3H8UA

Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
122
structure length
121
Chain Sequence
VNMRAETESRIFSVDEYVRPSNGEPIRSVVLETNDSVVVVWHAHPGQEIASHHPHGQDTWTVISGEAEYHQGNGIVTHLKAGDIAIAKPGQVHGAMNSGPEPFIFVSVVAPGNAGFALAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein with double-stranded beta-
publication title Crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (YP_001338853.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.80 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Structural genomics, unknown function
total genus 19
structure length 121
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3h8uA00
5I8YA 4IEYA 5JSPA 1OFNA 1X7NA 4EROA 5E1RA 1LB2A 4HBNA 3CF6E 5I0UA 3O14A 3ETQA 5FCCA 2IXHA 3RNSA 4IEVA 4Q0SA 1FXZA 5EZWA 3OCPA 4DINB 4MUVA 2DCTA 2XLFA 1HW5A 3OGJA 3RYRA 3I54A 4XFGA 4PIXA 4META 2GC0A 5FQ0B 3BALA 1X82A 2UY9A 5JCTA 4B29A 1Y9QA 3EJKA 3M70A 3LAGA 4IERA 4WVZA 1YUDA 5AVPA 3I59B 1LKNA 1I5ZA 1PMIA 4KU8A 4XF1A 4FBFA 5I91A 5FQ0A 2Q1ZB 4HZFA 4O9GA 1Y3TA 4LUKA 2IXLA 2Q0AA 4TLFA 2HJIA 4AVAA 1O3SA 1OD5A 1CAUB 3H7JA 3EQEA 3H50A 3I59A 4QMAA 4LULA 2E9QA 3H8UA 5JR7B 2XHKA 4UXAA 4WZCA 4QM8A 5C8WA 4XF9A 1RGSA 3MDPA 1CAUA 5I0SA 3H9AA 4BH9A 2ET7A 3FHIB 5I93A 1X8EA 1CAXB 1DGWA 3M3IA 3LA3A 1UIKA 4HMZA 2OYZA 3U0ZA 3NKTA 3IBMA 3HIFA 2XKOA 2K9ZA 4QX5A 2B5HA 3ELNA 1CAXA 4I2OA 1SFNA 4I0AA 4PIYA 4LLOA 3H3UA 2UYBA 2XGXA 4XF4A 1YLLA 3OTFA 4NVPA 4F7ZA 3CLPA 4J1XA 2K0GA 3WW1A 3IIAA 5BXXA 1RC6A 4N9IA 2CV6A 3SCFA 5J48A 3U10A 2VECA 2CAVA 4HVRA 5FPZA 4P9GA 2O1QA 3E5UA 2EA7A 2GC2A 1LRHA 1O5LA 3MYXA 1Q43A 5D1IA 4MGKE 3EHKA 1L3JA 5CU1A 3E6CC 4BIFA 3HT1A 4BHPA 1YHFA 1RTVA 1QY4A 3CEWA 3BU7A 4L11A 5KHIA 4IEZA 1G6NA 4XETA 3DKWA 1RL3A 1VP6A 3TNPB 1YFXA 3FX3A 3OF1A 4OLLA 4WBBA 4EWAA 3G7DA 3R6SA 1EPZA 1GQHA 1TQ5A 3GYDA 1WGPA 3CL1A 4EWEA 5F1RA 2XL7A 3SCHA 1EP0A 1UIJA 1IPKA 2WFPA 4D7TA 4KWLA 1Q5OA 4FAHA 1EYBA 1RUNA 4ONUA 3C3VA 3SHRA 1Q3EA 1J3QA 4AQ6A 2PA7A 4QXKA 4MH0E 1O4TA 2XKPA 3JZVA 