3H8UA

Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
122
structure length
121
Chain Sequence
VNMRAETESRIFSVDEYVRPSNGEPIRSVVLETNDSVVVVWHAHPGQEIASHHPHGQDTWTVISGEAEYHQGNGIVTHLKAGDIAIAKPGQVHGAMNSGPEPFIFVSVVAPGNAGFALAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein with double-stranded beta-
publication title Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (YP_001338853.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.80 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Structural genomics, unknown function
total genus 19
structure length 121
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h8uA00
1CGPA 3R6SA 4BH9A 2BYVE 2IXIA 5D1IA 4HSJA 2XKOA 3ST7A 1O3SA 3I7DA 5BY5A 3CJXA 1RUNA 1EY2A 3KGLA 5E16A 2EVXA 1X8MA 3PLQA 5EFUA 3HIFA 4BIFA 4F8AA 4BYYA 2BNOA 2BNNA 3D0JA 3IIAA 1DZRA 1QXJA 4Q0UA 1J3QA 1CAVA 4LLOA 2QNKA 3IDCB 1XE8A 1VJ2A 3MZHA 4Q29A 3FFQA 3KGZA 2HKXA 1H1MA 2QCSB 3SMHA 2V09A 3HT2A 1ZZ6A 3EO6A 1DZTA 2BEOA 4F7ZA 1WLTA 4XF4A 2PA7A 1DGWA 3JZVA 5I0SA 2IXKA 4WBBA 3L2HA 5JAXA 2PHLA 1OMIA 4AQ2A 2WFPA 4AXOA 4MGZE 2C0ZA 2CAUA 3BCWA 4O9GA 4A2UA 4OLLA 1RUOA 1Q43A 3DV8A 4QGNA 4P9GA 1EP0A 4I0BA 4QGLA 4MV2A 3LA2A 4LA3A 4XFFA 2XGXA 4Q0VA 2XL9A 3OTFA 2H6BA 4HZFA 2GU9A 4IERA 3PNAA 2I45A 3TNPB 3UKTA 1J3PA 3H1WA 3NW4A 2OZ6A 1QY4A 2PAEA 2BGCA 2CV6A 1ZZ9A 1ZRFA 1O3RA 3H9AA 4FBFA 3BB6A 2IXLA 4XFCA 2Y0OA 5CVRA 2GC0A 2O1QA 4UBHA 4IEQA 2MPFA 5JCTA 1Y9QA 2D93A 1UIJA 2GZWA 4JV4A 4X6QB 2VQAA 2XLAA 1ZNPA 4KU8A 3SXWA 3E5QA 1RC6A 1ZZ7A 2D5HA 2H6CA 5JSOA 4UBGA 3IBMA 1CAUB 4XFBA 3FWEA 4QM9A 3ZDSA 4FAGA 3H7JA 4IEPA 2PYTA 4JVAA 3DKWA 2PTMA 2IXJA 1YFXA 2P17A 1ZZCA 3N4MA 5BXXA 1EPZA 1YWKA 4XF0A 3NVCA 4HLTA 1X82A 2UY8A 3B02A 3SCGA 4BHPA 3RYRA 2F4PA 3FHIB 2D40A 1LKNA 2XHKA 3GYDA 2XLGA 4AVAA 1Q5OA 4J1XA 5LRRA 4E2GA 4L11A 2XL7A 4KWKA 4GULA 1WGPA 5FLJA 4MUVA 5JSRA 3E5UA 3ETQA 1FXZA 3PVBB 5FLIA 2Q4SA 2GC3A 1NYWA 1CAXA 1XE7A 4LEJA 1ZZBA 3MPBA 3OGJA 4HN0A 4IEVA 4DINB 4ZU7A 1YFUA 4J1WA 1ZZ8A 2B8MA 3TNQA 1EYBA 1O7FA 5KHHA 5KHJA 3WW2A 3H3ZA 3KMHA 4OFGA 2IC1A 2ET7A 3FZ3A 4IEOA 2IXCA 3U10A 3EJKA 4EWAA 2K0GA 4FAHA 4MGIE 3O14A 4HVRA 5J48A 5J3UA 3VHRA 2N7GA 4R52A 2FQPA 1X8EA 1Q3EA 4YNIA 4HVOA 3LWCA 1G6NA 4NVPA 2Q0AA 4JTOA 4AVBA 4B29A 3U0ZA 3OD0A 3ACLA 4UXAA 2DCTA 2MHFA 4QX5A 4L2NA 4K8FA 5KHKA 1V70A 1CAVB 1X7NA 1O4TA 2MNGA 3NKTA 1RGSA 1IPJA 4IEWA 4HVQA 2EAAA 3NJZA 3RYKA 5FPZA 3CL1A 3WW1A 4HBNA 1YHFA 4ZU4A 1VP6A 1GQGA 3FX3A 3RZZA 4IEYA 1I6XA 1YUDA 4XF9A 2KXLA 5BV6A 1GQHA 4E2QA 1O5LA 3E6BA 2ET1A 5J7MA 1O3QA 4WVZA 3HQXA 5HI0A 4LA2A 5CU1A 1YFWA 2GAUA 5FDBA 3DL3A 4IEUA 4ONUA 4LUMA 3FE5A 3UKNA 4IESA 1NE4A 2OA2A 3QOPA 5CADA 3GBFA 1LRHA 4QM8A 4PIXA 3D82A 4XETA 2GC1A 4Q0PA 3G7DA 4R8HA 3S7EA 3LOIA 1UD1A 3CLPA 3DN7A 1IPKA 5FQ0B 2EA7A 2QVSB 1O3TA 1O5UA 3MYXA 4RD7A 1ZX5A 3IWZA 3E97A 5I91A 5I0RA 3NSTA 4PIYA 2VPVA 3BALA 3RYPA 4META 2UYAA 1UPIA 4XFIA 2OZJA 1J58A 3SCHA 4ZU5A 2VECA 4D7TA 4XEZA 1ZVFA 1ZRCA 1HW5A 2H0VA 4MH0E 1DGRA 5EZWA 1PM7A 3I54A 3HT1A 4QXKA 3D0SA 4I3PA 1CAWA 1LB2A 3SHRA 4QGMA 4CYDA 2OYZA 3I59B 4XF1A 5T3NA 4AVCA 3H1YA 4IEXA 2GH2A 5LEJA 4TLFA 3S0MA 4XFAA 3RDIA 4N9IA 5FCCA 5KBFA 4KL1A 2OPKA 4PJYA 1L3JA 2Q1ZB 2XKPA 3S7IA 4MZUA 4X6RB 1RL3A 4LTAA 1JUHA 1FI2A 2PHDA 1SEFA 4I2OA 3EQEA 5LEKA 1XRUA 3EBRA 4IETA 3WW4A 1ZREA 2FMYA 1Y3TA 1NE6A 3EHKA 2GC2A 3OF1A 3LAGA 3ROUA 4EROA 1J59A 4Z07A 3MDPA 4Q0SA 3IDBB 5I8TA 3QACA 2ZCWA 2B9UA 1CAXB 5F1RA 2D5FA 5I8SA 3H7YA 3SCFA 1OI6A 2BNMA 5C8WA 1QWRA 4AQ6A 1TQ5A 3ES4A 3E6DA 3KCCA 4I0AA 3RPQA 4LULA 3USSA 5FPXA 3LA3A 5I0UA 1H1IA 4Z82A 5I0TA 2QJVA 5FLHA 4XFHA 2K9ZA 1CX4A 2O8QA 2ZKLA 5K8SA 1SFNA 4XF3A 5JR7B 5I93A 1FT9A 2Q30A 1ZRRA 1OFNA 4YRDA 4HSLA 2Z69A 1PMIA 3ELNA 5LRSA 3UKVA 4YYOA 3E6CC 1UCXA 1J3RA 2CAVA 2UY9A 3CEWA 2PQQA 1QXRA 4PIZA 5FQ0A 2PAMA 3H8UA 1CAUA 5BUVA 2ATFA 4YARA 4XFGA 3KSCA 4ORFA 4Q0QA 1U12A 5KHGA 4WZCA 2PFWA 2HJIA 4N9HA 4O9EA 4YSFA 5BPXA 4LUKA 3U11A 4EWEA 5I8YA 4HN1A 4KWJA 2B5HA 3C3VA 1WA4A 2PAKA 1UIKA 3BU7A 2IXHA 5JSPA 1J1LA 1VR3A 1UW8A 4EWDA 4I01A 3CO2A 4MX3A 4MGYE 1NXMA 4E2SA 2Z2SB 3I59A 5E1RA 4KU7A 2XLFA 1SQ4A 5C6CA 4H7LA 3ES1A 1RTVA 3LA7A 5KHIA 2WC2A 4D7SA 3CF6E 4JTNA 2QDRA 1NZCA 3H50A 3H3UA 4I09A 3H1MA 1YFYA 4MGKE 2CGPA 1OD5A 3RNSA 1ZRDA 4HMZA 3WW3A 3M3IA 3OCPA 2ETEA 4I02A 4IEZA 4KWLA 1I5ZA 4EV0A 2UYBA 3E5XA 3BPZA 1LR5A 4QMAA 3NL1A 3LZZA 4FT8A 1YLLA 5AVPA 3M70A 1CAWB 3FJSA 2E9QA
chains in the Genus database with same CATH superfamily
