3H87C

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
SDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
molecule keywords Putative uncharacterized protein
total genus 23
structure length 72
sequence length 72
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3h87C00
2CAXA 2CPGA 3GXQA 2BNZA 2RBFA 2HZVA 1BDTA 2K6LA 2JXGA 1PARA 1ARQA 3VW4A 2WVDA 2BJ9A 2KELA 1B28A 2BA3A 2HZAA 1IRQA 2K9IA 1MNTA 4D8JA 2WVBA 3FMTA 2JXIA 2CA9A 2WVCA 1BAZA 3VEBA 1P94A 2BJ8A 4HV0A 2CAJA 2K5JA 4FXEA 4ME7E 3QOQA 3FT7A 3LGHA 3OD2A 2BJ1A 2WVFA 1U9PA 3VEAA 1Q5VA 2BJ7A 1MYKA 2GPEA 1B01A 1MYLA 3H87C 1QTGA 2JXHA 2BSQE 2AY0A 2WVEA 1X93A 2CADA 1BDVA 2K29A 2BNWA 1NLAA 2H1OE 2K1OA 2BJ3A 1ARRA 1EA4A
chains in the Genus database with same CATH superfamily
2CAXA 1OG7A 2CPGA 3GXQA 2BNZA 2HZVA 1BDTA 2JXGA 1PARA 1ARQA 3VW4A 1B28A 2JXIA 4AAIA 4HV0A 3H5XA 3OD2A 2B43A 1Q5VA 4MJWA 2JXHA 2BSQE 2WVEA 4QPXA 1X93A 2CADA 4LRVA 4NRUA 1EA4A 3BSOA 4O4RA 3G5OA 1MNTA 1SH2A 2UUTA 2H3AA 2WVBA 3FMTA 2WVCA 3VEBA 3IR7A 2BJ8A 4FXEA 3LGHA 3VEAA 4NRTA 4LQ9A 1B01A 1MYLA 3H87C 2AY0A 1BDVA 2UUWA 3NAIA 2BNWA 2K1OA 1ARRA 2AN7A 3UPFA 2RBFA 2K6LA 3SFUA 2KKEA 2WVDA 2BJ9A 3H5YA 1IRQA 3QIDA 4D8JA 1OHNA 1BAZA 1P94A 2K5JA 2KOEA 4ME7E 2WVFA 1U9PA 1SH3A 2K29A 1NLAA 2CKWA 2H1OE 2BJ3A 2Q2KA 3NAHA 3BSNA 1SIWA 3SFGA 3NNEA 2KELA 2BA3A 2HZAA 2K9IA 3LJPA 2ADLA 3UR0A 2CA9A 3UQSA 2CAJA 3QOQA 2A2BA 3FT7A 4LQ3A 2BJ1A 2BJ7A 1MYKA 1QTGA 2JBVA 2WK4A 1Q16A 3NO7A 1SH0A 2GPEA
chains in the Genus database with same CATH topology
2CAXA 2CPGA 3GXQA 2BNZA 2RBFA 2HZVA 1BDTA 2K6LA 2JXGA 1PARA 1ARQA 3VW4A 2WVDA 2BJ9A 2KELA 1B28A 2BA3A 2HZAA 1IRQA 2K9IA 1MNTA 4D8JA 2WVBA 3FMTA 2JXIA 2CA9A 2WVCA 1BAZA 3VEBA 1P94A 2BJ8A 4HV0A 2CAJA 2K5JA 4FXEA 4ME7E 3QOQA 3FT7A 3LGHA 3OD2A 2BJ1A 2WVFA 1U9PA 3VEAA 1Q5VA 2BJ7A 1MYKA 2GPEA 1B01A 1MYLA 3H87C 1QTGA 2JXHA 2BSQE 2AY0A 2WVEA 1X93A 2CADA 1BDVA 2K29A 2BNWA 1NLAA 2H1OE 2K1OA 2BJ3A 1ARRA 1EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAX A;  2CPG A;  3GXQ A;  2BNZ A;  2RBF A;  2HZV A;  1BDT A;  2K6L A;  2JXG A;  1PAR A;  1ARQ A;  3VW4 A;  2WVD A;  2BJ9 A;  2KEL A;  1B28 A;  2BA3 A;  2HZA A;  1IRQ A;  2K9I A;  1MNT A;  4D8J A;  2WVB A;  3FMT A;  2JXI A;  2CA9 