4IEOA 3UKTA 4Q0PA 5E16A 2PAKA 3H7YA 4HSLA 1ZZ6A 1I6XA 4AQ2A 2QVSB 1SEFA 4CYDA 4KL1A 1YFYA 1YFWA 4HVQA 1WA4A 4XFBA 4N9HA 3VHRA 4XF0A 1QWRA 3FJSA 2ETEA 2FMYA 4I3PA 1CAWB 5FLIA 5BV6A 1DGRA 3E5XA 4D7SA 2FQPA 3FWEA 2GZWA 2WC2A 5LRRA 1H1MA 4K8FA 3WW4A 3SMHA 3WW2A 2KXLA 4I01A 1O3TA 1CAWA 4UBGA 4E2GA 2EVXA 2Y0OA 4YYOA 2PTMA 3RPQA 3HT2A 3SCGA 2QDRA 3S7IA 2UYAA 4EV0A 3SXWA 2BGCA 5LEJA 3BPZA 1QXRA 4IESA 1FI2A 4HN0A 2H6CA 4QGNA 5KBFA 1O7FA 3UKVA 3DV8A 4JVAA 2GC1A 2D5FA 4HLTA 3MZHA 3ES4A 5EFUA 4JTNA 5I0TA 4Q0UA 1J3PA 3KMHA 5JAXA 3PVBB 4XFIA 4QM9A 1ZRFA 1X8MA 4I09A 5BY5A 2PYTA 3PNAA 3BB6A 3MPBA 4R8HA 2B9UA 4A2UA 4Q0QA 4FT8A 3UKNA 5FPXA 3E97A 3BCWA 1GQGA 5LRSA 5LEKA 2V09A 4LA3A 4ZU4A 2UY8A 5J7MA 4Z07A 2Q4SA 3LA7A 4MV2A 5FLHA 1XE7A 3FFQA 1PM7A 1ZRCA 2IXCA 1UCXA 2PAMA 2XLAA 4EWDA 4I02A 3EBRA 3EO6A 4X6QB 1UD1A 3NW4A 4LTAA 2QCSB 2H6BA 3D0JA 3KGZA 2ZCWA 4Z82A 2IXKA 4KU7A 1ZRRA 1ZX5A 3E6BA 2PFWA 3RYPA 3RYKA 1YFUA 1NYWA 3GBFA 2QJVA 2HKXA 4KWKA 4PJYA 4MGYE 3KSCA 3LZZA 1J59A 1CGPA 4IEWA 2O8QA 3NJZA 1DZRA 1UW8A 4BYYA 3NL1A 2BYVE 4LA2A 3DN7A 4IEQA 4LEJA 3E6DA 1RUOA 4Q0VA 2GH2A 3RZZA 1CAVA 5KHHA 3KGLA 2OZ6A 3D82A 1O3QA 2N7GA 3ZDSA 2D40A 5I8TA 4XF3A 4ZU5A 1DZTA 4HN1A 3CO2A 3L2HA 3ST7A 4E2SA 2PAEA 4LUMA 3DL3A 2P17A 2B8MA 1ZZ8A 5I8SA 1ZZBA 2I45A 5C6CA 1QXJA 3RDIA 2EAAA 3QACA 3FE5A 1NZCA 1ZRDA 1ZNPA 5KHGA 4ZU7A 3S0MA 4E2QA 2MPFA 1ZZCA 2OZJA 4F8AA 4IEUA 2ET1A 1UPIA 3WW3A 3FZ3A 1NE6A 3IWZA 4J1WA 4MX3A 4R52A 1LR5A 3NSTA 2PHLA 4Q29A 1VJ2A 2OA2A 1ZVFA 3D0SA 3H1YA 4XEZA 2ATFA 3OD0A 5I0RA 5JSRA 3IDBB 1J1LA 3ACLA 5FLJA 4AVBA 4UBHA 4XFFA 4X6RB 3QOPA 1CX4A 2ZKLA 5JSOA 5BPXA 3CJXA 4MZUA 2XL9A 3TNQA 4L2NA 3ROUA 2VPVA 4AVCA 1FT9A 4QGLA 4JTOA 4MGIE 4XFHA 1ZZ7A 5BUVA 3N4MA 5KHJA 4FAGA 3PLQA 4ORFA 1EY2A 1OMIA 2F4PA 3H3ZA 4QGMA 3KCCA 3LOIA 1JUHA 5J3UA 4PIZA 1VR3A 3H1WA 4HSJA 3E5QA 2CGPA 4I0BA 2MNGA 2D5HA 5FDBA 4JV4A 1XE8A 1ZZ9A 4MGZE 4YNIA 4HVOA 2QNKA 2D93A 4XFCA 1OI6A 1O5UA 2PHDA 1U12A 2GU9A 2PQQA 1J58A 3H1MA 2Q30A 5CVRA 1XRUA 