3H85A

Molecular basis for the association of pipki gamma-p90 with the clathrin adaptor ap-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
277
structure length
253
Chain Sequence
IGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKISIAIDDCTFHQCVRLSRSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 complex subunit mu-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 53
structure length 253
sequence length 277
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A02
4EMZA 2PR9A 1HESA 2JKTM 1BXXA 1BW8A 4MDRA 2BP5M 3L81A 4UQIM 3H85A 5FPIA 1H6EA 2JKRM 4EN2A 2VGLM 5C7ZA 4IKNA 1I31A
chains in the Genus database with same CATH superfamily
2IOIA 2VLKB 2VQ1B 3GJEA 4LAJH 4F7EA 2R83A 5IROC 1PD6A 2ATKB 1GVIA 1F1AA 2ZKYA 2ZOWA 4X7SH 3S37X 2CRIA 3SGKA 1YEIL 2AK4A 2XX0A 4DPCX 4X7DC 4L8SA 3VNZA 4B50A 3VXRE 1MFEH 1RJYB 2G30A 4GAJH 4ERSH 4OFIA 2QKIC 4JDTH 3ZKNC 3QDHA 1YDPB 3PHSA 2HLAB 2EEXA 1FJ1A 2WM0A 1SUHA 1TYRA 1QLEL 2G3NA 3LZRA 4G7SB 1G7LB 1KCVL 3DIDA 4FTVD 1Z6JT 4W4NA 4MXWH 1USZA 3MACL 4NFDA 2NSXA 4AENA 4PTUA 1U95B 3MLYL 4L48A 1LE9A 5I24A 3RILA 2FNBA 1KGWA 1P53A 1CFSB 2CIIA 2QVMA 3HE7A 3FRPA 5D7IB 3TO4A 4DN3L 3QI9D 4ZXBD 1RH8A 4P2QB 4Z7UA 4LEBA 3IDJA 5GS3A 2XA8L 1ZHBA 1W6WA 3P0VH 2X4RB 2AK1H 4M1DH 4FXKB 2AABH 2JFCA 3NACL 3L9BA 1R5WA 3WMSA 1AD9B 3GSWB 3EFDL 1RZ7L 5D6CB 4PREB 2H32B 5K39B 3U48A 4XMTA 1F3JB 1BXUA 2J57A 4OM0H 1DVFD 5DHYB 2VYRE 3E6HB 2VUKA 1KCLA 4P46D 2QVTA 4HCRA 3B1TA 2NY5H 1BZOA 1QBAA 2GB2A 4UQ2B 3V4UH 5HHOE 5I6MA 2YOAA 4OQTH 1EV2E 2XVGA 5EUOF 1ETZB 4LP5A 1IFRA 4MHHG 5IJKA 2MPVA 4G70B 4JPIB 3U1SL 1DCLA 3HR5A 3U4BH 4WFFE 2V0AA 5DJDA 1F0LA 4GFTB 1B3JA 4UZSA 5ESVB 1YEKL 1IL1A 1AGCA 4K23H 1U2HA 2H1PL 5E1HB 4CGUB 1J9SA 3BPLB 2V9TA 1CL7I 3JWNH 4F1ZA 3B37A 1XH2A 3MJ9H 5IFHH 1SEBA 2ADFH 5JQ6L 1JD7A 1T22B 1WFJA 4CC4A 1TSRA 4OF8A 1O7VA 2O5XL 2Z34A 1U58B 2BOCB 4GRWB 4KJYA 3CPUA 5FUOH 1CO1A 2QSCL 2Z31C 1DQLH 2RALA 3ABZA 4Y2OB 2EXYD 1EFXA 2Y24A 4BH7A 2Y69B 3TJEL 4JJOA 3AT9A 5AAWA 4QRRA 4ENEC 4ZX4A 4KZCA 2ZXDA 5FIEA 3VFPA 1CI5A 4PJDF 4XVUC 5AVTB 3R7RA 2LLLA 1SNRA 1VACA 2HVJA 1KXTB 4KMQA 3QUZD 3PWPB 3QDJA 4K3JL 2P46B 3T0EA 5D7JA 1OAXH 3QC6X 1GPOL 2VRAA 4Y19D 1XF2A 3FUIA 3VG0H 3DLQR 3OMZA 5HHPB 2F74A 2IALA 3GRWA 3HZKB 1K85A 5LAXA 4BFFA 5AYUL 3NT0A 1I9EA 1E27B 4JVUA 2WK2A 4UMSA 1EAPA 3EDDA 4P04A 1NEPA 1CGXA 4M29A 1ACZA 1DUYA 1AOZA 1UOVA 3HEIB 1IC5L 5FHBL 5D7KD 2ED7A 1XGYH 3E0GA 4DETA 1E9OA 1UM6L 3H9HA 4JFYB 4WGWB 4ZQKB 1I3GL 4XWGH 2VZOA 4QHNA 1S7RB 4KK8C 4PJIB 4NO2B 4QOKA 4PW3A 4FA7B 3LPGA 3NSJA 5ID0A 5KJ4A 3OMAB 1CDCA 3IS0X 4NUJB 5ILTL 1SOXA 4N2FA 1KG0A 1EXHA 4U05A 4NKOA 1A4KA 1HSAB 3UZEA 1TOXA 2HG5B 2DV6A 1AC0A 2HKFL 3L4VA 3WEXA 1FAKT 4HP5A 3AS3A 3N43F 2YJQA 4HBCH 5I8OH 4IM8A 2ADIA 5K9QI 2NPLX 2P47B 4J3OG 1A6WL 1SGKA 4FFVC 5E8DH 2JQZA 2I32A 3KPOA 4Y4FC 4GBXA 2YXWA 4KNTA 3L1EA 4MVBC 1TTFA 3TL5A 3WIHA 4OCXL 3EOTH 3IGAB 2GBVA 3NCCB 1J8HE 5CFHA 1RVFL 2FRGP 2C3HA 4L4JA 4YDIL 4LCIH 4WW2F 4M6ML 2IGTA 1JGLL 1ORQB 4FS0A 1YEJH 4L9LC 5F0MB 5ERWB 3MLSL 3K6SB 2XXGA 2J71A 1KXVC 1S9VB 3M86A 3WNMA 2P8MA 4HJUA 1MJ8H 2FUTA 3QIBC 4LSQH 3WIFA 4AGMA 3L54A 5A6IA 1TENA 1UEMA 4FX5A 2WWKT 1IEAA 5KVEL 2CJ3A 4TUJB 2CCLA 3LXUX 4AH2B 2BVOB 4BXSV 4K8RC 4G7YH 3X13B 4GIAA 4WFEE 2Q6WA 4R4FH 3UZVA 5KSVB 2DDQL 1QW9A 3KPLB 3PWJA 2X41A 4PJCE 5IBTH 4DZBA 1IKFH 2F53E 4PJGB 3NEEA 5CKAA 2FH8A 1DQQA 3F58L 4LSTH 1ZLSH 2A6DA 3RUGB 1NGYA 2OMXA 2WUCH 3HNSL 4H40A 1XFPA 5KAQG 2WV3A 1W0VA 1XH1A 5JOFA 4NBZB 3FB6A 1WICA 5I1IH 3GBML 5CNHA 4JJ5A 1QHOA 3A22A 2ISDA 1LK3L 5FHAL 5HYQB 2ZXQA 3HNTH 3V4PB 2NY7H 4BZ2L 1PKQB 2BINA 1WCQA 4IMKC 2QFRA 4NQDD 5TQ2L 1MI5E 1MDTA 4G1EA 4IJ3C 1ZKAA 4RDQF 3CQQA 4ZX5A 5C0AE 3T1WA 3I85A 4NQED 3VX1A 5A2IH 4OI9A 3BN9D 3FL7A 1PLBA 5L9DH 4JZJB 1AZZC 3PCYA 4RISH 3FJTA 5AW8B 1YMMA 1DLHB 4TM9A 1KFGA 1QQDA 2A77L 2QVIA 4XMVA 4U7KA 1FAIL 3LHPL 4BYHA 1BWWA 3PPEA 3CBJB 1AR1D 1YNKH 3GIVB 4Y5VC 1MY5A 2PPEA 5A6LA 4F7MA 2H1XA 2IPKB 3UC2A 3K0YA 4LMQI 2YQBA 1SHXA 1AZUA 3L1OL 4N2AA 3E2HB 2FJFB 2F18A 5DWUH 1TPXB 3VX0A 4DGVH 4PP2A 2NNXA 1E6JL 3AQZA 1G9NL 1HL4A 3STBA 1QI5A 5AAPA 3C2AH 1QFWH 5DHVH 4YBQD 5I1HH 4M93C 4W9EC 1OCZB 2DKMA 3B2PA 1U2CA 3FCSA 5H94B 5I71C 3GSNH 2N7SA 1NKGA 2WXHA 1ZLVH 3NFSH 4B6ZA 1E3XA 1MWOA 5BOJA 2QL1A 3QNZA 1GJIA 1UASA 3AMKA 3PDGA 3O3BA 2C9QA 4KKZA 2FT8A 1ADWA 1TITA 4LDOB 1A21A 2XSKA 3X14A 1AJ7H 2CR0A 3VH8A 3TTSA 1BD2D 1M7IB 1MAKA 1QNIA 2J6EL 3DDFA 3H2PA 4NP9A 4Y16A 4M5YL 1WZ1H 4HOMA 4YFLI 3OWRA 2I24N 3UCRA 4JFEE 3TVMD 1CD1A 2BVTA 1C5BH 5IFJB 2ZXGA 3BGMB 4O2CA 5F71A 4JHAL 1P6WA 3V9EA 5EV7A 3WNJA 2F7PA 3H9YA 1AZRA 1WCBB 4RQQB 2CD0A 3WTXA 5DEGA 3KCPB 3VGFA 1JYXA 4TNVF 3BFQG 2R1WA 2X0UA 1LO4H 3GMQA 3Q8FA 4PRIE 1Q94B 5IUCA 4NOFA 3IS1X 2DLFH 2GITB 4UQDA 4TSCL 1UC6A 4UTBH 2ZUQB 4PB0L 2E76C 3HI1B 2AHIA 5T5FL 5JPNC 1ES0B 1IBGH 3QS2A 4CC0A 4Z7QF 5D7EA 4BHUA 5LGHL 1VFAA 5FYJD 3DGGA 3GPEA 4E9RA 5FYJH 2C3GA 4KZ0A 2XKUA 5AB1A 3R8QA 1CF8L 2E7HA 4WUUE 4B97A 1U2YA 1RUQL 1U4FA 2IANE 3BP4A 3MX0B 1A0QL 2EDRA 4HCGA 4RAUA 1VA9A 3WNLA 4MMYA 4Q97A 1A1OB 3AB0B 