3H8HA

Structure of the c-terminal domain of human rnf2/ring1b;
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
92
Chain Sequence
SEIELVFRPHPTLMEKAQTRYIKTSGNATVDHLSKYLAVRLALEELTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ring1B contains a ubiquitin-like docking module for interaction with Cbx proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase RING2
total genus 23
structure length 92
sequence length 107
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3h8hA00
3GS2A 3IXSA 3H8HA
chains in the Genus database with same CATH superfamily
1MVKA 2EKIA 4LDTD 3A9JA 3DPDA 2JVCA 5C2TB 1WGRA 2FIFA 2M0AA 4RM8A 1JWAD 1S3SG 1C4PA 2BB5A 2KVZA 4M01A 3ZJUA 2WDRB 4C00A 5KHQA 4MGYE 5EE3A 3A9JB 1UELA 3H1UA 1WYWB 3JSVA 1EU3A 2M8SA 2J42A 3MHZA 4F1SA 3W1YA 1HXYD 4G3XB 2LZ6A 3AN1A 3VXWA 1PGAA 4RMAA 2OEDA 3ZW3A 4P1CC 2PEAA 2N9LA 1F52A 5IKCM 3GOEA 1H8CA 1WX9A 4C7YA 3VQIA 2KZRA 2MJDA 5JHBA 2D5GA 4GSWA 2IBIB 2X38A 3R3MA 1TS5A 1J8CA 2KFJA 2KWUB 1ESFA 1XEEA 3MTNB 1VLBA 4URKA 2LUMA 1EF1A 4ARIA 4HJGE 4KVGB 4C80A 2JXTA 1WGGA 2L52A 5TSSA 1PFDA 3CIRB 1XLOA 3L0WB 4HWIB 2JX5A 4JL9A 3HRDD 4NZLB 3Q6BA 2Y5CA 2J0KA 1JWSD 5BYSA 1Q0WB 4IKGA 5BYRA 1XO3A 4NPNA 2W54A 3T3NA 2AL6A 1I4XA 2M19A 1TJEA 1RAXA 4CQNA 1ET6A 2RDBC 4A90A 2W55A 4R3DA 4IWQA 1E0ZA 4KV2A 1NI3A 4Q2JA 3BYTB 4WJPA 4DHZE 1YQBA 3VTUA 4CHKA 1VDVA 3B0AA 1YD8U 3R7RA 1YJIA 5C3JB 1N5XA 2MP2A 4FJZA 2MQJA 1WR1A 3M95A 2KMMA 1E5WA 3U8ZA 5JXVA 2KHWB 2H89B 1J0GA 4IOIE 3IBEA 4S17A 4BVUC 2BYVE 1H4RA 1AW7A 2KJRA 4XX5A 3VUXA 2JZPA 3Q8BA 3QAQA 2UWQA 3RN9C 1IPGA 4MM3A 4PYUA 2O2VA 2GOWA 1XLNA 4YXDB 2FUG1 3M62B 2V3SA 2MLBA 3VFKA 4NNJB 4MJSA 2KJ6A 3DBLB 3KUDB 3WALA 4OW0A 2N1VA 1E6EB 3VVWB 4DXFA 4FADA 3AE8B 1AN8A 4TQ1A 4PS7A 1CQVA 1WGHA 3QC8B 2DZIA 2MHJA 4JX1C 2J4XA 4US8A 2CHXA 2G4DB 2GI9A 2PW9A 1HQRD 3V61A 2KQ4X 4FN2A 4WWOA 2INPE 1BXTA 1TKYA 5H92C 3M63B 3V6CB 3QHTA 4YT0B 3BVZA 4ZYSA 1HA5A 4A55A 3L13A 5EE0A 2W9NA 2LASA 3OJ4B 4KSLC 5IA7A 2DX5B 2WDQB 3A4RA 2KO3A 2CHZA 2RMMA 3KW5B 4HCNB 4WIPA 4M02A 3SEBA 4BBNC 4KZ0A 2B76B 3KYCD 2WXQA 2VZKB 1P98A 2ZCBA 2N1WA 1Y8RC 2LGIA 1WRDB 2KNBA 3NHEB 1MPEA 1JQ4A 3MC8A 3S2AA 3W9CB 1SJHD 4HLEA 4KKJA 1SE9A 4OZCA 3J9CA 1UGMA 3L54A 1KFYB 1WE7A 1FRDA 4OVZA 1V81A 2VH1A 1STEA 2L05A 4YL8A 4ZOHC 3ZDMC 1GUAB 2BB6A 2WDTB 5BMIA 5HG2A 4DDGD 1J7BA 3EHVA 3H9DA 3QX1A 3V6EB 5HI1A 2DZMA 2YEPF 4IWPA 4EZJA 3ZJVA 4XYCA 5LXHA 1CMXB 2C5LC 4L2YA 2HJ1A 3A9KA 1SE3A 2KDBA 2GB1A 2KTRA 2KTFA 1P0RA 4L1BA 1FO4A 2OHFA 1T0QC 5TR5A 3HVDA 3PREA 4ZRPA 3ZKJC 3ZNHB 1LXDA 2C7NB 3BYYB 4P7IA 5BYQA 4E71A 2KXJA 4WURA 3I9V1 3DWGC 3U7DA 1F0ZA 2KOXA 2DZKA 4WJOA 1XT9B 3AEAB 3Q14C 2NVUI 4RGOS 2WNMA 5FKAC 3V3XA 3VR8B 4PS3A 3N1ZC 1GB1A 4ZRIA 2WX1A 1P7FA 4NAWA 3TBLD 1R4NI 3RULA 2M56B 1F77A 3AE5B 2J52A 2N9PC 2KVRA 2WP9B 4M0WA 3RD2A 3ENEA 1VR9A 2WQYB 4DXGA 4B9KA 3M3JA 4L23A 2IO1B 1P7EA 2K8CA 3DVGX 1QT9A 3R8BA 1YN3A 4P16A 2N7JA 1V2YA 4NJCA 5D3IB 2PVOD 5CTRC 3ZIMA 2MEKA 3N3KB 2MA9B 2KX0A 2BTEA 4W9LA 1RRBA 3VAWA 1KF6B 1R4MB 3ZUNA 4DQOC 3OAWA 3PSEB 4OVUA 3R7QA 2J53A 1V80A 2KFKA 2HDEA 4LJOB 4HDOA 1GAQB 1MFWA 4HKZE 4YTNB 4AUQC 1HZ6A 4WQOB 4A3PA 4EZKA 2KQSA 1YMHE 4ZHPA 1JWBD 2MBOA 2BF8B 4AWJA 1WXAA 2YEPB 1XLQA 3HVZA 4NJ7A 1NBFC 1V1PA 4MGIE 3IXSA 2LGXA 2W3SA 3DBSA 2K6QA 1YJJA 4WAFA 3WAPA 3TCAA 1N6ZA 2BQQA 4JWSC 4MSMB 4KX6B 1K8RB 4LNOA 2AQ2B 1LO5D 1PGBA 1L6VA 2EMTA 3BIID 4USAA 4XDCA 2JF5A 4DDID 1GNUA 1NENB 1TS3A 3HHMA 4TUUA 3X23A 2MRPA 1IP9A 2K0PA 2WU5B 1FFUA 1BMLC 4ICUA 2IJ0A 3AE6B 4G50A 3SFDB 3MJ5A 3JW0X 3X0WA 4TQ0A 1L4DB 1MHXA 2PMVA 3U7ZA 1OQRA 3FAHA 3ZXVA 2VZKD 3QK0A 1R7SA 1V1PB 4WJNA 1XCTL 1PQSA 3W5VB 1E7PB 3GE8C 1RYJA 4KIKA 4AJWA 4KGRA 2N0SB 1YQ3B 3GB1A 3RZFA 5BMHA 4JQWC 3TMPB 1V5TA 2GBNA 1D3ZA 3VTVA 5GXGB 5E6JA 1OQQA 2RPVA 4B0MA 4WWPA 5C23A 3L08A 1Q5WB 2FBWB 2REXA 3A33B 1DOIA 2L0FA 4XE0A 2QJLA 1NDDA 4FBJB 5HHDG 2IO2B 3GS2A 2WXNA 4MH0E 2DZJA 2V0GA 4IDIA 3ZRCA 2EELA 2LJ5A 2QCZA 3OG5A 1RFKA 4ZDVA 4KSKC 2LGDA 1L6UA 4JGHB 1SJED 1FXIA 2B3AA 1Q10A 2K9XA 4HVBA 4S0RA 1VZ8A 3SDLC 1E7VA 1V8CA 3BZDB 5AZFA 3Q3MC 3B2FA 3AEEB 3KUZA 2C7MB 4BKTA 3T8MA 1QILA 3P63A 3NJTA 2DLBA 2M17A 2N7DA 4AJYB 3PTFC 1TY2A 3RNGC 3ZYYX 2K39A 1QOAA 3MJWA 3JSVB 1XF5L 4ANUA 1WR6E 3NVZA 2HTHA 3H6NA 3EFUA 4K7UA 3RZWC 4I6PA 1IUEA 2ZJDA 4YSYB 5CX3A 2YVCA 1FNVA 1ET9A 2AYOB 3ETRA 3RCZA 3CWIA 2RDGA 3AI5A 4JIOU 2PE9A 4YWGG 2KK8A 2GRIA 3N1XC 3NS8A 1OTRB 4MSQB 3T9LA 2BS3B 5IO9A 3PS6A 1SGHA 2DHZA 3Q8EA 1C78A 4CO7A 4HJKA 1FPYA 1WMHB 1QZEA 4QAYA 1PGXA 2L76A 1SXTA 1BT0A 4N59A 2Z8LA 4AP4C 1UBQA 1WYGA 2NPTA 4I6NB 4PK1A 3ZGZA 2ZVNA 3WAOA 2JSVX 4DHJD 4RGTA 1T3QA 2DWQA 3RNAC 2NBUA 3AEBB 4NJ6A 4KZCA 2EKEC 3KLSX 1K53A 2WU2B 3APCA 3PHWB 4II3B 2WX0A 4HPPA 4JLCA 2KWCA 5FR6A 3OLMD 5IP4D 3ZQ4A 4W9DA 3AEFB 1GC6A 2PKOA 3ZNID 1K52A 3RNEC 2JUOA 3TEXA 1TT5B 2RDHA 2OJRA 4W9IA 1PDXA 4WWMA 2WXLA 3UI3A 1QF6A 2LRWA 2WXJA 3MP9A 1SEBD 1I42A 3VDZA 1P3QU 3Q8FA 4NAWB 1FNUA 1RM6C 1NYQA 2ON8A 1HZ5A 1EWCA 2MWSB 4G11A 1FM0D 3IT6B 2KN4A 1TIFA 2O6VA 4NAMA 1TGZB 1NYRA 3RYTA 