1CGPA 3VKMA 5JOYA 4D94A 4CDQA 4LBQA 4P5YA 3WNNA 5D1IA 1OOPB 2XKOA 3ST7A 3WQBA 2NN8A 1B35B 1X50A 1VMFA 3TN92 5C4WC 5JMOA 5BY5A 1J1TA 5C3PA 4JX0A 4XYXA 1N3QA 1ONAA 1ULGA 1GP6A 2ZS6B 2JD4A 3ZXLA 1RUNA 1UKGA 1EY2A 2XXZA 5E16A 2A5ZA 4S2GA 3PLQA 1QOSA 4Y5TA 5DDJ1 3WDUA 4RHV3 5LBEA 4WM8C 4FPEA 4M4PA 3DYOA 1ND3C 1TZOA 3KS7A 1LU1A 1QH7A 1Z0HA 2DUOA 5HXMA 2VW1A 4Q4Y2 1XE8A 5L7OA 5ISLA 3MZHA 2VZUA 1N1VA 4LPLA 4P9IA 3ZFFA 1LHOA 4BQYA 4R9AA 4FO9A 2R041 2V09A 3HT2A 4K1ZA 3EO6A 4MO3M 4Q4V3 4QPYA 5FMBA 4IDZA 2P3JA 1UMZA 4W6WA 3ETPA 4F7ZA 1HDKA 5KXCA 1RXFA 5T5LA 1GFF2 3ACGA 3VBRC 1DP0A 1QJU3 2IXKA 4WBBA 5I0SA 1CVNA 3AYEA 3CMGA 2HWE2 1OMIA 4AQ2A 1DLCA 2BUKA 4BZ4A 4MGZE 3B93A 1KGYA 2P3KA 4RN5A 2SLIA 5D8AC 4O9GA 1R1A1 4A2UA 1UOJA 3T0BA 5JPMB 1BBT3 4DXRA 1QQP3 4XC9A 1W28A 1ULFA 2QE3A 2RS31 3ZDVA 3NNLA 1WKYA 2WQ4A 4QGNA 4UW3A 1EP0A 4I0BA 4UFKA 5T54A 1UY0A 3D3AA 1JZ5A 1TEIA 3WP3A 1VRH3 4P5HA 2CWMA 4CPBD 2BBVA 1Y4WA 3WY6A 4CDXB 1QKQA 4IV1A 1NUKA 4AVSA 1FOD1 3DPRC 2FDHA 3OTFA 4YZ5A 4MHUA 3OPZA 4R9DA 2PAEA 2CV6A 3LQCA 1NQDA 1ZRFA 3KQ4B 5GLWA 5IVFA 1KD7A 3H9AA 3BPSA 4O61A 2B45X 1NCRA 2IXLA 1SCSA 4PCRA 4FOQA 4QPIC 2DF7A 3VD9A 2R1BA 1WLDA 5CVRA 2EXIA 4D3WA 5FUIA 2X5IA 2Y6HA 3UJQA 1Z78A 4GWNA 2Y6LA 4CUGA 4IEQA 3MV11 4UW4A 1D4VB 3CNAA 1OQDA 3ZXGA 4A7KA 4AE2A 1F5JA 2HWC1 2WJSA 3Q8CA 3D5OA 3UV9A 2JG8B 4KG8A 1OA4A 4UBGA 3BUCA 5JZGC 2KA3A 1GWMA 3AYAA 4CCEA 1VE0A 1DLLA 4ARYA 2PYTA 4P9JA 3J4UH 3ZN6B 4LLFA 4GXLA 1H8TA 3MIBA 3ZMNA 1JMUB 5DN2A 1YFXA 5IK4A 2P17A 2HYKA 1A78A 4XF0A 1YWKA 1DHKB 1HV0A 1Q8OA 4GJZA 5FP4A 3NVCA 2CDPA 4URTA 2R061 4GIQA 4NWWA 3B02A 1Z7S3 1UWWA 5IK7A 3GYDA 1AR73 2XLGA 3GBGA 1W8ZA 2VY0A 4LKEA 4KH9A 4BXFA 1UOBA 3I49A 4CCLA 3X29B 4MUVA 3THCA 4RHV2 3E5UA 1EUUA 3K3OA 4PBOA 1V6MA 4DY5A 1S0CA 4A3ZA 3R05A 3Q8AA 4TTGA 1UZYA 2B42B 3PVBB 3P3NA 4Y3OA 2GC3A 4YGEA 1XQNA 2GMEA 3MIEA 4LEJA 2P5BA 4AR2A 4X8PA 3RWKX 3SITA 3O12A 4FTEA 3I2JA 4XQWA 4HN0A 4Q4V2 4EQVA 3POEA 3ZVXA 4D8MA 3KQRA 5HCFA 2B8MA 3INAA 3TNQA 2RJLA 2DUQA 3B94A 1QJU2 5KHHA 4ES9A 2P34A 5EXOA 4GH4B 5FZ4A 1IHMA 2ET7A 4MXWA 2VUDA 2YGMA 4P02B 4XZUG 4K7JA 2PLV2 3U10A 3AMQA 3NQHA 1H9WA 5TSWA 3J26N 5DZGA 4EWAA 4HANA 4M0NA 4UWDA 3WG4A 1BBT2 1QQP2 3MEPA 2EIEA 3TEXA 3WX5A 5FUNA 4CP2A 1HRV3 4AEJA 1V00A 1JUIA 1OF3A 4YW7A 3WNOA 1NQJA 1JU4A 2WNUB 1ODNA 2A1XA 4XBNA 3AZYA 5C7GA 1KQRA 3AL5A 3HR9A 1VRH2 2DYCA 1I1EA 4TZDA 1X8EA 3I2KA 1V9U1 5F3GA 3ACIA 3T0DA 2F17A 1MZEA 3T2TA 1OH3A 1NCQB 1PHMA 1WD3A 2D44A 5FFOC 4LHSA 1S2KA 4COYA 1JYXA 1AR81 2VBBA 3VL9A 1MQTB 4AVBA 1S0EA 3OD0A 3ACLA 4GMP0 1C8NA 1Q56A 1YNAA 2DCTA 5IVEA 2MHFA 4Y22A 2C9KA 2XMLA 3VZNA 3DEMA 4K8FA 4L2NA 5F6LB 2WS91 3WLUA 4BQ1A 3UNPA 3ECQA 2DV9A 3VKOA 4LITA 1CAVB 2CWSA 3LEMA 4Q4Y1 3T09A 5FMCA 2QQMA 1O4TA 5FZGA 4LBLA 2PHRA 5C8CA 4KMQA 2C26A 5ERLA 3I2GA 1F9KA 3WW1A 1YHFA 5CB7A 1TMF1 1OPOA 1LULA 3FX3A 4P14A 4IEYA 1I6XA 4JKMA 3PIGA 2WINB 5FYVA 4RR3B 1YQ6A 2E53A 5H9RA 3J8F3 1YRZA 5BV6A 1OLME 2HWE1 3T1LA 2DBIA 1UU6A 3E6BA 3VN4A 3VB9A 4E4ZA 4WVZA 5HXVA 3W58A 1QJY3 1VLNA 2C24A 2V73A 3H42B 4P08A 3KV4A 4YVSC 1RUE3 4LUMA 3UKNA 2OA2A 1MACA 1MR5A 3D6EA 1DYOA 3VDDB 5CADA 1DCSA 1DGRN 2JG8A 3U14A 1EV13 1W8NA 2F4LA 3RZJA 1E5SA 4BM8A 3G6JB 1JOBA 2VUJA 4Q2FA 1IOAA 3MIFA 1Z7S2 3G7DA 3N9MA 4NPMA 5A7WA 3LOIA 1AR72 3FHQA 1I3HA 1UMHA 2ARBA 2EA7A 3T08A 1H4GA 3MYXA 4Y1UA 2VG9A 4AQTA 1O3TA 1S0BA 1FMD1 1VRBA 2WT1A 3IWZA 4NN0A 2W94A 5FTTC 5I0RA 4PIYA 1CZSA 2YZ4A 5DXDA 3BIWE 3R4SA 1MS1A 1WD4A 1OH4A 3KD4A 3I97A 2J1TA 2OZJA 5JXHA 5JVVA 1IQAA 4D7TA 1KS4A 1DQ4A 3MF9A 1ZVFA 3KV9A 3OGGA 3POSA 2YC4A 1V6NA 4SLIA 1BHGA 1YXWA 3HBZA 1DU3D 2D6OX 3KV6A 1MEC3 1POV1 1JZ6A 1QF3A 4QXKA 2WL1A 4W6XA 5FPBA 1LECA 4QB1A 3DKQA 1WMXA 3RI9A 4QAWA 2GP5A 5EPAA 2OYZA 1SLBA 1W06A 4XF1A 5IFTA 5L36A 3NNJA 3RZLA 4QXCA 5FZ8A 3B01A 2LRPA 1GZWA 2WZPP 1VALA 4CA9A 1HN1A 1KDKA 5ANQA 4ASMB 3T3YA 1ND3A 2IFWA 1D0GA 3OD4A 3AXEA 4CZSA 4CXYA 1GNYA 2HYXA 2BOIA 1QJX3 4IE0A 4XJAA 4ZXKA 4KL1A 5FXXA 4PJYA 4XILA 2Q1ZB 2NLRA 4YFWA 2XKPA 3S7IA 1SACA 1UZZA 4H55A 1RL3A 2ZACA 3Q8EA 5GM0A 4QU1A 2W1WA 1G9DA 4J25A 3ZXKA 5LEKA 5EWSA 5FZCA 1XRUA 1NLSA 4QDRA 5A3OA 3GGLA 1ZREA 4RHV1 2GP3A 2VZTA 3O5SA 2ARAA 4XJ8A 5L9VA 5KXBA 1N1TA 4C1WA 1AF9A 3LAGA 2QQNA 3CBNA 1PVC1 3ROUA 3UESA 5J09A 3BGAA 1W9TA 1XNDA 1T6GC 4CCOA 2BPA2 5DDJ3 2E26A 3OY8A 2ZGQA 1N1YA 2VZVA 3UGGA 1CAXB 3MBWA 4PF1A 2YB7A 2W52A 3GDBA 4Q4V1 5IVVA 1H8VA 5I8SA 3HVDA 4AL9A 1COV2 4WM7C 2J1AA 3E1F1 3B9CA 4PF5A 4CU7A 3SCFA 1BEV3 1A3KA 3O1RA 2JICA 5DUVA 3J8F2 3VZMA 4RL7A 3LPFA 3WHUA 4CDQC 5K0UC 2GMMA 3S57A 4KI5M 4IUGA 1TQ5A 2IUWA 2X8KA 3LSEA 4LORA 4A4AA 4Q8KA 2PLV1 1QJY2 2A71A 3KCCA 3C2UA 2OUJA 4Y24A 4AEKA 2HEVF 4YGCA 1YQ5A 1E5RA 1RUE2 4XUOA 4AI3A 5BNOC 1BBT1 1HRI3 1S0DA 1P8JA 3I3EA 4JGYB 4QPIA 3WCSA 4DXTA 1LHWA 2PHUA 2ZEZA 3A21A 1EV12 4BWOA 3EYPA 4Z82A 1JYTA 5FLHA 1R1A3 4HXCA 4XFHA 5J98B 2XOMA 2K9ZA 3WG1A 4PLOA 5K8SA 3ZSLA 1SFNA 4S2FA 3LCPA 4XMAA 5I93A 3Q8BA 1ZRRA 4PDWB 2WZ8A 3WF2A 2HWB1 4BQ2A 1O4ZA 3ZFFC 3VZKA 3NAPB 5ACA3 1RXGA 3POIA 4O7XA 3VBHB 3E6CC 2UY9A 3VUOA 2Q8DA 1PO21 3LEIA 4FPLA 2PN5A 2WKKA 1MS4A 2ZXQA 4NHYA 3VHNA 5JXGA 1PIV1 4PT6A 1LHNA 1XB9A 2AREA 2ZHLA 3AB0A 3H8UA 2PHWA 5GALA 2JDMA 3WNXA 4KG0A 3AC0A 3FBMA 5F5QA 3ZXJA 4ORFA 2GN3A 1ZBA3 4QB2A 4YM1A 5FXVA 5A1AA 1ULCA 5KHGA 2FCVA 2J1RA 2YBSA 1AYN2 3NJVA 3HPNA 1MEC2 4QKDA 3MIHA 4RQPB 2J42A 4LXLA 4L9BA 5C3RA 5IATA 1BJQA 1ASJ1 1RJ8A 4LIUA 4LUKA 1JZ8A 4EWEA 3VBUC 3ILNA 2QQWA 2BRTA 1SBDA 3ACFA 3BYWA 4HK9A 2C9AA 1CZTA 2GNDA 4N53C 5JDBA 5FY7A 3LPGA 1G8WA 5FO8B 5HBAA 2C5DA 4OI0A 4S2DA 4IV1C 1YI7A 1GWKA 5EP9A 5LASA 2ZKNA 1VR3A 3N9OA 4Z2AA 1PM4A 5FZ1A 2Y6GA 2O14A 1EAH3 1XSRA 2HEWF 1JZ4A 4XIOA 3DXTA 3F2ZA 4ZXEA 1QJX2 3M2MA 3M3QA 2LUWA 4IV3A 5HCBA 4K8RB 