3H87C

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
b'SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
total genus 23
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3h87C00
1BAZA 2CAXA 2K5JA 2JXHA 1MYKA 2WVCA 2JXGA 3H87C 2WVEA 1U9PA 2HZVA 1X93A 1BDTA 2BJ1A 3VEAA 1ARRA 2K9IA 3GXQA 1MNTA 2JXIA 1B28A 3FMTA 3FT7A 1Q5VA 1EA4A 2BJ9A 2WVFA 1PARA 2CA9A 2BJ7A 1IRQA 2CPGA 1BDVA 2WVBA 1QTGA 2CADA 2KELA 3OD2A 2RBFA 2H1OE 2AY0A 4ME7E 3LGHA 2BNZA 2K6LA 1MYLA 2BA3A 2HZAA 2GPEA 4FXEA 1P94A 3QOQA 2BSQE 1B01A 2WVDA 3VEBA 4D8JA 1ARQA 1NLAA 2K29A 3VW4A 2BJ8A 2CAJA 4HV0A 2BJ3A 2K1OA 2BNWA
chains in the Genus database with same CATH superfamily
1SH3A 2JXGA 3BSOA 3NO7A 4O4RA 1MNTA 1SH0A 2H3AA 2UUTA 1SIWA 1IRQA 2CPGA 2H1OE 2AY0A 3NAHA 1MYLA 2GPEA 2JBVA 3H5YA 2CKWA 1ARQA 2CAJA 4NRTA 2WVCA 1MYKA 3H87C 2WVEA 1U9PA 2HZVA 1X93A 1Q16A 3FMTA 1Q5VA 1OHNA 2WK4A 2WVFA 1PARA 1BDVA 1QTGA 2KELA 3NAIA 4LRVA 3LJPA 3G5OA 2BSQE 1B01A 2WVDA 4D8JA 2Q2KA 2BJ8A 3SFUA 4MJWA 2AN7A 3BSNA 2BJ1A 2UUWA 2K9IA 3VEAA 1B28A 1OG7A 1EA4A 3NNEA 2CA9A 2BJ7A 2WVBA 2B43A 3OD2A 2RBFA 4AAIA 2BNZA 2K6LA 2A2BA 2HZAA 1P94A 3SFGA 3VEBA 1NLAA 2KKEA 2BJ3A 2K1OA 2BNWA 3UPFA 1BAZA 2CAXA 2K5JA 1SH2A 2JXHA 4NRUA 4QPXA 1BDTA 1ARRA 3IR7A 3GXQA 2JXIA 3FT7A 2BJ9A 3H5XA 2ADLA 2CADA 4LQ9A 4ME7E 3LGHA 3UQSA 2KOEA 2BA3A 4FXEA 4LQ3A 3QOQA 3UR0A 3QIDA 2K29A 3VW4A 4HV0A
chains in the Genus database with same CATH topology
1BAZA 2CAXA 2K5JA 2JXHA 1MYKA 2WVCA 2JXGA 3H87C 2WVEA 1U9PA 2HZVA 1X93A 1BDTA 2BJ1A 3VEAA 1ARRA 2K9IA 3GXQA 1MNTA 2JXIA 1B28A 3FMTA 3FT7A 1Q5VA 1EA4A 2BJ9A 2WVFA 1PARA 2CA9A 2BJ7A 1IRQA 2CPGA 1BDVA 2WVBA 1QTGA 2CADA 2KELA 3OD2A 2RBFA 2H1OE 2AY0A 4ME7E 3LGHA 2BNZA 2K6LA 1MYLA 2BA3A 2HZAA 2GPEA 4FXEA 1P94A 3QOQA 2BSQE 1B01A 2WVDA 3VEBA 4D8JA 1ARQA 1NLAA 2K29A 3VW4A 2BJ8A 2CAJA 4HV0A 2BJ3A 2K1OA 2BNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAZ A;  2CAX A;  2K5J A;  2JXH A;  1MYK A;  2WVC A;  2JXG A;  3H87 C;  2WVE A;  1U9P A;  2HZV A;  1X93 A;  1BDT A;  2BJ1 A;  3VEA A;  1ARR A;  2K9I A;  3GXQ A;  1MNT A;  2JXI A;  1B28 A;  3FMT A;  3FT7 A;  1Q5V A;  1EA4 A;  2BJ9 A;  2WVF A;  1PAR A;  2CA9 A;  2BJ7 A;  1IRQ A;  2CPG A;  1BDV A;  2WVB A;  1QTG A;  2CAD A;  2KEL A;  3OD2 A;  2RBF A;  2H1O E;  2AY0 A;  4ME7 E;  3LGH A;  2BNZ A;  2K6L A;  1MYL A;  2BA3 A;  2HZA A;  2GPE A;  4FXE A;  1P94 A;  3QOQ A;  2BSQ E;  1B01 A;  2WVD A;  3VEB A;  4D8J A;  1ARQ A;  1NLA A;  2K29 A;  3VW4 A;  2BJ8 A;  2CAJ A;  4HV0 A;  2BJ3 A;  2K1O A;  2BNW A; 
#chains in the Genus database with same CATH topology
 1SH3 A;  2JXG A;  3BSO A;  3NO7 A;  4O4R A;  1MNT A;  1SH0 A;  2H3A A;  2UUT A;  1SIW A;  1IRQ A;  2CPG A;  2H1O E;  2AY0 A;  3NAH A;  1MYL A;  2GPE A;  2JBV A;  3H5Y A;  2CKW A;  1ARQ A;  2CAJ A;  4NRT A;  2WVC A;  1MYK A;  3H87 C;  2WVE A;  1U9P A;  2HZV A;  1X93 A;  1Q16 A;  3FMT A;  1Q5V A;  1OHN A;  2WK4 A;  2WVF A;  1PAR A;  1BDV A;  1QTG A;  2KEL A;  3NAI A;  4LRV A;  3LJP A;  3G5O A;  2BSQ E;  1B01 A;  2WVD A;  4D8J A;  2Q2K A;  2BJ8 A;  3SFU A;  4MJW A;  2AN7 A;  3BSN A;  2BJ1 A;  2UUW A;  2K9I A;  3VEA A;  1B28 A;  1OG7 A;  1EA4 A;  3NNE A;  2CA9 A;  2BJ7 A;  2WVB A;  2B43 A;  3OD2 A;  2RBF A;  4AAI A;  2BNZ A;  2K6L A;  2A2B A;  2HZA A;  1P94 A;  3SFG A;  3VEB A;  1NLA A;  2KKE A;  2BJ3 A;  2K1O A;  2BNW A;  3UPF A;  1BAZ A;  2CAX A;  2K5J A;  1SH2 A;  2JXH A;  4NRU A;  4QPX A;  1BDT A;  1ARR A;  3IR7 A;  3GXQ A;  2JXI A;  3FT7 A;  2BJ9 A;  3H5X A;  2ADL A;  2CAD A;  4LQ9 A;  4ME7 E;  3LGH A;  3UQS A;  2KOE A;  2BA3 A;  4FXE A;  4LQ3 A;  3QOQ A;  3UR0 A;  3QID A;  2K29 A;  3VW4 A;  4HV0 A; 
#chains in the Genus database with same CATH homology
 1BAZ A;  2CAX A;  2K5J A;  2JXH A;  1MYK A;  2WVC A;  2JXG A;  3H87 C;  2WVE A;  1U9P A;  2HZV A;  1X93 A;  1BDT A;  2BJ1 A;  3VEA A;  1ARR A;  2K9I A;  3GXQ A;  1MNT A;  2JXI A;  1B28 A;  3FMT A;  3FT7 A;  1Q5V A;  1EA4 A;  2BJ9 A;  2WVF A;  1PAR A;  2CA9 A;  2BJ7 A;  1IRQ A;  2CPG A;  1BDV A;  2WVB A;  1QTG A;  2CAD A;  2KEL A;  3OD2 A;  2RBF A;  2H1O E;  2AY0 A;  4ME7 E;  3LGH A;  2BNZ A;  2K6L A;  1MYL A;  2BA3 A;  2HZA A;  2GPE A;  4FXE A;  1P94 A;  3QOQ A;  2BSQ E;  1B01 A;  2WVD A;  3VEB A;  4D8J A;  1ARQ A;  1NLA A;  2K29 A;  3VW4 A;  2BJ8 A;  2CAJ A;  4HV0 A;  2BJ3 A;  2K1O A;  2BNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...