3H85A

Molecular basis for the association of pipki gamma-p90 with the clathrin adaptor ap-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
277
structure length
253
Chain Sequence
IGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKISIAIDDCTFHQCVRLSRSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 complex subunit mu-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 53
structure length 253
sequence length 277
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h85A02
2JKRM 3H85A 5FPIA 2VGLM 1H6EA 2JKTM 1HESA 4UQIM 1I31A 4EN2A 4MDRA 4IKNA 1BW8A 3L81A 4EMZA 1BXXA 5C7ZA 2PR9A 2BP5M
chains in the Genus database with same CATH superfamily
4F8TA 4A39A 3CHXA 2DAVA 4N4YB 3HOGA 1JV2B 4CC0A 3UL4A 4WK4B 2E27H 1NGWA 2Y36L 4I87A 4Y9EA 3RKDC 3TS8A 3QUML 2IFFH 4F9PC 1BVNP 5I82A 4KK8C 1FFOA 1VGEH 4FG6C 1JK9B 2ADFL 4JFHE 4KUCD 4Y4FB 5DD5L 3ULVL 2Q3XA 3B8YA 1I8KB 1BG1A 1G7LB 4P46B 3EOBB 1ZEAL 4LHQB 2PPAA 1GW0A 2BOBA 3A0OA 4OF8A 1Y07A 2OJZH 3C8DA 4MHHG 4PG9A 3OKOB 2NY4D 4O2FA 1A25A 4ZMWA 3BISA 2IOOA 4OSUH 4XMWA 5TF1H 2OJEA 2Z91A 1NFKA 5D1QD 3L13A 2JKXA 4X83A 3TOPA 3DTXA 4KH2A 1WWBX 1BOYA 3TH3T 3KJ6L 1P2CA 3WNPA 4NQSA 4FQXA 1BM7A 3LKSA 4QJ5B 3TO4C 4PLNC 1U0QA 4OJFH 4P9HH 2DOCA 2ZXBA 3OZ9L 1GTNA 1RERA 1AE6L 4AI7A 1IQDB 2H0PA 4UIKH 1BJ8A 4KX8A 5D7SH 4QI3A 2KZKA 5IVXE 4TQIA 3DX1A 1KIQB 2ATPA 2CE6A 1BBDL 2BXYA 3MRIB 4OJAA 3RRQA 1JUFB 1IM9D 3U0PA 4X99A 3VXME 2G4GA 2DW5A 1T83C 3P2TA 3R8BB 3NCBB 5F3BB 3QFJE 4HIPA 1QACA 1X4ZA 5MEOB 3K71B 5IW6B 3D9AH 3M1OA 3DO4A 4P4RA 4XPHH 1NAKH 2FL5A 2H9GA 3FU6A 4HSAC 2OTUA 2BNQD 2V3DA 1G1CA 4BFIA 1E3XA 1UM4L 1MCFA 4LSUL 4NFBA 1E4WL 1HCZA 4I3GA 3PHOA 4IU3B 4XP4H 5AB0A 3FB8A 1CLYH 1MELA 1VPOL 2XKNA 2Y2WA 2WSPA 3D85D 3O3AA 1UB6A 1T6WA 2DM2A 2QZ5A 2VO8A 1WWCA 3OJVC 1BEYH 3NDZE 4JO2L 4U1IA 4XX1E 1MLCB 4U05A 4NCC2 2F58L 1EJOH 1ZLDA 4HH9B 3WG7B 5HJDA 2C9XA 5DO2D 1OWRM 2GY5A 2NY3B 2P47B 3P0YH 3ZE1B 2DM7A 5CGTA 4LGSB 1J1XH 1NMCC 1A0QH 1UOLA 4OGXH 4ZXBB 3MLRL 1OARL 5IWLA 3M07A 1HNGA 4HZAA 4OZGB 1B9ZA 3H53A 3H1ZA 2R15A 1ZV5A 2A7BA 1T66C 2XNAA 3O2VH 3HC2A 1XIWB 3CZSA 2BH0A 3SDCA 3VD9A 4Y5VA 3Q3GA 2BVUA 1X5FA 2NY2B 5FAAA 4G8EA 4HT1L 5AW5B 4AJYV 4BKSC 3C08H 5LAXB 3S48A 1OAQH 5I2IA 5KBDA 4KUZH 2FATL 5E4OA 3KG5A 4O58H 4YLBA 3R4RA 1MW1A 4HX1B 2CJUH 5HHOE 5BNXD 2YRZA 3ABZA 3OR6B 3DX4A 4M62L 2C3GA 5H37A 1ROWA 1MFUA 5K5YA 2JKNA 3OX8A 2EDOA 3MNZA 3QR1A 4QRQB 3UJTL 1ORSB 2G5RA 2F6AA 3ISYA 4M93B 5F9JA 2OSXA 3UPAA 5E1QA 2VO5A 4AQ1B 5DEZA 3STLA 3RWIA 3O11B 1A7QH 1CD8A 3DBXB 1F58H 3FCTA 4J6RH 1HS6A 1HQRB 4F8OA 2DH2A 4AK2A 1NFDE 1JNHB 4FYSA 1SY6H 5HDLA 2WXOA 3ZHLA 1K5NA 3DXAA 3RWGB 3WL9B 3DTDA 1AC0A 3KHOA 4HZLA 3Q43A 3TBTA 2JKIS 3ET9F 1TENA 2XCMC 2OCCB 2VDLL 2ZOLA 5F9DC 5DURD 3SD2A 1JNNL 2XX1A 1KGIA 1T7WA 4BGDA 3AITA 1F45A 4L3AA 1D7BA 4YS4A 2EDEA 2NY7H 1T5XB 2XWTB 4GNKB 4X5RA 5F1NB 5C0CD 1RIVL 2OS7A 3CDCA 3ULUC 5SV4A 3DHPA 4PG2A 1QI3A 2GUOB 1T1XB 2LE9A 4K5LA 4BFKA 3N1MC 1J5HA 2NY1D 2X4NA 1HXYA 2BWQA 1Z9NA 4MLIA 4FFZA 4PMFA 5ANHA 2C1OA 3O2DL 2OMBA 2ZICA 1F90H 2OR9L 2DF3A 1FO0H 4W9KC 1ET7A 4RESB 1C08A 4EQ3A 4LVNC 3F05A 3BQUA 3TWYA 2YD0A 4GAJL 3O8XC 5H4YA 4F2FA 1N10A 4AITA 4LVHB 1NWPA 4FABH 3OMNB 5D7HA 2AV1B 2LU3A 1OF0A 3IFPA 4PJ7B 1DN0A 2BXZA 4PLOB 4BSJA 3BPNB 2C9SA 5HP5A 5I28A 2GSGB 3NESA 1RHHB 4G5ZH 3MRJB 3S6CA 3T0WA 3DXAE 5L9DL 5LBSL 3QJHB 2C4FT 1I82A 1FFQA 3B56A 2EUWA 5EEUA 5F6IC 4TVSa 2CDGA 2NY6D 5D93B 2YFNA 3FUEA 3ZKXB 4MA8L 4LQFH 4IYKA 3LN9A 4D94A 3DX2A 1IGJA 4P05A 1N2RA 3LRKA 3P02A 4UTBL 1H5BB 3WXVH 5IROD 5ETUB 3P3UA 4YAQA 5LCVH 3P4OA 5AVYB 3OHXA 4LNRB 5IBTH 2R4SL 2XFGB 4YHZH 5L2JA 4JANB 1P7QA 3UADA 5BMFH 3DECA 4OIIL 5GRXG 5TD4A 1LQSR 2IANA 3UAJC 3QNFA 4UUJA 3KD4A 2VDRB 4BA0A 4JB9L 1KF9B 43C9B 2Q1EA 2W9EH 3B2UD 1OM9A 5J12B 3UABA 3PDGA 4LCVA 4AWJC 4OM0L 1QHQA 5AYTA 3OB0K 1OAZH 2J88H 4D9RD 1GTFA 3OSKA 4OQTA 3G04A 4ODHH 5IB2A 3WFZA 1DO6A 3ARFB 3S5ZA 2GPZA 1EO8L 4NHCL 1I8UA 1O6SA 5MEQA 4PRAA 4RWHA 4AIEA 5DMJB 1AP2A 5JHMA 1ERNA 4F7TB 1II4E 2V17H 1FPTH 1XTLA 3LZLA 1T03H 4Z7VA 1QLEL 3RIAK 4XZ4A 2F19L 2QTVA 1W16A 3GXTA 1MHEA 3QIBD 3ZN6A 1A6TA 3WV0A 2VDNB 3OR7A 5LN8A 1F42A 3PCYA 1IU1A 2V2TB 3NZ8B 4IS6B 1U21A 3V0HA 1ZANL 2FT8A 1E27B 4FHJA 2H6UA 4YSSA 3QEGL 4JKNA 3UXFA 3HI5L 4Z3GA 5K9OB 3FHEA 3LKOB 3MYZA 1RK0B 2VUYA 3W57A 5E5MA 4B9JA 3P54A 1ZT4B 2XVLA 4G7YH 3I9IA 1HIMH 4E41D 5C0GA 2K9FB 2NY4C 5EU4A 2OM5A 2C1PA 1NUNB 3QC6X 5D1QC 4I4WB 4GW4B 3BDYL 4A2HA 5I6KA 1A2YA 3QCVH 4QGYA 4I0CC 4IKIA 5GGQH 1NC2B 3TT1H 4M8VA 3HN3A 1BD2B 4GSDL 5E1GA 3V9EA 2J2ZB 3EG9A 4UQ9A 2JQAA 2NXYD 3U9WA 3CFJA 5E2VH 4ODUA 2AQ3A 3KDPB 4JL2A 2BFVL 4PHXA 4HJIA 5KVGE 4UNVA 3LH8A 1R5WB 5HGGS 2JXMA 4Y2OB 1TQUA 1KB9J 3MTRA 3V0FA 1YEHL 5DJDB 5B8CB 3RVTD 1I75A 3M8OH 3H8NA 3TEWA 2R29L 2J25A 2YD7A 1S9VA 3BVDB 5D5MB 4MQ7B 1L5GB 3WLWD 2Y1AA 4RGOH 1FHNA 2OK0L 3TTSA 1XB8A 4GKNA 3G6DL 1RZJC 2Q86A 2DWDB 2FT6A 3DIFB 3FO2A 4A2GA 4F3FB 3D69B 4I5BB 1WZLA 3G6JF 1J0IA 4UDUA 3AWGA 4P4KD 5KANI 4WFGE 3IJ8A 3AS0A 5BRZA 4E0RB 2OX5B 5B39G 5KWYC 2CBMA 2OZ4H 3DARA 4G71B 4WGKA 5HYQB 4WO4D 