 2BSRB 1MQ8A 2ED9A 3HJEA 1MCOH 1LP9B 2VKXA 1BXAA 3Q5YA 3L3GA 4HDIA 4QAWA 3ZHFA 5FYJD 1WS8A 1AD9A 4FFVD 4XN9A 1UZ8A 3WIFA 4R97B 5I5MA 3APCA 1E8WA 1KPVB 4WJ5B 3UTSD 1DBML 3AAZB 4IIQA 2PP9A 3I9PA 4MCMA 1SOQA 2HTKD 4R3SA 4P3DB 1HESA 3QUZA 4WNQB 5I16A 1Z2KA 4JFDD 5K9KA 5D7HA 5DJYB 4PHXA 2OXHA 3KAAA 2WOYA 5I1GL 1J0HA 5FHAH 4DKDC 4YFEA 5JZ7D 5FCSH 1J0ZA 3Q2WA 3CSPA 3O3EA 2IDQA 3UBXG 3N6YA 3G5VB 1YEWA 2I5YL 3PDOB 5CS7A 43C9B 5AVZB 3PXJA 1LK2B 2Y1YA 3KGRA 4EN3B 3KS0H 1ONQB 4QGTA 4GG6E 2Q8BL 1S9XA 3JYBA 1UYWH 4Q6IA 5DJXB 1UD5A 1I1CA 2ZWNA 4M3KB 2CO6A 2EABA 1RVFL 4FZEL 3V6ZA 5HYSG 1MWOA 4L1DA 2BSCA 1N64L 4Z7VB 4PS4H 2EQDA 3SJVD 1GGBH 5ACMA 3WE1A 3EJZC 3L2NA 3BSZL 5I23A 1QI4A 2IMMA 2QSTA 3WL9A 2WBJD 3STZB 4A6YH 5BUPA 1G6RB 4RFEB 1S5HB 2EIBA 4HEME 2WPGA 3QRBA 3GZPA 4DWHA 5IFJB 2N01B 2YPVA 3OKNA 1A1MA 4OD2B 1IFGA 4PJHA 4WHCA 1AGBA 2K0RA 3E8UH 3FHAA 4MCZB 2JKJA 4OLUL 5FIEA 4BUQA 3CLEL 3NH7H 2F58L 3LN5B 4J3OD 2K7PA 3MRKA 3E9UA 5H94B 4NN7C 1YYLH 3GBNH 1DN0A 1KCUH 3Q44A 1E6JL 1HWWA 4FNTA 4YX2L 5LBSH 2V2WB 2IO5A 2AEPL 4FXTA 3A47A 5BO0D 1T0MB 3TJHC 4XPAH 5D7KE 4F5CE 2B1HL 3MNZB 3CUPB 5HYJA 2X6AA 1A4JB 1UA6L 4P4RA 1KYAA 4EZMA 5T33L 4Q9RH 3G9VA 4OZ4A 4O2CB 3D25A 2NW3B 4OF7A 1GOFA 3FYEB 1MCIA 3KYMA 3ISYA 3K5SA 4F5CA 1UM5H 2HLAA 1IM9B 3ZTJG 1RUKL 2EC8A 1JF1B 1F6LL 4WWPA 4X6EA 1A7QH 5HJ3B 3QJSB 3MUUA 4MJ2A 2DAVA 2P47B 2X1WL 1WZLA 4GI8A 2CLVA 3RFRA 4DUVA 3HB3C 3BP7B 2FJHA 4GG6B 2XUWA 4LQFH 4TTDC 4FJYA 2OJEA 1MI5B 1KPRA 4X8CA 3UO1H 2O72A 4KJPD 5T5NF 4L18A 4JRFA 4ALAL 1EAPB 3MGTA 1IILE 4HAKA 1Y7VA 4Q9QL 3HS0A 2YQ2A 4XODA 3W37A 3CK0L 1KB5B 5C8JB 1F58L 2IBZX 4YLBA 4NZUL 1XZ0B 2C7FA 5E4IA 1EZSA 4S0TD 