2IGHA 1UUPA 2KWDA 2M1MA 2I1KA 3Q3JA 1DYQA 2KKCA 3AE7B 1TZ1A 2N9XA 2RD0A 2W82A 4JWUC 3I57A 2CJNA 3JYUA 4ZYNA 3PPAA 4B0EA 2ICIA 4MJSB 4LDTB 4WQMA 4WH4A 3MC0B 3MFGA 4HPLB 1V6EA 5IN7A 2K22A 2ACZB 4MM3B 2I2YA 1ZOYB 2H88B 4RGNA 2Z0EB 4RCOA 1R4NB 4GU2A 5KHOA 1MJDA 3DBHI 3N20C 1E7UA 4BOZB 4LNKA 3OWEB 2BS2B 4BOSC 4IWOA 3V60A 3RUIB 2ZW1A 1UGJA 1WI0A 4UDUC 1IYFA 2K1FA 3WAMA 3DOWA 1V1OA 3VH3B 2WXGA 2V1YA 1MI0A 4HKQA 3C8YA 4LNIA 1M94A 2J0MA 3AMZA 3RMKC 3UGBB 4FJYA 3UIOB 2ZCCA 5D7GA 1Z5SB 2AQ1B 1AWDA 2Y3AA 1V86A 1GG3A 2JZZA 3EFCA 4A20A 3O65B 4EOYA 4FJVB 1KLGD 3PZDA 1FRRA 3KH0A 1K51A 4C7ZA 3AV8A 3P4SB 1KM7A 1L0XB 3AU4A 4FXCA 4FHJA 1OEYJ 1A5RA 4LCDE 2E6XA 4GDKA 4ANXA 1I35A 2D07B 1HTOA 1WJ4A 5BO4B 2L3ZA 4G0NB 2BBCA 1ISNA 1V9JA 1JROA 4HPMB 4A3OA 4A9AA 1YNTE 5AZGA 4FHKA 1C3TA 1I4GA 3TEWA 1B9RA 3I63C 4OZBA 3RT3B 3KUCB 2V9HA 4C56C 1C79A 2BT6A 2N7EA 1WX7A 3ZTCA 2N4FA 4LJPB 4JE3B 4M8MA 3APFA 1IBXB 3AB5A 4RFBA 5AUKA 3RI7C 1TZOA 4E74A 2MH7A 1JWMD 2NPTB 3O13A 2DAJA 2MP2B 3QIJA 1TYGB 1X1MA 1UWXA 1CJEA 2BYEA 1C76A 3R2IA 1IGCA 1WY8A 2D11A 2L1AA 3NVVA 3VUYA 3ZNGC 4US9A 1T6BX 4ICVA 1VD2A 1I4RA 1WXQA 4XC2A 1GJZA 1QOFA 3DDCB 1SIJA 2LVOA 3LB8C 2LFIA 4JPSA 2BWFA 1J19A 3URYA 5JHAA 1S1QB 1YN5A 1QKZA 3E56A 2MJEA 1NEKB 3R66C 1N5WA 4M0WB 2XBBC 4TSSA 1AYFA 3BY4B 1WIAA 3ZO5B 4GN1A 4GDLB 2ASQA 1E9MA 1QOGA 2KC2A 3MC9A 2WWZA 2NCNA 3K9OB 1E8ZA 4B95A 2K8HA 4BFRA 2RSUA 2Y5PA 2CU3A 2WXIA 3Q3NC 1R4MI 4KIKB 2AEHA 4YTPB 1EF5A 2PLPA 3QJZA 3U2SC 2GLSA 3KVFB 2JPHA 2FUHB 1WFYA 3CSTA 3ML9A 1LQBA 1FCLA 2ZNVC 3B08A 1UWMA 3NOBA 4MEMA 1QLBB 1FNWA 3GP7A 2IPKD 2PJHA 5BMGA 4KDLB 2AL3A 1KRHA 2JRHA 3H7PB 2LMCA 4WJQA 1F2RI 3DHGC 3Q3FA 1FFVA 4EFOA 4P6VF 4DXAB 3ZTDA 2IYDB 3I5JC 1VCBA 3L17A 1YN4A 2WXHA 4TV3A 5E6NA 3BVGA 2I38A 3AXCA 3B2GA 4XWTA 4DHJB 2O6VB 3AECB 2RGFA 2LXAA 2KQ7A 2AX5A 1ZE3D 1J7CA 4OVVA 3IT4B 2WXFA 3QQ8B 2INDC 1I4HA 1V49A 4GLSC 4LLGM 1L7YA 1UNSA 1PYWD 3PV1A 2MW5A 3WIMA 4ARCA 1EM7A 2X8XX 4RGMA 4ZHOA 3EA6A 1C4CA 3TEZA 1SE4A 2DYOA 4TKNA 1ZDXA 1IGDA 2E3TA 3LDZE 5D94A 1ROEA 2LHDA 4HK2A 3AM9A 3RNFC 1TTNA 4EZLA 4D2KA 2WYQA 1UBIA 1Z2MA 1SE2A 3SU8X 5D6JB 1ZP0B 2WXPA 3ZRFA 4MGKE 3GZNB 3AULA 2WDVB 1JRUA 1E8XA 1XQQA 3CSFA 2KMCA 4REZA 1KJTA 1V97A 1L0YB 1WJ6A 3NY5A 1WE6A 3Q69A 2JT4B 3PHXB 1MG8A 3CF6E 3QCAA 2LJIA 1CZPA 2G3QB 3VTWA 3P2BA 4H2AA 2BYFA 5E6OA 2KD0A 1ZGUB 2J7QB 3QARA 1E10A 3BINA 2CR5A 2HD5B 3K9PB 1WRIA 4K81A 2ZZPB 4TMAB 3V62A 3E9SA 4EKUA 3HUIA 2XNAC 2QEJC 3ZXRA 4XZ4A 2QMTA 5J17A 4X57B 1KH0A 4MDKE 3C19A 3PZ8A 3BWUD 1SIFA 1IBXA 3DBHB 2ZPNA 3Q8AA 1WXVA 5JZEB 1E8WA 4XDDA 1C77A 1LM8B 1D5MC 1GOZA 4HRSA 4HROA 2ZPYA 1WM2A 1F1HA 1ZW7A 4ACFA 4IC7B 1OQYA 4BKSD 4XWWA 2C60A 2R61A 3FILA 3PO0A 4I6LB 4W9GA 3APDA 2NR2A 3VHTC 3AE3B 1SSNA 2G1EA 2FCSA 1N61A 1A70A 3ALBA 1MG4A 1JW9D 3DWMA 3SD5A 2AQ3B 5LLIA 1TS4A 4YSZB 2ZW0A 5G5HA 4GIVA 2WXKA 2NMQA 1VRAB 5DPWA 1ZDVA 2FNJB 2DBYA 2CKHB 2FIDA 2KFKB 3Q2AC 2L00B 5LNK1 4M00A 1WGDA 2MCNB 1WGYA 3NVYA 3LJ3A 3ZNZB 4DHZB 2QC8A 4C4VB 3NZ3A 3AE1B 2V4IB 4N58A 2CS4A 2CU1A 3DBLI 4E3CA 1D6EC 1E8YA 3IG3A 2G4SA 1D5XC 3NZSA 3A1QA 1TBEA 3AU5A 3U30A 2KDIA 2MBEA 3WA0A 2UU7A 3I3TB 5EE9A 2K8BA 4K1RB 4ANWA 1FXAA 3SR6A 3B1LX 3H7SA 3KWLA 1WX8A 5IOIA 3PRMB 3TEYA 3FKYA 2JWZA 3ZLZA 3OJ3A 1OEYA 2TSSA 2FCMA 2D10A 2XK5B 2JZ3B 3Q8CA 4K3CA 1L0VB 4WAAA 3H7PA 2NTSA 1WMHA 3VRBB 4IM2A 2JU6X 2JWUA 3MHSD 1C9FA 3UINB 1QOBA 3NG0A 3LYYA 2HTME 2QHOA 3IHPC 1TY0A 2WXOA 3NZUA 3P1MA 4BZAA 2KANA 3AE4B 1VZ6A 1NI2A 2WGSA 3EGRA 1Q1OA 3L16A 4GB9A 2LI5A 1DOYA 1HE8A 4OHJA 1N62A 1YX6B 2NTTA 4GDLA 4GXBA 4RF1A 2FE8A 1P1AA 2A5UA 3DVNV 2GBJA 1FMAD 3VUWA 1UH6A 4II2B 2RR9A 1VZ7A 2QSDA 2JYEA 2R2QA 3SHQA 2KN5A 2D3CA 2Z59B 3RPFC 5JH5C 1I4PA 2WLBA 1K50A 2NBWB 2YLMA 5J2RA 1PUTA 1SF0A 3HIZA 4P1BC 1N63A 4M8NA 3CMMB 1KTKA 4BKSA 1G6JA 1MHHE 3P4QB 4ZRJA 2EMSA 3HM3A 1ZPSA 2XEWA 1WJUA 4F7ZA 3ONSA 5FR3A 2PVGC 3FILB 5HFYA 1RLFA 3AE9B 3C0RB 4J3OD 5T8IA 2VRRB 5J18A 1TS2A 1OFFA 2BPSA 4GMVA 1KLUD 1XLPA 4RF0A 4YTMB 1L2NA 4CYEA 2JRIB 4J6IA 5AEKB 3GE3C 3DBRI 5C1ZA 4XGAB 2I1JA 2RPQA 4MH8A 4KGSA 2QDFA 2JY6A 2L7RA 1NVID 4FLHA 3W2DA 1YOVB 4BAXA 2HJ8A 4W9EA 1JMLA 3DVNU 3TJPA 2KDFB 2LGSA 1UF0A 4MELA 2M0XA 1XXGA 1QQRA 1YJ1A 2VH2A 3DHHC 4LTUA 4RH6A 2KLCA 1XCQL 1FIQA 3QWZB 3ZJTA 4ASWC 2ZNVB 3W1SA 3PLVA 2R2OA 5FK9C 5CHWA 2O2VB 3DHIC 5G5GA 1YIWA 2MSED 2BYTA 4ANVA 1HTQA 3A9KB 2PE6B 3ECIA 3WANA 1UD7A 2MX2A 2XK5A 1C4AA 5G55A 2LVQA 2JXXA 1HEZE 3NUHB 2BW2A 2L83A 4ZRQA 3R2TA 2INCC 4FULA 2FCNA 3HM6X 1FCCC 3AEGB 1D4BA 4F8CB 4MT5A 2SEBD 2OOBB 5DPRA 5G2NA 3EC8A 4A8XC 5D3DA 3DQVA 3TIXA 4LNNA 5HKHA 2JYTA 2V4LA 1C1YB 3VRAB 4W9JA 3L4PA 2Y5BB 4C4VA 3D32A 3EUB2 3P4RB 2MJ3A 3PGEA 1JRPA 2KACA 3NS1A 2INNE 5LXIB 1DOXA 1EU4A 1FEHA 2XN9C 2FCQA 2KX3A 2LEKA 2V3PA 3N9YC 1WZ3A 3P42A 2KMAA 5E6PA 1EWYC 1L4ZB 1RWSA 2NBVB 3IFWB 4KKIA 2FAZA 3T3OA 2QILA 2PIAA 3QA8A 5IAAC 2KLGA 4DK5A 1P9DU 3IAS1 3N32A 2GBRA 1V5OA 4ITKA 3RFZB 2W3RA 1AARA 1Y56A 2LGYA 5D2MB 1ZXHA 1GB4A 3HK0A 3VH4B 2BS4B 3A1QB 2DYMA 2LRUA 4GOCA 2IY0B 4W9CA 2KTRB 3IVFA 3L10B 4IG7B 1LGRA 