3X1EA 3K2MC 4LESA 3C2AL 5KN5A 1GPOH 3NAAL 1QSFB 2P49B 5JQIB 3V5DB 4JFDB 3L5WA 3QQ9D 2NT0A 3ARSA 3U6XS 1TF4A 2UZPA 2ZXDA 5CGYD 4LCWA 2HXAA 5TTRA 2R2EA 1NGQH 1KT2A 3OGOE 4C55A 2A73B 2O72A 1JWSB 2ADFH 1VADB 2NYYD 3RPKA 3SKNB 3S8GB 2XETA 4A7GF 1I1AB 4HETA 4BKTC 4NN5B 4N0RA 5EBWA 4M5YL 1F11B 1ZEAH 2Z64C 3MNDA 4Z23A 4TXVB 2VWEE 1YQVH 3OKNB 3T2NL 1KGYE 3CHPA 5TE6L 5I1CH 5BZXA 3HE7B 1GCYA 3KJ6H 1E2ZA 3LEYL 1IVLA 1FZOB 1ZOXA 3M7OA 4XXWC 3EDEA 3SYOA 4KNSA 1RUPH 4QRBA 5IHWA 4NP4L 5IJKA 5I74B 5BRZE 2XG4A 3N06B 4PRBB 1U95A 3FTGB 3D2UA 3AUVA 5H2BB 2JCCB 1FSKC 3VX0A 5C0AD 1J9SA 5EIIA 2DWSA 2I9LA 5I8KL 1L7TH 5JDSA 3QXDB 3SJVD 3CHSA 3MCLL 3U36A 3D39E 1CE1L 1CLZH 1EAQA 3DRQB 4KRMB 4MBOA 3S5LB 4QMEA 4PGBB 4LCIH 4YHOH 3VFTB 4APQA 1A6AA 1PIGA 4MS6A 4LCWE 3FT3B 1KIPB 2GTWB 4UDTA 3TH2T 4LSUH 4JK0D 2MRYA 2W0KA 4XE5B 1E4WH 3M46A 2H26A 3OKDB 1AD0B 1UWXK 5GGUA 4P5TB 1OOAA 4WU7B 2V5SA 3UTSB 1UHVA 1XCQB 1FFNB 4RFEA 1KPUA 1CL7L 3QWOB 4JE0A 2HLAA 4PJFB 5FYLL 3KPLA 3B7RL 3NCYP 2F58H 1BOGA 5EZPA 5IESL 5B38G 4Y16B 2EDMA 3WFBL 2GSIA 4W6WB 4AYFB 5KG9A 4ISVA 1I1RA 2JE8A 2Q7YA 3O45A 1ZS8B 4N5UA 4N8CL 3AJ7A 3GHEL 3HVNA 2X6UA 1QG3A 3PL6D 3LX9A 1FGNH 5GRVL 2QHRL 2WVUA 1OARH 3HI6H 3D05A 3CDZB 4L9LA 2VXQL 1PZ2A 4F33A 5F88A 1CLCA 1WAEA 4JPKH 4XN8A 4LDEB 1YPZA 5FPIA 4PY7A 1CG9B 1UB5A 1QSEA 4MCNA 4PY8I 2WZ6A 5J8OA 3SPHA 4ZMPA 4DP5X 2CBOA 4IBZA 4IBUA 1TNNA 3FTVA 3GB7B 3C75A 2GJZA 2DKUA 2FATH 1I3GH 4OLZH 4QRPA 2ED6A 4OKVB 3BHBA 4FEIA 1NL0L 2X2UA 1MZZA 3FB7B 2A9CA 2ZD0A 1O5DT 5IROC 3ZE2B 1S9YA 3HZVA 5ICXA 3UJTH 1OP9A 2NNXA 2NYZA 2YA2A 3SKUD 3L7EB 1CFNA 4NSKA 3EUDA 4MNHA 2XWEA 3G3LA 3D07A 5C08A 2CIIA 3I9GL 1ZWIA 1SLXA 4NAMA 1DVSA 3IKCA 5AOZA 4E68A 2WP3O 1V3KA 1WQVT 3HAEB 2OV0A 2HT4D 3GZPA 2QSQA 2WBWB 5HGDA 5F0MB 3WNOA 3O8XB 3B2UC 2OSLA 4DKEH 4Z7WA 4PJDA 4CSPA 2R8SL 3LH9A 4QHMB 1R0AH 1SEBB 3RDTD 3QJTB 1MH5A 1D5BA 3ZL4H 2ZUUA 3KPSD 3GSRA 3HMWH 5CP7B 1F3JA 5CZVH 1YPZE 2PR4H 5HXMA 4J8RA 3CC5A 3BFWA 4FXTA 5EU5A 2KLTA 4QCIB 3PAVA 4FS0A 4YR6B 4A2DA 2Z7UA 4L5FE 4B9YA 5JQHC 4U6VH 1ES0A 3BWSA 2O5YH 3WNNA 5EUKA 4XCNB 4XBPB 3L1FA 5CHNA 3HG1B 1UJ3B 5JHBA 1UD6A 4AVHA 3QIBC 3VFMB 5KSBA 3AREB 3FQYA 3FMGH 4HXAL 4GAJH 5CLZA 5C0BD 5TH2B 3ZDXF 2EDNA 1Y18B 3PQYA 1U6AL 2VLJA 1F13A 4GYBA 4JZOA 5C08E 3KYOB 5FM5O 1IJ9A 1ZJAA 4KJPD 1HH6A 5E2TH 4DAGL 2GG1A 2V3FA 4RBPK 2MCAA 2EVIA 1RK7A 2MCG1 2APXA 3ZDYF 1R3HB 1M4KA 1YYMH 2OJ1A 4NUJA 3DVGA 1RMFL 1TQSA 5HVHC 3B9KD 4X6DA 4HIHB 4Z7WE 4PJDE 1JPEA 4YZFE 3EUUA 4JFOB 1GW6A 3E80A 2ZJSH 3MA9H 3MV8A 4GKZB 1NZRA 4U6HA 1M42A 4UTBH 1H0DA 2DRUA 3FRPG 1OD9A 4MAUH 4NZDA 2NXYC 2EO1A 2XDHA 3GZOA 3H85A 1L9RA 3QXUA 2X4QB 2VZUA 1B0GB 3ARYA 2NTFB 4NX0A 3IK2A 5HDBB 2XG5A 5FK9B 1S8DA 2G60H 2A0LD 1F4XH 5DJXA 1ZA3B 3QHFL 1IFRA 4XP9H 3GD1C 3RVTC 4LSPL 2WXQA 4D0BB 2A6DA 3NTCL 3SDXB 1R3KB 3WLWC 5HPOA 3KAAA 3QJOA 4KO5A 1EXUA 2AEQH 1K9TA 3CG8A 2VLJE 3ATFA 3DGGB 3FU7B 3I9PA 1T4KA 3GF8A 5DC9B 1ADWA 4A7UA 4IKKA 1QQDB 3MJ9A 5DSCB 4DOHB 4FXGA 1S2EA 2OTWB 4IRJA 4BSVA 4EF3A 3CVIH 1CVRA 4FQXD 4PLKD 2ZKMX 4DGUA 2B1HL 4WHTB 3RIFF 2ILLA 3JBG7 3RJQB 3RA7L 3IETA 1JGEB 4M7LT 4W93A 4WO4C 1A4JA 4HV8B 1QLEH 2HSIA 1OM3L 2YKKA 4ZFOB 3DPDA 3LS5L 1NAMB 3ES6A 5J13B 1TVDA 2ZWNA 4JFEA 4JN2A 3QQ9C 1UVQA 2CKBB 3MV8E 4K23H 1EWHA 5GGVL 5DJ0B 4A37A 3HBPA 3RFZA 3AB0B 3F3HA 5CGYC 2J55A 3ECBA 3RWHB 1WC7A 1UGKA 4X5XB 1IM9B 3MRCA 1UUSA 5F7EL 3ZDZF 4XMPL 2FNWA 2NYYC 1WF5A 2OTPA 1DUZA 2R69H 5CJQL 5CMAA 4FA8A 1FGVL 2P5WA 3NIGB 5GGTH 3H55A 3SEPA 4WJ5A 5D2LB 1WZAA 5FYKU 4QNPE 2A74C 5CCGE 4AQEA 2YWZA 3K6NA 4DGVH 3FAWA 3Q1SH 2BFGA 2HLEB 2BNQB 4U49A 4HYTB 4LE8A 3FSVA 3I6KB 4UT9A 5L2KD 4X0KB 5DZLA 2ZX7A 3EH3B 2AMUA 2WUBL 2NYKA 1GIGH 3QHZL 3PNWA 3FUNA 3HS8A 4KNTA 1FRGL 5CD3B 1U3HD 3MRBB 4JHUA 5LXVA 5EF1A 1TJMA 1UFGA 4U4IA 2EE0A 5JHLA 2HWZL 4N9GB 3U48A 1I9RL 3CLWA 1TMCB 3F6JA 4QHUA 1YEHH 3CVHA 1HYRC 3L3OB 4Z7OB 1V7NL 2FWUA 2OMUB 3ILDA 1BJMA 1KGJA 4WV1B 4L1LA 2R29H 1QWHA 1SJVA 1INEH 3FONA 2OK0H 1M6OA 4HUMB 3SDCD 1EXHA 2EDJA 1K4DB 1XF1A 4M6OH 8FABB 2ERJC 3VVWA 1CIDA 2P5WE 3P4NA 4OBRA 4BZ1A 1WHOA 4UQEA 5A2AA 4RFOL 4KJWD 2ZT9C 2B1AL 3IJYA 1HILB 4BH8A 5F7YC 3MNMA 1YC8A 3AU1B 2YPKB 3K2UH 4WUUB 5FGSA 1INDH 3MJGX 4EOWL 3IXTA 4LK4A 2CHXA 2GHZA 4BJLA 4IEFB 4HUVA 1MFMA 4X4MA 2BSEA 4D9QD 3FO1A 2XOTA 4HS3A 4M61B 4Q7DA 4KVNL 1FSKB 4KAQH 3Q6FB 1BM3L 5EZIH 3WAJA 2RBLA 1PQZA 3W2DL 3MLXH 3ZTNL 3FZUD 4DP0X 4F93B 4PJCB 2AXFA 3FBKA 1AFVL 1BG9A 1G5AA 1SN0A 4Y4KC 2CO3A 1IEAB 4CDHA 5IJCC 1AKJD 2GBVA 3M1CA 2BHZA 3GSQA 1SLVA 2YPLA 4QHLA 3U83A 2Q10A 4YZWA 1MLBB 1ZLVH 4CVWA 2I27N 2QBWA 4O2EA 1FN4B 1MFAH 4OCSL 4JRYB 3VWKA 1Q1JH 3V52L 1AXIB 2NY5C 2NUPB 2P5EE 5SX4H 5IB3B 5DURB 1MCPH 4PTUA 4EI6B 3G9AB 1DQDH 3WE1A 3PHSA 3KE0A 4AEIL 3RHWF 3MUUA 4NP4H 4OZHF 2IDSA 3CFIC 2R39A 4MX7A 2J12B 5C0CB 3ZIYA 5D7LA 2UY7B 3PHAA 2AI0H 4H7VA 1SN2A 4NKOA 2NY1B 4ZMNA 3LEVH 4F7CA 4F7KA 1ZTXH 2IQ9L 1T0PB 1UT9A 5I8KH 4B41A 3BQUD 4HS6B 3MCLH 1XX9C 4N8UA 1HKFA 2YWYA 2EABA 2HT4C 4JFWA 5AWNH 5FUOL 1EMTH 1A02N 2D9QB 1XR9A 1XGPB 1ACZA 3N1GC 3BW9B 4H0IA 4L3EB 2DLHA 4PJ8A 4PJAB 