5FYHA 2XLFA 1SQ4A 5A32B 2WWSA 4Z1VA 1UAIA 3VD4A 1NCRC 5AVAA 5KHIA 2XUEA 3ZFGB 1DQ2A 1CD3G 2WC2A 2KM2A 3T30A 3CF6E 2QDRA 2PHXA 3KB5A 3WF0A 3H3UA 1XU1A 2WNVC 2R063 4LK6A 1RINA 3RI8A 2DTYA 5CG9A 2D6NA 4WZFA 1ZRDA 2TEPA 4FPGA 4XXPA 3ZXAC 4QWNA 2A6YA 3LDBA 1M4WA 5CISA 4UFLA 3AVSA 3FL7A 1F8VA 1DZQA 5A7SA 4YFZA 5LK5A 4MG2A 4XTPA 5JOWA 3UETA 4F3JA 2UYBA 2IFRA 1ZM1A 3E5XA 1LJ7A 5APAA 2ZHNA 3BPZA 1Q8SA 4DZGA 1H8TC 2ZGKA 5LY1A 5EQUA 1KRIA 1JN2P 2D98A 4QMAA 3NL1A 5FY1A 3VKFC 4QHBA 4BJ0A 4G3YC 4IW3A 1YIPA 1BEV2 2XJVA 1V6OA 1YLLA 2FDIA 2D3PA 3M70A 4AAXA 2HEYF 3N9NA 1LESA 2WRAA 3PDQA 1RHI2 3R6SA 2IXIA 3TOJA 4BH9A 1LNSA 2W95A 3V0BA 4RSUA 1K12A 1A6CA 1S4CA 3I7DA 1R64A 3P1IA 1HRI2 5FZFA 2DTWA 2G1MA 4K9SA 5FYYA 1AJOA 4PQQA 2JDKA 1I9RA 4M01A 5EIYB 1X9PA 4AG4A 4CCJA 1UX7A 1X8MA 1OOPC 1R1A2 3K4DA 2YGLA 4BIFA 2VCMA 1GUIA 1TME2 2BNOA 3AVRA 3PUAA 5T50A 5A6XA 2J1UA 2BVVA 2DVBA 5LA1A 3IIAA 1DZRA 1IS3A 2DVDA 1MS0A 2YXSA 1QXJA 1XU2A 2J7MA 3WF4A 1AUYA 1POQA 5ACA2 1KJRA 2WA4A 5AC91 4OHYA 3IDCB 4LBOA 3VL8A 1VJ2A 5CFDB 1PMHX 2I07B 4FOYA 2HBTA 1LOEA 1JZ2A 2VR4A 5CA6A 1JZ3A 1N3OA 2QCSB 4LO6B 1V9U3 5H9QA 5F5IA 1WMFA 4AGGA 4HONA 1DZTA 3I3DA 1GICA 2P1BA 1WLTA 1ACCA 2PA7A 4PDWA 1NY71 1DGWA 4XF4A 1W2TA 2Q5TA 4YVSA 5FZ6A 4XDPA 1AR83 3PHMA 2EAKA 1BCXA 2VMHA 2PHLA 3ZKYA 4AXOA 4GQ7A 1ZBA2 4AEMA 5IT6A 2FDKA 4AFMA 3AZWA 2VNRA 4JDNA 2A3WA 2CAUA 5CEHA 1A34A 2WS93 4BQWA 1COV1 2R073 1RUOA 2R16A 4V2VA 1Q43A 1W6MB 1V6IA 3AFKA 3J8F1 3OGSA 1VMHA 3A0KA 1SLLA 4P9GA 5FP7A 1PGL2 3DECA 4QGLA 2OX0A 1X9TA 3LA2A 3MPPG 1SLIA 3R4DB 1W3XA 4LA3A 2Q8EA 2VC9A 4P9LA 1TMF3 4IE4A 1FV2A 1QJY1 2XGXA 3O1UA 1F5FA 1EAH2 5DUUA 3O1OA 3AX4A 3RFRA 2HLEA 2EIDA 5FZ3A 4HZFA 4SBVA 1O6UA 1WZXA 4CEYB 2GU9A 1XYPA 4M3CA 3PNAA 5KXDA 2I45A 4XACA 2UWAA 4KBBA 1ZZ9A 4CDXC 3IMMA 1W6QA 5FBJA 4ATFA 2JEMA 3RJRA 5C3SA 4XBQA 5C5TA 5IUQA 3FHAA 5IWFA 1S0JA 2R062 4OUSA 1JH5A 4EN6B 5C8CC 3FLRA 2O1QA 4AZZA 1OF4A 2MPFA 4B3NA 1PX4A 5DPNA 1Y9QA 1W99A 5C33A 1AR63 2Y6JA 3ON7A 2GDFA 1W03A 2JDNA 3QCWA 1G9BA 1FMD3 2W5FA 2BGPA 2LS6A 2ZMLA 4KU8A 3V0AA 3E5QA 1RC6A 2BU9A 2D5HA 5CFCB 2H6CA 1NA1B 4BA6A 5JSOA 1KITA 4L97A 5L7OB 2RMU1 3UGHA 2UURA 3ZDSA 2VNOA 3MHZA 2WSUA 4IEPA 2JDUA 1AYN1 4AK3A 1MEC1 3IPVA 4QD2A 2PTMA 3VDAA 5LY2A 2JG8C 3VHPA 3WUCA 4AFAA 1ZZCA 5B4XA 3ZSKA 3MICA 2HBUA 3THPA 4BQ3A 1ODMA 1VBB3 1HX6A 4AFBA 3FBYA 3CZUA 4AOCA 3PMSA 5CKNA 4BHPA 1RUD3 4LR4A 2F4PA 3RYRA 3AMNA 2Y26A 2XHKA 2W91A 2VMCA 2VZ3A 4FOVA 4OI2A 4AFCA 4CDWB 4AVAA 1UOFA 1UY1A 3ZYFA 5AFBA 1CQ9A 1BYHA 2WT0A 2YY1A 4KWKA 4CDUB 1QJX1 2BGOA 2VVFA 5F6KA 4FPJA 2D43A 5FBZA 2DCZA 5JSRA 1GQPA 1WCKA 2JD9A 3LDRA 4PI2A 4AI1A 4RS5A 3ETQA 1WCSA 2GH8A 2VOXA 3POJA 3ZMOA 5CKMA 3ENRA 2VH9A 4KGQA 4UOJA 2NM1A 2R30A 2JDYA 2XB6C 2Q4SA 5FK7A 4Y1ZA 1ZBE3 1XE7A 3GF6A 4EN9B 5K0UA 3PUQA 4ZPIA 4QHZA 5FZHA 2VMEA 3TEWA 1V9U2 3OGJA 4IEVA 4Y1YA 5F2SA 4DINB 1XBFA 4DPNA 4UW6A 2ZX1A 3M3CA 1SG3A 2FHRA 4C91A 2FDFA 1EYBA 5BNOA 3GZTB 3KCYA 5F7UA 4AYUA 1AR82 2HWD3 3WW2A 1R1ZA 1D4M1 2IC1A 3TEYA 2Y8KA 3CJIB 4IXLA 3M7AA 4MSVA 3USUA 4IEOA 3MUY1 2X10A 3T2PA 1S2EA 5LZ6A 4XPVA 5CAZA 1JYVA 2WS92 1PVC3 2VUCA 2XONA 3NV2A 1G9CA 2QQLA 1GLHA 4HETA 4PHZA 2R072 1V0AA 1HXS3 2W2IA 3T4VA 5C5UA 3O14A 4FP3A 1BEV1 3NJXA 5J3UA 5F5CA 4NE9A 2ENRA 3PVEA 4WVVA 4B8EA 4R52A 3WHTA 2XDVA 1JS9A 3WD5A 1LGCA 4M0HA 1RHI1 3P6BA 3VBOA 2SBAA 1TMF2 2KR2A 4R4XA 4DUXA 2QQJA 4ITCA 1Q3EA 2ZX4A 4YNIA 1K42A 1HRI1 2WNUC 2LW8A 4HVOA 4LKSA 1CWPA 1RUJ1 3OBRA 3WT3A 1W6NA 3N7JA 5FZKA 4CRQA 2PLV3 4QX7A 3TAYA 5T5JA 2VZ1A 1ENRA 2G9ZA 4JTOA 4YVWB 2D3SA 5FZ9A 3UK9A 1FATA 2XQRA 4QX8A 4XDQA 4XXAA 1TME1 3WDWA 4B29A 4UXAA 5LW9A 5HV0A 1KEXA 1VAKA 2EALA 5KHKA 2DVFA 3LD8A 5ACA1 3VBUA 1VMJA 4CUCA 3J7LA 4N53A 3THTA 1JHJA 1MVQA 4JGZB 4HVQA 5J96B 1IS6A 1GOGA 3NWKA 1D0HA 1T6BX 1OLQA 2IZWA 2JG9A 4FPCA 2VZQA 4BE3A 1OHFA 1YEWA 1AR62 3I2OA 2HWB3 2EXHA 2VQUA 1FMD2 1GQGA 4QQ2A 3RZZA 2R49A 2B9VA 4OUEA 1U0AA 2BWCA 2BOJA 4NHXA 5FP8A 1PO23 4MLOA 5GZGA 4BOWA 1LU2A 4PLNA 1GQHA 5A3UA 4E2QA 1O5LA 3ACHA 2ET1A 5J37A 1ZBA1 1W8HA 2GSYA 3HQUA 1PIV3 4K20A 3LB9A 4LA2A 5FYUA 5LA0A 4GMP1 1TG7A 4XUQA 4RR3C 3FE5A 2G19A 3WDVA 1NE4A 3QOPA 5LCWL 3FUQA 3EB7A 4YGDA 2BDRA 3M1HA 3MGUA 2WNVA 4QM8A 5DMYA 1VBB2 2W08A 1VBE3 5G04L 3K4ZA 4XETA 1NAEA 1PGL1 4D69A 1B09A 1SDDB 1RUD2 5JI7A 4DOUA 4R8HA 3S7EA 3VLBB 1ASJ3 1QOTA 1SZBA 3VDDC 1IKQA 3CLPA 2VZRA 3ZPOA 1EAH1 3ZR6A 4B7KA 5LBBA 4MGSA 3WDTA 2PXJA 5LBCA 4QQLA 1WLWA 5I91A 2YDEA 2WZR1 1OQEA 1DQ5A 3I2DA 3KV5A 3OEAA 4QPGB 1AYM3 4OMCA 4RGAA 3ZR5A 5B4NA 1IG3A 4META 1BXHA 1HB4A 1K5MB 1UPIA 2WBKA 3ZX7A 3SCHA 1DBNA 4CPBA 1S0GA 4FP2A 1ZBE2 1PGW2 2VECA 1GV9A 4AEDB 4CEWA 4NUBA 1XYNA 1ND2B 1YCIA 2VTFA 1GOHA 4DXZA 1QNYA 1PK6A 2KD7A 3HT1A 4I3PA 1KFUL 3GZUC 4EE2A 4F83A 3SHRA 4LOSA 1LB2A 4MOAA 4QGMA 2HWD2 4W6YA 3ZM8A 4FPFA 3VBFB 3ZIWA 3RGBA 1OOPA 4GKXA 5T3NA 1GMMA 1B35A 1WCQA 3ZYBA 2PELA 2WR9A 1GR3A 4Q5OA 1D2SA 1PVC2 3H1YA 1IS5A 2GH2A 4AVCA 2A7AA 1HXS2 1G9FA 2LROA 1SMVA 4IV3C 3O1MA 4CCDA 1X36A 1AZDA 4A6OA 4ZHNA 4FPYA 1YYNA 5KBFA 2MEV3 2OPKA 2CNAA 2VULA 3WQ0A 3AXDA 5AFEA 5K7PA 3M3OA 4X6RB 4DFSA 1PZ9A 