2ZEQA 2ZVOA 2DENB 1SB3C 2K25A 4O1NA 2Q5WD 2CHWA 4BBNF 1U4AA 3NRZA 5EE1A 4DWFA 2DNFA 3W5UB 1BUIC 4FA6A 1VJKA 1I7HA 4MACA 5EDSA 2CJOA 4GDKB 2M4NA 2KC1A 5AUIA 1D5ZC 3U52E 1N60A 3RNBC 4RNAA 3WCQA 2WHIA 1XD3B 2GBMA 3BVMA 2KAJA 3ABVB 2MBHA 5DPTA 1J7AA 5MPOA 3RNCC 1L5PA 1WJNA 5I4DA 1CK1A 1ZXIA 4EUTA 1GPXA 2MBQA 1KLVA 1B1ZA 4K3BA 3H8HA 1F2RC 1UZXB 1ENFA 2SAKA 1RFAA 4N6EB 2NS5A 1T0YA 5DCNA 1FD6A 1OGWA 3PRZA 2IO3B 2WXRA 2G9HD 2G45B 4ZRKA 2A4ZA 4W9HA 5L95C 2IGGA 4K7SA 4MGZE 2IDYA 2D2QA 1TKEA 4EE2A 5CHFA 1WXMA 1SBBB 2DAFA 2L32A 4YSXB 5AZHA 4AS1A 3UQAA 2OJWA 1I4QA 3DVGY 3KQ4A 3Q3OC 3N1YC 2D3GA 1FXTB 3A4SC 1WF9A 1KOTA 1E90A 3ML8A 2L8JA 2V3NA 2PPHA 2KDEB 1YQ4B 2KDMA 3PZ7A 4IM3A 2MBBB 2BGFA 3BK1A 2LD9A 3PRPB 2KYWA 4LK0M 1WZ0A 3NVWA 4AQ7A 3PLUA 4LNFA 2D3BA 3UF8A 5H8YE 4K7WA 1WM3A 2KWVB 1JCKB 2LVPA 1GC7A 4BKGA 3AEDB 3ZDTA 1JALA 4WWNA 3V05A 1YX5B 2C7HA 4NQLB 3AE2B 2GBKA 3FC4A 1T0RC 2L0TA 4KGTA 2QIEB 1WXSA 2N9KA 2UYZB 2D3AA 2IY1B 2K5PA 3UQBA 2AWTA 4PT5A 2LXCA 3AH7A 4DBGA 1ZUD2 4AOFA 1LFDA 1WWTA 2BKFA 2K6DB 2IZVB 3SFEB 2K3UA 2DYBA 4HDQA 3JVZX 3PT2B 3TUOA 5L83A 3B9JA 2GMIC 3P4PB 3UIPB 3N30A 4B6WA 2IGDA 4HCPB 2KJHB 5GMVA 4IM0A 3PVLA 3IAM1 5CHVC 3U4EG 3TSSA 4NY0A 2KT7A 1WH3A 1JWUD 3BK2A 2HE7A 2JQRB 4N9F4 4IUMB 1T0SC 2C9WB 3EECA 3DBRB 1EUVB 3GZNI 1F9JA 3DCGA 4EEWA 2LHEA 2LUEA 5DPSA 4RM9A 2WS3B 3LXFA 1EO6A 1T5XD 4KDIC 1DGJA 3KYDD 2Z0DB 1WGKA 4A6QA 4PS8A 4IW0A 2IO0B 2N9EB 3W1SC 1ZKHA 4HXDA 2WXMA 1WSPA 1TKGA 4PYZA 2PTLA 4GGQA 3ZVVA 3VR9B 4HEA1 2BWES 2BVCA 2O6VD 1ACCA 2J0JA 3KWVA 2LWPA 2ONQA 2BKRB 1M4VA 3TL5A 4NQKE 4W9KA 4W9FA 4OZAA
chains in the Genus database with same CATH topology
1MVKA 4MH8A 4KGSA 3BIID 4USAA 2EKIA 1I4RA 4XDCA 1NVID 1WXQA 3W2DA 5C2TB 1QOFA 1NENB 1TS3A 2M0AA 1JWAD 1C4PA 2K0PA 1SIJA 2BB5A 2WU5B 3LB8C 2LFIA 4JPSA 1FFUA 3URYA 3ZJUA 1JMLA 1YN5A 2WDRB 1BMLC 1QKZA 3E56A 2MJEA 1NEKB 2IJ0A 3AE6B 1XXGA 3SFDB 1N5WA 1QQRA 3MJ5A 4TSSA 1AYFA 5EE3A 4TQ0A 1L4DB 1MHXA 4GDLB 2PMVA 4LTUA 3U7ZA 4RH6A 1OQRA 3FAHA 1EU3A 3MHZA 2J42A 1E9MA 1QOGA 1XCQL 1FIQA 2VZKD 3ZJTA 1R7SA 1V1PB 1HXYD 3W1SA 1XCTL 5FK9C 3W5VB 1E7PB 1RYJA 2Y5PA 2CU3A 5G5GA 2WXIA 2BYTA 3AN1A 1PGAA 4KGRA 2N0SB 2OEDA 1YQ3B 3GB1A 2N9LA 5BMHA 1C4AA 4YTPB 4C7YA 2PLPA 3VQIA 3U2SC 2MJDA 2D5GA 1HEZE 3NUHB 2BW2A 2L83A 4ZRQA 2X38A 3R2TA 5GXGB 5E6JA 1OQQA 1TS5A 1FCLA 2RPVA 4B0MA 1UWMA 1ESFA 1XEEA 1QLBB 1FNWA 3GP7A 1FCCC 1VLBA 3AEGB 2IPKD 1D4BA 2FBWB 2LUMA 4MT5A 2SEBD 4ARIA 4A8XC 5D3DA 4HJGE 1DOIA 4C80A 2JXTA 5BMGA 2L52A 1KRHA 5TSSA 4XE0A 2JYTA 2LMCA 1PFDA 3CIRB 1XLOA 3VRAB 2QJLA 2JX5A 3L4PA 1F2RI 3HRDD 5HHDG 4NZLB 3EUB2 3P4RB 2Y5CA 3GS2A 1FFVA 2MJ3A 1JWSD 2WXNA 5BYSA 4IKGA 4P6VF 1JRPA 2KACA 3NS1A 2V0GA 4IDIA 2EELA 1RFKA 2INNE 1YN4A 5BYRA 2WXHA 1XO3A 1DOXA 1EU4A 1FEHA 2W54A 2XN9C 2V3PA 2LEKA 3T3NA 1I4XA 2M19A 1TJEA 3BVGA 1L6UA 4CQNA 1ET6A 1SJED 1FXIA 2I38A 3N9YC 3B2GA 3P42A 4A90A 1Q10A 2K9XA 4XWTA 1EWYC 2W55A 3AECB 1VZ8A 1L4ZB 2AX5A 4R3DA 1E0ZA 1ZE3D 1J7CA 1RWSA 3IT4B 2WXFA 1V8CA 3BZDB 1NI3A 4Q2JA 1I4HA 4GLSC 4KKIA 3BYTB 4LLGM 1UNSA 1PYWD 3T3OA 2QILA 3B2FA 2PIAA 4ARCA 1EM7A 4RGMA 4ZHOA 1VDVA 3EA6A 3AEEB 1C4CA 3TEZA 1SE4A 1YJIA 3IAS1 5C3JB 2DYOA 1N5XA 1ZDXA 1IGDA 2E3TA 4ITKA 3RFZB 2W3RA 1QILA 1ROEA 2KMMA 2LHDA 1Y56A 3AM9A 3P63A 5JXVA 4D2KA 2DLBA 1GB4A 1ZXHA 2H89B 1TY2A 2BS4B 3ZYYX 1SE2A 4IOIE 2DYMA 1ZP0B 1QOAA 2WXPA 1XF5L 1AW7A 3NVZA 1SB3C 2WDVB 4O1NA 2Q5WD 2JZPA 3Q8BA 1IUEA 3NRZA 5EE1A 3W5UB 1BUIC 4YSYB 1VJKA 1XLNA 4YXDB 4REZA 2FUG1 1I7HA 4MACA 1V97A 2CJOA 1FNVA 4GDKB 5AUIA 1D5ZC 1L0YB 1ET9A 3U52E 1N60A 3Q69A 3ETRA 2LJIA 4RNAA 3CWIA 1CZPA 2RDGA 3WCQA 4YWGG 2GRIA 4OW0A 4H2AA 1E6EB 3BVMA 4DXFA 3AE8B 1AN8A 2BS3B 2KAJA 3ABVB 4TQ1A 1CQVA 1E10A 1J7AA 5MPOA 3Q8EA 1C78A 1L5PA 4JX1C 5I4DA 2J4XA 4US8A 1CK1A 2GI9A 1WRIA 2PW9A 1HQRD 1PGXA 4TMAB 3E9SA 1ZXIA 1GPXA 1SXTA 2KQ4X 4N59A 2Z8LA 3HUIA 2INPE 1WYGA 1B1ZA 2XNAC 1BXTA 2QEJC 1TKYA 5H92C 3H8HA 3ZGZA 1F2RC 2QMTA 2JSVX 4RGTA 1KH0A 1ENFA 4YT0B 1T3QA 2DWQA 2SAKA 3BVZA 3BWUD 3PZ8A 1IBXA 4ZYSA 1HA5A 3Q8AA 4A55A 4N6EB 3AEBB 5EE0A 1FD6A 3KLSX 1K53A 2WU2B 1C77A 2WXRA 2G9HD 4XDDA 1D5MC 1GOZA 4HRSA 4HROA 2WDQB 2IGGA 2IDYA 2RMMA 4WIPA 1TKEA 4XWWA 3ZQ4A 3SEBA 2B76B 2WXQA 4EE2A 2VZKB 3AEFB 2PKOA 1SBBB 1K52A 2R61A 3FILA 3PO0A 3TEXA 2RDHA 2L32A 2LGIA 4WWMA 1PDXA 2WXLA 4YSXB 3AE3B 3UI3A 1QF6A 1MPEA 2WXJA 1SSNA 3MP9A 4AS1A 1JQ4A 3W9CB 2G1EA 1SEBD 1N61A 1A70A 1SJHD 3Q8FA 1I4QA 4NAWB 1JW9D 4KKJA 3DWMA 1FNUA 1RM6C 3KQ4A 2AQ3B 4OZCA 3J9CA 1TS4A 4YSZB 2ZW0A 1NYQA 2ON8A 1HZ5A 1EWCA 5G5HA 2WXKA 1KFYB 1FM0D 3IT6B 1FRDA 1VRAB 2KN4A 2NMQA 2V3NA 4OVZA 1YQ4B 1STEA 2KDMA 3PZ7A 4NAMA 4ZOHC 1ZDVA 1NYRA 2DBYA 2BB6A 5BMIA 5HG2A 2IGHA 3BK1A 1UUPA 2KWDA 1J7BA 5LNK1 1DYQA 3AE7B 5HI1A 2YEPF 3NVYA 4LK0M 2W82A 3NVWA 3ZJVA 4JWUC 4AQ7A 3I57A 2CJNA 3NZ3A 3AE1B 2V4IB 4L2YA 4N58A 5H8YE 4B0EA 1SE3A 2ICIA 1JCKB 2GB1A 4L1BA 1FO4A 4WQMA 2OHFA 4WH4A 1D6EC 3MC0B 3AEDB 1D5XC 1JALA 3MFGA 3HVDA 3V05A 2K22A 2ACZB 4MM3B 3AE2B 4ZRPA 3FC4A 3BYYB 2I2YA 1ZOYB 5EE9A 2H88B 5BYQA 4WURA 4KGTA 