3VXNB 3BQVA 3RDTC 2VSMB 2AJ3A 4GIAA 1RUAL 4YEEA 1INQB 1QRKA 1TETL 3RGVA 5T3ZH 3JTSB 4R7NB 5ABDE 2I7OA 3DI3B 4GP5B 2MEJB 2YPLE 5IGXL 3FFCE 1QBML 5DWUL 3RWFA 4F24A 4FA6A 1E6JH 5MEPA 2H0EA 2B0SL 1UWEH 1MUJA 1JK8B 4GXVL 2NY6B 1CL7H 4U1KB 4TVPE 4APXB 4PB9L 5FYLH 1YNKL 4BBWA 4Q6IB 5C0EB 5IESH 3C5ZA 3GJFB 3LXBA 3WFBH 5JORA 1E2WA 3BGFB 3WEBA 4NI6A 1NM4A 2ZAHA 3LS4L 4P2OD 5D96B 5AG8A 3EYQD 4N2LA 1UGNA 2IOIA 3UPRA 2BRRL 2IAND 5GGSB 5D7LE 3IJ7A 1BZ9B 4LLDA 4HEPA 2IDUA 1FORL 1RK1A 2J20A 2PKDA 4KTEL 4HIXL 3AS1A 5E8OB 1GJIA 3VXSD 1A7RL 1L3WA 3ZIMA 2EXWD 4TLSA 3CZFB 3DX8B 4XMKH 1A9BB 2DTMH 4FX5A 1XB3A 5DDHB 4TSCL 3RG1C 4DCQB 4LVEA 3O3EB 3X3FL 3I74A 3B9KC 1R3LB 2BY3A 4RNRB 3SE6A 3GSUB 1LE5B 1HAUA 1CT8B 3U79A 3TBWA 4K7FB 3ZYIA 2W65B 4FQ2L 2YPVL 1T6BX 1MFVA 1IFHL 3LQAL 1L9OA 3VXUA 1TOXA 4GLRI 5AD0A 3DOHA 1SHSA 5JPNA 2AJVL 5LGHL 1DE4A 1XH3B 5JXAL 1A3RL 2R0WH 2XN9E 1JNJA 4PCKA 5IHBA 5IMKA 3QIWA 3MBED 1UC6A 2A0LC 2A1WH 2ZCZA 4WI2A 2DZEA 4OF5A 1S9KC 2DS4A 4HHWA 2VAJA 3MLSL 3N40P 3QORA 4DUWA 3ZGHA 5HYEA 2IV8A 1KTJA 2OCFD 3TWCL 4ABQA 2PYEA 4XVUD 2XV6B 4M48L 4BFOA 1FP5A 4S1DD 3CGTA 3ZT5A 3BUYA 5D7IB 4E41B 3BEWA 3JWNE 2VE6A 3S88H 4J28A 4A2FA 3B7SA 3UGUA 2DQTL 1PY4A 1OKEA 2XPZA 1WGOA 4ZMVA 4LLQA 3D3VA 3BZEA 2OMVB 4JRXA 3L3KB 2X10A 2XA8L 2OMXA 1FJ1A 1YHPA 4NZFA 4M7KL 2JJSA 1EJFA 3QI9A 1YDPB 1AD9A 5I8OL 2VITA 1A6UH 2MPVA 5FFGA 3GLZA 5KSAC 3OG4B 1SGKA 4NKMB 2W92A 4P9HC 4PJBF 3ZMRA 3UC0L 4HBQA 4JQIL 2BOCB 2WZAA 1U6AH 3ELQA 4HMDA 3CCHA 4PM1A 4PWIA 2W59A 3JWDC 1L0YA 5HGAA 1CU4L 2ZPKL 1EEUA 2D2CC 3DO7B 2L3BA 4XNUL 3VE0B 4UINL 1RZKL 4K71C 3VRIA 4U0QB 4ETQB 3GXMA 1JWUB 3JXAA 2ZAIA 4AMWA 1RMFH 2PYEE 3NQIA 4W4OC 5EPMA 4G82A 3ZGIA 5I1KL 4ODWB 4EZMA 3C5JA 2NR6C 1ICTA 1YNTB 4BUHA 4PY8J 5AW3B 4J2QA 2KZBA 2IWKA 3DTUB 4LIQE 2V9QA 3WGUB 4P4KB 1NFIB 1HL5A 3GSNL 4MD5A 2VQ1B 3CSFA 1PGRB 4YSCA 1KB5A 4JO5A 5ESAB 2FSDA 5TE4L 1U3HC 2ITDA 1OY3B 2Y22A 3QJRB 2YO3A 2FSEA 3G5ZA 1C1EL 4OGYH 3QYMA 3SBPA 2LFEA 4PH8A 3LKPB 2XTJD 4HCRH 1QEWA 4J3VA 4QTHA 4R7DB 4WF7A 4LSPH 4X4KA 4RIRA 4O51A 1TQCB 2GEQA 2VQTA 3SKOA 1LLAA 2IPTL 4FL4B 4EI5A 2GCYB 4OLUL 1EXGA 5FYJE 5HJBA 4GJTB 4BFFA 3VD4A 2KHAA 1Y1DA 3T6QC 2JELH 1SVBA 4EZLA 4CJ0A 1KGUA 1HCFX 1ROCA 4WWKD 1PYWB 4XWGH 2ADIB 3VFNB 4HPHA 1S4IA 3ULVD 4HHGA 1KZYA 4RSYA 4WNSA 1FFTB 2RQEA 3MREA 3NABL 2EYRB 4KJWC 4MAYD 5HGHA 4OVVA 3BC9A 4WEBL 1I9JH 5D1XA 1N18A 4QRTB 4YHNB 4NZTH 5PAZA 3WTXA 3V6FB 1TQWA 4IIQC 4PJ5E 4WWNA 1OGAA 3D2UD 1KN4L 3GMRB 4E5XG 3BGMB 1XGUB 2ADGB 5F97E 5CP3H 5GGVH 1FNGA 2XQBL 3SO3C 1WD8A 3CQQA 3F64A 1SXBA 3LH2H 4KXZH 4QGTA 3OPZH 4FTVA 1I3VA 2K6ZA 3E8UL 4U1NA 4DZBA 2IGFH 2WQSA 3FZUC 5CJQH 3WMSA 4LCCB 1RV6X 1FGVH 5AOKA 2YD3A 4APQD 4K7PY 2BP8A 4RDQF 4IOSA 3EO0B 2NQCA 3T6VA 2D31A 2DMKA 3CMOL 4ZFFB 3B5GA 1TQBB 4JCLA 1MNUH 2Y7MA 4ZAKA 2GT9A 2CNYA 3SYAA 2D0GA 2W9DL 3MCKA 5GGRA 3TZVA 3TFKD 4P2CG 4RWYL 4RZCB 4I48B 4DPRA 2VDQL 5T33H 4A7GA 2TRHA 1NANH 4Q0XH 4IHBA 5AAPA 3EKCA 2I69A 4G1MA 3TVMA 3VG0H 3GMQA 4R90L 1B3IA 5IQ9A 5J6HB 3KL5A 4LBEA 1VFBB 1KJ2L 1AGCB 2HWZH 1J88A 5IJVA 1I9RH 1DHKA 3WN5A 3POHA 3MNWA 1EHNA 1MRDH 3ZHNA 4OV6F 4JFQA 1OGAE 3SDYL 3ZO0A 2H45A 3SBWC 3Q2VA 5F7MC 3PL6B 2ITCB 2FQEA 4KZCA 1AGBB 4FTVE 4MD4B 4ODXB 5HSFA 1QSED 2CAKA 2NNAB 5AYQA 5T1DL 2UXVA 4DGYH 4EIUA 1T4WA 1UD2A 4HKXA 3ATAA 2NXZD 5IMMB 3BXNA 4Z95L 1QPXA 4U1SA 2B1AH 3MLUL 4LLVA 2W5PA 2JMRA 3UIYA 4AVKA 4QRPD 5F96H 3UZEA 2NNFA 4XNYH 3F7KA 3ECQA 4B9CA 4ZMYA 1XDTT 2R1XA 3BP7A 4GRWE 4EOWH 1Y6MR 1N4XL 3EGDB 3OSVA 4BQCA 1C16B 4CADA 4B5EA 1BBJA 2BM3A 3N1QC 4P2OC 2VUKA 2WM0A 4KVNH 1XVSA 3U4AA 4F27A 1CVSC 4RX4A 3O6KL 2MOGA 2VDML 1IJNA 4OJEH 4L05A 2XWDA 4PREA 4P23D 1YUKB 2DQMA 3OWRA 2QKIB 4CC4C 3D4CA 3EDKA 4BRJA 1HSAB 2EXWC 4PV9A 1FC1A 1Q72H 4V11A 2D03H 4AQ8C 4ZFGL 3KBPA 4PJHB 3RDTB 3ZRFC 3V52H 2KC0A 2C9VA 1KCBA 3KPSB 3HN5A 1A21A 1F3DJ 5HHNB 3UYPA 3ZR5A 2HFFB 3ATBA 4PJIF 3CX2A 4E9TA 3W5MA 3QWRA 5IBUB 4AEIH 1BA9A 2MIZA 3HRPA 3I6GA 4LF3A 2FHBA 2K7QA 5I1EL 2D7PA 4RLDA 4B9ZA 3L4UA 3IJHA 4OCWL 4Q6KA 4AQAB 4NUPA 3SE4C 2IQ9H 4FQQA 3HHSA 3U4EB 2EKSB 4O02H 1NEUA 5F8QC 3MBEC 5I19L 2HYMA 5D9SB 2QTEA 3WNIA 5GZOA 2BHYA 3BH4A 3PQYD 5JDJA 1QNIA 4FG2A 1F56A 2AQ1A 5C0BB 3IDMB 4XVUC 3C9NB 5FUCC 1TJGL 2ZX8A 3BP6A 2ICEA 3P40A 3DOIA 4S1DC 1I53A 1RUAH 3PP4H 1HXMB 2VC2L 2ZKHH 3MNVB 3ZOAA 4K9JA 4J6IA 3VDBA 1BJ1H 5IGXH 4LLWB 2GJ6A 2HFGL 4GXVH 2WXNA 2P42B 3NIFB 2C5DC 1GGIL 4PB9H 5BZWB 3E7JA 3NCJH 1N19A 3IWVA 3PE9A 5IW1A 2CGRH 5C86A 2WCSA 2EINB 3MROB 3DMMB 3VXMB 3FUJA 3VO0A 1T5WA 3B37A 3GI9H 5IV2A 3EYUH 4L4JA 3EDFA 2B59A 1NGWB 3MGTA 5B1JA 4ODTL 3S35H 4Z1PA 1FORH 1C9SA 3NSYA 2FO1A 1JHLL 1V27A 1J5OL 2QPFA 3QHTC 1FFOB 2WBKA 1HSBA 4HIXH 3RVXD 1WT5A 4LRIC 5EC2A 5AZEL 3U0WL 3QBTB 3AG1B 1A7RH 4XXDA 3N41F 2X1XR 1IGFH 3WXWL 2UZIL 4K94C 4XN2A 3FOLB 1W72A 2BOBB 4PG9B 5B22A 1QUNA 4N0UE 1ETB1 4IRJD 4O2FB 4Z3HA 1FWXA 3CXDL 4D0CA 5DVOA 2Z91B 5KSVA 2BY1A 3DTXB 1WTLA 3TCXA 4WGWB 1DUYA 2VDKB 4FQ2H 4RAHA 5H35A 1P2CB 4NQSB 1DDHA 2YPVH 3HNVH 4FQXB 1IFHH 3LKSB 5A43C 3LQAH 3KBHE 1GZHA 1T1WB 1J48A 2GJ6E 2DMHA 4JFED 2Y69B 4OTXL 2XV2A 2YGQA 4X5PA 5AZ2L 2GY7B 1Z3GL 4E9SA 4F37F 3IDUA 1GC1C 2ATPB 4YOKA 2XTJC 3U0PB 3EGSA 1KYDA 4X99B 3TWCH 4KO6A 1EA9C 2FJGA 3LPPA 5E6SB 1U42A 1HI6A 1E5YA 2OAAA 1J7VR 4X6BA 4M48H 1T7ZA 3RX9A 3EZJB 1Z1WA 3W0WA 2A5UA 4P4RB 2FL5B 4FTDA 2H9GB 4K71B 1IEBA 1EGJL 4FYRA 2QQLH 4BFIB 4WWKC 4BZ2A 2K1MA 3Q05A 4NKIH 2XIIA 3PHOB 4GEIA 4OLWH 3FB8B 1JZ5A 2XKNB 4LHUA 1ODUA 4MAYC 5D55A 3UACA 2FB4L 4B9PA 2JNZA 1BQHA 3O3AB 1QABA 2HVJA 2FH8A 1UB6B 3G6AA 5DK0A 5SX5H 4M7KH 4E42A 3ASWA 2EECA 1Z3RA 4U1IB 3CLEL 2C26A 3JT2A 2Q8BL 3ETSA 3C09C 5CN1A 4AG4H 4DN4L 3HW7A 4GUPA 4WTZG 3VXRE 3VSTA 5AVUB 5DVKA 4TSAL 4LEXL 3UTTA 4AW7A 3PYCA 2D7NA 1XCTB 2FQGA 1CU4H 5E8EA 1TEGA 2H32H 4TOYL 2M83A 4YHMH 2ZSWA 1ET8A 3LZFL 3BPLB 1KBPA 4MJIE 2H0FA 1SZNA 2J7LA 2XNAB 4QEGA 5CUSH 3HRZA 4ZSOA 3SDCB 3QDGE 4Y5VB 5I1KH 2I24N 3Q3GB 5D1ZA 3GK8H 1MXDA 2CR3A 3O4LA 3TFKC 2AEIT 4G8EB 2C4XA 2HLFC 4NWUH 5I2IB 3DX9A 1KUMA 2CO7A 1RXLA 2W60A 2XY1A 4NOFA 3CH1A 1KJVA 5KSUA 4ZZFA 3DC0A 4IIQB 4YUEL 3GQFA 1IAKA 5EBLA 2BSED 2G75A 3MNZB 4Q9BA 1W8NA 4F58L 5F9JB 1NFAA 3CZGA 1NCHA 1JXFA 4I85A 3STLB 3SO3B 3RWIB 3HG3A 4LPCA 1XAUA 3FCTB 5E5UB 4WI7A 4JDZA 4XAWH 1E42A 4OH2A 2J1YA 2IPTH 3MLVL 2H3NA 3ZKMD 5JIDA 1K5NB 2LOEA 3IU4L 4G6JL 1XH0A 4ENED 3KWUA 4HZLB 1DFBL 1TT6A 3MACH 3TBTB 2O5XL 3VWKD 2NRDA 4XNDA 2IXQA 4QIRA 2K3TA 2ZOLB 3FT9A 3NABH 1MY5A 4XMLL 2F8IA 1OSYA 3DUUA 2UXGA 1PL3A 4D8PA 3N0AA 2WYZA 5DUBA 3R8QA 3RX5A 4ZSOE 3PGCA 3WJJA 1A8ZA 4WDIA 4WFHE 3MCYA 1EDQA 1TZIA 1KCSH 4JAMA 5F2FA 4MVBD 4RMBA 5KS9A 1CDIA 3CN1A 3S7GA 2X4NB 1HXYB 4WNJA 2RMNA 2XQBH 2AJXH 1I8LC 5CD5C 2I32A 4TLTA 4KTDL 1SUJA 5DUPH 5FGCE 5GGSY 4CMHB 4I13B 2V4LA 1KYOK 5KYYA 4PWKA 1C08B 2Y7SA 1NKGA 4WCYH 3BQUB 1XB6A 4JDTH 1EAOA 4YHKH 4P23C 2BMKA 5DD0H 3N85L 3S2AA 5B7FA 3IFPB 3NCXA 5C07D 3H0TA 1DN0B 4FFTA 4CN6A 3CMOH 5AAWC 5K9KB 3NZHH 4N68A 3QIUA 5D7JA 3LVEA 4I9XA 5ISZA 3RGVD 2UYLB 1CD0A 3ZE1F 3H3PL 3KPMA 1KXVC 1OWWA 2W1NA 2CDGB 3RNKA 1SY6A 2XACC 5JOEA 1E8XA 4HD5A 4NIYE 5ERWA 4XCYA 1IGJB 4R90H 3C5ZD 1N2RB 4D9LL 4PV1C 4YAQB 3RX8A 4B3VA 1PW3A 4H1LH 2BNRA 1ZDSA 2LV4A 3IEAA 3P4OB 1AHWC 3OHXB 4TUKL 3Q9QA 5IUCA 2VKXA 4DF9A 5KS9E 4P2OB 3L4ZA 5L2JB 2IFGA 4QKXB 4K15A 5IBLD 5JUEL 2G3XA 4GG8A 4JREB 2IANB 5F3HA 5SWSA 5CJ8A 1LO3H 4UUJB 3CSTA 2GYSA 2IVFC 3VFRA 2DQGL 1X5ZA 2K8MA 4LU5H 4QRRD 4IDJL 3EJZD 4HH8A 3THMH 2KDGA 2FO8A 2VT0A 4RGMC 2YAPA 1YN7A 3U1SL 3MBXL 5LNDA 3G04B 1IGTA 5IB2B 1NDMA 3BESR 1FO0A 3O3BA 5FCUL 3T04D 3TN0A 1EJ8A 3WBDA 1EUTA 4FNTA 5FHBH 1H8OA 3BWZA 3TEZA 1AR1D 1PFCA 5ISZE 5K93A 1O6SB 3U6RA 5MEQB 1WZ1H 4PRAB 2YARA 4JPVL 1N4XH 4MMYA 3VXUD 5GS0L 1AP2B 3F6IA 3NJHA 2BZ7A 2AVFA 3UO8B 4CU8A 2PWEA 4Z7VB 3F7LA 3INUH 5T1KA 2Q8AL 1MHEB 2A6KA 2VDMH 4FFYH 1A6TB 2J3SA 1EFXA 4PS8A 3V4VB 3OR7B 3ERXA 3US1A 4JFSA 2BNRE 4YWGL 1JGIA 1ZXQA 3GXDA 4GMSH 4UB0H 2XZQH 3R06A 3T71A 2QQQA 4HS8L 1ZHKA 4KKBD 5E5MB 5SWSE 2FX8L 2C34A 2GW5A 1FDLL 2PXYA 1NBVL 2XXCB 3L5IA 3P73A 4KK6D 5LAPA 5C0GB 5I1DA 4FYQA 4K0OA 4U6YA 5EHFA 5EU4B 3S37H 5LVEA 2C1PB 3CZUB 1SLUA 4W9GC 2KLSA 1U8OA 1PZ3A 4LHJB 1U92A 3D3VD 3WOVA 1PX3A 3EFOA 4JRXD 4NFCA 3Q8AA 4N8VA 1TZHA 4ORGA 3GSXA 2VCOA 2DQDL 3EG9B 5BVPL 1VACA 2NSQA 5JTWA 1NMBH 4J39A 3SE9L 3CFJB 3EH2A 2DDQH 1OSPL 4ODUB 4ODSH 5IR1A 1VENA 4M3JA 2Y6TE 5CJOL 2P1YA 2JXMB 3LIZA 1ETA1 1P4IH 1CE6A 2BHFA 4NBYB 1ORQA 4G72B 3IGAA 3BYYA 3RZWA 5I1LA 1S9VB 3P77A 4OVUA 3QCTL 3B9DA 2X1PA 5C0DA 1DSFH 3OC8A 4GKNB 5C6WH 5LG1A 4S1RL 2Q86B 3FO2B 1URIA 3QDME 4UDUB 4DW2L 1MQ8A 5DGQA 1GGIH 1KBKA 1R6VA 1RHFA 3BZFA 3CX5J 2J5LC 2V6HA 4X6EA 3W37A 5C6PB 3P4MA 5FF6A 5ICYA 5KN5B 2CIKA 1SEQH 3O0RL 2VDPL 2EYSA 3ZY7A 1EO5A 5FO2A 4PW9A 4L1SA 3TESA 2OPCA 3OF6A 3QUXA 4MRCA 4Z8FH 1ACYH 1QVOB 4LCWB 2XTJB 1RIHL 4ECNA 2R2EB 5AZEH 4A68A 1KT2B 2PCFB 3QZPA 4EI5D 4JFUA 5E6RB 4WSKA 1UACL 5EBWB 4LGPB 2UZIH 4MMXA 4XAKE 1GGBL 3B2VL 3FQUA 5T1LD 2EUVA 4EIBA 3MV7D 2AQSA 1AHKA 1UD3A 2WBJC 1IARB 1EBPA 3VQ2C 3SBQA 4MZ3A 3VGDA 3BT0A 4HG4J 4MDRA 3SPCA 2HPTA 5D1XD 1IC7H 3CWGA 3UPCA 1JJUA 2JCWA 2AK4D 2PW2A 5IJDC 2GITA 4BCXA 4AVJA 3FN0H 2HN7A 5E2UH 4DQOH 2NZIA 1TYJA 4B97A 4R7XA 2XG4B 1U95B 4ZW3A 3D2UB 2PCPB 3A6CL 1UYWL 2G2RA 5F7KC 3M17A 4XN1A 1U8PA 1NCJA 5EIIB 4PJ9A 2I9LB 4U0RC 1XSOA 1JDDA 1Z5LA 2F7PA 3VFPA 4N20A 2LTQB 3UGEA 1QW8A 5CS7A 5JDSB 3BP4A 3FULA 1O7DE 1S7RA 3U36B 3ZKMC 3IDYB 1MWAH 5I16A 1KCUH 2X38A 1ZLUH 3DJZA 1U8KA 4APQB 4ENEC 1A6AB 4NDMA 1DN2A 2WGNB 2DLFH 3WSQL 4UDTB 2CJ3A 3VWKC 1WZMA 4GW1A 1JGLL 1EZLA 2ICWI 1U58A 1C5BL 3EFFA 1E5AA 3B9EA 2HT2D 4PI2A 2FB4H 5FM5M 5GGUB 3GTTA 1EGJA 3PDDA 4XWOD 5TK4A 4RFEB 1KPUB 5JIQA 3W11D 1CGSH 2O6PA 4MVBC 5IVOA 5INDA 3CLEH 5D5MF 3KPLB 5LWYH 4J3OF 2Q8BH 3LNGA 4HIIA 2OXGA 2GSIB 4FG0A 4NPJA 5KG9B 1B90A 3K74B 3TIEA 5J89A 4DK3A 2Q7YB 3O45B 3PG2A 4LEXH 5GRJL 2F61A 5MERA 2I07A 4ZS7H 2AEPL 3ZZSA 1CDUA 2KI6A 4LGRB 2X2HA 3PV6A 4GOSA 5HHVL 4FADA 5EEYA 4TOYH 3EXLA 4L9LB 3LZFH 3N1FC 4NPYA 4F33B 1T21B 5F88B 2HKFL 3QEQD 4CGTA 4A7TA 1YPZB 5ABAA 2DWEA 1UB5B 1S7VA 1QSEB 4IK6A 4EN3D 2ZG3A 1HCYA 5I6XB 2WXKA 5KBKA 2NXZB 1L7IH 4QR7A 4B3EA 2ZUQC 2GJZB 3O9WC 4W4NA 1DBAH 2G9HA 