3H87C

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
molecule keywords Putative uncharacterized protein
total genus 23
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3h87C00
1ARRA 1Q5VA 2BSQE 2WVBA 2BJ1A 2JXIA 1MYKA 2BJ7A 2BJ9A 3FT7A 4ME7E 2K29A 2GPEA 1ARQA 2K9IA 1BDVA 2BJ3A 2WVDA 2CPGA 3LGHA 1BDTA 1B01A 3VEAA 2K1OA 2KELA 1P94A 3OD2A 4FXEA 1IRQA 4D8JA 1EA4A 1NLAA 2RBFA 2CAXA 2CADA 2CA9A 3H87C 2BA3A 1MYLA 3GXQA 1BAZA 4HV0A 3VW4A 2WVEA 2JXHA 2WVCA 2JXGA 2H1OE 1U9PA 2K6LA 1X93A 3VEBA 2HZAA 2WVFA 2BJ8A 3QOQA 2BNZA 2HZVA 1QTGA 2BNWA 2AY0A 2K5JA 1B28A 3FMTA 2CAJA 1PARA 1MNTA
chains in the Genus database with same CATH superfamily
2A2BA 2JBVA 3NO7A 4QPXA 2CPGA 1BDTA 2KELA 2KOEA 2CADA 3G5OA 4NRTA 1Q16A 3NNEA 3VEBA 3BSOA 2WVFA 2CKWA 4NRUA 2ADLA 2BNZA 1QTGA 3FMTA 1SH2A 4AAIA 4MJWA 2BJ7A 3FT7A 1SH0A 4ME7E 4LQ3A 2K9IA 2UUWA 2UUTA 2BJ3A 3NAIA 3LJPA 4O4RA 1B01A 3IR7A 2RBFA 2Q2KA 2CAXA 3UQSA 3H87C 1MYLA 3GXQA 1OG7A 3VW4A 2WVEA 2JXHA 3SFGA 3QOQA 2H3AA 2BNWA 3SFUA 2CAJA 1PARA 1MNTA 1ARRA 3BSNA 2BSQE 2JXIA 2BJ1A 2K29A 1ARQA 1BDVA 2WVDA 3VEAA 2K1OA 3OD2A 4D8JA 1NLAA 1SH3A 3UR0A 3H5XA 1BAZA 2WK4A 2JXGA 2K6LA 2HZAA 3QIDA 2B43A 2BJ8A 2AY0A 2K5JA 1B28A 2AN7A 1Q5VA 2WVBA 1MYKA 2BJ9A 3NAHA 2GPEA 1OHNA 3LGHA 1P94A 4FXEA 1IRQA 1EA4A 2KKEA 1SIWA 2CA9A 2BA3A 4HV0A 2WVCA 3H5YA 2H1OE 1U9PA 1X93A 4LRVA 2HZVA 4LQ9A 3UPFA
chains in the Genus database with same CATH topology
1ARRA 1Q5VA 2BSQE 2WVBA 2BJ1A 2JXIA 1MYKA 2BJ7A 2BJ9A 3FT7A 4ME7E 2K29A 2GPEA 1ARQA 2K9IA 1BDVA 2BJ3A 2WVDA 2CPGA 3LGHA 1BDTA 1B01A 3VEAA 2K1OA 2KELA 1P94A 3OD2A 4FXEA 1IRQA 4D8JA 1EA4A 1NLAA 2RBFA 2CAXA 2CADA 2CA9A 3H87C 2BA3A 1MYLA 3GXQA 1BAZA 4HV0A 3VW4A 2WVEA 2JXHA 2WVCA 2JXGA 2H1OE 1U9PA 2K6LA 1X93A 3VEBA 2HZAA 2WVFA 2BJ8A 3QOQA 2BNZA 2HZVA 1QTGA 2BNWA 2AY0A 2K5JA 1B28A 3FMTA 2CAJA 1PARA 1MNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARR A;  1Q5V A;  2BSQ E;  2WVB A;  2BJ1 A;  2JXI A;  1MYK A;  2BJ7 A;  2BJ9 A;  3FT7 A;  4ME7 E;  2K29 A;  2GPE A;  1ARQ A;  2K9I A;  1BDV A;  2BJ3 A;  2WVD A;  2CPG A;  3LGH A;  1BDT A;  1B01 A;  3VEA A;  2K1O A;  2KEL A;  1P94 A;  3OD2 A;  4FXE A;  1IRQ A;  4D8J A;  1EA4 A;  