1FXAA 4RGNA 3I9V1 3DWGC 3SR6A 4RCOA 2QIEB 1F0ZA 3KWLA 3AEAB 2N9KA 4RGOS 2WNMA 3TEYA 5FKAC 3V3XA 3VR8B 1GB1A 3OWEB 1P7FA 2BS2B 2TSSA 2M56B 1F77A 2ZW1A 3AE5B 3Q8CA 2J52A 2K5PA 1L0VB 1UGJA 4PT5A 2WP9B 4UDUC 3AH7A 4M0WA 1ZUD2 2NTSA 1V1OA 3VRBB 2JU6X 2WXGA 2JWUA 1MI0A 1VR9A 4HKQA 3C8YA 2WQYB 4DXGA 1C9FA 3AMZA 1WWTA 1QOBA 3SFEB 4L23A 2HTME 3LYYA 1P7EA 2K3UA 1TY0A 2WXOA 5D7GA 1QT9A 3P1MA 1YN3A 4P16A 2N7JA 3R8BA 3TUOA 2AQ1B 1AWDA 2Y3AA 3AE4B 4NJCA 1VZ6A 5D3IB 2PVOD 3B9JA 3P4PB 3EGRA 1DOYA 2IGDA 1KLGD 2MEKA 4C7ZA 1FRRA 1N62A 1K51A 2NTTA 3AV8A 4OHJA 3IAM1 4RF1A 2FE8A 3TSSA 3U4EG 3P4SB 1L0XB 4FXCA 2BTEA 1JWUD 1FMAD 3BK2A 2JQRB 1VZ7A 2E6XA 2QSDA 2JYEA 1KF6B 2BBCA 4DQOC 3RPFC 1I4PA 1JROA 2J53A 2WLBA 4A9AA 2LHEA 1K50A 1YNTE 2WS3B 1PUTA 1I4GA 1SF0A 3TEWA 3LXFA 4OZBA 1B9RA 2HDEA 1N63A 1GAQB 4YTNB 4HKZE 4C56C 1C79A 1KTKA 1T5XD 1DGJA 2BT6A 1HZ6A 1MHHE 3P4QB 1WGKA 4A6QA 1YMHE 1ZPSA 4ZHPA 4JE3B 1JWBD 2WXMA 1WSPA 1TKGA 5FR3A 2YEPB 2PVGC 3FILB 5HFYA 1IBXB 2PTLA 1XLQA 3AB5A 3VR9B 4RFBA 3HVZA 4HEA1 3AE9B 5AUKA 1TZOA 4J3OD 2MH7A 1V1PA 1JWMD 3O13A 3IXSA 5T8IA 2W3SA 1TYGB 1ACCA 1UWXA 1CJEA 1OFFA 1TS2A 1KLUD 1C76A 1XLPA 3KWVA 1YJJA 3R2IA 4RF0A 1IGCA 4WAFA 4YTMB 2ONQA 4JWSC 1M4VA 2L1AA 3NVVA 4US9A 4KX6B 2AQ2B 1LO5D 1T6BX 1PGBA 4OZAA 1L6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GS2 A;  3IXS A;  3H8H A; 
#chains in the Genus database with same CATH topology
 1MVK A;  2EKI A;  4LDT D;  3A9J A;  3DPD A;  2JVC A;  5C2T B;  1WGR A;  2FIF A;  2M0A A;  4RM8 A;  1JWA D;  1S3S G;  1C4P A;  2BB5 A;  2KVZ A;  4M01 A;  3ZJU A;  2WDR B;  4C00 A;  5KHQ A;  4MGY E;  5EE3 A;  3A9J B;  1UEL A;  3H1U A;  1WYW B;  3JSV A;  1EU3 A;  2M8S A;  2J42 A;  3MHZ A;  4F1S A;  3W1Y A;  1HXY D;  4G3X B;  2LZ6 A;  3AN1 A;  3VXW A;  1PGA A;  4RMA A;  2OED A;  3ZW3 A;  4P1C C;  2PEA A;  2N9L A;  1F52 A;  5IKC M;  3GOE A;  1H8C A;  1WX9 A;  4C7Y A;  3VQI A;  2KZR A;  2MJD A;  5JHB A;  2D5G A;  4GSW A;  2IBI B;  2X38 A;  3R3M A;  1TS5 A;  1J8C A;  2KFJ A;  2KWU B;  1ESF A;  1XEE A;  3MTN B;  1VLB A;  4URK A;  2LUM A;  1EF1 A;  4ARI A;  4HJG E;  4KVG B;  4C80 A;  2JXT A;  1WGG A;  2L52 A;  5TSS A;  1PFD A;  3CIR B;  1XLO A;  3L0W B;  4HWI B;  2JX5 A;  4JL9 A;  3HRD D;  4NZL B;  3Q6B A;  2Y5C A;  2J0K A;  1JWS D;  5BYS A;  1Q0W B;  4IKG A;  5BYR A;  1XO3 A;  4NPN A;  2W54 A;  3T3N A;  2AL6 A;  1I4X A;  2M19 A;  1TJE A;  1RAX A;  4CQN A;  1ET6 A;  2RDB C;  4A90 A;  2W55 A;  4R3D A;  4IWQ A;  1E0Z A;  4KV2 A;  1NI3 A;  4Q2J A;  3BYT B;  4WJP A;  4DHZ E;  1YQB A;  3VTU A;  4CHK A;  1VDV A;  3B0A A;  1YD8 U;  3R7R A;  1YJI A;  5C3J B;  1N5X A;  2MP2 A;  4FJZ A;  2MQJ A;  1WR1 A;  3M95 A;  2KMM A;  1E5W A;  3U8Z A;  5JXV A;  2KHW B;  2H89 B;  1J0G A;  4IOI E;  3IBE A;  4S17 A;  4BVU C;  2BYV E;  1H4R A;  1AW7 A;  2KJR A;  4XX5 A;  3VUX A;  2JZP A;  3Q8B A;  3QAQ A;  2UWQ A;  3RN9 C;  1IPG A;  4MM3 A;  4PYU A;  2O2V A;  2GOW A;  1XLN A;  4YXD B;  2FUG 1;  3M62 B;  2V3S A;  2MLB A;  3VFK A;  4NNJ B;  4MJS A;  2KJ6 A;  3DBL B;  3KUD B;  3WAL A;  4OW0 A;  2N1V A;  1E6E B;  3VVW B;  4DXF A;  4FAD A;  3AE8 B;  1AN8 A;  4TQ1 A;  4PS7 A;  1CQV A;  1WGH A;  3QC8 B;  2DZI A;  2MHJ A;  4JX1 C;  2J4X A;  4US8 A;  2CHX A;  2G4D B;  2GI9 A;  2PW9 A;  1HQR D;  3V61 A;  2KQ4 X;  4FN2 A;  4WWO A;  2INP E;  1BXT A;  1TKY A;  5H92 C;  3M63 B;  3V6C B;  3QHT A;  4YT0 B;  3BVZ A;  4ZYS A;  1HA5 A;  4A55 A;  3L13 A;  5EE0 A;  2W9N A;  2LAS A;  3OJ4 B;  4KSL C;  5IA7 A;  2DX5 B;  2WDQ B;  3A4R A;  2KO3 A;  2CHZ A;  2RMM A;  3KW5 B;  4HCN B;  4WIP A;  4M02 A;  3SEB A;  4BBN C;  4KZ0 A;  2B76 B;  3KYC D;  2WXQ A;  2VZK B;  1P98 A;  2ZCB A;  2N1W A;  1Y8R C;  2LGI A;  1WRD B;  2KNB A;  3NHE B;  1MPE A;  1JQ4 A;  3MC8 A;  3S2A A;  3W9C B;  1SJH D;  4HLE A;  4KKJ A;  1SE9 A;  4OZC A;  3J9C A;  1UGM A;  3L54 A;  1KFY B;  1WE7 A;  1FRD A;  4OVZ A;  1V81 A;  2VH1 A;  1STE A;  2L05 A;  4YL8 A;  4ZOH C;  3ZDM C;  1GUA B;  2BB6 A;  2WDT B;  5BMI A;  5HG2 A;  4DDG D;  1J7B A;  3EHV A;  3H9D A;  3QX1 A;  3V6E B;  5HI1 A;  2DZM A;  2YEP F;  4IWP A;  4EZJ A;  3ZJV A;  4XYC A;  5LXH A;  1CMX B;  2C5L C;  4L2Y A;  2HJ1 A;  3A9K A;  1SE3 A;  2KDB A;  2GB1 A;  2KTR A;  2KTF A;  1P0R A;  4L1B A;  1FO4 A;  2OHF A;  1T0Q C;  5TR5 A;  3HVD A;  3PRE A;  4ZRP A;  3ZKJ C;  3ZNH B;  1LXD A;  2C7N B;  3BYY B;  4P7I A;  5BYQ A;  4E71 A;  2KXJ A;  4WUR A;  3I9V 1;  3DWG C;  3U7D A;  1F0Z A;  2KOX A;  2DZK A;  4WJO A;  1XT9 B;  3AEA B;  3Q14 C;  2NVU I;  4RGO S;  2WNM A;  5FKA C;  3V3X A;  3VR8 B;  4PS3 A;  3N1Z C;  1GB1 A;  4ZRI A;  2WX1 A;  1P7F A;  4NAW A;  3TBL D;  1R4N I;  3RUL A;  2M56 B;  1F77 A;  3AE5 B;  2J52 A;  2N9P C;  2KVR A;  2WP9 B;  4M0W A;  3RD2 A;  3ENE A;  1VR9 A;  2WQY B;  4DXG A;  4B9K A;  3M3J A;  4L23 A;  2IO1 B;  1P7E A;  2K8C A;  3DVG X;  1QT9 A;  3R8B A;  1YN3 A;  4P16 A;  2N7J A;  1V2Y A;  4NJC A;  5D3I B;  2PVO D;  5CTR C;  3ZIM A;  2MEK A;  3N3K B;  2MA9 B;  2KX0 A;  2BTE