4XX5A 4ACTA 4QRPB 3BHBB 4N2NA 3W9DB 1AZCA 1A5FH 5DRZA 2CHWA 2YD8A 2LU7A 1S9YB 2DEWX 3HZVB 5ICXB 4GG6A 4UQIM 4PYHA 4RX4D 3NZSA 5C08B 3SE3A 4D3CH 1ZWIB 4C8XA 1PVHA 4FKEA 3IKCB 4RA0C 2J72A 5IBLC 4DEUA 4Z3JA 3VYNA 1ZVYA 2ZP8A 3MLVH 5HJGA 4PTTA 2CRMA 1JTOA 3CFKA 5HGDB 3VU1A 3EJZC 5I6LA 4P23B 1ZCRA 2OSLB 3UEQA 4LOEA 4X6FA 2Z4QA 3TBYA 2QGBA 3TJPA 4PJDB 4AYEC 2VZ3A 4YDJB 4G59C 2JCCF 5FC9A 1MH5B 1WHPA 1Z5HA 2FJUB 4M03A 5FYJU 1AIZA 4XMLH 1BVLA 3B2DC 2DQIH 4Z76A 3GSRB 2KQNA 2X4RB 3ESOA 1F3JB 7FABL 3QWRD 5DJYA 1AR1C 3GLAA 2ESVD 1LL1A 2EDLA 2DQJL 3KCWA 4J8RB 4K7PX 1N67A 3CC5B 4U3SA 5DZNA 3TU6A 5EU5B 3D0LB 2VDLB 1HVXA 4H0HB 4YBHA 1SDAB 5DI8A 1ES0B 5CF3A 1G7JA 5EUKB 1WBYB 5DLLA 2AMGA 3QG6A 1HINL 2PR9A 1ZLVK 5CHNB 2FJSA 4C56D 1A8JH 5GZOD 3HNTH 5KSBB 1MAML 2HH0H 2N1TE 4JX0A 4QKTA 4I18C 2KZWA 1F2XK 3PQYB 4GG6E 2VLJB 3EHBD 4JZOB 1OE1A 2W0FA 1QBAA 4KRPC 4LLAA 4PJFF 5IFHL 1IAIL 4M1DL 2IAMA 2R27A 1HH6B 2E9BA 4ELKA 3VU2A 1J5IA 1BPLB 2YMTA 3G7TA 4KK6C 4X4XA 5FM4A 1R5IA 4BD4A 2VIRA 4NUJB 4AGPA 3H3PH 4X6DB 5DEJA 4JO3L 3SO5A 1SHMA 4ZUTA 2MJWA 1OF2A 2AV7A 3OXRA 2EUXA 3TBBA 1IC4H 4TSBH 2IWEA 5TPWL 1T1YA 3WKML 4QHNA 5FGBC 3RWDA 3V6OC 5IK3A 5T3XL 3MV8B 2GBUA 4PJXF 4HWZB 1OAYL 2C9QA 4U6HB 1H0DB 3C8HA 3FTWA 4OCMC 3CDYA 3PXLA 4P2RA 4F91B 4XCCL 5F7UA 2BIMA 5FOBA 4X0NA 3SQRA 1U8CB 2QADD 4JKKA 2VQ4A 4OLXL 2XG5B 1S8DB 4GBXD 1F3RB 4EO5A 1FH5H 1YZZA 5DJXB 4M4RA 5DD6A 1UZ6E 4H1LG 5EO9A 4G11A 1G6RH 3ESPA 3T65B 4YL4A 1UJTA 4AYDC 2A6DB 4IDJH 1OEZW 3ZE2F 1SQMA 1EXUB 4TQPA 2HUHA 4IRSC 1T4KB 4F15C 2F53D 4KI5F 1L0XA 2PABA 4FXGB 4IRJB 4OAWA 4BSVB 4GMTH 4V1DA 5BCAA 5ACLA 2QVTA 1RP8A 4OGZA 1BREA 3IGLA 3OKEA 5GS0H 1X4YA 3COOA 3CU1A 4XPTL 2FX9L 3IETB 2H1LM 1ZT7B 1A4JB 3DJTA 5ICUA 5ESVA 3ES6B 2G2NA 1OHQA 4JFEB 3HZMA 4JN2B 4NQXA 4DTGH 1UVQB 5DJ2A 4HOMA 1DJYA 4RETB 1X9QA 3RFZB 4M7ZC 4FRWA 4P2RE 1AO7D 4JQXC 2DPKA 2PP7A 5T5FL 2E9WA 5C0RL 1MOEA 3ECBB 1P5UA 2APVA 2NTSP 3MRCB 4EI5C 5KVEL 4PJGA 1I31A 1DUZB 2GSMB 2XN0A 3CN0A 3W0WD 1GZQA 2MPAL 1MFNA 2FX8H 4OFPA 1CD1A 4WJ5B 4FMKA 4NM8L 4PS3A 5IFAL 2VJ0A 2KYIA 1RZ8A 4AQEB 3QRFM 4RMTA 4TQEL 1TO4A 4R7VA 2BJML 3GXUB 3EYSH 3EJUA 3E3QC 4LHUD 4XTRD 1KENL 4J3SA 2DWYA 5D1XC 5HHMD 1F4AA 4W9JC 3P9MA 3ZMNA 2OQJA 1K3IA 3KCPA 1JPTH 1KTLA 3ETBF 4ODVL 5CZXD 5FKPA 2VDNL 3K4ZA 3QRGH 4V1DE 3PNWB 3HS0A 4L9DA 3WFCL 2GJRA 4D2NA 4D7BA 4EUPB 1J8KA 4F2EA 3EJRA 4GO6B 4WTWA 1UZ8A 5TK2A 3UTTD 1WD9A 1XR8A 3VGGA 2ZE0A 2X40A 4DKAA 1NGXA 4QHUB 3CVHB 1MI5A 4DEPB 4KO7A 4GSUA 4GRMA 3T0EC 5MHSE 4JGMA 4M6AA 5DA0B 3B5TA 4GAGL 3AY4A 1UQSA 3QCUH 3DX0A 4S1RH 3Q1EA 5HDBF 4PJGE 3O4LD 4DW2H 5GISL 3P4NB 2HT2C 3KW7A 4XWOC 3IJYB 2R69A 4J23A 4ODBD 4BH8B 3NA9L 4UZGA 3W11C 1QTPA 5GGTA 5LBVA 3T3PE 3L4XA 1N6QL 3SDXF 5FO9B 1Q94A 2X89D 1N26A 3P4LA 1GY2A 2VDPH 1JMZA 4PRPA 1S7UA 4HJJH 5DMGD 4JG0L 5DS2A 3STBA 4OZFH 1NCDL 4HUVB 4WUKL 2Y5QA 4KXZI 3QR0A 3FO1B 1E9OA 4HS3B 5J4MA 1X9LA 2AQPA 2E6PA 4JZJC 1B6DA 1RIHH 5C09D 1NCWL 1PQZB 1DLHA 1ILUA 1JIBA 4N2CA 3SYQA 3HBZA 2AXFB 5E6ZA 2FWSA 5DFTA 4KC3B 1JV5A 3BVWA 3VQ1C 1GGBH 2KT6A 3MXVH 1MJ8L 4QHLB 1MI5E 2YPLB 2BY0A 4J7RA 3V0VA 4TUJA 4GQRA 3BE1H 4O2EB 1QA9A 1X3DA 3QSKB 4NAJA 3VWKB 1NTDA 4OFYA 4EN3C 3IFLH 1U8NA 3WTUA 1M3JA 2XZCH 4PTUB 5H94A 2L7QA 4NN7C 2WINA 4X7DC 3MLYL 5JQ6L 2FNBA 5K9QI 2GJJA 2N56A 3NIGF 5CO1A 3VGEA 5JOFA 3G5XA 5C8JA 4MX7B 5JXED 5D7LB 3LB6D 3DK0A 1RQ5A 3NN8A 1UYWH 4NKOB 3RJOA 3KXFA 3O6MH 3QFDA 4TM9A 2CHZA 4F7CB 4Y1SA 2R0KH 1P84K 4GRLA 2ICWA 1PU0A 4AGQA 4PRPE 3MCG1 3TNNA 1QRNA 1CDYA 1KLGA 3HUJE 2NLJA 1XR9B 2L4OA 3D87B 2C9AA 4KY2A 2J8UA 4AL8L 3IAQA 4PJ8B 3WSQH 5E8NA 2X28A 2YSTA 3KPRA 4MZRA 2AJ3B 1J9RA 2ZYHA 3RGVB 5G4MA 1MCOL 4FQJH 2WW8A 3U30B 4Z7OF 2ZYSA 3RWFB 3VVVA 2X0UA 2VR9A 1AXTL 3D5OF 5MEPB 4LNVA 1MUJB 5FW8A 4MLSA 5C7ZA 1UWGL 3T77A 2FYYA 4NO0A 5HDQL 4PW4A 3C5ZB 2MCMA 4L0YA 1IBBA 3TV3L 2OYKA 1USQA 5JORB 5ADPH 4JFYA 4I8DA 3LPOA 1PZ5A 4AKQA 2V0AA 5GRJH 3HG4A 2WLLB 1PZUB 1WFOA 2AEPH 5GS1C 3FO9A 5HHVH 4LLDB 5KYNA 4OFIA 3EH4B 1K4CA 4LOFA 3KXFE 1RK1B 5DQDH 3EHBC 4ANVA 4OW6A 1VSCA 4M6ML 2ICEC 2DD8H 2IDFA 5CEZH 5A6LA 3X11A 4QRRB 3KR3H 2ZWLT 1WFIA 5EV7A 2IADB 4N0YH 5CINL 4NI3A 2B2XH 3ZXAC 2J8UE 4UQBA 2XVBA 1XZ0A 2X2IA 5CXPA 1D2PA 4RDQG 3K6FA 3WIIL 2YD5A 3KPRE 3TBWB 4ELDA 2Z1PA 3DLQR 4LAQL 3VFSA 4QYAA 1AR1B 1RUQH 2ISDA 3MO1A 1DQQA 3FTYA 3VXUB 5C3LD 3KDMB 2XHNA 5AD0B 5T1JA 1EO7A 5JPNB 2Y24A 4XNXL 1F4WL 2QADC 2BLFA 2P26A 5B1JC 4K7PL 4GBXC 5IMKB 1EFXD 3QIWB 4YBLC 2EEFA 2C8NA 2OMTA 1O5PA 2Z9TA 2NY0D 1KBBA 5FKAA 3QORB 5IHZA 4KBPA 5CCHE 1ADQL 3PY9A 5DRNA 2O30A 1CD9B 1PZDA 3WAKA 2PXYD 4HSQA 4HJ0D 1GYUA 2PLTA 3DVNA 2VN3A 3I50H 3BUYB 1MCWM 4JPWH 4M8UA 4X50A 3BEWB 1G0XA 3QGVA 3BO8A 3QE5A 2VE6B 5I23A 1TJIL 2OP4L 2MTPA 2AGJL 4IU2A 5C0FA 1XD0A 1FBIL 2JQZA 2W91A 3C5SA 2FEDD 4PD4K 2ICWJ 1ZTXE 2F7IA 4LLQB 4LXFA 5J6SA 3D3VB 1S9WB 4QJ4B 1VA9A 2CR0A 2RR3A 4JRXB 3T2PA 5C6TL 3BPOB 1ZRUA 2OMXB 1FJ1B 3G5YB 4QY8A 3P2DA 4PJAF 1I1CA 32C2A 1EAPA 4QXWA 1MKFA 1KCWA 5B4MC 4PRHA 3QI9B 4TNGA 1AD9B 4U3HA 1WE5A 4IK7A 4PS4L 2VITB 1DQML 3LQAC 3H56A 1BYPA 2LW3A 1KXQA 1R46A 1ZLSL 