4NAOA 2PHDA 4BU2A 3TWIA 3EQEA 1H2LA 2G9GA 2CTVA 1WW7A 3VKLA 4N7UA 4LKDA 3K2OA 1KXGA 1HJFA 3OBZA 5C4WB 4XHBA 2XJTA 4IETA 3WW4A 2FMYA 4XBLA 3PUIA 1N47A 3OF1A 3GJBA 4JHTA 4LO4B 1ENSA 4OVEA 3J7HA 4EROA 1J59A 2A3XA 5JI9A 3MDPA 5JMCA 3IDAA 5HV4A 1XNBA 2CU5A 2EXJA 3IDBB 4A41A 4B1LA 4COUA 4DQAA 3MUZ1 1PGSA 1UYPA 4JCKA 5FXZA 5FMDA 2D5FA 2ORXA 4K40A 3VHOA 3QD6A 5EJ1B 2HWB2 5FXWA 5DABA 5FV3A 3ZYJB 2P2KA 4AWDA 3FFZA 3H7YA 4H3WA 4XJUA 5AC93 1CJPA 3MV01 3ZFEB 4E8DA 1PO22 2E51A 4L99A 5C8WA 3T2QA 3KF5A 3N9PA 5EJ3A 3IDEA 4QX1A 2VO5A 3ES4A 2D7FA 3VBRB 2I74A 4XAEA 1PIV2 1CX1A 4CDXA 4C90A 1UX6A 4FCAA 4I0AA 5FYTA 3RPQA 2FBEA 4AHYA 1IS4A 5FJKA 1DF0A 4LULA 3GHNA 1W8UA 3DGTA 2R071 5FPXA 4CCMA 2ERFA 2A6VA 5D8AB 3T4HB 2YU2A 4Y33A 1W04A 3ASIA 3QH7A 4M3CE 1VBE2 1H4HA 3POGA 3W9AA 3BIEA 5FZOB 1UXXX 1QNWA 3OB8A 1AR91 1COV3 1CX4A 2ZKLA 5D21A 5GZFA 1ASJ2 1U5ZA 2VTXJ 4JGYC 2ZABA 3LEKA 2NYYA 2WLQA 1FT9A 3Q8FA 4XOGA 5FZAA 4YRDA 4I30A 3ELNA 3ZYHA 5LRSA 4LE3A 4D6RA 3AMHA 5A3WA 3PU3A 4YYOA 4YG3A 1J3RA 1HLCA 3QLQA 1PZ8A 5FO9B 1AYM2 1DQ0A 1R081 4PDWC 4NIGA 4HPKB 5JPNB 4CE8A 5KR7A 4XQDA 5FAXA 2ZGLA 1NXD1 2PAMA 4I0WB 2JIGA 2W9XA 4BDVB 1GBGA 3AKQA 1DG6A 4JQRA 3ZN6A 1OSGA 1ULPA 1OXCA 2R6QA 2PFWA 3AZZA 3IN9A 2AYHA 1AR61 2HJIA 2VXRA 3KZ4C 5A6YA 1NT0A 3IAQA 2Y0IA 2ZGOA 4AHWA 1L7RA 2NMNA 4HL0A 4R9BA 2OW4A 1W2OA 5K4LA 2Z5WA 1PMJX 3C3VA 4H7MA 1RUI3 1PZ7A 1YIFA 2VOVA 1LOCA 3SEEA 2WO3A 4IE7A 2VXJA 1UW8A 4QQOA 1W9FA 5JZGB 1HV1A 1ULEA 2ORZA 3N7KA 2RMU3 4MGYE 4YW4A 3NNFA 4EZHA 3HNMA 1NXMA 4N43B 4Y5SA 5FREA 4E2SA 2D3RA 1HKDA 3FMGA 3OUHA 1W3VA 1VBB1 2J1VA 1AYN3 2MEV2 4GJYA 1US2A 3BN6A 1M06G 1O8SA 3WUDA 3LA7A 1RUD1 1JYWA 4NO4A 3U07A 1NZCA 3H50A 4IQPA 2GNTA 1C1LA 2W87A 3NMBA 4I09A 1JI6A 1BQPA 1NLRA 1CESA 3ZFGC 4Q1PA 5I0DA 5DG1A 1WBLA 2YU1A 3M3IA 4GAZA 5E89A 2VZOA 3WF3A 1C5IA 3P5BA 3NV1A 4CUBA 4DEQA 2XJUA 3UT0A 4GH4A 2P3YA 3UL2A 4JDOA 3VDCA 4A45A 5A6QA 4CP9B 2E7TA 1H30A 3M4FA 2JE9A 1ZBE1 1PGW1 5E6HA 2QTWB 3WR0A 3LEGA 5FPVA 1LR5A 1R093 4OYUA 2G9FA 1RMU1 1V6LA 3U4SA 3RZKA 5AC92 5DAPA 5F2WA 5A7NA 4FT8A 2VCAA 4ZY9A 2FZ2A 5FYIA 4HKLA 2WNUA 1Y7BA 1LCLA 1LGNA 5AVPA 1CAWB 2HWD1 2VBPA 4X8NA 5FY9A 4YGBA 3WQ7A 2BYVE 5FUPA 1ENQA 1SPPB 1HJGA 2PHFA 1VB2A 1UQXA 2D6PA 2OQ7A 4U2AA 1NY72 1W6OB 1O3SA 4TN7A 5BNNB 4FQ4A 2VOTA 1NCQA 3ZFEA 3K4AA 5IJRA 1D4M3 1HXS1 3WDYA 4KNCA 3K75B 1XPWA 1MQTA 3KGLA 4FFGA 5J36A 3K46A 5T5OA 5A1LA 4RS5C 4XVHA 2CSGA 1BZWA 4BYYA 2WO2A 3UYJA 2K2SA 2BNNA 4UF0B 1HQLA 4DB5A 3VD7A 3NV4A 4EZ4A 4K6BA 1PNFA 3HNBM 3WNMA 3AKTA 2P6HA 1SFPA 2RE9A 1CAVA 4NAMA 5DG2A 5A33B 2A75A 4OULA 4GA9A 1E57A 2QNKA 4PBPA 2H0BA 2OIIA 1RHI3 1QXPA 4XMIA 3KF3A 1SHWB 3KGZA 1PNGA 1H6XA 4D6QA 1JOJA 2NMOA 4NRMA 3SMHA 1ZZ6A 5T5PA 5A7PA 3POYA 2FD8A 4R4ZA 4ES8A 5FR3A 2IVIB 4QDQA 1RUJ3 2ZEWA 5DZEA 4RR3A 5CFDC 4TLGA 4BIOA 3JZVA 2HWF1 1JBCA 1YQ2A 3NNMA 1H2KA 3L2HA 4CTEA 2E63A 4IE5A 1TME3 3LIHA 5JOZA 2RV9A 1GOFA 3TYJA 1MZ6A 2X09A 2C0ZA 1OA3A 2ZGPA 3BCWA 4COWA 4CXWA 4OLLA 3VDDA 4JZRA 5A7QA 4AAPA 3DV8A 5IAVA 2QBXA 1AXZA 1AL0G 1XJAA 4OI1A 3U37A 3VBOC 3ZN4A 5FWJA 3OGRA 3SKJE 4YW6A 1UO9A 2LALA 4LO7A 1RUI2 4MV2A 4TYSA 4CU8A 4UW5A 4XFFA 3AJYA 4Q4W1 2CDOA 2J1EA 4Q0VA 4A42A 4Q4X3 1XNTA 4ET7A 5LWBA 1QMJA 2XL9A 1O59A 2RMU2 1I5PA 1H9PA 2VQ0A 2VJXA 4QT6A 3OJBA 1UY3A 4IERA 3TNPB 4TSVA 1K5JA 5LA9A 1J3PA 3H1WA 3CU7A 1A8MA 2OZ6A 1VBE1 2R0FA 1QY4A 4GMP3 2BGCA 3EMRA 4NPRA 1S55A 4YG6A 2RR11 2BTVC 2DCKA 4UAPA 1O3RA 2WA3A 2WZEA 4CEYC 4IE6A 3K51A 2Y0OA 4N43A 1CZVA 1LOGA 2W92A 5LK7B 2XVLA 1W2NA 2JG9C 4CU9A 4NR1A 2EF6A 2Y33A 5HCHA 2NPIA 4UBHA 3BTZA 5C9AB 4XE9A 1AYM1 4RA0A 4YZ4A 1UIJA 2GZWA 4JV4A 2XLAA 2VMGA 1POV0 1ZNPA 5CZKA 1KJLA 3WEZA 1LTEA 4QU2A 3V65A 5T52A 2WZR3 4Y4YA 1W8FA 1W8TA 3NNGA 3GALA 1CAUB 4XFBA 2RDRA 3FWEA 4QM9A 5J1XA 2JKBA 5GLZA 4LBNA 1R092 2HH9A 2OUHA 3ABZA 1JODA 3SKVA 4JVAA 4Y1VA 3RZMA 3DKWA 3I8TA 5CFCC 2YYOA 2JX9A 1E5IA 3N4MA 1UYXA 1UOGA 5BXXA 4CP0A 2D6MA 1EPZA 5GLVA 4AVVA 4NJ4A 4HLTA 1X82A 3SEPA 2UY8A 1D7PM 3JQXA 5BNPB 1J83A 4NRPA 3LGRA 4XIKA 2D40A 3K77A 4CUAA 3H8XA 1AX0A 3PURA 1VB4A 1WLCA 1D4M2 4OZXA 1RUH3 5JR2A 2RS13 4J1XA 4JRLA 5FQ0B 5LRRA 3H0OA 1PO13 3RVHA 1DQ6A 1SDWA 4KBZA 5FOBB 4GULA 1LOFA 3O0XA 5FLJA 4Q1RA 5GKAC 4CDWC 2MEV1 1XOYA 4OQ8A 2GMPA 1W6OA 3VZLA 4D0QA 4DXSA 2QDNA 3CQOA 4CEWC 4CDUC 2R7EB 5FLIA 3UGFA 3GHMA 3OYWB 2WYFA 3JB4C 1NYWA 3OOXA 4ASLA 1CAXA 4LMFA 1MS8A 1QOOA 1S0IA 1ZZBA 2XBO3 1UN1A 2Z42A 3GZEA 5EHDA 3VBSB 4URAA 1PK6C 1W9WA 2VU9A 3MPBA 3MO4A 4ZU7A 3W21A 4QPWA 4FXGB 1YFUA 4NPLA 2V72A 5ABJB 1RUJ2 5JWPA 4M4RA 4D6SA 1IPSA 1O7FA 5FY0A 3I3QA 3IZOA 1OA2A 4XW3A 3RS6A 1DFQA 2VUAA 3I2FA 4WVMB 5KHJA 3KMHA 3VGIA 4EN7B 1DDLA 1RYYA 3PVOA 1B35C 2XQXA 2IWGB 1GZ9A 4ZS3A 5A3NA 5FYMA 3FZ3A 3T1MA 2IXCA 2QKDA 3EJKA 3JBG1 4KGGA 3CIHA 3POWA 3DYMA 4C8DA 1SLAA 4XCBA 3B69A 1BVVA 1QDOA 2I2SA 2K0GA 4JGYA 3ZYRA 4FAHA 4MGIE 4GWJA 3W5NA 3N9LA 4HVRA 5J48A 2VMFA 4BPZA 4OI4A 5E88A 3VHRA 1JYCA 2Z79A 1MS5A 1RUF3 4NIIA 2ILMA 3AM2A 1YI9A 4FPHA 2FQPA 2ZMNA 4CDQB 4J6GA 1W9SA 4LBQB 2VTXA 4Q4X2 2JDPA 3NAPA 3Q9OA 1LGBA 3VBHA 1ZA4A 3LWCA 1OURA 4Z8BA 4NVPA 2Q0AA 2ZBJA 4UFMA 