2XLGA 5HI0A 2Z2SB 4O9EA 2CAUA 4RD7A 5KHKA 3S7EA 2MHFA 1O3RA 1YWKA 1CAVB 1SQ4A 2BEOA 4KWJA 2VQAA 2BNMA 3USSA 3I7DA 3B02A 2H0VA 3LA2A 1WLTA 2IC1A 1NE4A 2BNNA 1J3RA 2IXIA 4IEXA 4XFAA 4H7LA 4YARA 4IETA 1IPJA 3IDCB 2IXJA 4OFGA 3HQXA 3LWCA 3NVCA 1H1IA 2OPKA 5K8SA 2Z69A 5T3NA 4IEPA 4YSFA 2GAUA 3ES1A 1NXMA 2GC3A 4GULA 2BNOA 4AXOA 3U11A 1ZREA 5CADA 2C0ZA 4YRDA 1V70A
chains in the Genus database with same CATH superfamily
4CTEA 5FPAA 2E33A 3GGLA 5JSPA 1GR3A 3HPNA 1X7NA 4JDNA 1LGCA 2HLEA 5E1RA 4NIIA 5J37A 1RB8G 1JI6A 3CF6E 2VZUA 3O14A 1UYZA 3WP3A 2QZ2A 2W68A 1HB2A 4QX0A 2JG8A 5FCCA 1UX6A 2WIIB 4WM7B 3RNSA 3WINE 2VVDA 2CY6A 4X8NA 3VBRB 4EN8B 1YRZA 2X29A 3UL2A 4S2HA 5HCFA 4RR3C 4FTBA 2DCTA 1BKZA 3AKPA 3ZSEA 3QH6A 4AEDC 2FCUA 3R4DB 3OGJA 3BGAA 2ES3A 1H30A 2XBO2 1NY72 2LTNA 2A3XA 3I54A 2LW8A 1C4RA 4MVTA 4WM7A 3AFGA 1OF4A 3A23A 2OKXA 5F9TA 2RJ2A 3VBRA 4BISA 1QNYA 2HWB1 4PF1A 1H2LA 5A1AA 4I0WB 2GC0A 4N53C 3O1VA 2ZGLA 1MZEA 1SPPB 1DGRN 4GWIA 5FQ0B 2HWD3 1QJX1 3P6BA 1X82A 5IHRA 1OOPC 3KQ4B 4C0BA 5JCTA 4ZY9A 3RWNA 1HRV1 2CNAA 3LAGA 3M70A 4M01A 2ZKNA 3DXUA 1YUDA 3VD4A 1XE0A 1OUXA 1LKNA 3ACFA 3M2MA 4P02B 1SPPA 1C1FA 4XF1A 4AWDA 5CKNA 5FQ0A 2Q1ZB 4HZFA 1W3VA 3NRUA 4DOUA 4TTGA 3JB8A 5FZFA 3PUHA 1YQ6A 2Q0AA 2VZQA 3TB0A 1KS4A 4PHZA 1YO8A 2HJIA 4FOVA 1O3SA 3Q8EA 1QKQA 2A3WA 1LCLA 2ADEA 3N36A 5JMOA 5EYYA 1DDLA 1VRH3 2HEYF 1S2EA 2HWB2 3A21A 1V9U1 5FKBA 3H8UA 2RDNA 3IIIA 3GZAA 4CDQA 1MVQA 1R1A1 3AVSA 3J7HA 1QJX2 4WZCA 1F8VA 2D3RA 4QM8A 4AL9A 4XYXA 5GLWA 1N1YA 2Y8KA 1MS1A 5A6QA 1G9AA 1HRV2 1SLLA 1DZQA 5F2WA 3CHXA 5I0SA 4BH9A 1LOCA 2B7YA 5F39A 4XDOA 2HWF3 2PHUA 2DUQA 4AI1A 4QX7A 5TSWA 3LGRA 4K7JA 3A22A 1UIKA 5FXZA 5BNQA 4NIHA 4Y1YA 3VDBA 3VKMA 1V9U2 3JD71 4LO5B 4QQOA 5IAXA 1S0DA 3BN6A 1R1A2 4YW6A 2XKOA 1PVC1 4YGCA 4QX5A 3MUZ1 2B5HA 3MV01 3ZLIA 2MEV1 3ELNA 4IL7A 2VOKA 4XIOA 2JECA 1SFNA 3M4FA 1W9TA 1UZYA 4DIQA 3M3OA 2L9LA 3HMYA 5KC6A 1IQDC 1GOGA 1VMHA 5FZ9A 3B93A 3H3UA 4XF4A 3VLBB 1CIWA 4SBVA 4DY5A 4NIGA 1ULEA 