3WNJA 3WUWG 6FABH 3CCHB 1UOWA 5T3ZE 2DLGA 1IAIH 4XGZA 5HGAB 5CIPA 4UZUA 2AABH 3VRIB 2HFEA 1G0YR 2YQ3A 1M1XA 1AYOA 1AQKL 3BLBA 4FQCH 3TC9A 1ETZA 1G7PB 3ECVA 1DBML 1AZVA 5EPMB 4DKFL 3NCYS 4XTRC 3PHQA 2JB6A 4WKXA 3Q06A 5TPWH 3BUQA 4QRSA 4ZUVA 4S0SD 3T3MF 2WNWA 1GYWA 4MD5B 1P9MC 5CZXC 1CICC 1OAYH 2OMZA 1PEZA 1TXKA 3FU8A 3QZWA 4PI0A 4ETYA 1A3LL 1PZSA 3Q5YA 1KB5B 4IRZH 2ITDB 5ES4B 5LGJA 4WJKB 2FSEB 3H42L 3G5ZB 2OZNA 4HJUA 1AIFA 3SQBA 3KYKL 1BF8A 1GAFL 5EZOL 3F58L 1BQSA 2FYVA 1K85A 3FSZA 5K9JL 1QEWB 4CVUA 4PRHE 4QTHB 4M7ZB 5IQMA 7CGTA 4RIRB 4O51B 3SKOB 1N5YH 4IMKA 4EI5B 1NCCL 2BINA 1KXQE 3CH8A 2CO4A 3BD5A 1VRSA 4CAGA 1F4HA 3NOIA 4XVTL 3OC5A 1RZKC 1HQ4A 1OSZA 4L8CA 1IGYA 3MREB 4ZX6A 1DBKL 4QTIH 4G6FD 5HGHB 1W8EA 2CLVA 5D1XB 3TEUA 5FFLA 3D48R 4XPTH 2FX9H 4F92B 2J4WL 5EEZA 1AAJA 1GOGA 2A99A 4L2YA 4FDWA 4KQ0A 4NQDD 5EC1A 1YMHA 2VDRH 1OGAB 1MIML 4PAZA 5DMGC 4MJ6A 5D7IF 4ZX3A 3VH8A 1YEGH 1B2YA 4PJ9D 3EBHA 4N2DA 1FNGB 1F00I 3G6JB 4LASH 2AJSH 5T5FH 3ZSSA 2WHVA 5C0RH 3UJJL 2JTDA 3DPBA 1CCZA 3L81A 4U1NB 3ARXA 4DZBB 2WCPA 1S7XA 3H6AA 5LB1A 1KJ3H 2ZWKA 2BP8B 4FCAA 1F2QA 4EXKA 2VXSH 4XCFH 5IFAH 2D31B 4TQEH 4JJOA 4LDOB 3WEAA 4ZAKB 1FE8L 4EKJA 1WEJL 2GT9B 1ID2A 3BIKA 4GRWB 3V0WL 3MCKB 5GGRB 3TZVB 3WJJC 2XQYA 5KVFE 2ZOWA 1F97A 1G6VK 4FNLH 3GM8A 1G43A 3T08A 5E9DD 4G1MB 1D3CA 3GMQB 5CLWA 3IB4A 5J56B 4MNQD 5JXEC 5LQBL 1PLGH 2ZZUT 3LB6C 5IQ9B 4LBEB 1EV2E 3IAPA 5D71L 5IJVB 2UXTA 3WN5B 3IVKA 3W3BA 3QJXA 1YNTF 4JFQB 2MNWA 4KJYA 4LARL 3GRWA 2X4UA 2Y1VA 3S8WA 1T2QH 5D2NA 5DF0A 4JZJB 4DUXA 2H0JA 4LP8A 2QGCA 2P44B 3SPJA 4KKCD 2Z7WA 1Q0YL 1YCSA 1M1SA 2ETWA 1LVEA 1BMGA 3PGDA 3RIFK 1YEIL 4PLJC 2JSFA 4HXBH 5CP3A 4FKKA 2NW3A 2D7TL 4TTDD 4HKXB 5FX3A 1KGCE 4X9FA 5GISH 3T8XA 3FJTA 4IIZA 4R26L 1S3KH 1T89C 3BXNB 4YDVA 2R0ZH 1SNRA 4U1SB 4OKDA 4LLVB 4M00A 2V5YA 1Y6KR 3NA9H 5HYIA 2AITA 3MLTA 4HALA 4HEMA 3UP6A 1U8JB 4NN7B 5ALCL 1FVCB 2R1XB 2FECL 5JNYA 4PGCA 4KXDA 4CADB 1W2KT 1BBJB 4ILDA 4JGUA 4EBQL 3N43B 4KFMA 2YKLH 2FUQA 3CK0L 2COQA 4OZFG 4KK9C 4P57B 1DVZA 3HMXH 1QNZH 4XNBA 1CF8H 4PREB 3C60D 3Q01A 3KNBA 4UT6L 4J27A 1MJ8H 1JCVA 3Q8BA 4PV9B 3G5VA 4AJVA 2ENQA 2NX5A 4WW2F 3FO0L 5I0DA 3HI1A 4O5LH 2XV0A 1S7QA 1TIUA 1CFVL 4KKPA 3BKCL 4P2QA 3GS0A 3UYPB 3CFEA 4RMVA 4AYSA 1E43A 5JQ6H 2XPGA 2ESVB 4LF3B 3I6GB 4HPYL 2G3NA 4FQIL 4JEGB 3FT0A 3WDJA 1YAZA 2WAQA 3IJHB 4G8GD 4MXVE 4Y0GA 2EIMB 4NNYA 3IPFA 1RIUL 1DVTA 1UCBH 4FQQB 3HHSB 5DMKA 3RAJL 5LXGH 3N42B 3EBIA 4BK8A 2NY0C 5D7KD 4C56B 2ZUYA 1COBA 1D7FA 3RGBA 5DK2A 4HJEA 5IFJA 1HC1A 4PRID 3V0IA 3K5RA 1NPJA 3BUIA 4UM9A 4AL8H 2X2JA 3BP6B 1CS6A 4W9HC 2ICEB 3OLEA 2AVGA 4PUBL 1A7OL 5K1JA 5E8DL 1IL1A 1UXSB 5I73B 5LDUA 3CFNA 2WTPA 4NO3A 1MREL 3HC0A 2FEDC 1QPPA 2NX5E 4FG4A 2OFQA 3CNKA 1A6WL 5D70L 1A9VA 1VF5C 3BSZL 3C6EA 1OTSD 4P2RD 5E9NA 4FD0A 5DJAB 5IW1B 4DSYA 4F8LA 3EW3B 1GHFL 3T5WA 3UYOD 4OCNC 3QJFA 4U2YA 1S5HA 2B16A 1T5WB 4K3EL 3IDNA 4WK2B 5IV2B 2DL2A 4FHKA 2B59B 3MGTB 4R97B 1T7XA 3D52A 3HFMH 1HEJC 4GBXB 1HOEA 1UASA 4ERSH 1L0QA 1HSBB 3SGJC 5EC2B 1IM3A 2EKJA 2XY2A 4MCMA 4XXDB 3STZA 1VJSA 3RL1B 1QX1A 5DHXB 4YXHH 1TVBA 5KTEH 4I1NB 1Y0LA 1JAEA 3L17A 3NCCB 4Q2ZA 5CINH 3RHWK 1W72B 1FYTE 1XSJA 4DO4A 1BQLL 1QUNB 2VXVL 4L0PB 4O02A 4X2UA 3VX1A 1LM8V 1RZGA 4W6YB 4HOXA 5KSVB 5E6YA 4ELMA 1RLWA 1YY8A 3WIIH 3RWCA 2JJTA 1JI2A 5H35B 3SDAA 1DDHB 1IC5H 1A65A 3GS4A 3MYJA 4JR9L 2YOCA 1MCBA 3NGBC 1SJEA 1I9IH 1LWRA 1MAKA 2OYLA 3E6HA 3ZDYB 1F4WH 4KX7A 4ATWA 4AEHL 4PJHF 3B2MA 1JPSH 4OZ4A 3HC3H 2DTSA 4HLJA 3FUHA 3BKYL 4OB5L 4AIOA 2Z8VC 3EGSB 3LN4A 3IE4A 1UKSA 3EJYC 1ADQH 1L9SA 2FJGB 1HI6B 5HPMB 2BK8A 4PJXA 4Y4HA 4X6BB 4KKRA 4DGIL 3UX9B 5JHDE 3W0WB 3ZQXA 2F74A 4CKQA 4ZTOL 4NQEA 4XPAH 3LRHA 4MB3A 2GEEA 3CUPA 4AZUA 4HF5L 1JXDA 4LHUB 1KXTA 3N9GH 1KN2L 3LOWA 4BFJA 5HHMB 1BQHB 1DANU 3G6AB 5DK0B 3HAEH 2X0VA 4E42B 2QSTA 2Z0BA 3JWOL 3D4ZA 4AOFA 4Y2DD 1UOVA 2E56A 2P45B 2EH7L 4OFDA 3SB3A 4F57L 4ZMAT 4PJ9C 4GUPB 4AXWA 2WJ7A 3EFDL 4O9HH 1MI5D 3UTTB 4C57C 5ID1A 4R96A 4PD4J 4UBDD 3L2LA 2FIRT 4XI5C 3QUZC 5E8EB 2JV6A 5IVXF 2F8XC 1U2HA 3KYAA 2ZSWB 1J5DA 1Z9SA 1BFOA 2EIKB 5C0ND 3P3YA 1RUMH 3R1GH 3HRZB 4ZSOB 3NVQA 1MCKA 2QELA 3O4LB 2M26A 4N2FA 4Y19A 1XTMA 3C8KA 4YK4B 3QARA 4NQEE 3DX9B 2CO7B 1BGXL 4DESA 2W60B 5DJ8A 2JKRM 3MLZL 1KSRA 2UUDK 3D34A 3CH1B 1KJVB 5KSUB 2GBAA 3KLAA 3H42H 4G9DA 1IAKB 4X98A 5EBLB 1O9VA 2G75B 1XQ4A 3KYKH 1GAFH 2ZCLL 3LNIA 4HJTA 1J9TA 4LDCA 3GSNB 1JZEA 3F7QA 3W9EA 3EJPA 1UM5L 1GGTA 1SDDA 2IPKA 4JDZB 5DS8A 1KBGH 3V8OA 2H3NB 4WVRA 5IQLA 3WIHL 4BDVB 2XV3A 4KKCC 2V9RA 35C8H 1PY9A 1J18A 5DLML 1WICA 3VI3A 4TTDC 3LEXA 2IXQB 3HFFA 3RI5F 1F8TL 3EO9H 3SE8L 2J1WA 4FLOA 3BAXA 3DUUB 5E1AA 4L2LA 1BJ1J 1B4LA 2CLRA 2VR4A 4ALAL 4D8PB 5BS0D 2H32A 5HGBA 4HZ1A 3EH1A 4GXUM 5DUBB 5FLUA 3PGCB 5JMRA 1FLRH 5L88H 2KERA 1XGYL 2N01B 4FQHA 4WDIB 3WTTA 2O6CA 5AG9A 1TZIB 2IMMA 4LPWA 4XBMA 5KS9B 1F4YL 1JRHL 2XN1A 3MJ7A 3NCFB 4DPBX 2EEDA 3OQ3B 5KVDH 1QFHA 1SXNA 4MYPA 3SOTA 4XCEA 4TNWK 1JF5A 1IILE 3BVTA 4L18A 1QAWA 2R2HA 1P6AB 4BELD 5KYYB 4ADJA 5HBBA 1QRND 4XP1H 4Y4FD 5DRXA 4Z0XA 3LRMA 5SWZA 