3LKSA 4B60A 1L9QA 4PIRF 3V4VH 1IM9D 4YSUA 4AUJA 2DB8A 2R1YB 3CBRA 3O2VH 4JRWA 1QLFB 1A14L 4FG6C 3ZTJG 4BE6A 1VZHA 2VITA 3KPMB 4LNVA 4X6EB 5E08L 3GDBA 1LMKA 3MRNA 5EEXA 5FKAA 3U1QA 1MFDL 1AO7E 1G7IA 4J27A 2XYCA 3ZL4H 4PAZA 4YK4B 3KGTA 3GZOA 3UP6A 4AYFA 4OUOA 3GMPA 3PGFH 2JKNA 1YEEL 5J12C 4K55A 3VQMA 2WLMA 3N5AA 1E30A 2A1WL 2NUPA 5C09D 3EGXB 4LHQB 5MHSD 3RWCB 4E9VA 2GC4C 4N28A 1KCRL 4QCIA 1AG6A 4NC1C 2AXHA 4N0YH 3APFA 1QPKA 4PJXF 1IGML 3KAAA 2TRHA 4F2MA 3ATDA 3PG2A 4OZHA 8CGTA 2R1XA 5BS0A 3I02A 4NS0A 1XD0A 1L7TH 1RZIB 4KUZH 1CD8A 1FC2D 3NH7H 4ABVA 3MBXH 5KBLA 4U2YA 4BA0A 3P11L 2WQXA 3REWA 4LEXH 2X9YA 1H3WM 5C3LD 3R8BB 5DSCB 1F00I 4QRTA 1IE5A 1I1AD 5IMLA 2IQAB 4X5PA 3EDFA 4OV6F 1TLKA 1F42A 2AW2A 5EN3A 4RDBA 5JW4Q 3LIZL 1C7SA 3ARDC 4FERA 3VGAB 3BRFA 5HDBB 4CMHC 3B9AA 2R69L 3BT0A 2EE3A 1JYVA 1IU1A 1ONQB 3BDBA 4G6KL 1QSFD 4OIFA 1FGVH 4GG6F 3LN4B 4FQ1H 3QQ4B 4NRZA 2X40A 1CQKA 2OMNA 5FFGA 4NQEB 4ZJ9A 5L88L 1HHHB 3DV4B 2B5IB 2EDHA 3MOQA 4QMEA 1VKXA 12E8L 1AS8A 1QD0A 1PDKA 2O6PA 2WIIA 4JPKH 4J28A 4E5XB 3TCLA 4JFWA 4Q9QH 2NRDA 1J1PL 4ZBJA 3HPLA 1FORL 1XT5A 2A74A 4X6DB 2FWOA 4LSUH 4KK5C 1I7RB 1TYJA 4GSUA 4YEFA 4EVNB 4YSPA 4KO7A 3GIZL 4BFRA 2LT9A 3Q5TA 5I74B 4YSAA 2XQ0A 1BA9A 1WAAF 1OHQA 2H6UA 3O11B 4BE5A 3NA9L 5GRVK 1C1EH 2VZTA 3ISWA 4XHJC 1RERA 5DHVB 3BP5B 3I50H 4ZUWA 5I6NA 3WUWA 4R0LA 4A7TA 3TFKD 1R6VA 1ZVHA 1JUFA 1JHLH 3RVUC 2DI8A 1ZHLA 2QPFA 3M88A 5FO7B 1EEZB 3ULVF 4JL1A 3LH2H 1NMCB 4HZ1A 5CMAB 3MI6A 5E00B 3S96B 1VFBB 1X7QB 4FTDA 1BFVL 4OCSL 5IVXA 1URLA 1WBYB 4UQBA 4CVWA 4YS4A 1ITBB 2ZX9A 4PUBL 3VVWA 3EXLA 2QHRL 4DKFH 1YN6B 1OD9A 3HG5A 3KVPA 3KPSE 4EEEA 4KTEL 4CDHA 3GB7B 3F83A 4Q2ZA 5E6SB 2AJ3B 1MHPL 1XCXA 2ZICA 3C5SA 1N3NA 5AOIA 2B08A 4LCWD 2CDEB 1JMXA 2IQ9L 1NUGA 1DBAH 3BP6B 4QHUB 1MG2C 3CN3A 3NZSA 4C4KO 1J8KA 1GYCA 3MNZB 3LXBA 4FDWA 1KIRA 3FU5A 3IGLA 1ZANH 3EH3B 2HJKB 4YC2B 2CLZB 4E68A 3LQAH 1TZIA 3A23A 4U4IA 43CAB 3WAJA 2Y7QA 3NYKA 3FRUB 3QEQE 4HJ1A 4JO3H 4TV3A 4PB9H 4ELME 4HOXA 3FB7A 4G8FA 4AJ0A 1JNLL 3ZRSA 5FUCC 3GKWH 1U8PB 1UB6B 3HOGA 5FGBA 3BKCH 1RK1A 3QJOA 3ZLQC 1WBZA 5CXPA 1B2WL 3E9TA 1TFPA 3BLKA 3M7OA 3Q7JA 4Y4KD 2JQMA 4N24A 5AFAA 5DHDA 4X6FB 1T21A 2A9ML 4JEGB 3WFEL 1KTBA 3S36L 1GJUA 3TWYA 5I15L 4XNUH 3SDAA 3CVCA 4BZ2A 2CM6A 4Y7OC 5D2NB 3DMMC 3F2LA 2JB6B 4WLCA 5AW4B 1THAA 1F4HA 5DYFA 3QSKB 2ZCHH 4OAWB 4AZ8B 5FOBA 3ILQC 3RU8L 1G94A 3V4VB 5I6XB 3V10A 1U8MB 2CE6A 5KUKA 2CJSA 1G9EA 2RH0A 5D1XE 1N0LA 3Q48A 4EI5C 1HYRC 2BNUA 1BBDH 3PF2A 3U4EA 5CIPH 1CFNA 1ETB1 4UUJA 3SYAA 4CGTA 5GS0D 1GOHA 3CV5A 5DK2B 3MRCA 2VKWA 3VI3A 1NMAH 1K72A 3EAKA 4IQHA 5CR8A 5GS0H 2BVUA 4H8WH 3EO0A 2N0MA 3S97C 3QIUD 5D7IF 3VXTB 1MJJA 4MNGA 1GGCH 3SKMB 4DVBB 5E9DB 5GGUA 3HIZA 1S5IH 2KZKA 3KYNA 4MQ7B 1YPZB 5AVZB 4GW4B 4EUPG 5D2LE 1GGIL 2M83A 3QUYB 5EZJB 5AVRB 5SWSD 5EHFA 1OGAE 5D1ZD 1C16B 3L2MA 2ITFA 3HRPA 1NGPL 3SQRA 2E46A 4Z7WE 3MRRB 3FTXA 3EHBD 4HG4K 2VISA 3V7AG 3NCYP 4QWWC 4B5ZA 3HBPA 4UB0H 1NCNA 5CKGA 4NKQB 5KBNC 1SXSA 3Q8AA 5DDHA 4NQCE 3P77B 2JCCB 3ILPB 3KLAA 1GAFL 3DX6A 3IRZA 4D0DB 1JGUL 2MCG1 3W39B 1IM3D 1TTGA 3O41B 2I69A 4MAYC 1BV8A 4M6OL 4S1SL 1NCAH 4KRPB 3U0WL 4JY6B 3O8XC 2DWEA 2CHNA 2G5BB 5AD0B 1J1OL 1CUOA 1LO3L 2G9KA 1JHTA 2J6EA 3CFCL 2OMYB 4K9EL 3QO0B 2Q10A 4MMXC 3OKKA 4HULB 1B0GB 4RGND 4JGUA 3BPOC 1MIEH 2BPBA 5IESL 1BVKB 2GTWA 4J3OD 1OPGL 3BOVA 1Z9PA 3PQYB 1XIWB 4J3OH 3AAZB 1FV1B 1U8KA 1J5HA 4QO1B 3TYFA 1QSFB 3C9NB 1E8ZA 1P4LB 2WCPA 3NAAL 4L1BA 4OGZA 4CVXA 4XNYH 1L3NA 4GAGL 2NQDA 4GRWF 2P5WA 1LO2L 2K70A 4PY8I 4HWZB 4K7PY 3N0PB 4FJ6A 4UV7H 3S34L 3AACA 5F1NB 3NBNA 5HJDA 1BQHG 2H3XC 1X4XA 6TAAA 1PLAA 3ZDYB 5BRZB 1JRHH 2DWTA 2WQ8A 3RDJA 2F8XC 5J13B 2W9LA 5T5FA 1PG7X 3Q6FA 2JIXA 4ODUB 4XXWC 5EZLB 1FP5A 5E2UH 2XWBB 3SDYH 3H3PL 5HYJA 3C5ZB 4E9LA 4Y4HC 4NKMB 3RVVC 4GXVH 5I9QC 3F12A 2HT4D 3KE0A 4P3DA 2DAVA 2J2ZA 2VC2H 4RGMB 4GRMB 4RMBA 1CVSC 3QQ3A 4F57L 1BAFL 4OFPA 2XV0A 3OPZH 1RU9L 2R2EA 5GGTH 2LTQC 1MG3C 5EUOE 1TZOA 2A83B 3NIDB 4UU9B 4Y2DA 4ZUVA 2F08A 5D7SL 1OSYA 2MKWA 1A8JH 3I74A 5AB0A 1YNTF 4WI0A 1CB4A 2BVQB 5LGYA 1OAZH 1FI8C 1MSPA 2F54A 2HT3D 3W57A 3NFPA 4J3VA 4PJIF 5T33L 2PETA 4KX9A 5KG9A 2G5UA 4Z7NB 2APTA 3IWUA 2GTZB 3BFOA 4A7GA 1WP6A 2YAFA 4HDIB 1WDAA 4OD2A 4HG4J 2X1WL 5HBBA 1S78D 3U6RA 1LVEA 1MFMA 3ESVF 3K3QA 2VDPB 3DJRA 4ZPVB 1GZHA 3KYKL 3BO8A 3QARA 2IGFH 5DJ8B 5DRNA 1PCSA 4ZW7A 3MCYA 2D0FA 3IDNB 3OAZK 4PVLA 1S7VB 2V2WA 1X5MA 1NMBH 3O4LD 1U3HC 2CJUH 3SJVA 1A2YB 4A66A 2WLLB 3D69A 2H2PC 3C6LA 4KU1A 4Q6IB 2G2RA 5DCCA 4Z95L 1Y0LB 3VXQA 4DJMA 3D0AA 4NJ9L 1O9ZA 2WLIA 2MHAB 4N2LA 2FE0A 2VLLB 5EOCL 3O45A 4PJDE 3ES6A 5DHEA 4ADIA 5JHDA 3ULUL 1BJ1J 2JMRA 1FZKB 4PI0A 4GMTL 5EC1B 5FM5M 3LIZA 2X6AA 4XWOC 2R69A 4LO9A 35C8H 4LASH 4AM0Q 5CP3H 4CDGC 1R3JA 1NCUA 2BSCA 4EDXB 3VWJA 4PSRA 3ZKXC 2Z31D 4RMWA 4ZFQA 4L37A 3OJMB 3STLB 1J0ZA 3SOBL 3GI8L 2WANA 5HY9A 2CMRL 2XA3A 1BQUA 1C5DB 1J1XL 1YEGL 1ZPLA 2WLZA 3FUHA 1YO4A 1EEYA 2VQTA 3WFHA 4NKDB 4LGSB 1W72A 3ATAA 1FPTH 1WZKA 4PJGF 4XP6L 4LHUB 2TAAA 1PLCA 1HOCA 3U6XA 5BW7A 3TURA 2Q9OA 3WFBL 3C09B 3RUGF 3SD2A 1K2DB 