3ORJA 4W8JA 2ARCA 3SNMA 2EICA 5BNQA 4P9WA 3MW2A 3U0ZA 3WG2A 5LATA 1DIWA 2L9LA 3HWJA 3IKWA 4MYEA 5SV8A 4DY3A 1QDCA 4QXBA 3OSDA 1V70A 2YMZA 5FP9A 1X7NA 4EJRA 3NKTA 1AR93 1RGSA 1IPJA 4IEWA 4LQRA 5FJHA 2OPWA 2EAAA 2WQ8A 3NJZA 1DGWX 3RYKA 4BLJA 4RQPA 3ZFFB 5CG8A 3CL1A 1D2QA 4HBNA 4FSJA 1H1AA 3MLLA 5FZ7A 4JGZC 1YUDA 1V6JA 1HB3A 2WZR2 3CZJA 2KXLA 3KWVA 2AEZA 2VVDA 4NMIA 1R083 5FO7B 1HQNA 3PUSA 3ZOIA 5A3LA 2JDAA 5F32A 3HEIA 3HQXA 5F3EA 5HI0A 5CU1A 1YFWA 5JIUA 2GAUA 4C1XA 1O91A 4NHMA 3DL3A 1JXNA 3HOBA 4ONUA 3NJYA 5LB6A 2CY6A 2DVGA 2QFEA 4YZ1A 2R1DA 1C28A 2BV4A 3TRSB 3LE0A 3SH4A 3GBFA 3QH6A 1LRHA 2K46A 3MIDA 5A32A 4AI0A 3D82A 3BTAA 1RUI1 3ZFGA 1UYYA 5F3CA 4Q0PA 2B39A 1L7QA 1GNZA 2XPJA 2EIGA 1UD1A 4AQSA 3DN7A 1IPKA 3MFAA 1RUH2 1LAJA 3OUJA 2RS12 2DDUA 4UFHA 1PO12 4IV1B 2E6VA 3APBA 2R0HA 4COZA 4OHWA 5IYYA 3SH3A 1BK1A 3NSTA 1WUVA 1BMV2 3BALA 3LFIA 3ZSMA 1YJKA 3DYPA 3O0WA 3M8LA 4DRVA 1G86A 2E7AA 1RITA 4XFIA 4EYUA 1J58A 4XJZA 2GNMA 1NCRB 3PIJA 5JXJA 4LBQD 1AJKA 1AX2A 4QPGC 2AGSA 2VNVA 1GYKA 2XBO2 4N90A 5FK8A 2VAUA 1LENA 1W39A 1URXA 2X5IB 2H0VA 3L2YA 4MH0E 5EZWA 1ZRCA 1K5MC 4QKBA 3RMYA 3SQOA 3BVCA 1IQDC 3MLKA 2ES3A 2VQTA 1F2NA 4AEDC 5A7OA 4YWAA 4Z2WA 2P6CA 1F31A 4CVUA 1CR7A 3I59B 1UPSA 4GB33 4BXSV 1XYOA 5EJZB 5M0TA 1R091 5LEJA 4IEXA 2XH6A 5FRAA 5ABJA 4Y20B 3S0MA 2ZGMA 1H8TB 1XNCA 4XFAA 2NZ9A 1UYZA 3AP6A 3RDIA 4N9IA 3HJRA 3A7QA 1RUF2 1GP4A 2AZ5A 3PL0A 1RMU3 2OT7A 3POFA 4XUNA 1CJDA 1WCUA 2WFF1 3MI8A 2ID4A 4OQ9A 3RQ0A 3WP4A 5KC5A 2A73B 2CL2A 2OQ6A 4LTAA 5CFDA 5DAQA 3RMXA 1DYPA 4BK4A 2R32A 3K3NA 1VBC3 2FZ1A 1LEDA 5DQ0A 4DUWA 5KWRA 2JB4A 3T2OA 3VV1A 1MS9A 2XVKA 3EBRA 3ZYIB 3AYCA 1W0NA 4JC1A 5H9SA 2Q8OA 4GH4C 3EHKA 2GC2A 1BKZA 1NLQA 3AP4A 4GALA 5F3IA 2ADDA 2GALA 2JWPA 3RRDA 3B3QE 1BLZA 3O1PA 4Q0SA 1FPN1 2WABA 1AR92 5F39A 3QACA 2B9UA 5F1RA 3LF7A 4AF9A 2DVAA 1EUTA 3AP9A 1F35A 1JTZX 1W6MA 1CIYA 1GZCA 2CGOA 2B46X 1F4HA 4R9CA 5FWEA 2BNMA 3MW3A 3ILRA 1R082 3ZN5A 4AQ6A 2YBKA 3RJ2X 3WINE 2A6ZA 4NHLA 4B4PA 3E6DA 1AXYA 4MXWB 1OKOA 1Q8VA 1NCQC 1YO8A 3ZFEC 1XNKA 2ZX0A 2HWF3 1RVF2 3DCQA 3USSA 3TBDA 4CEYA 1MQTC 4S2HA 3ZLIA 5KC6A 3V56A 2BZDA 3LA3A 3KVBA 5I0TA 2QJVA 2EIBA 4TXWA 5FZ0A 3OGVA 4HKWA 5D2AA 4BB3A 2O8QA 1REFA 3W59A 2VD7A 1E5HA 2W1SA 4JAAA 4XF3A 3HD8B 3OEBA 2Q30A 1OFNA 2LTNA 2ZZJA 2Z69A 2W46A 4Q4X1 4O65A 2JB8A 3UKVA 2CAVA 3OBAA 3ZKUA 4YM3A 5DAXA 4Q4W3 4FFIA 3WF1A 1VBA3 1NX9A 3DUIA 4UI9L 3B00A 1RUG3 2EXKA 2YHJA 2J22A 5BYNA 1Y9GA 3D4KA 3FLTA 2YROA 4PIZA 3HN1A 1FNZA 5CFCA 4LT5A 5FPLA 1NA1A 2FCUA 1ALYA 4LIVA 4Y22B 1K3IA 1N1SA 2YFUA 2XJQA 3JB8A 5BUVA 1JZ7A 2ATFA 4RFT0 2RR13 4INDA 1F4AA 2QZ3A 2JDHA 2RG4A 2XR4A 2PHTA 2ZX3A 4HOOA 4Q0QA 1QIQA 5A3MA 5IK8A 3OPWA 4WZCA 1DYKA 1W9YA 2Y6FA 3BU0A 5C8CB 4O9EA 3ZSJA 4YSFA 4XTMA 2RS53 3WV6A 4H14A 5A3TA 1UNBA 1VBD1 5FYCA 3U11A 5A6ZA 4HN1A 2VGDA 4GB32 1HQWA 4EN0A 2B5HA 4G4FA 1UIKA 3BU7A 4CDWA 4LE4A 3WXPA 1S1AA 1WW6A 3NV3A 1J1LA 5JSPA 4BCUA 5IVYA 4EWDA 3ZIXA 1JYNA 1GKBA 3N36A 1QGLA 3CO2A 4MX3A 4OCTA 3THDA 4NIAA 2UWBA 4CDUA 2QUOA 3S6PA 2UWCA 2Z2SB 1CN1A 3I59A 5E1RA 4TWTA 1RMU2 3HNYM 5C6CA 4E27A 2YBPA 2LM3A 3ES1A 4H7LA 2E7QA 4K21A 5KXEA 2X53S 2WO1A 3WQ1A 2QQVA 1C8M3 3NO8A 5FMOS 3WP6A 4YW5A 4N43C 2E31A 1CONA 4Y20A 2WO7A 5A7WB 1OT5A 1RUH1 2WIIB 4JKKA 2RS11 4Q26A 1BK0A 1O8PA 3H1MA 1PO11 1VBC2 1YFYA 3AP5A 3POBA 1WMEA 2OXBA 3DF0A 1OD5A 3GBWA 3KHBA 5FY4A 2W1UA 3WW3A 1BMV1 4HG6B 1Y43B 2XJPA 3WNPA 5A1FA 5CYYA 1U5YA 5JLVA 3FC0A 1MPXA 4E4SA 5CKQA 4DEVA 3AKRA 2VM9A 3AK0A 4KWLA 3H8RA 1IZ3A 1I5ZA 2BFUL 3AFGA 3MFCA 4XUTA 4Y4RA 2JIJA 2WDBA 3CJIA 4EN8B 4LOTA 1K45A 3NKGA 3IB3A 3VKNA 3VD3A 2XBO1 1RB8G 1W2UA 3B5LB 3AZXA 2RDQA 5IW0A 3VZJA 2DU1A 2XG3A 2J1SA 4YW2A 3GJAA 3MLJA 2B4KA 2ARXA 3FJSA 2E9QA 2G4IA 1OKQA 4FOWA 2QQOA 4MXVA 4CCNA 4QDSA 2Q1FA 3AMMA 3SISA 4NIDA 4HSJA 4P00B 2HWF2 4JQTA 1GZWB 4W4ZA 1CIWA 2Y6KA 2AACA 2ZA9A 4WM8B 2BJSA 1G9AA 3M3EA 3I3MA 1LOFC 3CJXA 4PQ9A 1ND3B 2BQPA 2WWUA 3ZO0B 3HAGA 3I4IA 1UZ0A 2EVXA 1A8DA 3JBG3 4YVWA 3WG3A 1RUF1 3HIFA 1AL23 4YG0A 1RUC1 5EFUA 4F8AA 5BNNC 1BVP1 4CCKA 3JQWA 3P3PA 3D0JA 1ST8A 1OVPA 1ULDA 4Q0UA 2ZGRA 5F8PA 1J3QA 4AGVA 1YQ8A 3VZOA 2RDNA 2X29A 4LLOA 2JE7A 2AR6A 4JGZA 4DNYA 4GWMA 4AI8A 5A3PA 4Q29A 3FFQA 2VOWA 4Q4W2 2HKXA 1VBA2 1H1MA 4QX0A 1RUG2 3A0NA 4LBKA 3O1SA 2BEOA 4NROA 4QX3A 3A4UA 3PJYA 1S2BA 1W6PB 2Y64A 1KDMA 2ADEA 2AC1A 3UJOA 2Y60A 3NRUA 5JAXA 2X05A 3RWNA 1N3PA 2BBAA 2RR12 3TN91 2WFPA 4MGTA 5B2GB 3HBKA 2FDJA 2VNGA 2XVGA 1QJFA 3ME2A 5F9TA 3PUHA 3OY8B 3RZGA 1TVGA 1LOAA 2E33A 1TNRA 3C7HA 1IKPA 2RS52 3C7GA 1W0OA 4A7ZA 2QQPA 5EV7A 3AZVA 4V2WA 2VMDA 5GLUA 3DPRB 2DBNA 2XUMA 3IT8A 4XURA 2JKXA 4LO5B 5CNAA 3IIIA 3R0RA 4XUPA 3NAPC 2VW2A 3KHCA 3VBHC 1GP5A 4CXXA 2W0XA 3FN9A 1UL9A 3N7MA 1RVF1 1QEXA 2JENA 3HN3A 1SLTA 2H6BA 2BP6A 3SLIA 4QPIB 1OPMA 4QPGA 4XDOA 3UKTA 3NW4A 4ASKA 3BTXA 5FZLA 1C5HA 2GN7A 4B4QA 3N9QA 3KT1A 1OBNA 1XXNA 1K5MA 1C8M2 2ZZQA 5GZEA 1HB1A 3I2IA 4FVVA 4FXKB 5EYYA 4A6SA 4FBFA 2Y38A 2YC0A 3BB6A 4XFCA 4AEDA 3PJQA 2WLPA 3JCIA 4UT5A 1UU4A 2UU8A 2GC0A 3PVNA 4RQPC 1ND2A 1NG0A 4ISRA 4W65A 1NKGA 2O8OA 5JCTA 2VE1A 5LBFA 3JU9A 