3KT1A 1DCSA 4JDOA 3ZFEC 1SFPA 3OEBA 4PF5A 5JR2A 1YEWA 3FN9A 4GJYA 3NV2A 3RWKX 4L97A 2HBTA 2BW8A 3AZYA 4LKDA 3POJA 4LOSA 4ISQA 1XYOA 3JD72 2DVDA 3U10A 2WO2A 1OH3A 3S6PA 1CPNA 3FBYA 5FZLA 1PVC2 4U2AA 3E5UA 3LDKA 4CRQA 4O61A 2VL4A 1LRHA 1O5LA 3MYXA 2MEV2 4MGKE 2VBPA 3EHKA 4TXWA 4BHPA 1YHFA 4YZ4A 1CVNA 1W0OA 2BOIA 2ZHMA 4L11A 2R6QA 2JD9A 4QXBA 5DAXA 3OEAA 4DZGA 5C4WC 5HCAA 5FZGA 3J8F3 2RS53 3IMNA 2ZA9A 3FX3A 2ZEWA 2ZOEB 4P9WA 5JXGA 4AGVA 1BK1A 5FY4A 3W5MA 1JU3A 5DUXA 4A4AA 4EWAA 4AFBA 3R6SA 3BKZA 2ZGPA 2RS33 1MR5A 3LEMA 1SLCA 1TQ5A 2ARCA 4XUOA 4EWEA 4MO3M 3GZEA 3VZKA 3RZLA 2RVAA 4I30A 2AEYA 1UIJA 2E6VA 4ZZ8A 3UESA 4D7TA 1GZ9A 1VAMA 4AQTA 1KFUL 2HWC1 1UO9A 2NLRA 3WF1A 4BLIA 2Z79A 5KR7A 1W6QB 1GP6A 4BJ0A 1J3QA 4KG0A 1E5IA 5CB7A 5C9AB 3M8LA 4MGQA 2EXHA 2WN2A 2JG8C 3H7YA 2RR13 3P3NA 4HSLA 4ZS3A 1VIWB 1Y9MA 3E1F1 3SH5A 1ZZ6A 1SACA 1WUVA 2VUJA 3WNOA 3GDBA 2ZGNA 4HANA 2YU2A 4CYDA 2JDZA 2WYFA 4KL1A 4M3CE 1WA4A 1W6QA 3ITQA 3N7KA 4FFHA 4J6GA 4Y24A 5T54A 5A3LA 1WLDA 5M0TA 5C9AA 4I3PA 3VBFB 3E5XA 4QQLA 2XXZA 4WM7C 4MOAA 1BCXA 3T4HB 3I3MA 2R1BA 3PVOA 3EB7A 3CBNA 1V6OA 5JOWA 1XXNA 4YGEA 5C3PA 4LIUA 4QD2A 1PO21 4I01A 4CXYA 3VBFA 2VW0A 5JOXA 5F7UA 5I93A 2E7TA 4YYOA 2PTMA 4K6BA 1AYM3 2AENA 3ZXKA 2G9FA 4ATEA 2C9KA 1CPMA 5F5IA 4GB32 1SLTA 2Y6FA 3HT2A 1NXD1 1OC1A 1HDKA 2Q1MA 2ZHKA 4JGYC 1NLSA 2QDRA 2VMCA 1V6LA 4NUBA 5FV3A 4AHYA 1OLQA 1NX9A 2W1QA 4JHTA 4URTA 1QXRA 5T52A 3MIBA 1RUI3 4HN0A 1SFYA 5FWEA 4YM3A 1QXPA 4YVWB 3LPGA 4QGNA 3SNMA 2J1RA 2D43A 2EXIA 2WNOA 5C5UA 1KEXA 2A6VA 3O12A 4OHXA 1O4ZA 3DV8A 3TEXA 1IHMA 1VLNA 2VQ0A 1L7LA 1XOYA 3GZTB 1DP0A 5T5LA 5FP4A 4W6YA 2G9ZA 4Q0UA 3KMHA 3MF9A 4YVWA 3ZYGA 2WLQA 4QPIB 3KV6A 1U5IA 3PIGA 3A0NA 2XQXA 1TZOA 4W8JA 3T0DA 1LHOA 4I09A 5BY5A 1LESA 3HN1A 3L9JT 4COWA 3MPBA 4R8HA 2B9UA 4LJHA 3DYMA 4CCKA 3NNGA 3UKNA 3VDDB 1MS3A 3WF4A 1GV9A 4IDZA 3BCWA 4QB6A 1XU1A 2NPIA 4Y26A 5K7PA 1JYXA 3POEA 2NQYA 4NHLA 1UY4A 4QPIA 3ZDVA 5APAA 2EIDA 1S55A 1FMD1 1S0JA 2YU1A 3RI9A 5GZGA 