4DEWA 3ULUH 4UT7H 1HZHH 1J12A 2Z7UA 2QJDA 4H8UA 2YBRB 3V4PB 5A6LA 5CFAA 2Y3AA 2X1XR 1I9JH 1EMTL 2HT4C 2R2EA 1HCZA 4H0HB 3NIDB 5DJCB 1XB3A 3BJ91 3IDGA 5IROD 3OHXA 2QSVA 3QQ3B 4M6AA 3AC0A 5GRJH 1CIDA 2L7QA 4Q2ZB 5ADPL 3DX4A 5CZXD 4RIRB 4FQLH 5KSUB 4OD3L 4TOYL 2PF6A 4FQ1L 1CI3M 3INUL 3O6FB 1ZDQA 1NLBH 2E86A 5DO2C 5CXPA 5IBUG 5K39A 1VZIA 4PV1C 1UT2A 2JB6B 1OPOA 6PCYA 3SZ6A 1JZHA 4GXVL 4KITB 5FF6A 5LHDA 1HQ4A 4PJ9D 1L3WA 4U3CA 2WNGA 1V7NH 3F7LA 2Z7YA 2R56H 1HQ4B 3UTQB 4BWUA 4E41B 2QPFA 4A7TA 5GZOD 1WIOA 1CTMA 1WBYB 1XD1A 2YPVL 1VENA 5K33A 4E9TA 1HQRB 2LLGA 5I6XC 4CN1A 3LSOB 3LRSB 2HB0A 1DDHA 3ZYZA 4G8IB 4Q0XH 3DX6B 4XI5D 4QMEA 3C5ZC 4RIRA 4BDVB 4BRJA 1OAKH 3EGSB 4CC1A 12E8H 2MOQA 4KXZI 1T20A 5ANME 1WP6A 1EIBA 5JDSA 2GTQA 5IMMB 1JGVH 1NANI 4G8FA 4TLSA 3DOIA 3RVVC 4AE1A 1QNIA 4R7NB 3BHBB 4ECNA 5DD0H 3UG4A 3PWJA 3LB6C 2BP8B 3CZFA 4PB0L 3VXNB 4DJMA 5IW3A 3SJVA 2X4TA 3LX9A 4QHLB 3KJ6L 3SYPA 1U41A 4LLQA 1U8PA 2R23B 4WUKH 3DXAE 3MR9A 3QDHA 4I0CC 4IHBA 5DD5L 2YKKA 4GP4B 4HS8H 4WHTA 2CAKA 5E8NA 2Z8WC 3MRNB 1F02I 4K23L 2EVFA 2YGNA 4KH2A 2OR9L 3RFZC 4JO2L 4R4BB 3X3FL 3GLDA 2K1MA 3TTYA 1G7IB 4LCCA 1MCPL 1KJ2A 2VLJE 3QUYB 3LN4B 2VC2H 3K71A 3L13A 1OGTB 3MODH 5D7JC 2VR8A 3ARBC 2COVD 3EYUH 1T7XA 2A0LD 1I4FA 4XO4A 4UOQA 3KYOA 5CBAB 4U3HA 1S7QB 3HKZA 4OZFA 4WW2C 4FKEA 2Q86A 4DZ8B 2EC9T 2CD0A 1LEGA 3U30B 2O5ZH 3QPQD 3DUSB 4JPKH 4UT6A 2ISDA 3PJSA 1GAFL 3QH3A 5F7BA 1SHWA 3F7YA 4YS4A 5E6RB 4OCRH 1HH9A 1I7RB 3JTSB 4FI8A 3EOTH 5DD1L 3RLSA 3SPCA 5DSCB 1TVDA 2YD3A 5I75B 5GRXG 3HC0B 4JRXA 4MMZC 5D7IE 1JN6A 5J9PB 1B3JA 1GYWA 1KFGA 1T21B 1RKRA 3NGBB 5C0BE 2BP0B 4TL4A 4BFIA 2G0KA 4MCNA 3ZU8A 2WP3T 5J8OA 