3QWRA 5C8JB 2Y06L 4YQXL 4BWTA 4XCFH 5CJOL 3PE9A 3SGJC 2C9PA 4O02L 5AW3B 5BXFA 7TAAA 1P4IL 4GIOA 3VFMA 4JM2C 2ZKHH 1YMHA 2FD6H 3FO0L 4N6RB 3F7KA 5GZOA 2P45B 3T6QC 2W0KA 1UUNA 3QA3A 3MRHB 4S1QL 4LL4A 1MRDL 1S7UA 4FQXA 4NO3B 4Z18A 2G75B 1MH5B 1WG3A 3GMMA 4BIKA 2D0GA 1N6UA 4YSTA 4AT6A 2FO8A 4MA1B 1MQKL 4F7CB 1NBCA 2HPTA 1S7XA 3TA3A 1JN6A 3KPRA 4KK8D 3RIAK 1HHGA 3TIEA 2Q7YA 4RGNB 4KZDH 3G04B 2EQDA 4YFEA 2ORBH 2QLVB 2WO4A 4XBPB 4HBQA 2P26A 4RRPA 1RJZA 2R8SH 4G7QB 3FU3A 1MLBA 1JNNL 5F2FA 1EHAA 1KXQE 3BGFB 3BKMH 2FJHB 4W4OC 2ZIDA 4WFHE 2MPAH 3KWUA 3AU1B 3HE6B 4GUOA 4R5TA 5F7AA 3ZE1F 2FZ3A 4R4NC 3LEVL 1LE5B 3FFOA 2MQGA 4P4KD 2J6WA 2X70A 4L3ED 4LSPH 2YXMA 4UT9A 1YHPA 4FFVD 4V2CB 5FYKU 2CHZA 3FQWB 1TCRB 4FQJH 3CZFB 3ARUA 1ZEAH 3TPUA 3HC4L 3AXLA 4FG2A 5FDYA 1FVEB 4BBWA 1T0NB 3VXOB 4NNXB 4ODHL 4XE0A 3NCFB 5JHLL 2PPCA 2QKIB 4LIQL 1R3IH 4FXLA 3TU6A 1XAKA 1PL3A 1Z9OA 1AFVL 1YSOA 1X5GA 1JGDB 3EOBB 2HX7A 2X10A 4QHLA 4NM8L 2AP2A 4WU7A 4PJBA 1A3LL 4NQVA 2AXGA 4HC1L 1F4YL 1KYAA 1I4FA 3IGUA 5A3IC 3MRBB 1GTNA 4MJIA 3M1BA 5HGBA 3IU4H 1FYTA 2OCCB 5FO2A 4Z7IA 4K8RD 1O5DT 1S7TA 2XZQH 3MRPB 4K8RH 1H6FA 3TZVA 3MSPA 4PYHA 1A7OH 2FBOJ 2RB8A 3W82A 5CHNB 2Z64C 5ID1A 5SWZB 2CWRA 5M94B 5FA4A 3BYTA 4N8VG 1UZGA 5I18H 2BMKB 4DP0X 4WNSA 3QFGA 4GJTB 4JDVB 5FKPA 2EIKB 2IH3B 3IGFA 4NKIL 1J05A 1AZVA 5E03A 4P59H 2M2DA 3AREC 1HXYB 2WBJC 4JRYA 1AKPA 5MEOA 2WCGA 3GHEH 2J3SA 1OSPH 3STZA 5JLZB 1SMDA 5EBLA 3HG4A 1MFNA 3MV8D 4FZ8L 3TT1H 3WIIH 1P5UC 1PSKL 1KGCD 1UM5L 1ERNA 2KDYA 4PCTA 5ES4B 1PFOA 1ICTA 1GIGH 1XL4A 3DYPA 4NQSB 2X2JA 2BNRA 1JV5A 1R5VB 3H3BC 4RMUA 3NTCH 3TH3T 3U82B 2WN3A 3OF6D 2K7QA 3NABL 1TU2A 4FKHA 4PV1C 2EEFA 4LPVA 4OV5B 5EIVA 4RA3A 2OL3L 5HDLA 7FABH 3AG3B 2WAQA 5MERA 3LB6D 3P4OA 2IADB 3GLDA 2X6MA 4IBLT 5GHWL 1GZQA 3OX8B 4AYID 1CE1L 2BNQB 5EZOH 1P7BA 2IPTL 3VTTA 3MRGB 3VFUA 5GRUH 4URTB 3MHZA 1H3UA 5IMKA 2BX5A 4XMKH 3H85A 1H8SA 3OR6A 5GJSL 1RMFL 3UBFA 1UT9A 2VCOA 1TQBB 4ONFH 2OI9C 2DICA 4XP9L 2OQJA 4K3GA 4ANUA 1TVDA 2WB7A 1WHPA 1SHSA 1PS3A 4QXVA 2FHBA 2HKHH 3DETC 4JUSA 1MCOL 4JFXA 4RH4A 3RY6A 4AIEA 4NGHL 5JDSA 2BVPA 3S3JA 3QT2A 3R06B 4KTDH 2FO4A 3PUCA 2Q0ZX 5CGYD 1KJ3L 1KYUA 2EYRA 4NNYA 2UWEB 4J3WA 4F58L 5JXAH 3CDZA 2ZUSA 3LKPB 1MKFA 3MFFA 1N4XH 3ETSA 5CJQL 3GJFH 3QULB 1TQWA 3UIZA 4F37F 4BSWA 1G7QB 2VW7A 3W0WE 1T1ZB 3M6DA 3L4TA 4AW4A 3OJDA 5B38A 3UGEA 1GC1L 1KPUA 2DYPD 4MKTA 4HWBL 4X6BA 2NUTA 5SX4H 2Y23A 3KMDA 4JGNA 1XF4A 4N0UA 4I4WB 2CGYA 5C6TH 3OKEB 1HKLH 5E8NA 3KJ4C 4Z7QE 5ISZE 4FFTA 5L2KB 2O72A 3K46A 4H0HB 4W6XB 5C0BA 4PGEB 3CVIH 5B1KA 2E4FA 2VJXA 3FPYA 3LEXA 4ISVB 2DBJA 3VJ6A 2GVYA 1D5BB 3SZKC 1J48A 1V3LA 3HAEA 1QHQA 3OGCB 4ADJA 2UY7A 3PWVB 3WXVL 4A2EA 3FCGA 1H15B 3IWVA 3S3SA 4HUNB 2R56H 3R4DA 4QXUL 3TNMB 3MUGA 3GHBH 3V5KB 5E23A 3TO2B 1A02N 5E4AA 1UJ3A 4JE4B 4X6DF 4ETQA 5CSGA 4LLUA 2WP3T 3EFFA 3RFRA 2FX8H 4KKCC 1AY1L 1F2XK 2B3IA 5KJ7E 4U1IA 1T5KA 3FSOA 2ED8A 2MOGA 4Q4EA 2FSEA 3D2TA 2L3BA 2ZXAA 1ZLEA 2YGVA 2VLJD 3CVHA 3SE4C 1T7WA 4XB8A 5FO9B 3ASNB 4Y4FB 2VXSL 3DSNB 3ETTA 3QEGL 4HXBL 3MRQA 1A1MB 2Q2LA 3WO4C 1FH5L 3EYVA 4PJXE 4ZODA 5C0EB 4YHNB 4OT1H 2DD8H 1OGPA 5IQLA 1LEGB 1VFUA 4EUPH 2OX5B 3F7RA 3N1QC 2XJKA 3QDGD 4URKA 3V79C 3QDMB 3DBXA 2YAPA 4L9LB 2YRZA 1DBKH 1NCOA 3F7YB 5DD0H 4B96A 4JFDB 4H5SA 4JM0A 5KZCD 3T08A 1M7XA 3B9VA 3PWUB 1OAKH 2MNWA 3LKNA 4OKVB 3HN8A 4P49A 4ZMZA 3QIBB 2ZJSL 2ZXBA 3CD4A 4C56A 4E41D 4P8QA 4OBSA 3WTYA 4FNTA 4HIHB 4QRPA 3OD3A 1Q0YL 4JCMA 3BAXA 5JMOC 1R5IA 2EVJA 1RZ8B 4OJFL 5ICXB 1MXGA 3HS0A 4N5UA 4KXZH 3RNKA 3EBAA 2WWOA 3UABA 3V0IA 4HIQA 1DL7L 4J1UA 1Z9SB 4LSSH 1MUJA 1ZT1A 1V27A 5C07A 4GG6E 2ZWSA 4UF7C 1KB5H 2OYLA 1YG9A 2HFGL 4L4VA 1J8RA 4MA7L 4BFBD 4KITB 1WTLA 1XSOA 2ENSA 5H37A 1M6OA 1T1WB 2IPUK 3RKPA 5BVJA 5LG1A 1KZYA 1KNOB 2E7MA 2JJVA 1NC2D 1RUKL 1U93B 5B39B 1F6AA 5DZ9A 4L5FE 2E27H 4PS8A 4IIZA 1FNAA 4O02A 1U9KA 2Y7OA 1UYWH 2X4NB 1U42A 3P73A 3VD7A 5HGDB 1KGXA 2EIZA 4HJJL 4J3UA 1FH2A 1QO3B 4LLWB 2CK2A 3GWJA 2MCPL 3ZXAC 5LLIC 4GUQA 3N40P 2FQEA 2R2HB 4KDTA 5T3ZD 3RZWA 2BS71 4MRBA 1WAAE 2MEJB 5T3ZH 2XRAL 2QHLA 4H1LH 4XNMA 2YD6A 5EU6B 4IJ3B 3ARFC 3QUKA 3VXSD 1YJDC 3DROB 4LKXB 5IQ7L 3G5ZB 4IOSD 3E80A 1FBIH 4MB1A 1CLOH 1EAOA 2PCPB 2ODHA 2EAEA 1WJ3A 4FMFA 4KK6C 4PRPD 3QH3A 1P7QA 5ANME 3SQOH 3ULVE 4DP4X 4JFOB 4I2XB 4X8GA 3FRPG 1P1ZA 4HEPA 5KYUA 3ZHKA 5FV2A 3CDCA 3DRTA 1OO2A 4Y5VB 4KK5D 3R1GL 3WY1A 2RCSL 1MJJB 1DYZA 5DJ2B 5J06A 5CBAB 5LGJA 4MAZA 4NLAA 1YPZF 3PUUA 1NM4A 5D6DA 5F93C 3HA0A 4IKJA 1KFAH 1T6WA 2Y1ZA 1GS8A 3IMTA 3V0GA 5DUBA 3VRJB 2CNZA 1QACA 4WEMB 2LW3A 3TNNB 1EO7A 4M93B 1WE5A 3RPIB 2ENQA 2O5YL 2R0KH 2FTAA 3KH3A 4WHDA 3LJ3A 3HJEA 4R26L 2IWFA 3GJFB 4ONHB 3UX9B 5EU4B 4M6NL 3LQZB 2JKSA 2JCCF 2R9HC 3QJFA 1IIKA 2ZT9C 2YQ3A 5GSRA 2DYPB 4PRHA 1T83A 3DOSA 3D07A 4XC3L 4TOYL 4U0QB 4A68A 2EVFA 3ESOA 4L8BA 2VLKE 3J7HA 2ZX6A 4HC1A 4KI5C 5TDNB 2WTRA 3BVWA 1MIML 3QFJA 2R2BA 4WW1B 2GFBA 3MBEA 4J3TA 3ZHLA 4Q7DA 4EZLA 2YMOA 4I88A 3SY0A 1PAZA 2X28A 4JFZH 2V2XA 1BG9A 1X9RA 5E8PA 4QUOA 4HMEA 1TZGL 3P3SA 3IDMA 3IF1A 2AV1B 4G72B 3FT3A 1YY9D 3TCXA 