A;  4W9L A;  1RRB A;  3VAW A;  1KF6 B;  1R4M B;  3ZUN A;  4DQO C;  3OAW A;  3PSE B;  4OVU A;  3R7Q A;  2J53 A;  1V80 A;  2KFK A;  2HDE A;  4LJO B;  4HDO A;  1GAQ B;  1MFW A;  4HKZ E;  4YTN B;  4AUQ C;  1HZ6 A;  4WQO B;  4A3P A;  4EZK A;  2KQS A;  1YMH E;  4ZHP A;  1JWB D;  2MBO A;  2BF8 B;  4AWJ A;  1WXA A;  2YEP B;  1XLQ A;  3HVZ A;  4NJ7 A;  1NBF C;  1V1P A;  4MGI E;  3IXS A;  2LGX A;  2W3S A;  3DBS A;  2K6Q A;  1YJJ A;  4WAF A;  3WAP A;  3TCA A;  1N6Z A;  2BQQ A;  4JWS C;  4MSM B;  4KX6 B;  1K8R B;  4LNO A;  2AQ2 B;  1LO5 D;  1PGB A;  1L6V A;  2EMT A;  3BII D;  4USA A;  4XDC A;  2JF5 A;  4DDI D;  1GNU A;  1NEN B;  1TS3 A;  3HHM A;  4TUU A;  3X23 A;  2MRP A;  1IP9 A;  2K0P A;  2WU5 B;  1FFU A;  1BML C;  4ICU A;  2IJ0 A;  3AE6 B;  4G50 A;  3SFD B;  3MJ5 A;  3JW0 X;  3X0W A;  4TQ0 A;  1L4D B;  1MHX A;  2PMV A;  3U7Z A;  1OQR A;  3FAH A;  3ZXV A;  2VZK D;  3QK0 A;  1R7S A;  1V1P B;  4WJN A;  1XCT L;  1PQS A;  3W5V B;  1E7P B;  3GE8 C;  1RYJ A;  4KIK A;  4AJW A;  4KGR A;  2N0S B;  1YQ3 B;  3GB1 A;  3RZF A;  5BMH A;  4JQW C;  3TMP B;  1V5T A;  2GBN A;  1D3Z A;  3VTV A;  5GXG B;  5E6J A;  1OQQ A;  2RPV A;  4B0M A;  4WWP A;  5C23 A;  3L08 A;  1Q5W B;  2FBW B;  2REX A;  3A33 B;  1DOI A;  2L0F A;  4XE0 A;  2QJL A;  1NDD A;  4FBJ B;  5HHD G;  2IO2 B;  3GS2 A;  2WXN A;  4MH0 E;  2DZJ A;  2V0G A;  4IDI A;  3ZRC A;  2EEL A;  2LJ5 A;  2QCZ A;  3OG5 A;  1RFK A;  4ZDV A;  4KSK C;  2LGD A;  1L6U A;  4JGH B;  1SJE D;  1FXI A;  2B3A A;  1Q10 A;  2K9X A;  4HVB A;  4S0R A;  1VZ8 A;  3SDL C;  1E7V A;  1V8C A;  3BZD B;  5AZF A;  3Q3M C;  3B2F A;  3AEE B;  3KUZ A;  2C7M B;  4BKT A;  3T8M A;  1QIL A;  3P63 A;  3NJT A;  2DLB A;  2M17 A;  2N7D A;  4AJY B;  3PTF C;  1TY2 A;  3RNG C;  3ZYY X;  2K39 A;  1QOA A;  3MJW A;  3JSV B;  1XF5 L;  4ANU A;  1WR6 E;  3NVZ A;  2HTH A;  3H6N A;  3EFU A;  4K7U A;  3RZW C;  4I6P A;  1IUE A;  2ZJD A;  4YSY B;  5CX3 A;  2YVC A;  1FNV A;  1ET9 A;  2AYO B;  3ETR A;  3RCZ A;  3CWI A;  2RDG A;  3AI5 A;  4JIO U;  2PE9 A;  4YWG G;  2KK8 A;  2GRI A;  3N1X C;  3NS8 A;  1OTR B;  4MSQ B;  3T9L A;  2BS3 B;  5IO9 A;  3PS6 A;  1SGH A;  2DHZ A;  3Q8E A;  1C78 A;  4CO7 A;  4HJK A;  1FPY A;  1WMH B;  1QZE A;  4QAY A;  1PGX A;  2L76 A;  1SXT A;  1BT0 A;  4N59 A;  2Z8L A;  4AP4 C;  1UBQ A;  1WYG A;  2NPT A;  4I6N B;  4PK1 A;  3ZGZ A;  2ZVN A;  3WAO A;  2JSV X;  4DHJ D;  4RGT A;  1T3Q A;  2DWQ A;  3RNA C;  2NBU A;  3AEB B;  4NJ6 A;  4KZC A;  2EKE C;  3KLS X;  1K53 A;  2WU2 B;  3APC A;  3PHW B;  4II3 B;  2WX0 A;  4HPP A;  4JLC A;  2KWC A;  5FR6 A;  3OLM D;  5IP4 D;  3ZQ4 A;  4W9D A;  3AEF B;  1GC6 A;  2PKO A;  3ZNI D;  1K52 A;  3RNE C;  2JUO A;  3TEX A;  1TT5 B;  2RDH A;  2OJR A;  4W9I A;  1PDX A;  4WWM A;  2WXL A;  3UI3 A;  1QF6 A;  2LRW A;  2WXJ A;  3MP9 A;  1SEB D;  1I42 A;  3VDZ A;  1P3Q U;  3Q8F A;  4NAW B;  1FNU A;  1RM6 C;  1NYQ A;  2ON8 A;  1HZ5 A;  1EWC A;  2MWS B;  4G11 A;  1FM0 D;  3IT6 B;  2KN4 A;  1TIF A;  2O6V A;  4NAM A;  1TGZ B;  1NYR A;  3RYT A;  2IGH A;  1UUP A;  2KWD A;  2M1M A;  2I1K A;  3Q3J A;  1DYQ A;  2KKC A;  3AE7 B;  1TZ1 A;  2N9X A;  2RD0 A;  2W82 A;  4JWU C;  3I57 A;  2CJN A;  3JYU A;  4ZYN A;  3PPA A;  4B0E A;  2ICI A;  4MJS B;  4LDT B;  4WQM A;  4WH4 A;  3MC0 B;  3MFG A;  4HPL B;  1V6E A;  5IN7 A;  2K22 A;  2ACZ B;  4MM3 B;  2I2Y A;  1ZOY B;  2H88 B;  4RGN A;  2Z0E B;  4RCO A;  1R4N B;  4GU2 A;  5KHO A;  1MJD A;  3DBH I;  3N20 C;  1E7U A;  4BOZ B;  4LNK A;  3OWE B;  2BS2 B;  4BOS C;  4IWO A;  3V60 A;  3RUI B;  2ZW1 A;  1UGJ A;  1WI0 A;  4UDU C;  1IYF A;  2K1F A;  3WAM A;  3DOW A;  1V1O A;  3VH3 B;  2WXG A;  2V1Y A;  1MI0 A;  4HKQ A;  3C8Y A;  4LNI A;  1M94 A;  2J0M A;  3AMZ A;  3RMK C;  3UGB B;  4FJY A;  3UIO B;  2ZCC A;  5D7G A;  1Z5S B;  2AQ1 B;  1AWD A;  2Y3A A;  1V86 A;  1GG3 A;  2JZZ A;  3EFC A;  4A20 A;  3O65 B;  4EOY A;  4FJV B;  1KLG D;  3PZD A;  1FRR A;  3KH0 A;  1K51 A;  4C7Z A;  3AV8 A;  3P4S B;  1KM7 A;  1L0X B;  3AU4 A;  4FXC A;  4FHJ A;  1OEY J;  1A5R A;  4LCD E;  2E6X A;  4GDK A;  4ANX A;  1I35 A;  2D07 B;  1HTO A;  1WJ4 A;  5BO4 B;  2L3Z A;  4G0N B;  2BBC A;  1ISN A;  1V9J A;  1JRO A;  4HPM B;  4A3O A;  4A9A A;  1YNT E;  5AZG A;  4FHK A;  1C3T A;  1I4G A;  3TEW A;  1B9R A;  3I63 C;  4OZB A;  3RT3 B;  3KUC B;  2V9H A;  4C56 C;  1C79 A;  2BT6 A;  2N7E A;  1WX7 A;  3ZTC A;  2N4F A;  4LJP B;  4JE3 B;  4M8M A;  3APF A;  1IBX B;  3AB5 A;  4RFB A;  5AUK A;  3RI7 C;  1TZO A;  4E74 A;  2MH7 A;  1JWM D;  2NPT B;  3O13 A;  2DAJ A;  2MP2 B;  3QIJ A;  1TYG B;  1X1M A;  1UWX A;  1CJE A;  2BYE A;  1C76 A;  3R2I A;  1IGC A;  1WY8 A;  2D11 A;  2L1A A;  3NVV A;  3VUY A;  3ZNG C;  4US9 A;  1T6B X;  4ICV A;  1VD2 A;  1I4R A;  1WXQ A;  4XC2 A;  1GJZ A;  1QOF A;  3DDC B;  1SIJ A;  2LVO A;  3LB8 C;  2LFI A;  4JPS A;  2BWF A;  1J19 A;  3URY A;  5JHA A;  1S1Q B;  1YN5 A;  1QKZ A;  3E56 A;  2MJE A;  1NEK B;  3R66 C;  1N5W A;  4M0W B;  2XBB C;  4TSS A;  1AYF A;  3BY4 B;  1WIA A;  3ZO5 