4NQVA 1S3KL 1Z1WA 2GK2A 3NCWA 4PUBH 4XNZC 1YEHH 3UTZA 1YEIH 3HJ0A 3WELA 3MRPA 3ROLA 1KYOK 3QZPA 3LXUX 2IMNA 5EU5A 1HHHB 3QG7L 4N2KA 1SFDA 2YPKA 1UB5B 4J4PC 1RHFA 2YQGA 4OQ1A 2CH8A 4YUEL 3RUGB 1N8ZA 2D2OA 3D51A 4XNXL 3Q6FB 4E42A 2CO6B 4KHXL 1HKFA 1I75A 2VR4A 5GJTL 4QOKA 1QYGH 1KCVH 1NL0H 2F18A 4WKZA 2NR6A 3ZZLA 5SWSD 3HE6B 3B7UX 3VYOA 4ZFGH 1U95A 4FG2A 3CFKB 4HP5A 4JDTH 2Y1ZA 4KZCA 1BZ7B 5CJBA 5C3TA 3T0EE 4WI9A 5EF1A 2HVKB 3LB6D 2VIRA 3V7AG 2AK4A 4P2QE 2CIKB 1D7CA 4X7TB 2Q7NA 3V79C 4D8OA 2VM4A 3P3RA 1U2YA 3S4SB 4HPHA 3MRIB 1WAAE 1NCJA 4IU3B 4Y4KB 3FFDB 2FNBA 1DQQB 3DTXB 5DR5L 5ACZA 3WEXB 5BQDA 5FWQA 1ZJBA 2JJUA 1PFCA 2EICA 1KC5H 2X7LB 4FQHA 2NYYC 4P4KB 4TQHA 5C0ND 4HUXB 3GSXA 2FLRT 3RWHA 3WFHB 2BP5M 4EE2A 3GS0A 1NKGA 3RGVC 3IGKA 2OJZL 1IAIM 4E36A 3MKKA 5T1LB 3VXPA 1AXSA 3PCYA 3L54A 3EJQA 1N7ML 1B90A 2WVSA 3RB7A 4X5WB 4WI7A 5KBPA 1TQWA 2R51A 2Z1PA 1MHHA 3BH8B 3D4ZA 4N0FA 1O6SA 4PJCE 2W0KA 3AM8A 3MGOB 3OAUH 4ZAKA 4CU7A 2NZIA 2Q3XA 3C9NA 4JUSA 4YSPA 4M1GL 2NMSA 4L5FE 4YHLL 5D7IF 1FORL 1IGCH 1AFVL 1B0GB 3JWNE 3KHQA 5FDWA 4ZPVB 5J7CC 3FHQA 2P48B 4JY4A 3KLDA 3O6LH 4UTBL 5C0BB 5J6HA 3SQBB 1HNFA 1E7VA 4PGBB 4G2AA 1PW3A 1IGFH 3JV6B 2DN7A 4QRUA 4X4ZA 4XO9A 5DHVB 5CD5D 3QIBC 4ZW7A 5C0AA 2VDML 4P5KB 2WWNA 3MBWA 3L1OH 2Q2LA 4UOZA 3BZEA 2HX7A 5J1TC 2B39A 4AG4L 2VLRD 3BN3B 2O5XL 1INEL 2VXQA 4LCWE 2AGJL 4PP2B 4AX3A 2MRYA 1AJ7L 2ZXDA 5EU7E 5AKVA 2X1QA 3E6HB 3N44F 5AG9A 2OJ1A 4FEMA 4MS8D 1DQLH 2BMKB 2QSQA 1JVLA 5IR1B 4V2BA 3QFGA 3L9RB 4P5MB 2CXGA 4GEJA 1PVHA 1A6AB 1O0VA 5DJAB 3X12A 4C56D 2G9HA 5DC0A 2Y1VA 3R0NA 5JXAL 1A0QL 3MLWL 4KTGA 1VACB 4JO3L 4KK6D 5BMFH 1OWWA 3PQYA 1KJ2L 1INDL 4G6KL 