3PP4H 5J7CC 5ICYB 1GGUA 1A6ZB 1VJSA 2YWZA 4D0CA 4PW4A 1GOFA 4PJ9C 2VN7A 3A6BL 5D71L 3VFGH 2CKBA 2NDFA 3GT6A 5DVOA 1D5XA 1BGXL 1IGYB 3U30C 3V6OE 3ZDYF 4L1TA 5D7IE 5JPNB 5KVMC 3IJYB 4OD1L 1MNUL 4P2QE 2A0LD 2X53A 3CAFA 1AHWA 1JGEB 1F86A 1SDDA 3GSRA 1HH6A 1R3KA 3N55A 2A7BA 5C0FA 2VDOL 1UKQA 4PWHA 5E4OA 5HGAB 1DQMH 4P2OC 3DMMD 4HK0A 1G7JB 4UV4L 2AERT 3JQOB 4QPEA 1KELL 4RBPK 1MHCB 1CFQB 4C83B 5IV2A 5ABAA 3ILQD 4YO0A 1JF6A 3TEXA 4HK3N 4CADB 2OL3A 4A6YL 1KGIA 2XWRA 4YE0A 1A7QL 2N0KA 5AUMB 1WHOA 3B2UD 2VXTL 4U6HA 5C97A 3TBWA 4LAQL 4L8CA 5JW4N 1JPSH 1FO0H 3KG5A 1FL6B 4X98B 1H3VA 5T1LD 3NIDF 1Q0XH 2N59A 3F04A 5EUKA 2D03H 3VXUD 3B5GA 4MLSA 5J12B 3JYBA 5DMIL 5FA3B 1A25A 1TJIH 4IOFC 2QEJA 3EYQC 1PQZB 2WTOA 3UBXI 2L7EA 2XXCB 3VD5A 4PQXA 5IQOA 4QAWA 2H0EA 3BQUD 3QYMA 4N9GB 3WL9B 2EO9A 2J5LC 3KGUA 1XO8A 4Q4IA 4UDUB 1N59A 1H8NA 2ITDB 2EDBA 2OJZL 3QCUH 5IEHA 3SDXB 3EYUL 2VNCA 1KB5B 2OXGB 3LX9A 3TN0A 3SBPA 2Y7MA 1R24A 4JO1H 1T5WA 4GRWE 4ZUUB 5IW6B 1CICC 4DNLA 1MEXL 3K4AA 4JFPB 1T1XA 4N20A 2E8YA 1J18A 3HZ3A 5DS8B 2ZSWA 3MLRL 3O8XD 4HWBA 5ALCH 1NBVL 1XGZA 4Z7OB 3N06B 2IAMA 2RFXA 4JO5A 3WEAA 3ARDB 4DKAA 5H4ZA 1K5WA 3T8XB 1NCBL 4JR9L 2FBJL 3VXRA 3ZO9A 4CMHB 5AW2B 2PF6A 4TULL 3QPXH 4R4BA 3U2SA 3PWPE 1U21A 3C08L 4H1LB 5FO8A 4MCZA 3IBEA 2IJ0C 1I1CA 1Z5LB 3MJ8A 4P9ML 3VYOA 3MXVL 1UD2A 1P1VA 1ZS8B 1HINL 4XNQB 5SV3A 3FQYA 3ZHFA 1IBBA 4QTIH 1I7UB 4I3RL 2V5RA 3IN2A 4PRPB 3R19A 2ATAA 4OGYL 3BAYA 3ATBA 1W6LA 3Q44A 1NLBH 1MW2A 2P8PB 4FP8H 2XPGB 2CR6A 3LNDA 1EXUB 1WVZA 4M6AA 2APVA 2HCZX 1GH7A 4OB5L 3Q2WA 4PJIE 4BELD 4UZUA 3HHRB 1EGJH 3BPCB 1HJCA 1Q9OA 3BH8B 4ZUTB 3MRIA 1OF2A 1NUNB 1MCQA 4X9FA 2OA9A 1JV2A 1KCSL 5HHOA 3QAQA 3QR2A 1E7UA 5T8IA 1NFKA 1TVBA 4FKKA 4BQCA 4BD4A 4MB3A 4LRIA 1CBVL 4H2AA 4ORGB 3PREA 3HRZC 4OLZH 5EIIA 3TM6A 2GIMA 1CG9B 5I8KL 4HKJA 4YBLB 2SEBB 4H0IA 4ZX3A 25C8L 1QRND 5ADPL 4D9LH 3LDBC 4AEEA 2LU5A 2YPVL 3CBKB 4HF5L 4U1NA 1BJ1H 4JVPA 3B9EA 3ULSB 4EE2A 4J3OF 4FYQA 4YVUA 1MCKA 4ZSOB 3CLWA 5BO0D 2VDKL 4G8GD 2IPUG 2BC4A 4JY4B 1QFWI 4PMFA 4JQVA 1LYQA 4B9YA 1UVQB 2YQGA 5I5IA 4H26A 5HJ3A 4ALAL 4WI5A 2M26A 4OD3L 1U3HD 4XC1L 2ARJA 5CJXC 5F8QC 3SDDA 5ABDE 3BCFA 4WRLA 1ZTMA 4FE9A 2H2PD 2DJSA 1KBWA 2UZPA 4XRCB 4MJJA 2KH2B 1EPFA 1HHIA 2I9TB 1OP4A 2R4RH 4X0KA 5C0RL 3NCJH 1HDMA 3EOAA 4PJGE 3UTSD 1HYSC 2YN3A 1NCDH 4ATTA 1AMYA 3AQDA 3RUGE 4XWOD 5IGXL 2VN5A 1BW8A 3DMMB 3N85L 5C0JA 5F7HA 1UKSA 2OTPA 3ATFA 4HZLB 3VH8G 4WCYL 4E9XA 1NJ9B 5G4MA 3BKJL 3CGTA 3IFNL 1QR1B 1KV3A 4NZ8A 4B9IA 5F3BB 4O9HL 4I5BB 5DUPH 3IAGC 4EI5B 3UPRB 3RDTC 3H42H 3QXUA 2UYLA 4F7TA 1D9KC 4DO4A 4JFQA 3KCWA 2ZP9A 4F20A 5KAQF 1RZFH 1IQWH 4D2NA 1QKZL 3H7BA 1K8DA 4AYDC 5C6WH 1I8KA 1A5FL 1NIEA 3FN0L 3WLBB 2K8MA 3MMEB 2X2IA 4KVNL 1PKQE 3MRFA 5T1LB 3MV11 3VFNB 1SXZA 3MJGX 2YS4A 3MREB 2XYBA 1G7MB 1XCWA 5J6GA 4L4TD 4AY0A 2E7LC 3L3GA 2CA3A 3MNDA 1CU4H 4JS7A 3FU9A 4PJFF 5HVFB 2DQCH 2VE6A 5BZDB 3LSOA 3VAEA 5E70A 4FHKA 3SKOB 3KR3H 1BVNT 3JWNE 1NCCL 3U36B 2PTTA 4KPHH 2Z35B 1JF1A 3K1DA 1L5GA 3SBWC 4BSVB 4JM2D 3BMWA 5CEZD 4KQ3H 5ICZB 3ARRA 3KBPA 3THML 2ZD0A 3HZVA 2VM3A 5CEZH 5GZND 3V95A 4XXDB 4PCYA 1KN2H 2B1AH 2P9RA 3FULA 1BZ9B 3CCHB 3ZT7A 5F6HJ 1HHJA 1Z2KA 1NA8A 5BOPA 3ZE1E 2NW3B 4UMGA 2NTSP 2P8LB 2BLFA 2VKXA 3QFDB 4MAYB 3OAZH 2FGZA 1FGNL 4HPYL 3O8XB 1XCQA 1SFDA 3F62A 4HUMB 5B22A 2QBWA 4XAWL 3RWFB 1B3IA 4FABH 4E9TA 2O1AA 3P4OB 2FT6A 4MMXB 4I0KA 1J8HA 5ADOH 1MHEA 2X1QA 4L29B 2P5ED 2NNAA 3HCVB 2OYPA 3DC0A 1M2VB 2AJSH 3FOMB 5L7XL 4UIKL 1BCIA 1P4UA 3RTQA 4NZRH 5TDPA 3WDHA 1OSEA 1F4XL 2XVKA 4XBMA 5CGBA 3SOTA 1JWSB 1M7DB 2F58L 4Z3GA 3S48A 4IKKA 3KWWB 5AVQB 4G11A 3C6EA 4OGQC 2HRPL 1AD0B 4M7KL 5CU5A 4WI8A 1FG2B 4PJCA 5D7KE 4RAVB 1GTFA 3O3DA 1M42A 4OZFA 1INDH 2K9UA 2L4OA 3MLWL 2UWEF 3CSFA 1N2RA 2WNWA 3PHQA 2J4WL 1I3VA 3EBHA 2FNWA 2ZAGA 4GRLA 2FIKA 1QPXA 3CFEA 1RLWA 3PABA 4Y4HB 1S7QA 5CD3A 4ETYA 5I9QB 4KY1L 1UOLA 4Y5XA 5A43C 1ZOXA 3TO4C 5A3ID 4GAYB 3D48R 3VGBA 3EJUA 1HL5A 2W8CA 3WU1A 2PMZA 4DIXA 2LTQB 1YQVH 2EC9T 5BQ7B 1AKJA 3GC3A 3DX3A 1PY0A 4XI5C 5INDB 2ZUUA 1TZHA 2V33A 4G42B 2VJ8A 2ICWA 4XNZC 4XPBH 4YXHL 5JNYA 2BDNH 1DQJA 1TETH 2XWEA 2AK4D 3HMXH 1BQLL 2DIJA 2UV3A 2YBRA 3Q13A 1JI2A 4CN1A 3MJ6A 2F5AH 4HUXB 4I1NB 2GAZB 2WBJD 4WI4A 1C12A 1EMTL 3BVUA 4J4PA 4Y1SA 1J88A 2N1TE 2V9QA 2YMTA 1K6QL 4G8GB 4N8CH 3ARWA 2ADJB 2ESVB 2P7TA 3JT0A 3A21A 3SKUD 3EFFB 3EFOA 2QT6A 5E2TH 5ITBL 2V8MA 4AEHH 4Y7MA 3WS3B 1QOKA 4ODXA 5F7DA 3T0DA 4LOVA 1KSRA 1EVTC 2I7SA 3CPLB 4R7DB 5KSAA 4HIIB 1HH9B 3GBNH 2FSEB 3OXSA 4HWEL 1UADC 4QI3A 3ZT6A 3WUWG 3FZUC 5D8JL 4I9WD 3H0TB 5EEYA 5DQJB 1T03H 3S9DB 1B9KA 3WUZA 4LVNC 2FYVA 3BDXA 1P2CA 4LGRB 3SE9H 2C34A 3QUML 4N1HB 5EU7E 3FQTB 5DD1L 1I7ZB 2WJ5A 2R7EB 4ONOA 3P30L 3UTSB 3ALXA 3FFCA 3DJZA 3G5YB 3JBG7 3EG9A 2M1KA 2GYSA 4NIYE 3EJQA 1JCVA 4PMEA 4IGBC 1T0MA 2WKOF 4TNGA 4RVBA 4ZO6A 3V0JA 4G82A 2J56A 4ZNCD 2OMVB 4G43A 3K8LA 4MHHI 1HHKA 1KOAA 1XSIA 5IFAH 4WV1C 1P4BH 4HU2A 5F9DC 3ZKXB 3L16A 3O6ML 4G6ML 1DANT 4FAAB 2QADD 3DETD 2K78A 2G60L 3BRDA 2FR4A 2H26A 2ZX8A 3QG7H 4JFEA 5E6IC 3TBVA 3MJ7A 2DKSA 5DQDL 2WNKA 