B;  4GN1 A;  4GDL B;  2ASQ A;  1E9M A;  1QOG A;  2KC2 A;  3MC9 A;  2WWZ A;  2NCN A;  3K9O B;  1E8Z A;  4B95 A;  2K8H A;  4BFR A;  2RSU A;  2Y5P A;  2CU3 A;  2WXI A;  3Q3N C;  1R4M I;  4KIK B;  2AEH A;  4YTP B;  1EF5 A;  2PLP A;  3QJZ A;  3U2S C;  2GLS A;  3KVF B;  2JPH A;  2FUH B;  1WFY A;  3CST A;  3ML9 A;  1LQB A;  1FCL A;  2ZNV C;  3B08 A;  1UWM A;  3NOB A;  4MEM A;  1QLB B;  1FNW A;  3GP7 A;  2IPK D;  2PJH A;  5BMG A;  4KDL B;  2AL3 A;  1KRH A;  2JRH A;  3H7P B;  2LMC A;  4WJQ A;  1F2R I;  3DHG C;  3Q3F A;  1FFV A;  4EFO A;  4P6V F;  4DXA B;  3ZTD A;  2IYD B;  3I5J C;  1VCB A;  3L17 A;  1YN4 A;  2WXH A;  4TV3 A;  5E6N A;  3BVG A;  2I38 A;  3AXC A;  3B2G A;  4XWT A;  4DHJ B;  2O6V B;  3AEC B;  2RGF A;  2LXA A;  2KQ7 A;  2AX5 A;  1ZE3 D;  1J7C A;  4OVV A;  3IT4 B;  2WXF A;  3QQ8 B;  2IND C;  1I4H A;  1V49 A;  4GLS C;  4LLG M;  1L7Y A;  1UNS A;  1PYW D;  3PV1 A;  2MW5 A;  3WIM A;  4ARC A;  1EM7 A;  2X8X X;  4RGM A;  4ZHO A;  3EA6 A;  1C4C A;  3TEZ A;  1SE4 A;  2DYO A;  4TKN A;  1ZDX A;  1IGD A;  2E3T A;  3LDZ E;  5D94 A;  1ROE A;  2LHD A;  4HK2 A;  3AM9 A;  3RNF C;  1TTN A;  4EZL A;  4D2K A;  2WYQ A;  1UBI A;  1Z2M A;  1SE2 A;  3SU8 X;  5D6J B;  1ZP0 B;  2WXP A;  3ZRF A;  4MGK E;  3GZN B;  3AUL A;  2WDV B;  1JRU A;  1E8X A;  1XQQ A;  3CSF A;  2KMC A;  4REZ A;  1KJT A;  1V97 A;  1L0Y B;  1WJ6 A;  3NY5 A;  1WE6 A;  3Q69 A;  2JT4 B;  3PHX B;  1MG8 A;  3CF6 E;  3QCA A;  2LJI A;  1CZP A;  2G3Q B;  3VTW A;  3P2B A;  4H2A A;  2BYF A;  5E6O A;  2KD0 A;  1ZGU B;  2J7Q B;  3QAR A;  1E10 A;  3BIN A;  2CR5 A;  2HD5 B;  3K9P B;  1WRI A;  4K81 A;  2ZZP B;  4TMA B;  3V62 A;  3E9S A;  4EKU A;  3HUI A;  2XNA C;  2QEJ C;  3ZXR A;  4XZ4 A;  2QMT A;  5J17 A;  4X57 B;  1KH0 A;  4MDK E;  3C19 A;  3PZ8 A;  3BWU D;  1SIF A;  1IBX A;  3DBH B;  2ZPN A;  3Q8A A;  1WXV A;  5JZE B;  1E8W A;  4XDD A;  1C77 A;  1LM8 B;  1D5M C;  1GOZ A;  4HRS A;  4HRO A;  2ZPY A;  1WM2 A;  1F1H A;  1ZW7 A;  4ACF A;  4IC7 B;  1OQY A;  4BKS D;  4XWW A;  2C60 A;  2R61 A;  3FIL A;  3PO0 A;  4I6L B;  4W9G A;  3APD A;  2NR2 A;  3VHT C;  3AE3 B;  1SSN A;  2G1E A;  2FCS A;  1N61 A;  1A70 A;  3ALB A;  1MG4 A;  1JW9 D;  3DWM A;  3SD5 A;  2AQ3 B;  5LLI A;  1TS4 A;  4YSZ B;  2ZW0 A;  5G5H A;  4GIV A;  2WXK A;  2NMQ A;  1VRA B;  5DPW A;  1ZDV A;  2FNJ B;  2DBY A;  2CKH B;  2FID A;  2KFK B;  3Q2A C;  2L00 B;  5LNK 1;  4M00 A;  1WGD A;  2MCN B;  1WGY A;  3NVY A;  3LJ3 A;  3ZNZ B;  4DHZ B;  2QC8 A;  4C4V B;  3NZ3 A;  3AE1 B;  2V4I B;  4N58 A;  2CS4 A;  2CU1 A;  3DBL I;  4E3C A;  1D6E C;  1E8Y A;  3IG3 A;  2G4S A;  1D5X C;  3NZS A;  3A1Q A;  1TBE A;  3AU5 A;  3U30 A;  2KDI A;  2MBE A;  3WA0 A;  2UU7 A;  3I3T B;  5EE9 A;  2K8B A;  4K1R B;  4ANW A;  1FXA A;  3SR6 A;  3B1L X;  3H7S A;  3KWL A;  1WX8 A;  5IOI A;  3PRM B;  3TEY A;  3FKY A;  2JWZ A;  3ZLZ A;  3OJ3 A;  1OEY A;  2TSS A;  2FCM A;  2D10 A;  2XK5 B;  2JZ3 B;  3Q8C A;  4K3C A;  1L0V B;  4WAA A;  3H7P A;  2NTS A;  1WMH A;  3VRB B;  4IM2 A;  2JU6 X;  2JWU A;  3MHS D;  1C9F A;  3UIN B;  1QOB A;  3NG0 A;  3LYY A;  2HTM E;  2QHO A;  3IHP C;  1TY0 A;  2WXO A;  3NZU A;  3P1M A;  4BZA A;  2KAN A;  3AE4 B;  1VZ6 A;  1NI2 A;  2WGS A;  3EGR A;  1Q1O A;  3L16 A;  4GB9 A;  2LI5 A;  1DOY A;  1HE8 A;  4OHJ A;  1N62 A;  1YX6 B;  2NTT A;  4GDL A;  4GXB A;  4RF1 A;  2FE8 A;  1P1A A;  2A5U A;  3DVN V;  2GBJ A;  1FMA D;  3VUW A;  1UH6 A;  4II2 B;  2RR9 A;  1VZ7 A;  2QSD A;  2JYE A;  2R2Q A;  3SHQ A;  2KN5 A;  2D3C A;  2Z59 B;  3RPF C;  5JH5 C;  1I4P A;  2WLB A;  1K50 A;  2NBW B;  2YLM A;  5J2R A;  1PUT A;  1SF0 A;  3HIZ A;  4P1B C;  1N63 A;  4M8N A;  3CMM B;  1KTK A;  4BKS A;  1G6J A;  1MHH E;  3P4Q B;  4ZRJ A;  2EMS A;  3HM3 A;  1ZPS A;  2XEW A;  1WJU A;  4F7Z A;  3ONS A;  5FR3 A;  2PVG C;  3FIL B;  5HFY A;  1RLF A;  3AE9 B;  3C0R B;  4J3O D;  5T8I A;  2VRR B;  5J18 A;  1TS2 A;  1OFF A;  2BPS A;  4GMV A;  1KLU D;  1XLP A;  4RF0 A;  4YTM B;  1L2N A;  4CYE A;  2JRI B;  4J6I A;  5AEK B;  3GE3 C;  3DBR I;  5C1Z A;  4XGA B;  2I1J A;  2RPQ A;  4MH8 A;  4KGS A;  2QDF A;  2JY6 A;  2L7R A;  1NVI D;  4FLH A;  3W2D A;  1YOV B;  4BAX A;  2HJ8 A;  4W9E A;  1JML A;  3DVN U;  3TJP A;  2KDF B;  2LGS A;  1UF0 A;  4MEL A;  2M0X A;  1XXG A;  1QQR A;  1YJ1 A;  2VH2 A;  3DHH C;  4LTU A;  4RH6 A;  2KLC A;  1XCQ L;  1FIQ A;  3QWZ B;  3ZJT A;  4ASW C;  2ZNV B;  3W1S A;  3PLV A;  2R2O A;  5FK9 C;  5CHW A;  2O2V B;  3DHI C;  5G5G A;  1YIW A;  2MSE D;  2BYT A;  4ANV A;  1HTQ A;  3A9K B;  2PE6 B;  3ECI A;  3WAN A;  1UD7 A;  2MX2 A;  2XK5 A;  1C4A A;  5G55 A;  2LVQ A;  2JXX A;  1HEZ E;  3NUH B;  2BW2 A;  2L83 A;  4ZRQ A;  3R2T A;  2INC C;  4FUL A;  2FCN A;  3HM6 X;  1FCC C;  3AEG B;  1D4B A;  4F8C B;  4MT5 A;  2SEB D;  2OOB B;  5DPR A;  5G2N A;  3EC8 A;  4A8X C;  5D3D A;  3DQV A;  3TIX A;  4LNN A;  5HKH A;  2JYT A;  2V4L A;  1C1Y B;  3VRA B;  4W9J A;  3L4P A;  2Y5B B;  4C4V A;  3D32 A;  3EUB 2;  3P4R B;  2MJ3 A;  3PGE A;  1JRP A;  2KAC A;  3NS1 