3C7FA 5ANNA 2D93A 4QQHA 4X6QB 1W90A 2VQAA 4KWUA 3GM8A 1H2MA 3SXWA 3VBFA 1FX5A 1ZZ7A 3SC7X 4I3GA 1F15A 3IBMA 5C9AC 2ZAAA 5FPAA 2NP0A 2WUHA 1OD3A 5FYBA 4YPJA 4QQPA 4FAGA 1PX3A 3H7JA 1WW5A 3LSDA 3AYDA 1JOPA 2IXJA 1C3HA 3ZSEA 1GU3A 1SFYA 3LKJA 4JDMA 1OUXA 5C71A 3KCXA 4GB31 4V1PA 4AGRA 4XABA 3EXUA 3KT7A 2JECA 3OUIA 5DZFA 5L9BA 3SCGA 4AHZA 3FHIB 4BQ4A 1IG0A 2C4XA 1LKNA 4DUVA 4NIHA 1AXKA 3SH5A 1Q5OA 2RM23 4E2GA 3BI3A 3K48A 4L11A 2VZPA 2XL7A 5FOJB 5BNPC 3IM0A 5C4WA 3JBG2 4XQ4A 4BMEA 5JUVA 3TEZA 1S0FA 5FKCA 1AL22 1WGPA 3CDZB 1UMIA 4IV3B 2CGNA 5FKBA 3W20A 5CBLA 1FAYA 1LODA 2BWAA 4DMIA 4AVTA 1FXZA 4WM8A 3WZ1A 5JIAA 3WNKA 5IK5A 1L7LA 5FZDA 1HRV2 2QQIA 3O7OA 1VBC1 1XSQA 2P3IA 2ZHKA 4NRQA 2WFF3 4GZ9A 4GKYA 3JD73 2XWBB 3O0VA 1ZZ8A 2VL4A 4J1WA 2VCBA 2AENA 4ZZ8A 4N7IA 3U75A 4ATEA 4QXHA 1UY2A 1CPNA 4FI9A 3VBSC 3ZXDA 4OZOA 3H3ZA 4OFGA 3LFMA 3VBRA 3OG2A 1W8OA 3BTYA 5DUXA 4ARXA 3AJZA 5ABJC 5HCAA 1US3A 1H0BA 3I3BA 4HFSA 1UXZA 4OMDA 2C6SA 4AI2A 5D8AA 1FPN3 2FMDA 2RJKA 2ZTNA 1MZ5A 1W6PA 5LA2A 2VCCA 2YUEA 3WVJA 5GJ6A 1PVXA 4B7EA 1QH6A 5FZOA 2N7GA 2DURA 2Z4FA 3WSOA 3PTRB 3N7LA 1OVSA 4XJ9A 4Y26A 5FY5A 4ZZ5A 2AEYA 4A7YA 5FZBA 4XAAA 3B7MA 3V0BB 2WQZC 2BERA 1OQ1A 4MADA 5IHRA 1G6NA 2RDSA 3WP5A 1XNAA 4A44A 5DAWA 1QJU1 2V4VA 3DPRA 1GZTA 1UKRA 3I2HA 4HPKA 4JHZA 1U5XA 2R043 1MS3A 3CHXA 4LHNA 2WYSA 4LHKA 4OUMA 1OUSA 2A6WA 1UY4A 4B1MA 1T2XA 3A22A 4QX5A 5DUWA 4AW7A 4PLMA 1QQP1 1OLRA 5A70A 4L0PA 2YFZA 4CSWA 2ZX2A 2MNGA 1DQ1A 4DO0A 5A80A 5E8AA 1YC61 4K3UA 4E9KA 5FPZA 1VBA1 3AKSA 4FQZA 1RUG1 1REDA 3VDBA 4ZU4A 1VP6A 3R4UA 1VRH1 4OHZA 2ZOEB 3ITQA 1UF2C 2RS33 4YVSB 4IGPA 4XF9A 5L7OC 5FZEA 3S5AA 1SBEA 1IGOA 5T55A 3KVAA 1NOVA 5J7MA 1O3QA 2P4EA 2WAOA 2ZGTA 3H8OA 2P37A 2OS2A 4AFDA 5JZGA 4HKOA 5FDBA 4IEUA 3FUOA 1G7YA 4M3CF 2XJRA 2Q8CA 1FOD3 4IESA 3HQRA 2RS51 1Y9MA 1JHNA 2TNFA 2VZSA 3J7MA 5L9RA 5K9YA 4YM2A 4IL7A 1X33A 4UFJA 1ZRIA 1YJLA 4YZ3A 5G05L 4P9YA 5FMOL 4PIXA 2A3YA 2BW8A 3S5QA 2GC1A 5F5AA 5JXIA 1VAMA 2JDZA 2JJ6A 2W68A 2CYFA 3FLPA 4OHVA 4QHOA 3AKPA 1VBD3 4E4HA 4H2AA 4LO8A 1JW6A 4WVWA 2RVAA 1W2AX 4LBMA 4U36A 2VVEA 2QVSB 2RM22 5DAVA 1O5UA 4RFRB 5FPUA 4RD7A 1ZX5A 1H2NA 2YG0A 4W50A 3E97A 2RJ2A 4NOTA 4YLZA 3URFA 5IVJA 1XE0A 3PMEA 2W1QA 4XZPA 4CCCA 1NZIA 1AVBA 2VPVA 4M3CB 2DFBA 1NA1C 1UZVA 4WV8A 1C8M1 3RYPA 4OHXA 2BVBA 2D6LX 2HWC3 2UYAA 3AMPA 3KLSA 5GZDA 3GCXA 4IGQA 4CP9A 1W6QB 1LHVA 4ZU5A 3ZXFA 4E4DX 4UFIA 2WFF2 4AI9A 3JD72 1LOBA 4XEZA 2OKXA 1XC6A 4RGKA 2FDGA 1HW5A 1GWLA 5FIXA 1DGRA 1AHSA 3VD5A 1PM7A 3HMYA 3I54A 3IAPA 3RSJA 3D0SA 4MVTA 1CAWA 1Z7S1 5JOXA 1CPMA 2ZEXA 2AUYA 2Y34A 1AR71 4CYDA 1C57A 2X5IC 3V64A 4A3XA 1SPPA 3LDKA 4HK8A 3V0AB 3O1VA 1JU3A 1VIWB 5BNNA 1OC1A 2FCTA 1V6KA 1Q8QA 4TLFA 1FPN2 3JUUA 3MF6A 2WWJA 5IAXA 3IPVB 2PMWB 1AX1A 3IMNA 2Q1MA 3WCRA 3ATGA 5DDJ2 5FCCA 5FYZA 1HN0A 2VMIA 4UF0A 2JXAA 1ENXA 1GANA 1QHDA 2TBVA 1L3JA 4GD4A 5A33A 3L9JT 2DCJA 4FFFA 4MZUA 2ZGUA 3QBQA 1JUHA 1FI2A 1SEFA 2ZAHA 2ZMKA 3N35A 4GWIA 4D7YA 2VOKA 4I2OA 1ULOA 4XJWA 2BFUS 4FTSA 3MW4A 2R042 2JE8A 1AL21 3JXSA 4YW3A 1MZFA 4DRRA 2YPJA 1Y3TA 1NE6A 4LKFA 4FPOB 1QJEA 3CJIC 4RS5B 3ZYGA 4N8MA 3OBTA 4BQXA 2RHPA 4MGQA 4WM7B 1REEA 4QB6A 4Z07A 1WW4A 3BOWA 1RUC3 4ZS2A 2WNOA 1ZA7A 3N3HA 2QQUA 1HRV1 5I8TA 2ZCWA 2W47A 1TE1B 5FP3A 4CU6A 1Q8PA 2V5DA 1RJ7A 4M00A 5K0UB 2PQSA 4LNVA 1WCDJ 1FYUA 2IVJA 4QX2A 1OI6A 2ZJCA 2RS32 3LOBA 5BNOB 3OPTA 5F37A 1QWRA 1MVEA 2C1FA 4Y5Z0 3J9SA 1C1FA 3GCWA 3RZHA 4ISQA 4LBJA 3AP7A 1HB2A 2ZGSA 3ZXEA 2DWRA 2WT2A 1FV3A 1WMDA 3TB0A 3USUB 3O1TA 3ILFA 1FOD2 4LHLA 3D8CA 3TN93 4YVWC 4HT1T 3BOPA 2WAAA 4FFHA 5I0UA 2XWJB 1H1IA 2YPDA 2YC2A 1EPWA 3ZYPA 4LK7A 1UZWA 1WA6X 4NHKA 3U1XA 4BISA 4Y1XA 4BQ5A 1KS5A 3VBOB 4MHRA 3B9IA 1VBD2 5C3QA 5JR7B 1QU0A 4YZ2A 1TNFA 4HSLA 1PMIA 5FZIA 2DUPA 4RGGA 1SBFA 2D6KA 4JRAA 1GNHA 4UYBA 4Q4Y3 5SV5A 1HIXA 2ZPXA 4FTBA 1UCXA 1SLCA 2WSVA 5GLTA 2W39A 1RIRA 4K1YA 1DGLA 3CEWA 3WOGA 1W6NB 5FYSA 4BMBA 2PQQA 5C9AA 3MIGA 1H6YA 4IGOA 1WWYA 2A6XA 1RVF3 1VAVA 1QXRA 1C4RA 5C3OA 2OVUA 2DU0A 3ALQA 2ZGNA 3PU8A 2HWC2 5FQ0A 1O4YA 4LJHA 3C7OA 4ZKTB 1CAUA 3A23A 1RUE1 3DXUA 4DIQA 1KFXL 4DS0A 2HWE3 4XFGA 4YARA 3KSCA 3VBUB 3BODA 1LEMA 5GZCA 3KT4A 1U12A 1EV11 4N53B 2GNBA 5IFPA 2JG9B 4N9HA 3S30A 2QZ2A 2YV8A 5BPXA 4L8QA 4YW1A 4PI0A 5I8YA 2V4AA 2A70A 3CKHA 3J7NA 3LIGA 3U78A 1OLMA 5IVBA 5BNPA 3T0AA 2B7YA 5H9PA 4KWJA 2W3JA 2WNEA 1WA4A 3F95A 2PAKA 1UU5A 5CIRA 3ZPYA 2NQYA 1FNYA 2IXHA 3RG0A 1STMA 2ZHMA 4I01A 2QQKA 5FY8A 1YQCA 4Z92B 2ZEYA 1J84A 4RYDA 2VBDA 4E8CA 4BK5A 1QJZA 3WDXA 5HPOA 3BKZA 4KU7A 2WN2A 2AH2A 2XHNA 2XJSA 3KM5A 2WNVB 4P9XA 3U4XA 1RTVA 4KQ7A 4ZONA 4XHXA 1APNA 2O0OA 4D7SA 4JKLA 1W05A 1W0PA 4C0HA 3OYWA 4JTNA 4QKNA 3H3LA 2TUNA 1ND2C 1JYIA 2RM21 4C0BA 2V5YA 3VBSA 4MGKE 2E32A 3W5MA 4BLIA 3GZAA 4NWVA 2CGPA 1LHUA 4Q27A 3C7EA 3RNSA 4HMZA 2DCYA 2VW0A 5IVCA 3WNLA 3GXUA 3OCPA 1POV3 2ETEA 4I02A 4AHXA 3VBFC 4IEZA 1OFSA 4WVMA 1U5IA 3C8XA 1WBFA 4EV0A 4QKFA 1RUC2 3AL6A 4YM0A 4Q8LA 5L19A 1VPHA 4CP1A 4CEWB 3JD71 2CHHA 1GSLA 3PTYA 2D97A 2WN3A 5FZMA 2DFCA 4XCAA 1SCRA 3GNEA 1W8WA 3LZZA 4L92A 1PK6B 5L73A 5C70A 4WM7A 4B4RA 2F6BA 4COVA 5EYXA 1ZYBA 4G9SB 4FPKA