3DURB 5BV7B 1J86A 2X4QA 4QDGA 4N6QA 4NQDE 2PW2B 3VFVA 4DN4L 5JHMA 4R96A 2YC1B 1C7TA 3FUJA 3TH4T 4L4TB 4UM9B 1RUAH 3QQNA 5DVLA 4NQEE 1E4WH 1J9CT 4NZUH 4YHOH 2XJLA 1IE4A 1D6VH 4YXLH 4EIGB 4PRIA 1YNLL 4R3SB 4GKZB 3C60C 4XGZB 2EVGA 3SN6N 4JY5H 3D39B 4PRNA 1LEKB 5K1JA 2Z91B 3DBSA 4ONGL 3U9WA 1A6UH 3KW7A 4X6DE 4A39A 1MFVA 1PJ9A 1U6AH 1GZPA 1EFXD 1A66A 4NPYA 1EH9A 4NM4L 3MNVB 2R0WH 4LOEA 4YLQT 4BQ8A 4AL8L 4WUUA 1D7CA 4IS6B 2IANA 4AV4A 3OKNB 1EJOL 3SODB 4TLTA 4QRUA 4TYUA 1S6NA 4K3HA 5FW6A 4AL8C 3VXPB 2RIKA 2EDMA 3NJMA 1YC7A 3QUKB 2QQNL 3CHOA 2VH5L 4G80A 1S46A 4TSBL 2ROYA 5AZ2H 3T0ED 4OF7A 2X89A 3UROR 3VA2C 2J7LA 4B41A 2V5YA 3MCLH 1DZBA 3RI5K 3E9UA 1MVFA 1N0XL 2YPVA 1AO7A 3HI5L 4X8XA 2CGRH 3GRWH 1FYHB 1NFIA 2EH8L 1PY4A 2YKLL 3DHJA 5D1ZI 3TV8A 1EEUA 1U41A 2OW7A 1MF2L 3MLXL 2WZAA 4L8DB 1JNHB 3O6FC 4LP4A 3MRDB 2V3EA 1BD2E 1M9WA 4L1SA 4QRFA 4RGOL 1EJFA 4WDIA 2ZZUT 3I3DA 1GA2A 2NXYD 1ETJA 3L3DA 1TKWB 3AMLA 2NY2C 5EN2B 5J1AB 3DX8A 2YEZB 3TA3C 4U7MA 2W9DH 3CZSA 5JIIA 2HTLC 4ICXA 4QOKD 3T3PB 1MWAL 4UWQB 2I60L 3UDWA 3LKOA 1K3ZA 3A4AA 3Q1SH 3A5VA 3NRPA 1IARB 2O6FA 5E1QA 4K3DL 1JPEA 3D85A 4B53A 3BZFB 5MEQA 2YPLB 5HHVL 4YDJB 3S5LG 4GQPH 3D0LA 4AQAA 4N2BA 1LO0L 4JRXD 5M7QA 3LEYL 4DK6A 3EBGA 3OXRB 2J12B 2R0ZL 3KH4A 4AV0A 3FBQA 3DARA 4X50A 3CMGA 2EEBA 2AJUH 1CIUA 1W0WB 4KAQL 4UOQA 4GBXD 4JPWH 2ITCA 3P69A 2DQJH 3AM8A 4OZIB 1DCEA 5EPMB 1FVDA 4PJ6A 2BSTA 2XG5B 1OP5H 3BUPA 3WIHH 3UYPB 5D2NE 1E6OL 3VDAA 5CWSB 4OSUH 2VAAA 1N5YL 3M8OH 1CVRA 1I1FA 1TTBA 4JANB 5JOPD 1JRHI 4P9HL 1SHMA 1OM3H 2BSRB 1FIGL 1IO4C 3FDWA 4KY2A 4OFYD 4FQ2H 3AREB 2WBJB 3UC0L 3GHPA 2E75C 2YSTA 1T5XB 2E4TA 1CFVL 1NLDH 3FO2A 1FFPA 1P5UB 3PWNB 4MD0A 3HUJB 5BCAA 1MJ7L 5IK3B 5LVEA 2AQQA 1THCA 2DQGH 3ARBB 5F9JA 3SHSA 3MV7B 4MJHA 2VDMH 5HYEA 3X11A 3L5WA 1YPZE 1JP5A 1S4IA 4ZO9A 1NFDA 1T7ZA 1E9QA 3IFPA 4JKLA 1UT1A 4M8QA 2BSEA 1TYEB 3IXAA 4G1MB 3EDEA 3VW3L 2EYTA 3BDYH 3BZ4B 4U33A 2DJ4A 2UY6A 2D7MA 1GYVA 1ODUA 3LRGA 3UYRH 3R0NA 1XMEB 3DSFH 4KK6D 3PGDB 4D0BB 5EDXA 3F5WB 2GEEA 2YPKA 5I1AA 1EZVX 2NXZD 4LLQB 3S37H 2BW4A 2X4PA 1QBLH 2Q8BH 3IAPA 4JQIH 2APXA 4R8WL 3ZKQD 5CR1A 4AG4L 1MCEA 2DLTA 1FZMA 2JCCE 3BE1H 1T04B 2X3AA 3DX9A 3KPPA 1NIBA 2IMMA 2OI9B 1CJYA 1NBZB 4LLAA 3GMNA 4JHWH 3ROLB 4LSRH 3HPJA 5I1LA 4HQQH 1O6SB 1XSJA 1YEFH 1JZ2A 4UQ3A 2AJZA 4OLYL 5I0DA 3TWCL 1MPAL 1BFSA 3BP7B 4JFFB 5E7BA 5IQ9A 3MGTA 3S35L 3U0PA 3PQYE 2Y36H 3UXFA 2A6JB 1G43A 3AADB 1S3RA 3O2WH 4LOUD 4OLUH 1CDYA 2VT0A 3VXNB 5I0YA 1YMMD 1QSFE 2BY1A 5DRXA 5HDQH 3SDXF 3T1FA 1T89C 3GXDA 5GXBB 3D6GA 2LU4A 4TQHA 5JOEA 1IVLA 3HS9A 3QEQA 3RWHB 4AQEB 1XCTB 4A2HA 1SY6L 1W15A 4ELMA 3OC5A 5LQBH 5BMFH 2OM5A 1NPNA 3OB8A 2F5BL 2VR6A 4J7RA 5H35A 4LK4A 4G9FA 3FTZA 3FTWA 4HS8L 4Z7OF 1OP3K 1NGQH 1N64L 2YD3A 3LNHA 5BRZE 5I23A 4UDTB 4NO0A 4XPHL 3H2WA 5F89B 2VMFA 3KJ4B 1URIA 2Z93B 1UENA 3QORB 1XV8A 4Z8FL 4CN4A 3FYIB 5CZXC 1SEQH 2WJ7A 1B0RB 3KL3A 2WXPA 3CLEH 1CTOA 4NUMA 2GT9B 4ODVL 5DR5L 1J5OH 3QJVB 4JN1L 1DQIA 3COOA 4MNHB 3FUFA 5FK9A 5JW3H 3VDCA 2N7BA 2OXHA 2R0LH 4WIQA 5BUPA 5I1KL 4YR6B 4XBGB 3V8CA 5DRZB 1F90L 3PNWA 5D1XA 1W9XA 1TR7A 5LDSA 3WJMA 5A2LH 3IYLW 2YXFA 1JZHA 4FKEA 4LCCA 2APFA 1FNEA 2B59A 2BP8A 3MNMA 4AMXA 5LXVA 2BWQA 4XCCL 1JPFA 4MBRA 1QLEH 1XVSA 2XN9B 4M62H 1UACL 4MD5A 4ZYKA 1ACCA 1IBHA 3NIDE 4HUUB 5AZEH 5TQ0L 5IR1B 5K1VA 2EILB 2B20A 1OARH 2RGSA 3LS5H 3MACH 4FFWD 4J12A 5KYWA 2H9GA 3MLYH 2C9XA 2IIJA 1O75A 1TEYA 1OGAA 2D7QA 4P2OD 3RIFF 2FGWH 5CZRA 4Z7WA 2KT6A 4QF1A 1JPST 3HI6L 2X87A 5C0IA 1D5IH 1OB1B 3P4NA 4NUGL 3EW3B 2AV7B 1PZ5A 2W92A 4FXGC 4P07A 3F85A 3WO4B 1T6BX 3P40A 2AEPL 4U1SB 1NSNL 1WBXA 2Z65C 1NBYA 4IIQA 4UZGA 1OAQH 3QUMA 4ZFOB 1BYNA 3FMGL 4V1DD 4YAQB 2EDFA 4NQCA 1SM3L 2J1YA 1P6AB 1AMXA 2Q86A 4MZIA 1AI1L 1VGEL 1WWAX 3OV6A 1CFBA 1N9PA 2KKQA 4ZS7L 3PYCA 2PXYA 4XCNA 1H3TA 1U91A 1RIUL 3SKNA 4JRXB 2FX7L 1SVZA 1G6RL 1PZSA 1ZWIB 1E4XI 4APQA 1AXSB 2GJZB 1T2JA 4JG0L 2PWFA 1A9BB 1B6UA 3GF8A 1NGWB 3CC1A 5B1JA 3RL1B 1DDTA 3TBTB 2OZ4L 4RRPG 4AQ1A 2DM3A 4UQIM 5KN5B 2PTVA 4Q6YA 4YOKA 1QWUA 4FFYL 1KN4H 3N6YA 4MS6A 3K6FA 4QTFA 3HLAB 4XHQA 6FABH 5DFVD 4AKOA 2VDQH 3ARGB 1WZMA 5F1IA 4R90H 4EDWL 9CGTA 4NNPL 3RURA 3GTTA 1ZGLM 5BZXA 3UJTL 1IX2A 5C2BL 4JDZB 1CFTB 3NRFA 5F7BA 4JK0D 3OR7B 3VYNA 2FLBT 5JHAA 2HJLA 5TF1L 4PJ5A 1JTOA 5JQ6H 2I9LB 1A4CA 1KJ2A 2CUAA 2YKKA 3CMOL 1KEGL 4Y0GA 3QGVA 4MMZA 2O5XH 4GW5A 3H53A 4IRSA 4M8RA 3GS0A 4MSWA 2XZAL 3GQFA 1MAMH 3KM2A 5IMOA 2ICEC 2MH4A 1IC4L 3ASWA 4P5TB 1UA7A 4WWNA 3CC5A 4NSKA 2TSBA 3ARFB 4JN2A 5EOCJ 3GSVB 1NZRA 3OKMA 3MLTB 4WWKA 2X5PA 5CCKL 1ID2A 2BWIA 2V37A 3Q9PA 4FEMA 3WNKA 4AUYA 3RI5F 2GC7C 4GKSB 2Z7WA 1R3HA 1XR9A 2EDXA 3VE0B 4K3JH 4Y9EA 5K9OA 2WYIA 4JO2H 3FSVA 2VDRL 3K8KA 4IOIB 1VPOH 3QEUA 3U7AA 5I19H 3BD3A 2PYEB 3GM8A 2VB5A 1Z9LA 4HJIA 2B0SL 3WE6A 1RFDL 4DVRL 5AYUH 3FHAA 2E56A 1HT6A 1GYWA 1KUMA 2X9ZA 3EJYC 4CNIA 5EBWA 1KIUB 1SXCA 3L3GB 1EDYA 2EE2A 2W0FB 2ZX5A 4MD4A 1IC5H 1OP9A 1OZTG 2CIKA 2ADGA 3D8MA 4RGNE 4TNFA 3L17A 1LK2A 2B9BA 2WO2B 2PPFA 2Y4SA 3FQXA 1WD8A 2LAGB 3KPNB 4GUPB 2Q7NA 3ESMA 2WP3O 4Z78A 4U6XA 2BP0B 