A;  2WVC A;  1BAZ A;  3VEB A;  1P94 A;  2BJ8 A;  4HV0 A;  2CAJ A;  2K5J A;  4FXE A;  4ME7 E;  3QOQ A;  3FT7 A;  3LGH A;  3OD2 A;  2BJ1 A;  2WVF A;  1U9P A;  3VEA A;  1Q5V A;  2BJ7 A;  1MYK A;  2GPE A;  1B01 A;  1MYL A;  3H87 C;  1QTG A;  2JXH A;  2BSQ E;  2AY0 A;  2WVE A;  1X93 A;  2CAD A;  1BDV A;  2K29 A;  2BNW A;  1NLA A;  2H1O E;  2K1O A;  2BJ3 A;  1ARR A;  1EA4 A; 
#chains in the Genus database with same CATH topology
 2CAX A;  1OG7 A;  2CPG A;  3GXQ A;  2BNZ A;  2HZV A;  1BDT A;  2JXG A;  1PAR A;  1ARQ A;  3VW4 A;  1B28 A;  2JXI A;  4AAI A;  4HV0 A;  3H5X A;  3OD2 A;  2B43 A;  1Q5V A;  4MJW A;  2JXH A;  2BSQ E;  2WVE A;  4QPX A;  1X93 A;  2CAD A;  4LRV A;  4NRU A;  1EA4 A;  3BSO A;  4O4R A;  3G5O A;  1MNT A;  1SH2 A;  2UUT A;  2H3A A;  2WVB A;  3FMT A;  2WVC A;  3VEB A;  3IR7 A;  2BJ8 A;  4FXE A;  3LGH A;  3VEA A;  4NRT A;  4LQ9 A;  1B01 A;  1MYL A;  3H87 C;  2AY0 A;  1BDV A;  2UUW A;  3NAI A;  2BNW A;  2K1O A;  1ARR A;  2AN7 A;  3UPF A;  2RBF A;  2K6L A;  3SFU A;  2KKE A;  2WVD A;  2BJ9 A;  3H5Y A;  1IRQ A;  3QID A;  4D8J A;  1OHN A;  1BAZ A;  1P94 A;  2K5J A;  2KOE A;  4ME7 E;  2WVF A;  1U9P A;  1SH3 A;  2K29 A;  1NLA A;  2CKW A;  2H1O E;  2BJ3 A;  2Q2K A;  3NAH A;  3BSN A;  1SIW A;  3SFG A;  3NNE A;  2KEL A;  2BA3 A;  2HZA A;  2K9I A;  3LJP A;  2ADL A;  3UR0 A;  2CA9 A;  3UQS A;  2CAJ A;  3QOQ A;  2A2B A;  3FT7 A;  4LQ3 A;  2BJ1 A;  2BJ7 A;  1MYK A;  1QTG A;  2JBV A;  2WK4 A;  1Q16 A;  3NO7 A;  1SH0 A;  2GPE A; 
#chains in the Genus database with same CATH homology
 2CAX A;  2CPG A;  3GXQ A;  2BNZ A;  2RBF A;  2HZV A;  1BDT A;  2K6L A;  2JXG A;  1PAR A;  1ARQ A;  3VW4 A;  2WVD A;  2BJ9 A;  2KEL A;  1B28 A;  2BA3 A;  2HZA A;  1IRQ A;  2K9I A;  1MNT A;  4D8J A;  2WVB A;  3FMT A;  2JXI A;  2CA9 A;  2WVC A;  1BAZ A;  3VEB A;  1P94 A;  2BJ8 A;  4HV0 A;  2CAJ A;  2K5J A;  4FXE A;  4ME7 E;  3QOQ A;  3FT7 A;  3LGH A;  3OD2 A;  2BJ1 A;  2WVF A;  1U9P A;  3VEA A;  1Q5V A;  2BJ7 A;  1MYK A;  2GPE A;  1B01 A;  1MYL A;  3H87 C;  1QTG A;  2JXH A;  2BSQ E;  2AY0 A;  2WVE A;  1X93 A;  2CAD A;  1BDV A;  2K29 A;  2BNW A;  1NLA A;  2H1O E;  2K1O A;  2BJ3 A;  1ARR A;  1EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...