4KQ3H 3VWKC 3PFQA 3ETBF 1ETZB 2IANB 4D8PB 1Q94A 3MRMB 3MACL 5L2JB 3WU1A 2OMXB 3H6JA 3DVIA 1ZLSH 1CK0H 5C7ZA 4HF5L 3K6NA 4OW6A 2BM3A 3BEVA 3CFQA 1KFAL 4LHUA 4U1HB 4H8WC 4ZUSA 2DBLL 4MVBC 5GGQH 4LLUA 3CH1B 3S8FB 1OZUA 3PV7A 5HGDA 2Z6FA 1WZ1H 1O9WA 4X99A 3THML 1T6WA 5F7NC 4TRPL 4HG4K 4LLDA 1JPTL 3QEQD 3EO9L 3QJHA 5DI8B 5DUML 4F33B 1S5IH 2NX5D 3KPNB 3B2DC 4YXKL 4Z78A 3TO4B 2PWGA 4K8RD 4F33A 2R2BB 1T80A 2RQEA 5IW1A 4DP2X 3IU4L 4NKMA 3L2LA 5AYQA 1OAUL 3O0RH 3VMNA 5EDSA 3QWOA 4X99B 3BJLA 5DHMC 1AGFB 1ASQA 4K55A 1PL3A 2QELA 4FLHA 5DGQA 5DUPH 2H8PA 4XN4A 3S3CB 1HN1A 1YECH 2AZUA 3D4YA 4MA3B 1VEOA 1JZ3A 1G5AA 2GITB 3FO2B 1KIUB 3RRQA 4U4BA 2W59A 3WS6A 5E51A 2VN4A 3PLYA 2K3TA 4ZFOA 3CHQA 3BH4A 1BF2A 3GMQB 3GSUB 4C83B 2QVIA 3CFDB 1JHKL 3K6FA 1I82A 2N1KA 4LRNL 3K2KA 4D0CB 5JW4R 3QEUB 1JRHH 2XN9E 4ZNCD 3VFSA 2JTYA 1PIFA 1NMAL 2IADB 3FOLB 3QUXC 3WHXA 3SY0A 2CQVA 3L4VA 2JJSC 1A5FH 3GJFK 5EZOH 5JW3H 2LU7A 4N2GA 3MNMA 2XYBA 3T2PA 2YEZB 2G75B 1R33A 4I3RL 4AGMA 1FO0H 4FP8L 3FQRB 4Y4KC 4YDLC 4WW2B 2NQCA 2Y2WA 4XO5A 3S35L 1HK6A 3EYSL 4AQ8A 1AGEB 4R26L 3SDXE 4ZNEE 4IRSD 1QRKA 1E5YA 3ZE2E 3MLPA 2ETWA 2X2HA 4YHZH 4AEEA 2CO2A 4Y9BA 2E56A 4XP5H 4HQQL 3X17A 3CZKA 4LSSH 4ETQA 2J1WA 2X3AA 4B7LA 3SE8L 3FF8A 3RU8L 4DGVL 2VJ0A 3IPBA 4JFZH 4XBMA 1V27A 4ZXBB 2OMWB 3ARZA 4WUUE 4X4XA 5C07A 4ELMF 3FB7B 1S7VB 4PJ6A 3RX7A 1HE7A 2ITCB 3ARBB 1IC7H 1IMHC 5FA4A 3RQ3A 3PAYA 1HXYA 2IAMD 3HMXA 3I6GA 2A9NH 4LSVL 1RZPA 3MJ8B 3OKMA 3E1ZA 2ICEB 3LZOA 1FE8L 3KL0A 3EJJX 5DVOA 1UXSA 4BHUA 3FUMA 3LZNA 4NT6A 1KZQA 3MRBB 4P5RA 3QJUB 3RP1A 1L9OA 1JPST 2PW1A 1P7QD 2QADB 1QFOA 2HWZH 2I5YH 2OMYB 2N7SA 5I75C 1DTUA 2FQEA 2IBGA 1SUJA 