1NLA A;  2RBF A;  2CAX A;  2CAD A;  2CA9 A;  3H87 C;  2BA3 A;  1MYL A;  3GXQ A;  1BAZ A;  4HV0 A;  3VW4 A;  2WVE A;  2JXH A;  2WVC A;  2JXG A;  2H1O E;  1U9P A;  2K6L A;  1X93 A;  3VEB A;  2HZA A;  2WVF A;  2BJ8 A;  3QOQ A;  2BNZ A;  2HZV A;  1QTG A;  2BNW A;  2AY0 A;  2K5J A;  1B28 A;  3FMT A;  2CAJ A;  1PAR A;  1MNT A; 
#chains in the Genus database with same CATH topology
 2A2B A;  2JBV A;  3NO7 A;  4QPX A;  2CPG A;  1BDT A;  2KEL A;  2KOE A;  2CAD A;  3G5O A;  4NRT A;  1Q16 A;  3NNE A;  3VEB A;  3BSO A;  2WVF A;  2CKW A;  4NRU A;  2ADL A;  2BNZ A;  1QTG A;  3FMT A;  1SH2 A;  4AAI A;  4MJW A;  2BJ7 A;  3FT7 A;  1SH0 A;  4ME7 E;  4LQ3 A;  2K9I A;  2UUW A;  2UUT A;  2BJ3 A;  3NAI A;  3LJP A;  4O4R A;  1B01 A;  3IR7 A;  2RBF A;  2Q2K A;  2CAX A;  3UQS A;  3H87 C;  1MYL A;  3GXQ A;  1OG7 A;  3VW4 A;  2WVE A;  2JXH A;  3SFG A;  3QOQ A;  2H3A A;  2BNW A;  3SFU A;  2CAJ A;  1PAR A;  1MNT A;  1ARR A;  3BSN A;  2BSQ E;  2JXI A;  2BJ1 A;  2K29 A;  1ARQ A;  1BDV A;  2WVD A;  3VEA A;  2K1O A;  3OD2 A;  4D8J A;  1NLA A;  1SH3 A;  3UR0 A;  3H5X A;  1BAZ A;  2WK4 A;  2JXG A;  2K6L A;  2HZA A;  3QID A;  2B43 A;  2BJ8 A;  2AY0 A;  2K5J A;  1B28 A;  2AN7 A;  1Q5V A;  2WVB A;  1MYK A;  2BJ9 A;  3NAH A;  2GPE A;  1OHN A;  3LGH A;  1P94 A;  4FXE A;  1IRQ A;  1EA4 A;  2KKE A;  1SIW A;  2CA9 A;  2BA3 A;  4HV0 A;  2WVC A;  3H5Y A;  2H1O E;  1U9P A;  1X93 A;  4LRV A;  2HZV A;  4LQ9 A;  3UPF A; 
#chains in the Genus database with same CATH homology
 1ARR A;  1Q5V A;  2BSQ E;  2WVB A;  2BJ1 A;  2JXI A;  1MYK A;  2BJ7 A;  2BJ9 A;  3FT7 A;  4ME7 E;  2K29 A;  2GPE A;  1ARQ A;  2K9I A;  1BDV A;  2BJ3 A;  2WVD A;  2CPG A;  3LGH A;  1BDT A;  1B01 A;  3VEA A;  2K1O A;  2KEL A;  1P94 A;  3OD2 A;  4FXE A;  1IRQ A;  4D8J A;  1EA4 A;  1NLA A;  2RBF A;  2CAX A;  2CAD A;  2CA9 A;  3H87 C;  2BA3 A;  1MYL A;  3GXQ A;  1BAZ A;  4HV0 A;  3VW4 A;  2WVE A;  2JXH A;  2WVC A;  2JXG A;  2H1O E;  1U9P A;  2K6L A;  1X93 A;  3VEB A;  2HZA A;  2WVF A;  2BJ8 A;  3QOQ A;  2BNZ A;  2HZV A;  1QTG A;  2BNW A;  2AY0 A;  2K5J A;  1B28 A;  3FMT A;  2CAJ A;  1PAR A;  1MNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...