2DCKA 2UY8A 3KZ4C 2JICA 2Q4SA 3N9OA 4Z07A 3VV1A 3FFQA 1DGLA 4G4FA 2ZMNA 3USUB 3VDDA 1BQPA 3O1SA 1TMF3 3GJBA 1OA3A 4A44A 2P6CA 2JENA 1GANA 4X6QB 3U14A 2WL1A 4CDWB 2WS93 2F17A 1GNZA 2H6BA 3D0JA 4KNCA 3KGZA 3O1UA 2C4XA 4Z82A 4TN7A 5A6XA 2X10A 2VOWA 3N7MA 5T50A 1XQNA 3RRDA 2IXKA 3J4UH 3USUA 3AYEA 2FDKA 2ZBJA 4UYBA 1VRBA 1QJZA 4JKLA 3N9NA 3OBRA 2VQTA 4Z2WA 3ZXFA 2FDJA 1Z0HA 2WN3A 5F5QA 1Q8VA 4MGYE 2JDKA 3K3OA 5GM0A 2BWAA 4ES8A 4YVSB 5HCBA 3KV5A 2HBUA 4IEWA 3ILRA 2FDIA 1AZDA 1ENRA 3NJZA 4M3CF 5FP7A 1OLMA 3MIGA 5JVVA 1UW8A 2RM23 4AE2A 3ZSMA 4BYYA 2XJSA 2WNUB 3FMGA 2BYVE 2HWD2 2EIEA 3TRSB 1QOTA 5B2GB 1O59A 4WVVA 5DN2A 5ERLA 4Q0VA 2XOMA 2GH2A 1HV1A 5LY1A 3RZZA 2J1AA 3VZMA 1NQDA 4NMIA 1RUC3 4YVSA 2VNVA 1QMJA 4KMQA 3O1TA 1YCIA 4Y20B 3BIEA 1PGL2 3BODA 4LORA 1GKBA 1RUD1 2NZ9A 4QB1A 2WNUA 1VAKA 3MF6A 4MADA 2JWPA 3AL6A 1YJKA 1UU4A 4ZU5A 2KR2A 1DZTA 1C57A 4KG8A 5AVAA 1AXYA 1VRH2 3AMPA 3ME2A 1QDCA 1QNWA 2DF7A 2YBKA 4NWVA 1LOFA 4Y20A 3H3LA 4HPKB 1POV3 4OZOA 4ITCA 3CQOA 3M3EA 3OB8A 3RGBA 3ZR6A 2EALA 4E2SA 4COYA 1CZSA 2PAEA 3KV9A 3R0RA 3MO4A 5JLVA 2VULA 3HNBM 1NZIA 2B8MA 1DFQA 1ZZ8A 5A3MA 3GZUC 3I2OA 1WW6A 5AC93 5I8SA 1D0HA 4OUEA 3UJQA 4HPKA 4AI9A 4NN0A 2EAAA 4NHXA 3FE5A 1UMHA 2HWF2 2B42B 4BCUA 5FZDA 1TME1 1XJAA 3OUHA 4LE3A 3MW2A 2JDHA 3D5OA 4IGPA 5C9AC 2ZGOA 4K3UA 5FUPA 2ZX2A 3K51A 4A3XA 4DO0A 2Y34A 3CKHA 1KD7A 3WCRA 2OZJA 1T2XA 3KT4A 4DUXA 4DPNA 3S57A 3LOBA 4D6SA 2VU9A 1RIRA 2DUPA 3LEIA 3PTYA 3W20A 2C6SA 4J1WA 3GHNA 3W9AA 2QQVA 4HL0A 3KD4A 3SH3A 3WDUA 1VJ2A 3AKTA 3MIHA 1ZVFA 3N9QA 3D0SA 4PDWB 3TN93 3VBFC 5C33A 2VZ1A 3PHMA 4YZ1A 4UFJA 4XEZA 1IPSA 3OD0A 5HCHA 3ZXGA 4A45A 3IDBB 3NV3A 4LBNA 4P9XA 1WMFA 1KITA 4ASKA 2BPA2 1QOOA 1CX4A 1H2MA 2WZR3 4UFLA 1GZWB 3WQ7A 2VNOA 2YC0A 4PDWA 1REFA 4DEVA 2YMZA 5IJRA 3HBKA 4MZUA 1JOJA 2XBO3 1M06G 2EF6A 2R073 1JYWA 1FT9A 2WSUA 2GMPA 4JTOA 4GALA 1K5MA 2P37A 5BNPB 3J7MA 2ZHLA 3MW4A 4ORFA 1PX3A 1EY2A 2P1BA 4XUTA 1OURA 3H3ZA 4BM8A 1PZ7A 4Y1VA 4ASMB 4BLJA 2HEWF 3LOIA 