3QHZH 2MPVA 3APNA 1BQSA 1RJLA 2A6KA 1EJOL 1JD7A 1N4XL 1L7TL 3OXRB 4HC1L 4ODSH 2OFQA 4G6FD 2XU9A 3VE0A 3NCJL 4V1DB 5GRWA 3LKSB 4KOBA 3QEQE 4KAQH 5HHOA 4BZ1H 1DJYA 4UZSA 1KV7A 2A6DB 4NPYA 2CGZA 2PTVA 5AW7B 3RWDB 3VFNA 3SHSA 3DOHA 5HVWA 4PRHB 1KBPA 2GVYA 4TNVK 3SDDA 5K1VA 2ESVE 1LO0L 5TFSL 2WC7A 4B95C 2EH7L 1GJUA 1NDGA 4KXZH 1L3NA 2YHGA 3T6QC 1YEJL 3TURA 2FVNA 2GSMB 2A6JB 1A6WL 1MH5A 1OTTC 1DBBH 4ONHB 1OAZH 3MLYH 1CLCA 1W0VA 4QXWA 5IESH 1BBJA 5GJSH 1YNTA 3DV6B 5CR1A 1KGJA 1NSNH 3IPEA 4NZTL 5FM5O 5KSBF 1CGYA 1RU9H 4KPHH 1NGZA 2BS71 3BWUC 2XN9D 4LSTL 4G8EA 1OP5K 4CVUA 1A3LH 2XWRA 5GGVY 1W8NA 1OARL 5HYFA 5TE7L 4MAUL 2VLRB 4XVOA 3GIZH 4KTYA 5HHMD 1I1RA 1WFOA 3HBZA 4G6AC 4GKSB 2VITA 3JTTA 4RMWA 4I7ZC 2LAAA 3QJTB 1U91A 3U9WA 5GGVL 3ZXAC 1T04B 1MFDL 1QBMH 3I74A 4TULH 3CZUB 1A21A 4XWGH 1KXTA 4LQFL 2OL3L 5C70A 1LO3L 5FUOL 3SPIA 4N2IA 3SGEH 5CNHA 4GG8A 3TA3A 4MNGB 1XGYH 4TN9A 5I8EA 3DROB 3DXAB 5ADOL 4AEHH 5FYLE 5I1GH 5AB2A 4MX7A 1OQOA 3HEIB 2PYEB 4AJ0A 4G8GD 2XV6B 1IGML 4A39A 2VJ8A 2NY0C 2KLSA 1F00I 1PLCA 2LVCA 3IDXL 4MJIE 4JJ5A 2DKSA 4PHZA 2W9DH 4MJ5B 1G7JB 2PR4H 5C0NC 3PWJB 2DQCH 2ZX9A 4XN2A 2IOOA 3EGXA 5IMMA 1RLBA 1RJZA 1M56B 2VR9A 3B9KD 1MREH 3V6OC 5IMOB 1NIEA 4A2HA 4Z1PA 5J11B 1FDLH 2VABB 5HHXH 1L9PA 3WFDH 2VXSH 4JG5A 5D5ME 4IBWA 3O2WL 3PHAA 2B14A 2HAZA 3KLSA 2DWXA 2I9LB 3IKCB 2MOVA 4MXWH 1C1EH 5IHHA 2R2CA 4XP6H 3HB3B 2DOCA 4GW4A 1WBXB 1SEQH 1I8IB 1NOLA 1TTBA 2XWEA 4PGDB 3LS4L 1QLRB 1IKFH 12E8L 3NCYP 1EBAA 1HINH 1V7ML 3SZKC 3HUJF 2E7MA 3JXAA 4YBHA 1ZVSA 4M1CC 2UXGA 1BZOA 3VXQB 2HFTA 5DO8A 4L3CA 3SKMA 1YUHB 4P2YA 4EN3C 3SGKC 1DANT 4KJPC 3GBML 4MAYD 5DWUL 3OHMB 2IADA 1MLBB 1GY1A 