3C60C 2LHAA 1B0RA 2V7NA 4I88A 2BMKB 5F7NC 4EJ1C 4QWWD 4BH7A 3IPBA 4PP1D 3CBRA 1G84A 1MFDH 5AVTB 2Y5EA 3WI9A 1PKQE 2Q76A 5D7JB 4ZD3H 3Q5TA 2MCPL 5ISZB 1FE8H 4LL9A 4Y5XA 1OB1B 1NFDF 5I18L 3A6BL 5EU6A 1NEZA 1NAMH 2MQ3A 3FF7A 4GSXA 4YVNA 1JRHI 1HHIA 3KPMB 2CKBH 3AMLA 5A2IH 4AV5A 4G9FA 5E6IA 3VI3E 1SM3H 2EZ0C 3RNKB 2FTAA 1TYRA 2MKLC 1SMAA 4NO0D 1GS8A 1BLIA 4XCYB 1N0XL 2E5EA 1FNHA 1T80A 1X4XA 3ILEA 3L4YA 5LQBH 2J6EL 1ZLUK 1BFVH 1G7MA 2V2XA 4WWID 3MAWA 1WLHA 4H8HA 1WIUA 2ZCKH 5D71H 4BHUI 4AE0A 2BNRB 3D4GA 3U4BH 5F21B 1WBXA 4KZEL 3FYIB 3QPXL 1E6OL 4GG8B 5F3HB 5CBAA 2XYCA 5SWSB 5T5NF 1RZJH 1D2OA 3DVIA 1KEML 2O6FA 4W9ZA 1KJ2B 1FVEA 2O6DA 1GZPA 4B60A 4TS6A 3VFRB 3DOSA 1MCRA 4OZHB 1G1KA 2ODIA 4M1GL 2DI8A 4K3GA 4YXKL 3U6XA 5DZJA 4N90D 1OAKH 1CTMA 5SWZE 5GSRA 3RWEA 1QFUL 1YN7B 3QH3A 4YHPA 5DHYA 4KDVA 5G4OA 2LVCA 4R26H 1IGTB 1JZ3A 1NDMB 3MLWL 2VZOA 2BSTA 2YGVA 1FO0B 3O3BB 1MIEH 4HWUA 1YYCA 4Q9QH 3TN0B 2YGPA 3KMDA 1NWOA 3FN3A 5AVWB 4WHCA 3VRLE 2IBBA 5EU6E 3U6RB 5E6UB 4MMYB 1OTSC 3HJ0A 1E4HA 2GKIA 3ARGA 4NJAL 5ICZA 1ZSHA 2NY3D 4OCXL 1C5DA 4G9FE 4EBQH 5AYUH 3CZKA 3FQWA 4HKZA 1IKFL 3ULSA 1C7SA 1U41A 5IY5B 4ZXBD 2A6KB 4RFNC 5JYLA 2EC8A 2VRAA 4XP5H 1EFXB 3DX3A 4KGJA 4HFUH 1DQJA 1HHKA 2NY0B 1WIOA 5IQ7H 2K70A 3JV6A 1QZNA 4PS7A 4HBCH 1RJYA 3R06B 4NGHL 5AW1B 3GRGA 1ZHKB 2NNCA 3ESMA 2DYPA 3LHPH 2VB5A 4KHTH 2PXYB 3P73B 4H40A 3BFQG 5I1DB 3CVDA 4U6YB 4YC2C 1SRDA 1J1PL 4LCUA 3SDDA 4GB9A 1BQKA 3UBHA 4Y1TA 1CFVH 1U8OB 3MI6A 1N70A 3F12B 1U92B 3EFOB 2C9RA 2F2HA 1TSHA 3LN5A 4N8VB 3V9FA 1YEDB 3VA2C 1PFOA 3GSXB 4ORGB 5GZNA 4XNQA 3RUGA 1VACB 3PRZA 5FCSH 2ZOTA 1DCLA 3DSNA 3QK0A 2X09A 2PO6A 3L2MA 4GP4B 2ZUWA 5GS0C 1QWUA 3V95A 3RAJH 1OCCB 5IR1B 4DP8X 3KEHA 4XNZC 1IC1A 4PB0L 4BK5A 3US9A 4L4TA 1CE6B 4HUUB 3TA3C 1ORQB 1OTTD 2GAZA 4XPBL 5C3TA 2Q7NA 3IGAB 2ATAA 1B2WH 3WGVB 1T0NA 2ZTBA 4ZOEA 5I1LB 2P9RA 3P77B 3V79C 4G2AA 4AH2B 5C0DB 1QHPA 2R4RL 1JGVH 1HWWA 4UIMA 4GS7B 2BIHA 4KX9A 2AP2A 3CMGA 3FU9A 3ARDA 3RILA 2WZ5A 1A6WH 1HL4A 4XMTA 2JH2A 3CV5A 3AXIA 3BZFB 2P8LA 3HS0C 3PWVA 4X6EB 4L23A 2WLNA 3GS7A 4Q97A 3P4MB 4AIZA 4Y2DC 2BHUA 4YH6A 5ICYB 5DFWH 3SQOH 3K80A 5EOCL 1MEXL 2EYSB 3AU0A 5T3XD 1G5GA 1RY7B 2WLKA 3BSZA 1GVIA 2D4FA 1W8OA 3S5LG 2Y6SD 2LU4A 4MRBA 2GFBA 3P0VL 5DD3L 4E9VA 1IAOB 3EYVA 2EDFA 4UBDC 5TQ2L 2VN7A 3ZMEA 4TKWA 1QFWM 5CR8A 3N2JA 2X4OB 3L2NA 3EOTH 5L7XL 3AY4C 4MMXB 5C0NC 1YN6A 4L4TE 3FQUB 3QEUA 4JJHA 2VLLA 2DLTA 4NQCE 2ZF8A 1I85C 5DUMH 3BZ4A 4PBXA 5GGRY 1F1GA 4TPRL 2EDTA 2DJSA 4L8SA 1RPQA 3ABLB 4AX3A 2QQNH 3FCUB 5J3HD 4PIRF 4UV4L 1JDCA 5GJTH 4I2XE 2PW2B 4P3DA 3ARWA 1QR4A 2GITB 2VM3A 4LSRL 4RRPM 3VW3L 4AMKL 2HN7B 3NP4A 4RGNE 4NLHA 3NH7L 5DUJA 4BE6A 2QFRA 3M17B 4QOKA 4IBQA 1U8PB 4KKLD 3BKYH 1T7VA 4OB5H 4IKNA 4PJ9B 5C92A 1H6UA 1Z5LB 3VFPB 2WPGA 1GOFA 4P04A 2TRYA 4FKHA 4BIKA 4ANKA 3KL3A 1OW0A 1VGKA 3BP4B 1W91A 4XN7A 1KGCD 4FP8L 2WTRA 4I1RA 4QF1A 2Y06L 3F8UB 5I16B 3NIDE 2VDKL 1WCBA 2EH8H 5T1MA 3O4OB 4OLEA 1U8KB 4CN1A 3ARFD 4NDMB 4G83A 1BAFH 4ZTOH 4KMTL 5CFAA 4NQTA 1CK0H 3L6FB 2GIYA 4GW1B 1S7WA 2WUCL 1U58B 4HF5H 2EC9U 5JPMA 1CWVA 5DRWA 4AC2A 3TCTA 4NN6B 3BAJA 4HCFA 3T2QA 2AQTA 2J6WA 1P1VA 2ZKXA 4BINA 4KXBA 3BN9C 2VLKD 4CW1B 5INDB 2HB0A 1CBVL 1UM6L 3RY6A 2CA4A 4LKXA 2ITFA 4HLZG 4GSRA 3SKJL 3RTQA 4ZUWA 4HIIB 1NCIA 4F57H 2CZNA 2OXGB 3HAEG 4B0MM 3FB6A 4I3SH 4QLRA 4CBPA 4UILL 5MERB 2I07B 2RIKA 3PV6B 4Y4FC 2JFCA 3IFNH 2E8YA 4P46C 1MCJA 4QOKE 4UYPA 4QWWC 4UMGA 4NPYB 4Q4IA 4PP1C 3IDIA 4XXCA 1LP9E 5HDOA 1M05A 1BW8A 4ONGL 4EVNA 1XL4A 1WWWX 5I66B 3EYFA 2FBOJ 1S7VB 3CXHK 2PW1B 3CZLA 3GUTA 1NC2D 2X70A 4ZTPL 4CSTA 5GS2D 2OSWA 1RI8A 1TYEB 1V55B 4AUYA 2G9HB 1MWAA 4FI7A 2QQKL 3MV01 5DRZB 1VEMA 4JMXA 3RZCA 3ULAB 4PJBE 1CI3M 4QYOA 3VSQA 2FD6L 4K5NA 4GG6B 3TJHD 4P9MH 1IT9H 2VW4A 1TJXA 2F54A 1DBBH 2WO4A 1AHMA 1YEFL 4H8PA 5CCKH 1A7NL 1YO4A 4MXWH 4J3OD 2XWZA 3WIHH 1WUZA 4PTTB 4MTMA 3CFKB 4DUVA 2ORBL 4FQLL 5DLMH 2Z34A 4X6FB 2Z4QB 3TBYB 4B9GA 4KMLB 1KV3A 3HZ3A 4UOW1 5I30L 1U3ZA 2WQUA 1BVLB 3QDHA 4P2QD 1URZA 3O6FA 4Z76B 2WGXA 2UVFA 1MHCA 1VFUA 3L4CA 1I1YB 1I4FA 3T0AA 1HDMA 2D4DA 4HPOL 3V10A 5JOPE 3WD5L 4U3SB 4KZDH 3BAEL 4KV5E 4ZX4A 4HIQA 1JGUH 5DI8B 5L4IA 2NY3C 4JY5H 1G7JB 5AEAA 3EJTA 3QG6B 3P11L 4M43H 4PV8A 1NGPH 4YVUA 3PPSA 1AS8A 5FS5A 1VZIA 5I71B 4ZXBC 1KCVL 3IN2A 2I26N 2JWYA 4RMQA 1ZA6A 1P4LA 2ZUXA 1XHHA 4OCRL 3KPPA 3UP1A 4UM9D 2A9AA 1AQ8A 1XIWC 2WWNA 2F54E 3Q6GH 1QPKA 4ELKB 4WQOA 2AQRA 4OD3L 2MCPH 2NY2C 3MRKA 1QFPA 4A55A 4X4XB 3SCMA 1MQKL 1R5IB 2VIRB 1YMME 3A6BH 3HE7D 2VN4A 1U36A 3KYNA 3PREA 4TF4A 4BHUA 1A14L 1UD4A 1YJDL 4HSCX 5DT1H 1H6EA 4ONHA 4ZUTB 4G8FA 4JCWA 1OF2B 2AV7B 4FNUA 3OXRB 4C59B 1CIUA 1E4KC 2BWDA 4ICXA 1T1YB 4NCDA 4XPFL 4CC1A 3QXVA 1N0XH 4QHNB 3RWDB 5IK3B 5D6DA 2J6EH 3GSWA 1DLFH 1D6VL 1MHPL 2FJHB 4P2RB 4QTFA 1YPZF 4N1CA 4P0DA 3EGXA 4AQ1C 5DR5L 5FA3B 5FOBB 5CKAA 2FLMA 4ZW8A 4Z77A 4R4NC 3HZYA 1E6OH 1QP1A 5D72L 4M4RB 5DD6B 1HH9B 3KM2A 5EA0H 5EO9B 4LQ1A 4KMQA 4DVRL 4H88H 1IM3D 1OTTC 5I0VA 1NLBH 1X5GA 4M1GH 1FNEA 5EO0A 3UCRA 4AEEA 1DL7L 1F6AA 1KIRA 5BVJB 1I8MA 3LD8B 4UQ3A 4B6ZA 