A;  2INN E;  5LXI B;  1DOX A;  1EU4 A;  1FEH A;  2XN9 C;  2FCQ A;  2KX3 A;  2LEK A;  2V3P A;  3N9Y C;  1WZ3 A;  3P42 A;  2KMA A;  5E6P A;  1EWY C;  1L4Z B;  1RWS A;  2NBV B;  3IFW B;  4KKI A;  2FAZ A;  3T3O A;  2QIL A;  2PIA A;  3QA8 A;  5IAA C;  2KLG A;  4DK5 A;  1P9D U;  3IAS 1;  3N32 A;  2GBR A;  1V5O A;  4ITK A;  3RFZ B;  2W3R A;  1AAR A;  1Y56 A;  2LGY A;  5D2M B;  1ZXH A;  1GB4 A;  3HK0 A;  3VH4 B;  2BS4 B;  3A1Q B;  2DYM A;  2LRU A;  4GOC A;  2IY0 B;  4W9C A;  2KTR B;  3IVF A;  3L10 B;  4IG7 B;  1LGR A;  2ZEQ A;  2ZVO A;  2DEN B;  1SB3 C;  2K25 A;  4O1N A;  2Q5W D;  2CHW A;  4BBN F;  1U4A A;  3NRZ A;  5EE1 A;  4DWF A;  2DNF A;  3W5U B;  1BUI C;  4FA6 A;  1VJK A;  1I7H A;  4MAC A;  5EDS A;  2CJO A;  4GDK B;  2M4N A;  2KC1 A;  5AUI A;  1D5Z C;  3U52 E;  1N60 A;  3RNB C;  4RNA A;  3WCQ A;  2WHI A;  1XD3 B;  2GBM A;  3BVM A;  2KAJ A;  3ABV B;  2MBH A;  5DPT A;  1J7A A;  5MPO A;  3RNC C;  1L5P A;  1WJN A;  5I4D A;  1CK1 A;  1ZXI A;  4EUT A;  1GPX A;  2MBQ A;  1KLV A;  1B1Z A;  4K3B A;  3H8H A;  1F2R C;  1UZX B;  1ENF A;  2SAK A;  1RFA A;  4N6E B;  2NS5 A;  1T0Y A;  5DCN A;  1FD6 A;  1OGW A;  3PRZ A;  2IO3 B;  2WXR A;  2G9H D;  2G45 B;  4ZRK A;  2A4Z A;  4W9H A;  5L95 C;  2IGG A;  4K7S A;  4MGZ E;  2IDY A;  2D2Q A;  1TKE A;  4EE2 A;  5CHF A;  1WXM A;  1SBB B;  2DAF A;  2L32 A;  4YSX B;  5AZH A;  4AS1 A;  3UQA A;  2OJW A;  1I4Q A;  3DVG Y;  3KQ4 A;  3Q3O C;  3N1Y C;  2D3G A;  1FXT B;  3A4S C;  1WF9 A;  1KOT A;  1E90 A;  3ML8 A;  2L8J A;  2V3N A;  2PPH A;  2KDE B;  1YQ4 B;  2KDM A;  3PZ7 A;  4IM3 A;  2MBB B;  2BGF A;  3BK1 A;  2LD9 A;  3PRP B;  2KYW A;  4LK0 M;  1WZ0 A;  3NVW A;  4AQ7 A;  3PLU A;  4LNF A;  2D3B A;  3UF8 A;  5H8Y E;  4K7W A;  1WM3 A;  2KWV B;  1JCK B;  2LVP A;  1GC7 A;  4BKG A;  3AED B;  3ZDT A;  1JAL A;  4WWN A;  3V05 A;  1YX5 B;  2C7H A;  4NQL B;  3AE2 B;  2GBK A;  3FC4 A;  1T0R C;  2L0T A;  4KGT A;  2QIE B;  1WXS A;  2N9K A;  2UYZ B;  2D3A A;  2IY1 B;  2K5P A;  3UQB A;  2AWT A;  4PT5 A;  2LXC A;  3AH7 A;  4DBG A;  1ZUD 2;  4AOF A;  1LFD A;  1WWT A;  2BKF A;  2K6D B;  2IZV B;  3SFE B;  2K3U A;  2DYB A;  4HDQ A;  3JVZ X;  3PT2 B;  3TUO A;  5L83 A;  3B9J A;  2GMI C;  3P4P B;  3UIP B;  3N30 A;  4B6W A;  2IGD A;  4HCP B;  2KJH B;  5GMV A;  4IM0 A;  3PVL A;  3IAM 1;  5CHV C;  3U4E G;  3TSS A;  4NY0 A;  2KT7 A;  1WH3 A;  1JWU D;  3BK2 A;  2HE7 A;  2JQR B;  4N9F 4;  4IUM B;  1T0S C;  2C9W B;  3EEC A;  3DBR B;  1EUV B;  3GZN I;  1F9J A;  3DCG A;  4EEW A;  2LHE A;  2LUE A;  5DPS A;  4RM9 A;  2WS3 B;  3LXF A;  1EO6 A;  1T5X D;  4KDI C;  1DGJ A;  3KYD D;  2Z0D B;  1WGK A;  4A6Q A;  4PS8 A;  4IW0 A;  2IO0 B;  2N9E B;  3W1S C;  1ZKH A;  4HXD A;  2WXM A;  1WSP A;  1TKG A;  4PYZ A;  2PTL A;  4GGQ A;  3ZVV A;  3VR9 B;  4HEA 1;  2BWE S;  2BVC A;  2O6V D;  1ACC A;  2J0J A;  3KWV A;  2LWP A;  2ONQ A;  2BKR B;  1M4V A;  3TL5 A;  4NQK E;  4W9K A;  4W9F A;  4OZA A; 
#chains in the Genus database with same CATH homology
 1MVK A;  4MH8 A;  4KGS A;  3BII D;  4USA A;  2EKI A;  1I4R A;  4XDC A;  1NVI D;  1WXQ A;  3W2D A;  5C2T B;  1QOF A;  1NEN B;  1TS3 A;  2M0A A;  1JWA D;  1C4P A;  2K0P A;  1SIJ A;  2BB5 A;  2WU5 B;  3LB8 C;  2LFI A;  4JPS A;  1FFU A;  3URY A;  3ZJU A;  1JML A;  1YN5 A;  2WDR B;  1BML C;  1QKZ A;  3E56 A;  2MJE A;  1NEK B;  2IJ0 A;  3AE6 B;  1XXG A;  3SFD B;  1N5W A;  1QQR A;  3MJ5 A;  4TSS A;  1AYF A;  5EE3 A;  4TQ0 A;  1L4D B;  1MHX A;  4GDL B;  2PMV A;  4LTU A;  3U7Z A;  4RH6 A;  1OQR A;  3FAH A;  1EU3 A;  3MHZ A;  2J42 A;  1E9M A;  1QOG A;  1XCQ L;  1FIQ A;  2VZK D;  3ZJT A;  1R7S A;  1V1P B;  1HXY D;  3W1S A;  1XCT L;  5FK9 C;  3W5V B;  1E7P B;  1RYJ A;  2Y5P A;  2CU3 A;  5G5G A;  2WXI A;  2BYT A;  3AN1 A;  1PGA A;  4KGR A;  2N0S B;  2OED A;  1YQ3 B;  3GB1 A;  2N9L A;  5BMH A;  1C4A A;  4YTP B;  4C7Y A;  2PLP A;  3VQI A;  3U2S C;  2MJD A;  2D5G A;  1HEZ E;  3NUH B;  2BW2 A;  2L83 A;  4ZRQ A;  2X38 A;  3R2T A;  5GXG B;  5E6J A;  1OQQ A;  1TS5 A;  1FCL A;  2RPV A;  4B0M A;  1UWM A;  1ESF A;  1XEE A;  1QLB B;  1FNW A;  3GP7 A;  1FCC C;  1VLB A;  3AEG B;  2IPK D;  1D4B A;  2FBW B;  2LUM A;  4MT5 A;  2SEB D;  4ARI A;  4A8X C;  5D3D A;  4HJG E;  1DOI A;  4C80 A;  2JXT A;  5BMG A;  2L52 A;  1KRH A;  5TSS A;  4XE0 A;  2JYT A;  2LMC A;  1PFD A;  3CIR B;  1XLO A;  3VRA B;  2QJL A;  2JX5 A;  3L4P A;  1F2R I;  3HRD D;  5HHD G;  4NZL B;  3EUB 2;  3P4R B;  2Y5C A;  3GS2 A;  1FFV A;  2MJ3 A;  1JWS D;  2WXN A;  5BYS A;  4IKG A;  4P6V F;  1JRP A;  2KAC A;  3NS1 A;  2V0G A;  4IDI A;  2EEL A;  1RFK A;  2INN E;  1YN4 A;  5BYR A;  2WXH A;  1XO3 A;  1DOX A;  1EU4 A;  1FEH A;  2W54 A;  2XN9 C;  2V3P A;  2LEK A;  3T3N A;  1I4X A;  2M19 A;  1TJE A;  3BVG A;  1L6U A;  4CQN A;  1ET6 A;  1SJE D;  1FXI A;  2I38 A;  3N9Y C;  3B2G A;  3P42 A;  4A90 A;  1Q10 A;  2K9X A;  4XWT A;  1EWY C;  2W55 A;  3AEC B;  1VZ8 A;  1L4Z B;  2AX5 A;  4R3D A;  1E0Z A;  1ZE3 D;  1J7C A;  1RWS A;  3IT4 B;  2WXF A;  1V8C A;  3BZD