chains in the Genus database with same CATH topology
1CGPA 3VKMA 5JOYA 4D94A 4CDQA 4LBQA 5D1IA 1OOPB 2XKOA 3ST7A 2NN8A 1B35B 1X50A 3TN92 5C4WC 5BY5A 1J1TA 4XYXA 1N3QA 1ONAA 1ULGA 2ZS6B 3ZXLA 2JD4A 1RUNA 1UKGA 1EY2A 5E16A 2A5ZA 4S2GA 3PLQA 1QOSA 5DDJ1 3WDUA 4RHV3 4WM8C 4FPEA 1ND3C 3KS7A 1LU1A 1QH7A 1Z0HA 2DUOA 2VW1A 4Q4Y2 1XE8A 5L7OA 3MZHA 1N1VA 4P9IA 3ZFFA 1LHOA 4R9AA 4FO9A 2R041 2V09A 3HT2A 4K1ZA 3EO6A 4Q4V3 4QPYA 2P3JA 1UMZA 4W6WA 4F7ZA 5KXCA 1HDKA 5T5LA 1GFF2 3VBRC 1QJU3 2IXKA 5I0SA 4WBBA 1CVNA 3AYEA 2HWE2 1OMIA 4AQ2A 2BUKA 4BZ4A 4MGZE 3B93A 2P3KA 2SLIA 5D8AC 4O9GA 1R1A1 4A2UA 5JPMB 1BBT3 1QQP3 1ULFA 2QE3A 2RS31 2WQ4A 4QGNA 4UW3A 1EP0A 4I0BA 5T54A 1TEIA 3WP3A 1VRH3 4P5HA 2CWMA 2BBVA 3WY6A 4CDXB 1QKQA 4IV1A 4AVSA 1FOD1 3DPRC 3OTFA 4YZ5A 3OPZA 4R9DA 2PAEA 2CV6A 1NQDA 1ZRFA 5GLWA 1KD7A 3H9AA 2B45X 1NCRA 2IXLA 1SCSA 4PCRA 4FOQA 4QPIC 2DF7A 2R1BA 1WLDA 5CVRA 2EXIA 4D3WA 2X5IA 3UJQA 1Z78A 4GWNA 4IEQA 4UW4A 1D4VB 3CNAA 1OQDA 3ZXGA 4A7KA 4AE2A 1F5JA 2HWC1 2WJSA 3D5OA 3UV9A 2JG8B 4KG8A 1OA4A 4UBGA 5JZGC 2KA3A 3AYAA 1DLLA 2PYTA 4P9JA 3J4UH 3ZN6B 4LLFA 4GXLA 1H8TA 3MIBA 3ZMNA 1YFXA 5IK4A 2P17A 2HYKA 1A78A 4XF0A 1YWKA 1DHKB 1HV0A 1Q8OA 3NVCA 4URTA 2R061 4GIQA 4NWWA 3B02A 1Z7S3 5IK7A 3GYDA 1AR73 2XLGA 3GBGA 2VY0A 4KH9A 3X29B 4MUVA 4RHV2 3E5UA 4PBOA 1V6MA 4DY5A 1S0CA 3R05A 1UZYA 2B42B 3PVBB 3P3NA 2GC3A 4YGEA 1XQNA 2GMEA 3MIEA 4LEJA 4X8PA 3SITA 3O12A 4FTEA 4XQWA 4HN0A 4Q4V2 3ZVXA 3KQRA 5HCFA 2B8MA 3INAA 3TNQA 2RJLA 2DUQA 3B94A 1QJU2 5KHHA 4ES9A 2P34A 5EXOA 4GH4B 1IHMA 2ET7A 4MXWA 2YGMA 4K7JA 2PLV2 3U10A 3AMQA 1H9WA 5TSWA 3J26N 5DZGA 4EWAA 4HANA 4M0NA 3WG4A 1BBT2 1QQP2 3MEPA 3WX5A 4CP2A 1HRV3 4AEJA 1V00A 1JUIA 1NQJA 2WNUB 4XBNA 3AZYA 1KQRA 3HR9A 1VRH2 2DYCA 1I1EA 4TZDA 1X8EA 1V9U1 1MZEA 3T2TA 1WD3A 1NCQB 1PHMA 2D44A 5FFOC 1S2KA 4COYA 1AR81 3VL9A 1MQTB 4AVBA 1S0EA 3OD0A 3ACLA 4GMP0 1C8NA 1Q56A 1YNAA 2DCTA 2MHFA 4Y22A 3VZNA 4L2NA 4K8FA 5F6LB 2WS91 3WLUA 4BQ1A 3ECQA 2DV9A 3VKOA 1CAVB 2CWSA 4Q4Y1 1O4TA 4LBLA 2PHRA 5C8CA 1F9KA 3WW1A 1YHFA 5CB7A 1TMF1 1OPOA 1LULA 3FX3A 4P14A 4IEYA 1I6XA 2WINB 4RR3B 2E53A 5H9RA 3J8F3 1YRZA 5BV6A 2HWE1 3T1LA 1UU6A 3E6BA 3VN4A 4E4ZA 4WVZA 5HXVA 3W58A 1QJY3 1VLNA 2V73A 4YVSC 1RUE3 4LUMA 3UKNA 2OA2A 1MACA 1MR5A 3D6EA 3VDDB 5CADA 2JG8A 1DGRN 1EV13 4BM8A 3G6JB 2VUJA 4Q2FA 1IOAA 3MIFA 1Z7S2 3G7DA 3LOIA 1AR72 1I3HA 2ARBA 2EA7A 1H4GA 3MYXA 4Y1UA 2VG9A 4AQTA 1O3TA 1S0BA 1FMD1 2WT1A 3IWZA 4NN0A 5FTTC 5I0RA 4PIYA 2YZ4A 5DXDA 3BIWE 3R4SA 1MS1A 1WD4A 3KD4A 2OZJA 5JVVA 1IQAA 4D7TA 1KS4A 1DQ4A 3MF9A 1ZVFA 3OGGA 3POSA 4SLIA 1V6NA 1YXWA 3HBZA 1DU3D 2D6OX 1MEC3 1POV1 1QF3A 4QXKA 2WL1A 4W6XA 1LECA 3RI9A 2OYZA 1SLBA 4XF1A 5L36A 3B01A 1GZWA 2WZPP 1VALA 1KDKA 4ASMB 1ND3A 2IFWA 1D0GA 3OD4A 3AXEA 4CZSA 1QJX3 4XJAA 4ZXKA 4KL1A 4PJYA 4XILA 2Q1ZB 2NLRA 4YFWA 2XKPA 3S7IA 1SACA 1UZZA 4H55A 1RL3A 2ZACA 5GM0A 1G9DA 3ZXKA 5LEKA 5EWSA 1XRUA 1NLSA 1ZREA 4RHV1 3O5SA 4XJ8A 5KXBA 1N1TA 4C1WA 1AF9A 3LAGA 1PVC1 3ROUA 5J09A 1XNDA 1T6GC 2BPA2 5DDJ3 3OY8A 2ZGQA 1N1YA 1CAXB 2W52A 4Q4V1 1H8VA 5I8SA 1COV2 4WM7C 3B9CA 4PF5A 3SCFA 1BEV3 1A3KA 2JICA 5DUVA 3J8F2 3VZMA 4RL7A 3WHUA 4CDQC 5K0UC 2GMMA 1TQ5A 2X8KA 3LSEA 4Q8KA 2PLV1 1QJY2 2A71A 3KCCA 3C2UA 2OUJA 4Y24A 4AEKA 2HEVF 4YGCA 1RUE2 4AI3A 5BNOC 1BBT1 1HRI3 1S0DA 4JGYB 4QPIA 3WCSA 1LHWA 2PHUA 1EV12 4BWOA 4Z82A 5FLHA 1R1A3 4XFHA 5J98B 2K9ZA 3WG1A 4PLOA 5K8SA 3ZSLA 1SFNA 4S2FA 3LCPA 4XMAA 5I93A 1ZRRA 4PDWB 2HWB1 1O4ZA 3ZFFC 3VZKA 3NAPB 5ACA3 3VBHB 3E6CC 2UY9A 3VUOA 1PO21 4FPLA 2PN5A 2WKKA 1MS4A 3VHNA 1PIV1 1LHNA 2AREA 2ZHLA 3AB0A 3H8UA 2PHWA 5GALA 3WNXA 4KG0A 3FBMA 5F5QA 3ZXJA 4ORFA 2GN3A 1ZBA3 4YM1A 1ULCA 5KHGA 1AYN2 1MEC2 3MIHA 4RQPB 4L9BA 1BJQA 1ASJ1 1RJ8A 4LUKA 4EWEA 3VBUC 3ILNA 1SBDA 4HK9A 2C9AA 2GNDA 4N53C 5JDBA 1G8WA 5FO8B 5HBAA 2C5DA 4OI0A 4S2DA 4IV1C 1YI7A 2ZKNA 1VR3A 1EAH3 2HEWF 4XIOA 1QJX2 3M2MA 3M3QA 2LUWA 4IV3A 5HCBA 5A32B 2XLFA 1SQ4A 2WWSA 4Z1VA 1UAIA 1NCRC 5AVAA 5KHIA 3ZFGB 1DQ2A 1CD3G 2WC2A 2KM2A 3CF6E 2QDRA 2PHXA 3KB5A 3H3UA 1XU1A 2WNVC 2R063 1RINA 3RI8A 2DTYA 2D6NA 4WZFA 1ZRDA 2TEPA 4FPGA 4XXPA 3ZXAC 2A6YA 1M4WA 1F8VA 1DZQA 4YFZA 5LK5A 4XTPA 5JOWA 4F3JA 2UYBA 2IFRA 1ZM1A 3E5XA 1LJ7A 4DZGA 2ZHNA 3BPZA 1Q8SA 1H8TC 2ZGKA 1KRIA 1JN2P 2D98A 4QMAA 3NL1A 3VKFC 4QHBA 4G3YC 1YIPA 1BEV2 2XJVA 1V6OA 1YLLA 2D3PA 3M70A 2HEYF 1LESA 3R6SA 1RHI2 3TOJA 2IXIA 4BH9A 3V0BA 4RSUA 1A6CA 3I7DA 1HRI2 2DTWA 4K9SA 1AJOA 1I9RA 4M01A 4AG4A 1X8MA 1OOPC 1R1A2 2YGLA 4BIFA 1TME2 2BNOA 5T50A 2BVVA 2DVBA 3IIAA 1DZRA 1IS3A 2DVDA 1MS0A 2YXSA 1QXJA 1XU2A 1AUYA 5ACA2 1KJRA 2WA4A 5AC91 4OHYA 3IDCB 4LBOA 3VL8A 1VJ2A 5CFDB 2I07B 4FOYA 1LOEA 5CA6A 1N3OA 2QCSB 4LO6B 1V9U3 5H9QA 4AGGA 1WMFA 1DZTA 1GICA 1WLTA 4PDWA 2PA7A 4XF4A 1NY71 1DGWA 4YVSA 2Q5TA 1AR83 3PHMA 2EAKA 1BCXA 2VMHA 2PHLA 4AXOA 4GQ7A 1ZBA2 4AEMA 5IT6A 4AFMA 3AZWA 2VNRA 4JDNA 2A3WA 2CAUA 2WS93 1COV1 2R073 1RUOA 2R16A 1Q43A 1W6MB 1V6IA 3AFKA 3J8F1 3A0KA 1SLLA 4P9GA 1PGL2 4QGLA 3MPPG 3LA2A 4LA3A 1SLIA 3R4DB 4P9LA 1TMF3 1FV2A 1QJY1 2XGXA 1F5FA 1EAH2 5DUUA 3AX4A 4HZFA 