1YEJL 1SOSA 3CDGA 4KHXH 3KPQA 3ZZQA 5DVLA 2F5AH 2R0LL 3J07A 4P5TD 2YK1L 1R5VA 4KPHH 4OAWB 4YC2B 4V1DB 3D18A 3VFGH 4U1MA 3D30A 4N8PA 5KW9L 4OI9A 4UQCA 1RURL 3HNSH 2WVSA 4LP5A 4DH2A 1TPXB 4Y16D 1MF2L 2DQCL 3MUGA 4K2UH 4NJAH 2ED8A 4Z7WF 4OCXH 2LAGB 4ZMLA 3DIDA 4PJDF 1XSKA 2E7DA 3E9TA 3T0XA 4YZFF 5ESVB 3UBXI 4UTCA 3OAUL 4HAFA 3HZMB 5DJ2B 2X1QA 4I77H 3NCWA 2JB5L 2L0DA 4LVHC 2Z8RA 1A3ZA 1X5KA 3F84A 3E6FA 1P5UB 1V10A 1GSMA 4Y4HD 2KLRA 4UM8A 5F0JB 1Z0NA 3TGXA 4PJGB 3WTWA 1GZQB 3RIAF 1I8IA 3FH5A 1CD1B 2VABA 3V0EA 3DX7A 3S3CB 3NACH 1Y6NR 4NQED 4AM0Q 4CJ1A 2DQEL 1CQKA 3DURA 5IMOA 1OAUH 1RZ8B 4ZO9A 5D93C 5KVGL 1JNLL 2DQ6A 4HHAA 3UO1L 3ZKXC 2XTLA 2FR4B 3T3PB 3LTVA 4AYMC 1G6RA 5A2BA 3P30H 3WHE1 1AGEB 3P9MB 5J3HC 2OQJB 2GUYA 3KCPB 1KTLB 3BZ5A 3RJDA 4JFXA 5FKPB 2MMXA 1A7PH 1XF5A 3WELA 5GXBB 3AVEA 3HS0B 1IEHA 4Y2DB 3OLIA 5DHEA 1UZ8B 5AL8A 1CXFA 1XR8B 4Z7UA 4ZFZA 3V6ZA 2QV4A 2OW6A 1NGXB 4OJDH 5FYKE 1SBSH 1MI5B 5DU7A 4XPBH 5J12C 5TQ0L 2PWGA 4GRMB 2ZXCA 5CZRA 2WIIA 5IKCA 2VXUL 3WCYA 2YXFA 3O3DA 3FB5A 3ARFC 1FVDB 2MFNA 3GKZA 3MOBL 1UQSB 1NLDL 4HUCA 1XEUA 4PWGA 4MA1B 3JTTA 1FNFA 4Y19D 3BVXA 3QDJA 5E2WL 1TQVA 5MENE 1C5CH 1HNFA 4QNPF 3DETD 1SYSA 2CUAA 1IMHC 1IGIH 1NC4A 2Y2YA 1Q94B 3HG1D 1ZE3C 3I75A 4PRPB 1S7UB 1J1OH 3JV4A 3CZNA 2DMGA 4PJEA 4HWBA 2WQ8A 4CILA 2R1YA 4OIAA 2YD4A 1E9OB 5DD3H 1N3NA 2TSAA 3P0VH 5A2LH 3ZRCC 2HFTA 1YG9A 5GS3A 5DHDA 2KMWA 4N1HB 2QR0A 4OZIA 3KWVA 4IMLA 2WAHA 4I9WE 4MYWB 1DLHB 4OFKA 1I7UA 2A9NH 3OJ2C 3A67H 1VCAA 3UJIL 5L7XH 5F3FA 4Z7UE 1JV5B 1CF1A 3VXPA 5EF2A 4M5TA 3QZNA 3V0VB 1PEWA 1EEYA 2R83A 3HPJA 3FQTA 4TUJB 4EDWL 1ZVNA 3HKFA 2YJQA 2VW7A 3BVVA 1XXFC 3X12A 4B27A 5I1HH 1QA9B 4LAJH 5FHAL 2WWOA 1ZK5A 5EU7C 4QXUL 1PAZA 1U8NB 4QPEA 5CILL 4JM2A 5F9WB 1IGCL 2X9XA 4UV4H 3GYRA 1FNSL 5IVXA 1HZLA 2WINB 3GHBL 3MJ8A 5BS0B 3T2OA 2H6PA 4ZTEA 1EAJA 3CJJA 5DHVA 5JOFB 3G5XB 5C8JB 4Z6AT 3I6LE 1S9XA 1EEZA 1JFHA 1EX0A 2YMXL 3L3JA 3IDJA 2WLYA 3NN8B 3AXLA 3KXFB 3QFJA 2K4WA 1WBZA 3GPEA 4AEFA 5CFHA 3TJHC 2YGNA 3ARBA 4N0CD 4XP6L 5B8CC 2ICWB 3HLAA 4A7SA 4YE4L 3LIUA 3TNNB 1PIFA 4FP8H 4LSTH 3KWXA 4FXLA 4PJEE 5AFAA 3U7WH 5M7QA 1QRNB 4J3OC 5DVMA 1H9VA 1KLGB 2NLJB 4ZI8A 3L95A 4KKAD 4BYHA 2J8UB 4RVBA 1JTTA 1BZOA 4E9YA 4OZIE 4JMNA 5E8NB 1RVFH 1REIA 3KPRB 1CFMA 1MVUA 4R0LA 2VMFA 2CUMA 2UY6A 4G7VL 2VN5A 2WXMA 1NCBL 2JIXA 3FT4A 4JKPL 1FC2D 2YEZA 4JO8A 4PCYA 5AW2B 5HVGB 1CB4A 2VUOA 5IEKA 4JW3A 4X7SL 5EWIL 1UM6H 5HHPA 2FIKA 2MHAA 4MB1A 3L5JA 3T77B 2YOAA 2XWRA 4NO0B 4AENA 1DVFA 3GIZL 4GAYA 3JWDH 3N50A 2IH1A 4JFYB 4MXQD 3ZKNC 4DPAX 3U25A 3VM7A 1IC0A 4JY4A 4UILH 2CUIA 2E59A 4K3DL 1I7ZA 3FO9B 5IZ7A 3BJ91 1I1AC 4NN5C 4ZW7A 4UV7L 1B88A 3SY0A 3ZTCC 5EEWA 5JIMA 5E4EB 2GBTA 1E7UA 3CHOA 3X11B 2DBJA 2IF7A 2MQ0A 2Z31A 4G6ML 4K5MA 4XZUA 3HE7C 2BP0A 2HTKD 2J21A 1N5AA 3LPWA 4KKNA 5HHOA 3L3GA 1HN1A 5I15H 3OKOA 4AL8C 3V2AR 2AJYL 2YAHA 5C7XH 1M2VA 1XZ0B 3AM8A 4GKSA 4X7FC 2ZKYA 2XRAH 4K5PA 3ORJA 5I74C 3VFSB 3ARGD 4M29A 5EOCJ 3MO1B 3KLQA 1DQQB 4JQVC 4LSVL 4DP4X 1BVNT 1VESA 1NFDA 3BKJL 2E4TA 2FD6H 3KPNB 2A9MH 4M5ZL 4HW6A 5L4JA 5I17A 1QFWI 3PWPA 5G5DA 2FBRA 2OMTB 5IB1A 5FKAB 1A7NH 1T3FA 2GTZA 2XWBA 5I75C 5IHZB 1TTRA 4L5FL 3MV9A 5DRNB 5KJ4A 1Q4NX 2DYPD 3UZVA 4AK1A 1S7TA 3DVNB 5KOMC 3SDDD 1AZNA 2PPCA 4P5TC 2EE6A 2WY3B 3BO8B 1E40A 4PGEA 3DV6A 2VRKA 4IU2B 5C0FB 4HPOH 3P9LA 4IU3A 4WUUD 3C5SB 25C8L 2X6MA 5CJBA 2YAOA 5GZND 1ZHLA 4Y16C 1QMUA 2B4CH 5TGBA 43CAA 1MFCH 2WWKT 3QG7L 1T1ZA 4LKCA 5AALA 1U4FA 3S36X 3BYTA 4XPGH 1AZZC 4QY8B 3VFOB 1N68A 1MVYA 1EAPB 3MRLB 2YQGA 3P11H 5I1JH 1Z32X 1T5KA 3I3BA 3OHMB 4R6UA 3L45A 5FECB 1OE3A 3RURA 4XC3L 4AYID 1ZIBA 1NOAA 2RALA 4L8DA 2R56H 2FX7H 4OCRH 3S34L 4MDJA 3ZE0E 1FLTX 2FJFA 4RDBA 5ESQA 1LMKA 2ALAA 3HN8A 4XGZB 5CIPB 4HK3N 4UTAH 1TCRA 3BAKA 3PWPE 4PVBA 2OI9B 4HOZA 4JRYD 1RZ7H 1M1XB 2VLME 2EE9A 1MQKH 3V5KA 1ETZB 3UCQA 4R2GD 1TZ8A 1L9MA 3MV9E 5BV7L 1X5XA 3VFUA 4OF7A 4QO1A 2O4EA 1LEIA 3U7YL 3PHQB 2QGEA 2JB6B 4P49A 4FFZH 4W9LC 5FXCH 4HQQH 1IBGH 4QRSB 4ZUVB 4OT1L 5A1AA 4J4PA 2QLYA 1PX4A 4Z18A 1DVYA 2OLDA 1D6VH 4RH4A 5DFAA 4OD2A 2OMZB 3QZWB 1V05A 3OXSA 4WW1A 5BJTA 4OCYL 4P5KA 4KI5C 5LGJB 5ALBL 1S5IL 1V54B 2RD0A 5CEZE 1AIFB 4N25A 2D3NA 3MOAL 2LFGA 2P8PA 3RIKA 5BW7A 1LQBC 3K6DA 5DMIL 3MFGB 4L3ED 1FL6A 1KZQA 3ZLQC 2ENSA 2I5YH 1X7TA 4YL9A 5D6CA 5F7DB 4YHLL 1ZY9A 2B08A 2JQMA 9PCYA 3ZE1E 3L1EA 2R7EA 3MN8A 1QSZA 4X7EC 3UBXA 3RP1A 1U93B 3JVGC 5GIRA 4GQZA 2WIMA 1OSZB 4L8CB 1IGYB 1FAIH 1L9QA 4OZGE 1JMXA 3II2A 2HKAA 3QB7C 4J3UA 5B21A 2QSVA 4UAOB 3AS2A 2RHEA 5I1IH 3GMNA 4F7PA 3PIQA 3FUIA 1XF3A 5HYSA 5EC1B 1UJ3C 4GW5A 1YMHB 3UYRH 1O9ZA 2XI9A 4ZT1A 5BRQA 3GNMH 3FT2A 2BP3A 2EVFA 3AREC 4MJ6B 1J86A 3VH8B 5JZ7D 1DJGA 3WJLA 1K8DA 3B4NA 2FE0A 4KQ4L 1IFGA 2CG9X 3E1F1 5DQJA 4OQTH 4NO5A 3DPBB 2QMKA 1OCWL 1XD1A 2O5ZH 2CRYA 1MFEL 2HVKA 3MJ9L 1S7XB 3WNMA 3UDWA 3N1PC 1BXAA 2CHDA 3JYBA 1AJ7L 3MBWB 5FB8A 2CWRA 4WLCA 5J1AA 4NT6A 1JNLH 1TDQA 4HIEA 3C6LA 2X6BA 3MRJA 1SDYA 2DBLL 3HC4L 1LNUA 4HC1A 4MAZA 3UG4A 3BIKB 4ZRGA 2CK2A 4HWEH 2C9PA 2BP5M 1ZJBA 3O41B 3V4VH 3QPQD 2WANA 4NRXA 2WXFA 4NBZB