2CHDA 2NQ3A 5B21A 4KVCL 1MWAA 3G3LA 3CZEA 1NAKL 2WYTA 4HJ0D 3FTSA 3NUKA 3S4SA 3LNFA 1CL7H 1Z3GL 3DXAB 3AITA 1NCIA 5T3XD 4WU5B 2X88A 1A47A 2BHZA 3DHUA 4FNLL 2AQ2A 1KTDA 3LIUA 4I77L 5T3XH 5ILTH 3EDJA 1Z5YD 4U1HA 5T1KD 4NQTA 4QRQA 4UOW1 2UZIL 5GS1A 3L48A 5L8KB 4ZG1A 5CJ8A 1FN4A 1Y1DA 2AANA 2W07B 3D5OF 1PGRB 2VLRB 4QRSA 2Y5EA 3V7MA 3QCVH 4PJDA 1IGCH 4JZOB 5EFIA 4MDIB 1GHFL 1WRFA 2XQYG 4EJ1C 3K71A 3H9SB 1WC7A 5JXEC 5FCUL 4PJ7A 4ZTPL 4UOW0 4N2KA 3P2TA 3X1GA 1JAEA 1JHKH 1Z9MA 3QUGA 4PJ8A 3MROB 3WKYA 2IWGA 4GSXA 3KPQB 4OZGF 4YEEA 1QBML 1QUPA 5ESAA 5C08B 4PJ9B 2D4DA 4JQXC 1PY9A 4W68A 2ID5A 2NOYA 2KS0A 4GI6A 2WXMA 3HZYA 4WI2A 3U30B 2V7NA 3S3DB 4APXB 2MMXA 4TUOB 2F53B 1R0AH 3C6SA 4QT5B 1ZY9A 3KDMB 5B1AB 2I5YL 4NP4L 5SX4I 5TDOB 2RBLA 2OMUA 1HYSD 2V5TA 3QNXB 5B38G 4P2OB 3IPFA 4PJFE 2HJFA 1T3FB 1UZ8A 1H8OA 3RA7L 2DDQH 4L5FL 3NFNA 5F88A 5ACZA 3BHBA 2ZOKB 3VD9A 3HC0A 3ZSTA 4M4PA 1G9MC 3B2VH 4FQIH 3WHE0 3FQNB 2PO6C 4J2XA 2DQTL 4A6YB 1D9KD 3SE8L 2W1NA 4W9LC 4V1DB 3VACA 2PN5A 3DECA 2F8IA 1KIQB 1DUZB 1QWHA 1TEFA 3FOLB 4QJ4B 5MENA 2EC8A 4IRJC 4ZDHA 3JV6A 4FD0A 1MI5B 3HAEG 3P1VA 4P0DA 2NY0D 2NNCA 5C0AB 3G5XA 2MOVA 1RZKC 5DVMA 4ELKA 3MNWB 4ZPTB 3CX2A 3FB8A 3IU3B 3SDAD 3ULVL 2WXGA 4H20L 3V0VB 1OT4A 4I3GA 2VMEA 2YD9A 1CYGA 2OLDA 2NTFB 1R1CA 3L4CA 2FEDC 4LDEB 1HE8A 4YHZL 2BNQE 3Q0HA 3VXMD 4EIUA 2YR3A 3HBQA 3UAJA 2PR9A 2J5LB 1HZHL 2CPUA 2VDQB 1I3UA 5IB4B 3QCTL 1I9RL 1XGQA 3NJXA 1KXQA 3DUUB 3AQXA 1FL5A 2DEXX 3F6LA 4HIPA 4D94A 4IW4C 3IMWA 5T1DL 2JB5H 2C3XA 2COVD 1QA9B 1UWEL 1WAEA 3M1CA 4M3KB 2JF1A 4P5SA 4DP2X 1DBBL 1CICB 1ZMYA 3O2DH 5DJCB 1FAIH 4GY4A 1SY6A 2P80A 3LHPH 1UXLA 4XE5B 3K2MC 1P9MA 3RWGA 1XWVA 3CNKA 4NWTL 3OPUA 4EZMA 4EN3A 3H3KA 6PCYA 5K5YA 2R39A 3L1OH 4UIMA 1KTKE 3BJ91 1XF3A 1GW6A 4WO4A 1A8ZA 2UWEE 3DRQB 3GGWB 3TXAA 1G9NH 1T1YA 3W9EA 2KHAA 3CFJA 4PS4L 4M61B 4M56A 1RHHA 2AMUA 1M53A 4OUUA 3ZQ9A 3CSYB 4LCYB 3BIAX 5HTSA 3AWFA 1QSED 1P7KB 2IG2H 1L7IL 3WLWC 4RA0C 2YSSB 4KXZI 1DVSA 4QXWA 5IF0B 1HXMA 1MRFL 4WUKL 1IJNA 4D9RD 2NY6D 2YGPA 5EEWA 1T2QL 2JK5B 5TE7L 3FAXA 5IJVB 3TBYB 5IBUG 4HKXA 1JGVL 2RR3A 4HLZG 3ZGHA 1CGWA 4IHOB 4F9LA 2DQIL 1ZTXH 2KLTA 2JKWA 5EWIH 5AVXB 4DF9A 5H37G 2A73B 3DV6A 2AQSA 1BAGA 2YMXH 3JV4B 5DJYB 2ZX7A 2AAAA 2GSIB 4YHPA 2HFEA 2VMJA 3ENEA 4JPSA 1I7TB 4JHAH 3MU3A 2V4LA 3IJ8A 4Z0BL 3JWDL 1RSYA 2GCYB 2Y07L 3EGDB 4Q74A 3RE0A 3QWOA 5D72L 2P5WD 4RFNC 4JM2F 2FIRT 1TJHL 4B95C 1MCWM 1OGTB 2J8OA 4KFMA 2EICA 3X12A 1T4KA 4MB4A 2HRGA 4HUVA 2GG1A 5D4HA 3KNBB 4P4RB 4B3VA 1JPGA 4OLWH 1KMGA 4TN9A 3L9RA 4GMSL 3VCLA 3GSUB 2WUBL 3HRZB 4FXTA 4F8OA 3IN0A 5T1KB 3O3EA 3QYCA 3D12B 3RNQA 2CA4A 2LV4A 3VFOB 3OGOE 3GO1H 4RZCB 2OTUA 2IDSA 3WI9A 3UJIL 3WD5H 5H2BA 4KGLA 4XCYA 3TJHD 3LDBB 1ZGLB 2R4SL 4LLYA 4HEPG 4QY8A 3A6OA 1RUQH 1N8ZA 4XVOA 4HCIA 4EBQL 4C8XA 3OKOA 1IKNC 4QTHA 2OZ4A 3WN5A 1RIVL 1FUNA 3QDME 3EO9L 3NQIA 1U8NA 4FFYA 4N3TA 4NWUH 4JFDE 1J0IA 1QX1A 3QQ9C 4XMPL 4X9GA 4BFIB 5FECB 1YYLL 1A14H 4R7NB 3LKQA 3U0TA 3CFMA 4Y2DD 1ZLUH 4EOWH 5F7KC 1MFDH 4DKEL 5F9OL 2CDFA 3HG1B 4JL2A 3QUXC 4AM0A 5BV7C 2V3DA 5C0GB 2GI0A 3SKJL 3OVUB 3U7YH 4O4YL 4KFZC 4FYSA 4LCUB 1EVUA 5I1DB 3T3PF 2NW2A 5G5DB 5K93A 2AGJL 4K94H 5IG7A 1BLNA 2V17L 5CD5C 2IVFC 4WSKA 3PAUA 2N4IA 4FQQA 4X5XB 4NN6C 1KBKA 3W0WA 3GSXA 5DFAA 2FJGA 1ZPUA 1KCRH 2W65A 2YGNA 5GGQH 1F13A 2IH1B 4UNUA 3T3MF 1EBAA 4FYRA 1CIDA 5AVVB 1I8LC 1QUNB 1TIUA 4LSVL 4FJYA 3LPOA 1Q72H 4KDWA 3MV8E 3RDTB 2EDNA 4O58L 1KGCE 1D9KB 2FL5B 5AYQA 5AOZA 2DQHH 3SJVD 3MA9L 3D51A 5LBSH 1I9IH 2AS5M 3C6LD 5E6ID 1EO8L 4LFHG 1AGEA 4KZEL 4OZIF 4LNRB 4ATWA 4P2CG 4FNQA 3CIAA 5E2WL 1XGPA 5CUSL 1MCDA 5EU6E 5JHDD 4HSQA 4GO6B 1JZ5A 1E50A 2CK0L 2J73A 4X6CB 3WELA 2G0KA 3IT8D 3NOIA 4GG8A 1YEWA 2FYYB 4QD2E 5J56B 4J2QA 3C60D 3VXMB 5D96C 4G3YL 1OANA 5IOKA 4I2XE 3VWJD 4H88H 4GSQA 2WVVA 4U1GC 3AW5A 1JPTH 4LE8A 2CBMA 1MJUL 3HUJF 1TQTA 4OM1H 3Q9QA 2R2CA 2X38A 4YHLH 4J3SA 12E8H 2A9BA 2FAUA 3O4OC 4I3SL 1ZK5A 3X3FH 4UTAH 4ZS6C 4AQ8C 4PRAB 1J1PH 2KZBA 3P3RA 4DGIH 1PVHA 5F44A 1MREL 2HH0L 4AIZB 4Z7UF 1W72H 3OAYH 2PWGA 4WFGE 1FL3B 2AEQH 3G5VB 2OYMA 4NI3A 4PJXA 1RURL 4LLMA 4PJEB 4DZ8B 1QNZH 4J3BA 4UT6L 3RKDD 2MTPA 3QXAA 3ZTCC 3CSGA 3RG1C 4NZTH 4JDEA 3C5JA 3RGVB 5DK0A 4HFUH 4KROB 4GINA 1SYVA 3FQUA 1KB9K 3I6GB 3IMRA 3MOBL 1MCLA 1WGVA 1RAMA 4YVNA 3OLEA 1HSBA 1MCPL 3QR1A 4MCYA 4WJ5A 3SCMC 2P48B 5GZOD 3B56A 3OKDB 2J43A 4MNQB 1QSEB 1ZV9A 2WLHA 1JK8B 3KPSB 4X7SL 4YDLB 4FQXD 3KZ8A 4IBZA 3I75A 5IB3A 4YDZA 2WY3B 2FHCA 3D7PA 3C2SA 4LGPB 3CDGB 4XO9A 4X42A 3RWJA 4GAJL 3FO9B 1D2PA 4ERSL 1RSFA 3ZVVA 2NY2D 3TV3H 3U7WH 4JDTL 2ZSVA 3UZQA 5IHLB 3S5LB 3TA3D 2CXGA 1YN7B 3DVGA 5C0DB 2GBTA 2E7CA 3MRMA 4GG6A 4FADA 3L6FB 4MXWL 1RUMH 3RWEB 3SDCA 4I89A 3DTXA 4ZW5A 3D05A 2CO7B 5D9SA 3QQDA 3IETB 2N1KA 3A67H 1WS7A 3L1GA 3UO1H 5JUEH 2DRUA 3GDCA 2APBA 2WC7A 3QZPA 4GSRA 4P5MB 4CAGA 1RIHL 1SYSB 4XNXH 5D55A 3P0VL 2ILLA 4M1DL 3QI9C 4ZXBC 5DC0A 2CBOA 5HVGB 1BMGA 1JDDA 4WHYG 3VM7A 1TQCC 4UT9H 1H3XA 2CRMA 1JNLH 2Q76A 1UFGA 1X5IA 4S2SA 3VWKC 4CMMB 4OM0L 5ESQA 4XNZB 4N0FB 1E9PB 1XD1A 2CPCA 1VCAA 4U4BA 