4ZMTA 2YPLD 2HRPL 1RHHB 1R24A 3BLBA 4MWFA 5GS2H 1KIQA 3W5MA 2Y5QA 5HHOD 3VTMA 3BFOA 6CGTA 3HIZA 5DD5H 2YJLA 4MJHA 4ZS6D 3QDGD 4CN6A 4PJFA 3RG1C 4G42A 1RUKH 1YG9A 1LXMA 2FATH 2MQCA 1ZIAA 3WI9A 3ULVD 4XNQA 3VMPA 2OR9H 1AQDB 1NCHA 4M9OA 4NCC1 4TNWF 5K5YA 1KIUA 1R47A 1VFBB 2YSSA 2W92A 1DE4B 1YC8A 5H37H 3RWCB 2QPEB 1FLRL 2PN5A 3CAFA 4R97C 1J1XH 3FMGL 1DQVA 5DZNA 3SGDH 4BUGA 4L4TE 5JO5A 3ULVL 3GTNA 3VD7A 4XMTA 1XSOA 3CC5A 1PEZA 2IWFA 4ZD3H 5D1ZA 2HT3C 3HR6A 3EADA 2YXVA 1NUFA 3MJ7B 4PJ5A 5E2UH 3TXAA 4NC1E 4NC2B 4PREB 4AI7A 4YDVA 3FSWA 4ZSOB 4AT6A 4XX1G 4Y5VA 1AZCA 3ALPA 5D7KD 5IHZA 5EEXA 4OCRL 5AEAA 4PJ5E 2ADGA 1IVTA 4ONGL 2ED6A 4HUNB 3G6JF 3QUKB 4Q6KA 1KLUA 5EWIH 3QRLA 1BQHA 3QUMA 1IUZA 1TZ8A 4EF3A 1MW2A 5IV2B 1KB5L 3EDJA 5GSRB 3TWCL 4KX8A 5FR3A 4FQLL 3NTCL 3CUPA 4Q74A 3X1FA 2JB5H 3MNVA 4WW2F 4F7PB 1CGSL 1PFOA 3GSNL 3MRJA 5FYLD 3IFOA 3WJLC 2HFEB 4AIZB 4X6CA 4HFWB 5IVXF 3AS0A 4Y16A 5C0FB 1QA9B 3FRPA 3AS3A 2R0KL 4BH7A 1OSPL 3NQKA 3K6OA 4QRTA 4EUPA 4FTVB 3SKNB 5SWQB 3OWEA 2JVUA 3MCLH 2C4XA 1KOAA 1NM9A 1Q9WB 2CZNA 4NWUH 1WFNA 2VLME 4AVKA 3S88H 1CCZA 2WHVA 1XF5B 3D39A 3UYRL 1BJ1J 1TG8A 5LNEA 4PPTA 2LW3A 4WI4A 2R0ZL 3S3JA 3RIFK 2UUDK 2Z3FA 4RFEA 1BWWA 2W60B 1CXFA 4MDRA 4EXKA 2VDOB 1QYGL 5CLZA 1KGCE 4RAUB 2OLDA 4LCWB 1JDDA 1IAII 2X4UA 4GUCA 4M48H 4ABQA 3KM1A 4N0YL 2EZ0D 2CCVA 1PD0A 4JM2C 2VOTA 1MIMH 1AY1L 4G5ZH 5KG9A 2VMJA 1T6VN 4PGBA 1T5WA 4JREC 4P2RD 3BO8A 4FJZA 3ML9A 5DD3H 4PJ9C 2OMTA 2FQGA 2ZXAA 1GC1C 3IJ9A 1A3ZA 4GUPB 4XNMA 5F97E 5TDOA 2JLLA 5SV3A 3MLZL 1MUJA 1GYVA 4ZXBC 1TETL 4YGVA 4EZKA 5C3LD 2R7EB 5DQDL 1FN4B 1RIVL 4F9PA 1SRDA 1U0QA 1WK0A 2MIZA 4ODUB 4UZUA 4U6XB 1PJWA 3P02A 