2JDAA 3EXUA 3LFIA 4YVWC 5J3UA 1CX1A 3J8F2 4XXAA 3NMBA 4Q1RA 4Q8LA 5BNPA 3VD3A 5DZGA 5FMDA 4C1WA 4AHWA 4QDQA 4ZXKA 3NNMA 2MNGA 4I0BA 1ULOA 2ZGMA 4QDRA 3C7OA 4JV4A 4XMIA 5IVEA 1ZZ9A 2QNKA 4AHXA 4ASLA 5J7MA 2IFRA 2ZABA 2P6HA 2QQUA 4P00B 4AEKA 3AZXA 1AYN1 3I2JA 3VDCA 4QPIC 5JOYA 5FMCA 4DRRA 4XHXA 2HWB3 1G9DA 3KWVA 1OLRA 4GKXA 1W2OA 4LE4A 4OQ9A 1QJX3 3T30A 5DAVA 2VZOA 2XJQA 1XRUA 4RSUA 1ZBA1 1LGNA 1WW4A 3VD7A 1HX6A 1ODNA 1HRV3 4AI2A 1ONAA 4GWNA 2WA4A 3OSDA 4RD7A 4IW3A 3OGVA 5IK7A 3PUQA 3S7EA 2MHFA 2RR12 2R16A 1W6MB 2BEOA 4KWJA 4P08A 2WR9A 5A7WB 1K12A 2GDFA 2A3YA 2EXJA 4QB2A 4QX3A 3VB9A 3KF5A 4P9IA 1J3RA 1MQTB 5ABJB 4IEXA 1LODA 1F4AA 3H8RA 3JBG1 5F6LB 1D4M1 1V9U3 1WZXA 2DBIA 2P5BA 3AKQA 1GNHA 5LA2A 1R1A3 2WFF1 4LITA 1W6MA 4NPLA 4PLOA 5A7WA 1G7YA 2ZEYA 4AEMA 4CUBA 3RZGA 1TNRA 5C70A 3R4UA 5T3NA 1JXNA 3SKJE 1MQTA 5EJZB 2J1VA 5ABJA 3ES1A 4LHSA 4RR3B 3O7OA 4LBJA 2C26A 5F37A 4U36A 2IUWA 4GULA 4CCOA 2E51A 1T6GC 1LULA 2YBSA 1HRI1 4LKEA 4URAA 4IV1B 1AYM2 5HXVA 1JZ4A 1XNBA 2VE1A 4YVSC 3AYAA 4N43A 2AREA 3I2GA 4OI2A 2C0ZA 2QZ3A 4FPHA 4IEYA 1VMFA 4UFIA 4N53B 4RA0A 2WNUC 4C8DA 4EROA 2VMDA 4RR3A 1LB2A 3JBG2 4OVEA 2DCYA 1D4M2 2WNVB 3JD73 1DBNA 5FYHA 4Z2AA 2WO3A 3ETQA 3MFCA 4A7KA 2OUJA 3WQ0A 1UKRA 2WFF2 5K4LA 1PVC3 5FUNA 1MZ5A 3OY8B 4IV1A 2J1EA 3DYOA 5JDBA 2VR4A 3BOPA 4GIQA 2MEV3 2PMWB 1LOFC 4Q0SA 4QQPA 2XJVA 5CFCB 4AGGA 1GU3A 5EZWA 3F2ZA 2GMEA 3GHMA 4MUVA 5FXVA 3WHTA 3QLQA 4BXSV 2WNVA 2D6NA 1HRI2 2A70A 1V0AA 2OPWA 3OY8A 2FDGA 1QQP1 3A7QA 1BJQA 1H4HA 1CR7A 4N7IA 2PHRA 4XFGA 5CFCA 3O1RA 2WAOA 3KM5A 1N3PA 5CKQA 4F3JA 3VL9A 2W91A 4YW7A 5A7OA 1US3A 2YFZA 5FPLA 1AR91 1KS5A 2QUOA 4NIDA 2CTVA 3POSA 3ZXEA 2P4EA 2DDUA 4QWNA 4WVZA 3VBSC 4Z8BA 2X05A 1XNTA 2EIGA 5AVPA 1PMIA 5CA6A 1H9WA 2WA3A 5JPNB 1ZA4A 3R4SA 2ARBA 4CDXB 2X8KA 4JX0A 4D7YA 4TLFA 4AVAA 4CA9A 2WT0A 4K9SA 5KXEA 2JE8A 1CAUB 2JB4A 3EQEA 3U37A 3WXPA 4QKDA 4ARXA 4LULA 4ES9A 1JOPA 5GLTA 2W47A 2WS92 5JR7B 1K42A 1POQA 2XHKA 1LJ7A 2BQPA 3D8CA 5A3PA 1AR92 4ARYA 