1XEDA 2BP5M 3B1UA 3M45A 3MJWA 4PWEA 3TPKA 5FYKD 4AYEC 1DVFC 5FYKH 1CXKA 4GI9A 4P46C 5E1GA 2NY5C 3BESR 1K8IB 3V4UL 3IJHA 1FLRH 5ANMA 4UI2A 3V5DB 5A1AA 2DQMA 2CZNA 4PY7A 3BUTA 1SN2A 3B9KA 4QYAA 5F0PB 4ADGA 3O9WA 1IQDB 1PX4A 1KCBA 1F97A 3UTTD 1IAOB 2MOQA 4KBPA 4M7LT 4MJID 4OZ4A 3FTGA 3RFZA 1FYTD 5CLWA 5LGKA 1DANU 5IVOA 5IT2H 5F70A 3TZVD 1H0DA 5D2LB 5DJ6B 3PV6A 4E41E 5C0CB 3B2XA 5IFHL 1KT2B 2CCWA 4NRYB 1NDGA 2VABA 4XODA 5FF6B 5IVNA 3LPWA 2MKLC 1EEQA 1MLCA 2ED6A 4OJCA 2ZOOA 3MCKA 4NC1E 2K7PA 5IW1B 4OF3A 2X7LA 3GZPA 1CK0L 3GSOB 4KC3B 4G7VH 4JRYD 5FUOL 2C3VB 1EAQA 3SDXE 4AVIA 3MRKA 1PG7H 2ZG2A 3QNFA 1DQLL 4B9GA 2VDLB 5HHQA 4AXWA 3G08B 3UP1A 2DI9A 4IGBB 1XEUA 3Q3GA 4XXCA 2YA0A 3V4LA 2EXYC 4M1GH 2BNRD 2NX5A 1HNGA 4UQ9A 4WV1B 2VLKA 2VQ1A 3F64A 4Z7OE 2W91A 4GSDH 1T20B 2ATKA 2ICWJ 2XDHA 4TVPD 4BCXA 3GRGA 4TVPH 3N41B 3WEBA 5E6IB 3BAEH 3ZTNH 1OAXL 1FDLH 1RJYA 3QUZC 3RBSA 1CXLA 3AG1B 5D1QC 3VG0L 3CSBA 5T3ZE 3U0WH 4OLXH 3BIKB 4HUKB 1IBFA 4OCYH 3CFCH 1YDPA 2HLAA 1G7LA 3H2QA 1Q90A 2Q20A 5DURD 4R97C 4JHVA 1U95A 2F7IA 2YZ8A 5L0QC 4PRPE 3C60B 2KYIA 4GB9A 3SPVB 1XGYL 3G6AB 2Q5BA 1BOGB 1WFOA 5FGCB 3V6OA 1CFSA 5D7IA 5I2IB 3HG3A 4P2QA 1HQ4B 2OZNA 3NIGB 1KLGB 2X4RA 1JG9A 4GQRA 4FXKA 3L7EB 4M00A 2JQAA 1AD9A 1EHXA 4IMLB 1BJ8A 3GSWA 4ZW6A 5D6CA 3H56A 4PREA 2H32A 3G5WA 4Y5YC 5K39A 4X0NA 1F3JA 3S5ZA 5DHYA 1PG7W 3E6HA 1AGDB 2K45A 3FUDA 4LPWA 3TBBA 1JBJA 3OC8A 9PCYA 4MZ2A 4UQ2A 2NYKA 1BMWA 3INUH 3H3PH 4HBCL 4N2CA 3BVNB 4WJG3 5I8OL 1GSMA 1N8OE 2Z3FA 5EUOB 1ETZA 3LRKA 5ALBH 1FFNB 4JPIA 1F58H 5E8DL 5EZPA 1DQKA 2IXQB 4W1TA 3S3PA 3VFSA 3O6FB 4RLDA 4WO0A 15C8H 3EOTL 1IFHH 4OIIH 4X8CA 4Y1TA 5DVPA 5ESVA 5C0BD 4MGXA 1DTUA 4QIRA 4X5RA 1DJXA 3ZE0F 4X4XB 2WLJA 2DEYX 3MKGA 3LMJH 1YEJL 1IIIA 2NY2B 1LO5B 1D7BA 3FC8A 3HAEH 5D7SH 4DGYH 1SMAA 3RVTC 1SBSL 1T22A 2HA1A 4DTGH 1FNHA 1MJ8L 3M1OA 3Q5YA 4ABWA 1D7FA 5HPMB 1K3IA 2Q2EB 4ZD3H 3T77B 1M3JA 5IY5B 4TUKL 1ZV2A 1U58A 2BOCA 4Z77B 2EVIA 3GXUB 4LQFH 4MTMA 4ESKA 5A7EA 1DFXA 4FF9A 4Y2OA 5EEUA 2JJTC 4XN2A 1LM8V 3MRLB 2FECI 4R4FL 1EHLH 1IGTB 5FUCE 5IBTL 3HBZA 2VN4A 5C70A 1REIA 4FJZA 2CG9X 1IKFL 3U6XS 4TL4A 2LHAA 5L4JA 4KI5F 1BOYA 4KH9A 1URZA 4LSTL 3DJ9A 1ZLSL 4BK5A 3CVHH 4QHMB 2WUCL 4YL4A 2J1ZA 3KS0J 3PWPA 3FFDB 1KDJA 4MWFB 4I48B 5D4JA 1FNLA 4Z95H 4NJ9H 2GUOB 2VDNH 4N4YB 3A4EA 2WTPA 3P4MB 4FZEH 5HHPA 2D8KA 2G3ZA 3MRJB 3AS2A 1CMOA 3HZKA 5EOCH 2B2XH 2J1WA 1F11B 1MCFA 4W9KC 2ZWYA 2K4WA 2EDTA 1E27A 3N1PC 3HNTL 5JZ7C 2NY7L 3PP3K 1FHGA 3U83A 1CTMA 4OZFG 1NGXB 3UTTB 3W9DB 2GJJA 4JFYA 4OU3A 4QRPD 2XFGB 4ZQKA 4XBEH 3E1F1 3VXUE 5L9DL 1UA6H 4RISL 3VU2A 3WTSA 1S7RA 4PJIA 3BN9C 4NO2A 5I82A 3GZKA 5TJWK 2LFGA 4PFEA 5C07D 5CLZA 1P5VB 2CRZA 1YNKL 4NUJA 3JSSA 4HLZH 2WINB 3LRSB 4L4VD 2A5UA 1FZOB 2H3NB 4NERA 1T7XA 1HSAA 1AR1C 2HG5A 3C8DA 2DI7A 5H37H 2KQNA 4GS7B 4A2DA 3IJ7A 5DWUL 3P2DA 4DGVL 2Y06H 2CHWA 5KOMC 1Q9KB 3Q5OA 3QVAA 4H0LC 3C2AL 2DZEA 5BVPH 5I1HL 1P4IH 1A1NB 4X5QA 2NT0A 1TTAA 2EO7A 4Y9BA 1F3DJ 1MFAL 3GSNL 3FPXA 2BK8A 1SXBA 3IGAA 1PKOA 4CUCA 1FIEA 1GMIA 1OTSD 2OTWB 4HIJB 5ABZA 1M05B 4WW2B 1M57B 1ORQA 2PR4H 3ALWA 4KWUA 2DL2A 2WKLA 5ERWA 2E8ZA 1AJ7L 3JXAA 3K6SA 3NPZB 1S9VA 2CM5A 3O3UN 2KPNA 1YEHH 2WGNB 3AY4C 3N50A 5FAAA 1WZ1L 3ZTEA 1VADB 3B7UX 3GNMH 4OZGE 5B8CC 5J9PB 4TUJA 4I18C 4AH2A 2BVOA 2F68X 3ZZSA 2VN3A 3X13A 2C7UB 2DIEA 5DZPA 4BFEA 3NDZE 5AENA 5ELIA 5KSVA 1YEDB 3KPLA 3HZMB 4PLKC 4PJGA 1UEYA 4LVHC 2C26A 4KXBA 4OF5A 2VMDA 1F8TL 3CDFA 4FI6A 5DI8B 3VSUA 1N68A 1QATA 5CEXB 2GK2A 3RUGA 4O51B 3NZHL 3R4RA 4OCWL 1I75A 3TP4A 4Z3FA 4PP1D 1COBA 1OE1A 4EAEA 4UTBL 5JXED 3E3QC 4WNQB 3C8HA 3HC4H 4GW1B 1IBGL 1QWNA 4V11A 1P7HL 4M7JH 1SOKA 4GAAA 4EF3A 1V5JA 5E9AA 5HYQA 5EZIH 1NIAA 1E4HA 3U9UB 3BZEB 3MTXA 2DQDH 4PRHD 1DJHA 4WHTB 5B7EA 4JLRB 2JJSA 3U25A 1OAYH 1PKQA 3Q01A 2D3VA 2PCFB 5C71A 4U0RC 1XR8B 3QFJD 3QJUB 4HC1H 3MBED 4POZC 3V4VL 3T5WA 4LL1A 3UPAA 1JK9B 1KGJA 1BQSA 3AWGA 3O2VL 1HOEA 4PG2A 4FQHB 3F05A 4JZJA 4LFHD 5DMKB 1QRNE 1SQMA 1DLHA 2LU3A 1NINA 4TRPH 4GO9A 4LARH 5DRWB 3ARTA 5HHXH 2WXNA 4FXGB 2NR6A 3IKCB 1UD8A 4NENB 4PLNC 5CF3A 3GIVA 4DAGH 1G9MH 4G8GE 1BVNP 2ESVE 2JTYA 5IP4A 2IPKA 4NKIH 2F0CA 5AOMA 1JS4A 1GXEA 2YRBA 3MO1B 3W5MA 1OAUH 2CKBH 2FJFA 4YGAB 4DGUA 4TQ8A 2PYFB 4IRJD 4XN4A 3RB5A 2IH9A 3AZUA 4K5MA 2PP9A 3B43A 3RGBA 1AGBB 3K1KC 2ZCZA 3Q2VA 5E8OB 4N0YL 2WZ6A 4YDKH 2AEWA 5DA0B 3R18A 3GZQA 1ASQA 1RZKH 3S7GA 1I82A 4OCRH 5H94A 5DC4B 1G6RB 5A7BA 5E95B 2FEDD 3NH7L 3P0YH 3MBXL 2JV6A 1IZKA 3DX1A 5FLUA 4BFJA 2FWSA 3BAIA 1YRKA 3UTSE 3ECBB 4LEXL 5IQMA 4UOZA 5KVGH 4KX8A 1JYNA 2ZF8A 4KQ4H 2VDNB 3MLUL 2CCVA 4N85A 1F3RB 1A6AB 1NUDA 3L9EA 3QHFL 1M6UA 1M7IA 2QSVA 1BXAA 2EYSB 4XMZA 5AVWB 2EIJB 4LRNH 4PM1A 1CT8B 4YLCA 1I1AC 3LXCA 1PX8A 3P9MB 4ANVA 4B9PA 4HA1A 2Q3AA 3JVGC 4PVMA 4D3CL 5IFJA 3H7LA 1FGVL 2EEDA 2Y7SA 3BGMA 5L4MA 2WXIA 3V52H 2BIOA 2WWNA 5I17B 1M56B 3FB5B 4PS7A 1WCBA 4RQQA 1AQHA 1IJ9A 3NCWA 3KCPA 4L4TE 4HAGA 4JPKL 4YMPA 2ICEB 4Q9QL 2XIBA 1LEIB 2VR8A 5K9JH 2AZUA 3MYJB 3T6WA 3B4NA 5IBUB 1Q94A 1E5YA 3N91A 3VO0A 4LSUL 2GITA 3TN0D 5GIRB 3QYNA 1ZT4B 4KRNA 3D39E 