1MFCH 4MRBA 1FVDB 1U8CB 4A67A 3NZSA 2V5RA 4YE4H 3QIBA 2VC2L 2R8SH 1LD9A 5CMAA 2HTLD 4RGNC 5B7EA 2GPZA 1RMFH 1X5ZA 5E03A 3D12B 3U36A 2EXWD 4B6ZA 2G9HB 3QHTC 2BK8A 3WGUB 4NAJA 3VI3E 3KPQB 1WZAA 1IFRA 1DQQA 1TYRA 2CJ3A 2WVVB 5DJZB 3O2DL 2KHAA 2QPSA 4JANB 3QXAB 3BWUF 3VCLA 2EE3A 3EYFB 1QZNA 1URZA 5E2TL 4KUCF 1QVOB 1VFAB 1ZCRA 3DI3B 5DMGC 4G6AD 2BW4A 2WWMC 4AIOA 3EO0B 1I1AC 3RX5A 2PWDA 1PD1A 4UT6L 4QCIB 4BSJA 1IC5L 2EIJB 3DXAD 5A2FA 1MWAA 3VRLF 3ZR6A 5E5RB 3SJVE 3ZL1A 1JNNH 1IZJA 2J88L 1U6AH 1BX2B 1K3ZA 1JTOA 1JZ6A 3QULB 2MEJB 4JPWL 4GAAA 1CDGA 5GZND 5LNGA 5SWZD 2XN2A 4MA7L 3ZHLA 5B38B 5MP6L 4ALAC 5E9DE 4JKWA 4A2EA 4XP9L 1OEZW 3TL5A 1MI5E 3IDYB 2A9DA 1F41A 4M7JH 4IRZL 3AQYA 4JFSA 3VXSB 3AADB 4RGOL 2QZ5A 3P73B 5L2KA 3QAZB 4L5FL 5JXAH 2FHCA 1G9MC 1AQHA 4KZEH 4JO3H 3DX3A 4JBSA 2OZ4L 4JHWL 3HHMA 1JIBA 3IE4A 5I71C 4N6RB 1E27B 4JRYB 4AYEC 4GP5B 1ZLSL 2X4NB 1N67A 4WQOA 1K4CA 3EYFA 3WLBA 3CPLB 3BFQG 4HK0B 5DC2A 1E4KC 3KR3L 2KZ1B 3BVDB 1KFAH 3LIUA 4NT6B 1FRGH 2O6DA 2DM2A 1S9KC 1O9VA 3LZFH 3UYOD 1TMQA 1C7TA 4I88A 2CIKA 1CD1B 4QXGH 1WIUA 2WZ5A 4UIMA 1N6QL 4HLEA 2JSFA 3ZDXF 3QW9A 2F19L 3CFEB 1HC1A 1AGDA 3C6LD 3HLAB 3AQDA 2R27A 3ARFC 4L4TB 1B6DA 1U8CA 1R3JB 3FTGB 2WXKA 2WLHA 2GHZA 4XMPL 1HSBA 3O6KH 3BZFA 3P4MA 1ITBB 3D39D 2UZIH 1QO3A 4AYGA 4C8XA 1UATA 4MZRA 3TN0A 2N7AA 1OPGH 2YFNA 2P8PB 1D5MB 3BP4A 5F88A 5E5LA 2QKSA 3U6RB 1QKZH 5FWRA 1UB5A 3DJTA 3Q5OA 2LGNA 1DQJA 3SDAA 2VW7A 3PGFH 3LKPB 4PJBE 1NMCC 4LRNH 3ROLB 4P2RA 4OF8A 1IC4L 1BVOA 4F3FB 1A1NB 3VFRB 4PRDB 5D4JA 5IIEA 1BFOA 2KBGA 3CQQA 3ARDB 4UDTA 5T1LD 4ZX4A 5FOBA 4H1LB 2ZUTA 5K1NA 4U1HA 2XXFA 5SWSA 1B3IA 1FJ1B 4BFIB 2IQ9L 3HBPA 3GBDA