B;  1NI3 A;  4Q2J A;  1I4H A;  4GLS C;  4KKI A;  3BYT B;  4LLG M;  1UNS A;  1PYW D;  3T3O A;  2QIL A;  3B2F A;  2PIA A;  4ARC A;  1EM7 A;  4RGM A;  4ZHO A;  1VDV A;  3EA6 A;  3AEE B;  1C4C A;  3TEZ A;  1SE4 A;  1YJI A;  3IAS 1;  5C3J B;  2DYO A;  1N5X A;  1ZDX A;  1IGD A;  2E3T A;  4ITK A;  3RFZ B;  2W3R A;  1QIL A;  1ROE A;  2KMM A;  2LHD A;  1Y56 A;  3AM9 A;  3P63 A;  5JXV A;  4D2K A;  2DLB A;  1GB4 A;  1ZXH A;  2H89 B;  1TY2 A;  2BS4 B;  3ZYY X;  1SE2 A;  4IOI E;  2DYM A;  1ZP0 B;  1QOA A;  2WXP A;  1XF5 L;  1AW7 A;  3NVZ A;  1SB3 C;  2WDV B;  4O1N A;  2Q5W D;  2JZP A;  3Q8B A;  1IUE A;  3NRZ A;  5EE1 A;  3W5U B;  1BUI C;  4YSY B;  1VJK A;  1XLN A;  4YXD B;  4REZ A;  2FUG 1;  1I7H A;  4MAC A;  1V97 A;  2CJO A;  1FNV A;  4GDK B;  5AUI A;  1D5Z C;  1L0Y B;  1ET9 A;  3U52 E;  1N60 A;  3Q69 A;  3ETR A;  2LJI A;  4RNA A;  3CWI A;  1CZP A;  2RDG A;  3WCQ A;  4YWG G;  2GRI A;  4OW0 A;  4H2A A;  1E6E B;  3BVM A;  4DXF A;  3AE8 B;  1AN8 A;  2BS3 B;  2KAJ A;  3ABV B;  4TQ1 A;  1CQV A;  1E10 A;  1J7A A;  5MPO A;  3Q8E A;  1C78 A;  1L5P A;  4JX1 C;  5I4D A;  2J4X A;  4US8 A;  1CK1 A;  2GI9 A;  1WRI A;  2PW9 A;  1HQR D;  1PGX A;  4TMA B;  3E9S A;  1ZXI A;  1GPX A;  1SXT A;  2KQ4 X;  4N59 A;  2Z8L A;  3HUI A;  2INP E;  1WYG A;  1B1Z A;  2XNA C;  1BXT A;  2QEJ C;  1TKY A;  5H92 C;  3H8H A;  3ZGZ A;  1F2R C;  2QMT A;  2JSV X;  4RGT A;  1KH0 A;  1ENF A;  4YT0 B;  1T3Q A;  2DWQ A;  2SAK A;  3BVZ A;  3BWU D;  3PZ8 A;  1IBX A;  4ZYS A;  1HA5 A;  3Q8A A;  4A55 A;  4N6E B;  3AEB B;  5EE0 A;  1FD6 A;  3KLS X;  1K53 A;  2WU2 B;  1C77 A;  2WXR A;  2G9H D;  4XDD A;  1D5M C;  1GOZ A;  4HRS A;  4HRO A;  2WDQ B;  2IGG A;  2IDY A;  2RMM A;  4WIP A;  1TKE A;  4XWW A;  3ZQ4 A;  3SEB A;  2B76 B;  2WXQ A;  4EE2 A;  2VZK B;  3AEF B;  2PKO A;  1SBB B;  1K52 A;  2R61 A;  3FIL A;  3PO0 A;  3TEX A;  2RDH A;  2L32 A;  2LGI A;  4WWM A;  1PDX A;  2WXL A;  4YSX B;  3AE3 B;  3UI3 A;  1QF6 A;  1MPE A;  2WXJ A;  1SSN A;  3MP9 A;  4AS1 A;  1JQ4 A;  3W9C B;  2G1E A;  1SEB D;  1N61 A;  1A70 A;  1SJH D;  3Q8F A;  1I4Q A;  4NAW B;  1JW9 D;  4KKJ A;  3DWM A;  1FNU A;  1RM6 C;  3KQ4 A;  2AQ3 B;  4OZC A;  3J9C A;  1TS4 A;  4YSZ B;  2ZW0 A;  1NYQ A;  2ON8 A;  1HZ5 A;  1EWC A;  5G5H A;  2WXK A;  1KFY B;  1FM0 D;  3IT6 B;  1FRD A;  1VRA B;  2KN4 A;  2NMQ A;  2V3N A;  4OVZ A;  1YQ4 B;  1STE A;  2KDM A;  3PZ7 A;  4NAM A;  4ZOH C;  1ZDV A;  1NYR A;  2DBY A;  2BB6 A;  5BMI A;  5HG2 A;  2IGH A;  3BK1 A;  1UUP A;  2KWD A;  1J7B A;  5LNK 1;  1DYQ A;  3AE7 B;  5HI1 A;  2YEP F;  3NVY A;  4LK0 M;  2W82 A;  3NVW A;  3ZJV A;  4JWU C;  4AQ7 A;  3I57 A;  2CJN A;  3NZ3 A;  3AE1 B;  2V4I B;  4L2Y A;  4N58 A;  5H8Y E;  4B0E A;  1SE3 A;  2ICI A;  1JCK B;  2GB1 A;  4L1B A;  1FO4 A;  4WQM A;  2OHF A;  4WH4 A;  1D6E C;  3MC0 B;  3AED B;  1D5X C;  1JAL A;  3MFG A;  3HVD A;  3V05 A;  2K22 A;  2ACZ B;  4MM3 B;  3AE2 B;  4ZRP A;  3FC4 A;  3BYY B;  2I2Y A;  1ZOY B;  5EE9 A;  2H88 B;  5BYQ A;  4WUR A;  4KGT A;  1FXA A;  4RGN A;  3I9V 1;  3DWG C;  3SR6 A;  4RCO A;  2QIE B;  1F0Z A;  3KWL A;  3AEA B;  2N9K A;  4RGO S;  2WNM A;  3TEY A;  5FKA C;  3V3X A;  3VR8 B;  1GB1 A;  3OWE B;  1P7F A;  2BS2 B;  2TSS A;  2M56 B;  1F77 A;  2ZW1 A;  3AE5 B;  3Q8C A;  2J52 A;  2K5P A;  1L0V B;  1UGJ A;  4PT5 A;  2WP9 B;  4UDU C;  3AH7 A;  4M0W A;  1ZUD 2;  2NTS A;  1V1O A;  3VRB B;  2JU6 X;  2WXG A;  2JWU A;  1MI0 A;  1VR9 A;  4HKQ A;  3C8Y A;  2WQY B;  4DXG A;  1C9F A;  3AMZ A;  1WWT A;  1QOB A;  3SFE B;  4L23 A;  2HTM E;  3LYY A;  1P7E A;  2K3U A;  1TY0 A;  2WXO A;  5D7G A;  1QT9 A;  3P1M A;  1YN3 A;  4P16 A;  2N7J A;  3R8B A;  3TUO A;  2AQ1 B;  1AWD A;  2Y3A A;  3AE4 B;  4NJC A;  1VZ6 A;  5D3I B;  2PVO D;  3B9J A;  3P4P B;  3EGR A;  1DOY A;  2IGD A;  1KLG D;  2MEK A;  4C7Z A;  1FRR A;  1N62 A;  1K51 A;  2NTT A;  3AV8 A;  4OHJ A;  3IAM 1;  4RF1 A;  2FE8 A;  3TSS A;  3U4E G;  3P4S B;  1L0X B;  4FXC A;  2BTE A;  1JWU D;  1FMA D;  3BK2 A;  2JQR B;  1VZ7 A;  2E6X A;  2QSD A;  2JYE A;  1KF6 B;  2BBC A;  4DQO C;  3RPF C;  1I4P A;  1JRO A;  2J53 A;  2WLB A;  4A9A A;  2LHE A;  1K50 A;  1YNT E;  2WS3 B;  1PUT A;  1I4G A;  1SF0 A;  3TEW A;  3LXF A;  4OZB A;  1B9R A;  2HDE A;  1N63 A;  1GAQ B;  4YTN B;  4HKZ E;  4C56 C;  1C79 A;  1KTK A;  1T5X D;  1DGJ A;  2BT6 A;  1HZ6 A;  1MHH E;  3P4Q B;  1WGK A;  4A6Q A;  1YMH E;  1ZPS A;  4ZHP A;  4JE3 B;  1JWB D;  2WXM A;  1WSP A;  1TKG A;  5FR3 A;  2YEP B;  2PVG C;  3FIL B;  5HFY A;  1IBX B;  2PTL A;  1XLQ A;  3AB5 A;  3VR9 B;  4RFB A;  3HVZ A;  4HEA 1;  3AE9 B;  5AUK A;  1TZO A;  4J3O D;  2MH7 A;  1V1P A;  1JWM D;  3O13 A;  3IXS A;  5T8I A;  2W3S A;  1TYG B;  1ACC A;  1UWX A;  1CJE A;  1OFF A;  1TS2 A;  1KLU D;  1C76 A;  1XLP A;  3KWV A;  1YJJ A;  3R2I A;  4RF0 A;  1IGC A;  4WAF A;  4YTM B;  2ONQ A;  4JWS C;  1M4V A;  2L1A A;  3NVV A;  4US9 A;  4KX6 B;  2AQ2 B;  1LO5 D;  1T6B X;  1PGB A;  4OZA A;  1L6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...