3HI1A 4F58H 2QGCA 3GTVA 4ZMVA 2D7OA 2WBWB 5CEZE 1ES0A 3WFDH 4EPSA 1D6EB 1XB6A 3B34A 5ISZB 4L1HA 3L2LA 3TF7C 2Q3XA 2KBGA 1XF5B 2P24B 3VYPA 3BEWB 2X6CA 1DBML 2VDRB 3WNNA 5AALA 1C1EL 4JRLA 2ZP0T 4MMZC 1DFBH 2IAMD 5CZVH 5F9AC 3MX0A 3MR9B 4UILH 1A1OA 5E99H 2B4CC 4DQOH 4YSEA 2CSPA 3TFKC 4HK3J 4XP1H 4X6CF 5EF1A 4WHYH 3IKKA 4IU3B 2R1YA 2CUIA 3ABLB 1MELA 1SLVA 3BSZH 4KHXH 4BK4A 1QLFA 4WTZA 3KPMA 1NUFA 4F91B 2P5EE 2EIMB 3JVFC 2FB4H 3D52A 4RESB 3JV0A 4IJTA 3WS6C 1SJEB 1NM9A 1UWGH 3LRHA 4KOCA 1WT5A 4HV8B 4IBVA 3VI3F 5GRJH 2EDEA 2EABA 1NEUA 3F6JA 1NQBA 2V8LA 3DO7B 5CFAA 5INCB 1DBAL 3EGXA 5DD6B 3OSKA 3RTLA 4IBWA 3RWCA 3MLZL 2B7DT 4ENZA 4UT7H 4XN5A 1CCZA 4LF3B 3ZY7A 2WLKA 1AY1H 4PJEF 4NN7C 4GT7A 4BDVB 1CLCA 3MOAH 3LQAL 1SFHA 3T3PE 1HILB 1RZIA 2VRQA 1RUPH 3LQAC 4JO3L 4PB9L 3W3BA 4ZFGH 1JOIA 4FULA 4AC4A 3GKWL 3PHAA 3BKCL 3H6JA 5HHOD 3AUVA 2YPLE 1H8LA 3MV01 3T3ME 3RY4A 5DSCA 4YNYB 5L6YH 2AXFB 1OL0A 2IQAA 1KGUA 4Y4KC 1PIFA 3RZCC 1QEXA 4WFFD 4HOWA 5IWLA 3OKLB 2KC0A 3QUXD 4WK0B 1ZT7B 1KB3A 4GP4B 1ONQA 2OPCA 4MJ5B 5BV7H 2ZCHL 4OZIE 3FHEA 1K4DB 2YRLA 4LZKA 2K1MA 4K3EH 1GGBH 3LN4A 3QQ4A 2AK4E 4NQEA 3CSTA 5J6SA 1HHHA 3DV4A 1BBDL 1DQDH 2OBGA 4ZZKA 3PLYA 3RBGA 1CGSH 4X80H 4PVBA 5GS0L 4OJFH 1NMAL 4E5XA 1OAJA 1TO5A 1FE8L 4H8WL 1WWBX 5FW7A 4U1MB 4ZW3A 2NY3C 4E9SA 2ENJA 3QXTA 4PJ8C 2VO5A 3PDOB 4X6DA 3VFRB 3WIAA 2PO6B 1I7RA 1S5IL 3QIUC 4EVNA 3HUJE 1GS6X 1QEWB 1ZE3C 4MA3B 5E9NA 3SDDD 4MA7H 1NAMH 2JXMB 4GUCA 3O0RH 1VF5C 4JUTA 3MV7E 1MDAA 3ECQA 4TTDD 1V05A 2QVKA 1HQRB 3CVBA 4IRJB 3HNVH 3O11A 1JWMB 3CIQA 3T8MA 3FTYA 4Z7UE 5DHVA 1MW1A 3BP5A 4I9WE 2XOTA 3EHBC 3JWOC 4FQPA 2XTJC 1BP3B 2Z9TA 2HPOA 4GIPD 2FATH 4UB0L 3BWAB 1EUUA 2MCPH 3ATEA 1EEZA 1YUHB 1BFOB 5FO7A 2V7HB 3O6LH 3NVQA 4KTYA 4YGVB 5SX5K 2XRAH 4HEMA 1E3FA 5CMAA 5E00A 3PHOB 2X4TB 3S96A 1OSZB 1R47A 1VFBA 4D9QD 1W8OA 2DY2A 1X7QA 5A2CA 1WBYA 1IMHC 1NCAL 2NY4D 2R15A 3CHPA 1ZIAA 3QBTB 1YN6A 2DIAA 5EDSA 3TBCA 4ZS6D 1MN4A 2A38A 4IBSA 3GB7A 1MIEL 2XY1A 4YSRA 2AJ3A 3X1BA 4AITA 3S8FB 5EIQA 4LBAA 2D31B 2CDEA 3BP6A 4QHUA 3D9AH 2H2SC 1BXXA 2Y9RT 4J3OC 2ZWKA 4JFFE 4KTGA 4S0TD 4HCFA 3MNZA 5MI0C 4M5TA 3CQPA 4K7PX 5TE4H 1I85A 4NAMA 3MUHL 2HJKA 1A4JB 1G6VK 2CLZA 2QLYA 2OJEB 3AT8A 4ORZC 2RD0A 3UAJC 1U8QB 1ZJAA 4G83A 1A3RH 3NJHA 43CAA 3FRUA 1J0JA 2WYZA 2WZPA 3ALPA 1V7NH 5B1BB 1U8PA 2AI0H 1UB6A 3ZKSD 1S8DB 2EDQA 3MXWH 2MNUA 3WNIA 3MV9D 1W0YT 4PGDB 1MVYA 2JTDA 3S98A 1EZUA 4AYBA 5F3HB 4I0PC 4X6FA 2DM7A 5E2UL 3SDYL 3N41F 1P9MC 1VHPA 3LRMA 3NA4A 1N19A 4L0ZA 1N5AB 5HVHC 1BF8A 5I26A 2BSSB 2YJLA 4GXVL 5D2NA 3RWIB 4HLEA 2JB6A 4XNAA 1JZ8A 4EIBA 4OAWA 1H6EA 4AZ8A 1HL9A 1B4JH 2VC2L 5F7FA 2WXKA 1Q1PA 3V4VA 1U8MA 1P84K 3ME0B 4JNXA 2HT4C 3OPZL 2HLEB 1S5HB 1KWGA 1AQ8A 5GGTL 4GKNB 4X4ME 1G7PB 1RP8A 3RTQD 5DK2A 4FLQA 1E5BA 3T0BA 4AJWA 3OAWA 4YIQB 4ZMQA 1TZGH 1JNJA 4RFNB 3VXTA 4DVBA 3SKMA 3QO1B 2XN9E 2VWEC 5E9DA 2YD0A 3NIGF 5IM7B 4MQ7A 1WZLA 1YPZA 2DWDB 1NH6A 4GW4A 1INQB 5CGTA 4HHAB 5D71H 3T6ZA 1JXDA 3IMBA 3QUYA 2HT2C 5EZJA 2HT3C 4MX7B 3VWKD 2EVHA 1C16A 1ZJBA 1BGXH 4HS3B 3MRRA 3GXIA 4TNVK 4GLRH 1PAMA 2Y72A 3PWLB 2AQRA 1SLWA 1S78C 3GMLB 3GEWB 4DSYA 2VDOH 1HESA 2J8HA 3WFZA 4BGLA 1OY3B 4KDVA 2UUDK 4U6VH 1NMBL 2D7TH 2F7OA 2CJUL 4YSOA 1KELH 3T2QA 3C75A 1ZHKB 2JCCA 3ILPA 2X3BA 3P77A 3ZHNA 3F7VB 4KQ0A 4D0DA 4IHBA 3W39A 1QYGH 3O41A 3VFSB 4F93B 2VQ4A 1A7QH 2AJXH 3GXMA 3VUAA 2E74C 3KYOB 4JY6A 2G5BA 1AKJD 2OS7A 5AD0A 4JRXE 1KBPA 5I6OA 1U8LB 2OMYA 3QO0A 2NNRA 3GS7A 4HPHA 1B0GA 4HUWB 4HALA 3TC9A 3QHZH 4MQTB 3QUXB 1BVKA 2QGEA 2P42B 35C8L 4LASL 4KUCD 1GMEA 3PQYA 4M8VA 1XIWA 1X4YA 3AAZA 1FV1A 3S2CA 1IV8A 4QO1A 4DQAA 1QSFA 2EKJA 3C9NA 3S0PA 1P4LA 2OSWA 3S4SG 3L95B 4Z7AA 4XO3A 3VFWB 5AKRA 4NN6B 1DDHB 4W9GC 5JOPE 3MQIA 4HWZA 1RK7A 4HIXH 5F1NA 1GRWA 2ED9A 3K2UL 2OJZH 4LQ1A 2ZNWA 2CH8A 4PEEA 3BW9B 2FDBP 1WEJL 5DXWA 5BRZA 5KSAD 1TT6A 3KD4A 1CURA 1NAMB 2A6IB 3PNRB 1ODAA 3AGWA 3K5RA 1HTYA 4AGOA 3G6JB 1MEXH 4NT6B 3NJVA 4ODUA 3JUZA 5EZLA 1KTLB 3V8OA 1I8MB 1QTYT 5D1QD 2XWBA 3C5ZA 4XCFL 3MLRH 1S9YB 4LXFA 1GY2A 2BIHA 4NHUB 4M4RB 5AL0A 1JI1A 4NKMA 1UUSA 2JKLA 2XV6B 1FNGB 5FWQA 3FFCD 1IGIH 4N3UA 3WOVA 2OSLB 4FHJA 4GRMA 4JR9H 1O7SA 3B7RL 4DWHA 2ALWA 2R59A 4TULH 4R84A 2ENYA 3S88H 2XPYA 5D96B 4AGQA 4U1GB 1BQRA 3U9PH 2WHVA 2PYEE 1ORSB 5TFSL 2A83A 4UU9A 2EECA 3PL6B 5H4YA 5G2NA 3O4OB 4KK9C 4I3RH 4JFED 4CVZB 1YNTB 2DN7A 32C2B 2BVQA 4H7VA 2DEWX 4BFNA 4XVJH 4KZDL 1DLFH 3PPSA 4IBUA 2OMWB 3EJSA 2GTZA 3ZE0E 4K9JA 1XZ0B 1CLVA 3L7FB 4HDIA 4LLVB 4JW3A 4BSJA 5F6HI 3BKML 1OTUC 3ORJA 3UACA 2B16A 4ZOBA 2MPAL 4BRJA 5C6PB 3US1A 4ZPVA 2E9JA 5DJZB 1RKRA 5DJ8A 4M1CD 1WS8A 2VERA 1EZSA 1A65A 1UWXK 2B9AA 3IDNA 3DXAE 3N3EA 4LSPL 1S7VA 3AS1A 3ZYJA 2DMCA 3SCMB 1CC3A 3JYCA 5HYSG 4V33A 2WLYA 1A2YA 3BUYB 4MCNA 2WLLA 4FQJL 1AIZA 4P4KC 4Q6IA 1ZEAL 2HN7B 1Y0LA 4JREC 1KCSH 4CBZA 1RK0B 3BXNB 1E43A 3M07A 1QVOB 3MV9B 1U3YA 4WUUD 1SJXA 2MHAA 2VLRE 2IAND 2VLLA 2W5PA 4KI5E 3S2AA 4XZ4A 1QFWM 1FZKA 5HGHB 3D1MC 1DJZA 4N2IA 5EC1A 5JPMC 1E40A 1QHPA 3KS0H 2CLRB 3RVTD 2QGDA 4E9QA 4KXCA 5HGGS 5KS9B 2EH7H 3H9SE 3IJ9A 5G55A