4SBVA 5CG9A 4CEYB 2GU9A 1XYPA 4M3CA 3PNAA 5KXDA 2I45A 2UWAA 4KBBA 1ZZ9A 4CDXC 1W6QA 4ATFA 2JEMA 3RJRA 4XBQA 5IUQA 1S0JA 2R062 4OUSA 1JH5A 4EN6B 5C8CC 3FLRA 2O1QA 2MPFA 4B3NA 1Y9QA 5C33A 1AR63 1G9BA 2GDFA 3QCWA 1FMD3 4KU8A 2ZMLA 3V0AA 3E5QA 1RC6A 2D5HA 5CFCB 2H6CA 1NA1B 4BA6A 5JSOA 1KITA 4L97A 2RMU1 2UURA 3ZDSA 2VNOA 2WSUA 4IEPA 1AYN1 4AK3A 1MEC1 3IPVA 4QD2A 2PTMA 2JG8C 3VHPA 3WUCA 4AFAA 1ZZCA 3ZSKA 3MICA 3THPA 1VBB3 1HX6A 4AFBA 3FBYA 3PMSA 4BHPA 1RUD3 4LR4A 2F4PA 3RYRA 3AMNA 2Y26A 2XHKA 4FOVA 4OI2A 4AFCA 4CDWB 4AVAA 5AFBA 1CQ9A 1BYHA 2WT0A 2YY1A 4KWKA 4CDUB 1QJX1 2VVFA 5F6KA 4FPJA 2D43A 5FBZA 2DCZA 5JSRA 1WCKA 4AI1A 4RS5A 3ETQA 1WCSA 2GH8A 2VOXA 3ZMOA 3ENRA 2VH9A 4KGQA 2NM1A 2R30A 2XB6C 2Q4SA 4Y1ZA 1ZBE3 1XE7A 3GF6A 4EN9B 5K0UA 1V9U2 3OGJA 4IEVA 4Y1YA 4DINB 4DPNA 4UW6A 2ZX1A 3M3CA 2FHRA 4C91A 1EYBA 5BNOA 3GZTB 3KCYA 4AYUA 1AR82 2HWD3 3WW2A 1R1ZA 1D4M1 2IC1A 3CJIB 4IXLA 4MSVA 3M7AA 3USUA 4IEOA 4XPVA 5CAZA 2WS92 1PVC3 3NV2A 1G9CA 1GLHA 4HETA 2R072 1HXS3 3O14A 4FP3A 1BEV1 5J3UA 2ENRA 3PVEA 4WVVA 4B8EA 4R52A 3WHTA 3WD5A 1LGCA 4M0HA 1RHI1 3VBOA 2SBAA 1TMF2 4R4XA 4ITCA 1Q3EA 2ZX4A 4YNIA 1HRI1 2WNUC 4HVOA 1RUJ1 3OBRA 3WT3A 1W6NA 3N7JA 4CRQA 2PLV3 3TAYA 5T5JA 1ENRA 4JTOA 4YVWB 2D3SA 4B29A 3UK9A 1FATA 4XDQA 4XXAA 1TME1 3WDWA 4UXAA 1VAKA 2EALA 5KHKA 2DVFA 5ACA1 3VBUA 4N53A 3THTA 1MVQA 4JGZB 4HVQA 5J96B 1IS6A 3NWKA 1D0HA 2IZWA 1OLQA 2JG9A 4FPCA 4BE3A 1OHFA 1AR62 2HWB3 2EXHA 1FMD2 1GQGA 4QQ2A 3RZZA 2R49A 1U0AA 2BWCA 1PO23 4MLOA 5GZGA 4BOWA 1LU2A 4PLNA 1GQHA 4E2QA 1O5LA 2ET1A 5J37A 1ZBA1 2GSYA 4K20A 1PIV3 4LA2A 3LB9A 4GMP1 4RR3C 3FE5A 3WDVA 1NE4A 3QOPA 3FUQA 4YGDA 3M1HA 3MGUA 2WNVA 4QM8A 1VBB2 2W08A 1VBE3 4XETA 1PGL1 4D69A 1B09A 1RUD2 5JI7A 4DOUA 4R8HA 3S7EA 3VLBB 1ASJ3 1QOTA 3VDDC 1IKQA 3CLPA 1EAH1 4B7KA 3WDTA 4QQLA 1WLWA 5I91A 2YDEA 2WZR1 1OQEA 1DQ5A 3I2DA 4QPGB 4RGAA 1AYM3 4META 1BXHA 1UPIA 1K5MB 3ZX7A 3SCHA 1DBNA 1S0GA 4FP2A 1ZBE2 1PGW2 2VECA 1GV9A 4AEDB 4CEWA 1XYNA 1ND2B 1YCIA 4DXZA 1QNYA 1PK6A 3HT1A 4I3PA 1KFUL 3GZUC 4F83A 1LB2A 3SHRA 4QGMA 2HWD2 4W6YA 4FPFA 3VBFB 3ZIWA 1OOPA 4GKXA 5T3NA 1B35A 2PELA 1GR3A 1D2SA 1PVC2 3H1YA 1IS5A 2GH2A 4AVCA 2A7AA 1HXS2 1G9FA 1SMVA 4IV3C 1X36A 1AZDA 4FPYA 1YYNA 5KBFA 2MEV3 2OPKA 2CNAA 2VULA 3WQ0A 3AXDA 5AFEA 5K7PA 3M3OA 4X6RB 4DFSA 1PZ9A 2PHDA 3TWIA 3EQEA 1H2LA 2G9GA 2CTVA 1WW7A 3VKLA 4N7UA 5C4WB 1KXGA 4XHBA 2XJTA 4IETA 3WW4A 2FMYA 4XBLA 1N47A 3OF1A 4LO4B 1ENSA 4OVEA 4EROA 1J59A 2A3XA 5JI9A 3MDPA 5JMCA 1XNBA 2EXJA 3IDBB 4COUA 4DQAA 1PGSA 4JCKA 2D5FA 4K40A 3VHOA 3QD6A 2HWB2 3ZYJB 2P2KA 4AWDA 3FFZA 3H7YA 4H3WA 4XJUA 5AC93 1CJPA 3ZFEB 1PO22 2E51A 4L99A 5C8WA 5EJ3A 3IDEA 3ES4A 2D7FA 3VBRB 2I74A 1PIV2 4CDXA 4C90A 1UX6A 4FCAA 4I0AA 3RPQA 2FBEA 4AHYA 1IS4A 1DF0A 4LULA 3GHNA 3DGTA 2R071 5FPXA 2ERFA 2A6VA 5D8AB 3QH7A 3ASIA 4M3CE 1VBE2 1H4HA 3W9AA 1QNWA 1AR91 1COV3 1CX4A 2ZKLA 5GZFA 1ASJ2 1U5ZA 4JGYC 2ZABA 4XOGA 2NYYA 2WLQA 1FT9A 4YRDA 4I30A 3ELNA 5LRSA 4LE3A 3AMHA 4YYOA 4YG3A 1J3RA 1HLCA 3QLQA 1PZ8A 1AYM2 1DQ0A 1R081 4PDWC 4HPKB 5JPNB 4XQDA 5FAXA 2ZGLA 1NXD1 2PAMA 4I0WB 1GBGA 3AKQA 1DG6A 4JQRA 3ZN6A 1OSGA 2R6QA 2PFWA 3AZZA 3IN9A 2AYHA 1AR61 2HJIA 2VXRA 3KZ4C 2Y0IA 2ZGOA 4AHWA 2NMNA 4HL0A 4R9BA 2OW4A 2Z5WA 3C3VA 4H7MA 1RUI3 1PZ7A 2VOVA 1YIFA 1LOCA 1UW8A 4QQOA 5JZGB 1HV1A 1ULEA 3N7KA 2RMU3 4MGYE 4YW4A 4N43B 1NXMA 5FREA 4E2SA 2D3RA 1HKDA 3FMGA 1VBB1 1AYN3 2MEV2 1M06G 3WUDA 3LA7A 1RUD1 4NO4A 3U07A 1NZCA 3H50A 4IQPA 2GNTA 1C1LA 4I09A 1BQPA 1NLRA 1CESA 3ZFGC 4Q1PA 5DG1A 1WBLA 3M3IA 5E89A 1C5IA 3NV1A 2XJUA 4GH4A 3UL2A 4JDOA 2E7TA 1H30A 3M4FA 2JE9A 1ZBE1 1PGW1 3WR0A 1LR5A 1R093 2G9FA 1RMU1 1V6LA 5AC92 4FT8A 2FZ2A 4HKLA 2WNUA 1Y7BA 1LCLA 1LGNA 5AVPA 1CAWB 2HWD1 4X8NA 4YGBA 3WQ7A 2BYVE 5JWPA 1ENQA 4U2AA 2PHFA 1VB2A 2D6PA 1NY72 1W6OB 1O3SA 5BNNB 4FQ4A 1NCQA 3ZFEA 1D4M3 1HXS1 3WDYA 4KNCA 1MQTA 3KGLA 5J36A 5T5OA 4RS5C 1BZWA 4BYYA 2K2SA 2BNNA 1HQLA 4DB5A 3NV4A 4K6BA 1PNFA 5FO9B 3AKTA 2RE9A 1CAVA 5DG2A 5A33B 2A75A 4OULA 4GA9A 1E57A 2QNKA 4PBPA 2H0BA 2OIIA 1RHI3 1QXPA 4XMIA 3KGZA 1PNGA 1JOJA 2NMOA 3SMHA 1ZZ6A 5T5PA 3POYA 4R4ZA 4ES8A 1RUJ3 5DZEA 4RR3A 5CFDC 4BIOA 3JZVA 2HWF1 1JBCA 1H2KA 3L2HA 4CTEA 2E63A 1TME3 5JOZA 3TYJA 1MZ6A 2C0ZA 1OA3A 2ZGPA 3BCWA 4COWA 4OLLA 3VDDA 3DV8A 1AXZA 1AL0G 4OI1A 3VBOC 3ZN4A 2LALA 4LO7A 1RUI2 4MV2A 4TYSA 4UW5A 4XFFA 3AJYA 4Q4W1 4Q0VA 4Q4X3 1QMJA 2XL9A 2RMU2 1H9PA 2VQ0A 4QT6A 3OJBA 4IERA 3TNPB 4TSVA 1J3PA 3H1WA 3CU7A 1A8MA 2OZ6A 1VBE1 2R0FA 1QY4A 4GMP3 2BGCA 4NPRA 4YG6A 1S55A 2RR11 2BTVC 2DCKA 1O3RA 2WA3A 4CEYC 3K51A 2Y0OA 4N43A 1LOGA 5LK7B 2XVLA 2JG9C 4NR1A 2EF6A 2NPIA 4UBHA 5C9AB 4XE9A 1AYM1 4RA0A 4YZ4A 1UIJA 2GZWA 4JV4A 2XLAA 2VMGA 1POV0 1ZNPA 1KJLA 1LTEA 4QU2A 3V65A 5T52A 2WZR3 4Y4YA 3GALA 1CAUB 4XFBA 3FWEA 4QM9A 2JKBA 5GLZA 4LBNA 1R092 2OUHA 4JVAA 4Y1VA 3DKWA 3I8TA 5CFCC 2YYOA 2JX9A 3N4MA 4CP0A 5BXXA 2D6MA 1EPZA 5GLVA 4AVVA 4HLTA 1X82A 2UY8A 3JQXA 5BNPB 3LGRA 4XIKA 2D40A 1AX0A 1VB4A 1WLCA 1D4M2 4OZXA 1RUH3 2RS13 4J1XA 4JRLA 5LRRA 3H0OA 1PO13 1DQ6A 1SDWA 5FOBB 4GULA 1LOFA 3O0XA 5FLJA 4Q1RA 5GKAC 4CDWC 2MEV1 2GMPA