1AR61 4CDXA 5A3NA 3B3QE 2E53A 2JXAA 3NNJA 5C8WA 3KV4A 3WR0A 1ZBE1 4D6QA 4XF9A 1CAUA 4K1ZA 4CPBD 5DUUA 2ET7A 4XQWA 3WT3A 1TEIA 4HKWA 2HWC3 3FUOA 3NO8A 3HR9A 1K5MC 2Y6LA 4GMP0 4NIAA 3NAPB 1CQ9A 1X8EA 1UKGA 2Y6JA 4DUWA 2BTVC 3PJYA 5AFBA 3WVJA 4XDPA 2OYZA 3MIDA 1WW5A 1IS6A 4L99A 3NKTA 3U0ZA 1GP5A 1NOVA 2D3SA 5FYVA 1H1AA 3DPRB 2K9ZA 5C3OA 5BNPC 1RUC2 1SCSA 1IOAA 3NAPA 3ZN6B 5CZKA 2IWGB 4DB5A 4I0AA 1ZBE2 2WLPA 1SZBA 2YGLA 4AQSA 3LKJA 4LLOA 2WQ8A 3PVNA 2XGXA 3N7LA 1TNFA 5C4WB 3ZYHA 1BZWA 2VTXA 1GBGA 1YLLA 5FIXA 3JB4C 3MBWA 3OTFA 3DPRA 3IB3A 4J1XA 3UNPA 5L7OC 4IE6A 5FPUA 4E4SA 5BXXA 3ZN6A 1PGSA 4P14A 4AHZA 1YXWA 5FZCA 2QQOA 1PO23 2JDUA 2YYOA 3OPTA 4N9IA 2E7QA 3BTAA 1KDKA 5LBCA 5J48A 4LBQD 4BQXA 2EIBA 4LO7A 4BZ4A 4CCCA 2VCCA 3IT8A 2ZAAA 2FMDA 2ZZQA 2CAVA 4HVRA 2XQRA 2ZX4A 2O1QA 5FPZA 3WP4A 3I2FA 5D1IA 5AC92 3HN3A 1OT5A 2J42A 1WLWA 4MHUA 2JJ6A 2QTWB 3HD8B 1RTVA 5IVYA 5HPOA 5LCWL 3BU7A 4IEZA 2ZPXA 3ALQA 3ZKUA 1RL3A 1VP6A 3FL7A 4QDSA 1WMDA 3THDA 3FHQA 4OLLA 4CP2A 4WBBA 2XWJB 3INAA 3G7DA 4KWUA 1EPZA 1GQHA 1QJU1 1W0NA 2YG0A 3O0VA 1C5IA 1MQTC 2RDSA 5ABJC 1WGPA 4B7KA 4OHWA 2BP6A 4O7XA 3TN92 2XL7A 3T3YA 3ZM8A 2BERA 4ISRA 2DV9A 1UY2A 1EP0A 3HBZA 5LATA 3S5AA 4N43C 4KWLA 2R32A 1UF2C 1U5ZA 2YZ4A 1SBDA 4PI0A 4RGAA 2R041 3ZMOA 5FZIA 4YZ5A 3AL5A 3SHRA 4CDUB 2WZR2 1D2SA 4B1MA 1S0IA 4NHMA 1QJFA 1CZVA 2VMEA 1UZ0A 2XKPA 5DUWA 3WNNA 3UKTA 3O0XA 2EAKA 1FMD3 4IV1C 1RUF1 2BVVA 5E16A 5L9BA 5JXJA 1WWYA 2R072 4IV3B 1PGW1 1QJU2 4AQ2A 5L19A 4Y4RA 2ZMLA 5FTTC 1YFYA 2BWCA 1YFWA 4HVQA 4JGYB 4XFBA 4MXWB 4N9HA 4BPZA 4CDUA 1QWRA 4Q4Y1 2Q8CA 2FMYA 2WNVC 2YDEA 2VZRA 3LDBA 5FLIA 2ZEZA 3ZN5A 5BV6A 3K46A 2Y60A 3SKVA 1C1LA 1RMU1 1N47A 4XJ8A 4Y1ZA 3VN4A 2YFUA 1ODMA 4KBBA 3UT0A 1Z7S1 2FQPA 3FWEA 4IV3A 5EHDA 2WC2A 1I9RA 4AFMA 4YW3A 4FSJA 2FZ1A 1OHFA 1TG7A 1XNCA 5CFCC 2R042 5LW9A 3O1OA 1W90A 5LRRA 1H1MA 2OW4A 2VBBA 4JGYA 4K8FA 4MXWA 4P9JA 3SMHA 3LD8A 1GFF2 1OQDA 4UBGA 5DG1A 4E2GA 2EVXA 3CU7A 4MLOA 1IS3A 1DYKA 1RUF2 1UZVA 4HK8A 3FHAA 2CWSA 3T2TA 1PGW2 3ETPA 1US2A 1Y9GA 3WNLA 2D3PA 3RPQA 4FPYA 4B3NA 2UYAA 4BMBA 4HOOA 4LPLA 2VOTA 1RMU2 2BGCA 4TLGA 4OZXA 4XPVA 3BPZA 4D0QA 4DMIA 3AM2A 4IESA 4HT1T 1KJRA 1Z7S2 2A6WA 1UPSA 3LDRA 4H55A 1W2NA 2H6CA 1YJLA 5DZFA 5FZOB 2XB6C 3KCYA 2W2IA 1C3HA 1GQPA 2ZJCA 1RUD3 3LIHA 1F35A 1UYPA 1GSLA 2B45X 2LM3A 3UKVA 1LHWA 2JG9B 3PMSA 3W59A 4CDXC 3MZHA 2EICA 4Y5SA 4CZSA 2I2SA 2QFEA 5EFUA 3AMQA 5I0TA 4CCNA 1J3PA 5FZOA 4LLFA 4XFIA 2BBVA 2WWUA 1WCSA 4PI2A 2G9GA 1ZRFA 4CP1A 2W46A 2FDHA 4HG6B 3AXDA 3BB6A 2JG9A 2O0OA 4AEJA 1X50A 2CGOA 4YW2A 2XONA 1OVSA 1CJDA 2GN7A 1JU4A 3WX5A 1Y4WA 2XUEA 2YROA 1XNDA 4MG2A 1Q8QA 4A41A 5LEKA 1W2UA 4ZU4A 5FYSA 3V64A 4XJUA 3NAPC 3HNYM 1TME3 1W9YA 5FOJB 1W2AX 3IM0A 2WT2A 2VG9A 4JQRA 2IXCA 1UCXA 3BPSA 3WNMA 1C8NA 5EP9A 2C9AA 4YZ2A 3EBRA 3MIEA 4Q4V1 1DQ0A 1LOEA 3TOJA 4EN9B 5IATA 1W03A 3DPRC 4NE9A 4LTAA 4I3GA 1S4CA 4B4PA 2CWMA 4UI9L 1SBFA 3FLPA 2ZCWA 1W8ZA 1DHKB 4P5HA 2R061 1JUIA 2XH6A 3DF0A 4FPEA 1JZ6A 2NM1A 2PFWA 4DFSA 4DQAA 4BOWA 1IS4A 1WCUA 2O8OA 2ZGRA 5CBLA 2E7AA 5IFTA 3P3PA 1N1TA 2EXKA 1FYUA 3KSCA 4IQPA 2BU9A 1J59A 5J1XA 2VZSA 1HQWA 4XBLA 3RMXA 3MIFA 3CZUA 3NL1A 4N8MA 4LA2A 4Q4V2 1OKOA 3DN7A 5E6HA 4BMEA 1RUOA 5IK5A 1E5RA 1OFSA 4Y3OA 5T5JA 1STMA 5FYZA 3D82A 2R062 4IGQA 1RVF1 1O8PA 5DMYA 4Y5TA 3CIHA 3ZDSA 3LCPA 5LBFA 2VZPA 2CDPA 4XAEA 3RVHA 5I8TA 3BUCA 5GLVA 3HWJA 3LPFA 1YC61 4WZFA 1XBFA 3WSOA 4QX8A 4AW7A 4IE0A 3PJQA 3VHOA 3B7MA 4JCKA 4LHKA 1RUG1 5IYYA 1UY3A 1MS9A 3WQBA 4XBQA 4DRVA 4LUMA 1A3KA 4LK7A 1AYN3 5DXDA 4QXHA 1VBE1 1I3HA 2P17A 3TWIA 4AF9A 5IFPA 5LK7B 2JEMA 4H3WA 3K4AA 3OOXA 1W06A 3WV6A 5FZ8A 3B00A 4RL7A 3BYWA 3FLTA 1RVF2 5FYCA 5C6CA 1QXJA 2HWC2 1JYCA 3RDIA 2VMHA 5A3UA 1BBT1 1NZCA 5FZ4A 1ZRDA 2W92A 1MPXA 1ZBA3 1AX0A 1AXKA 4CDUC 5KHGA 1IG0A 3SEEA 2MPFA 4BWOA 1GZTA 1O6UA 3KT7A 4F8AA 2RE9A 2ZGKA 1Q8PA 1RUG2 2ET1A 1HQLA 5JWPA 1UPIA 5EXOA 4IV3C 3WW3A 3WUCA 1NE6A 1YQ8A 2O14A 5FZMA 2SBAA 1DYPA 1RHI1 4XZUG 1PMJX 3IWZA 3KQRA 5DPNA 3NSTA 3POYA 1VBE2 2PHLA 4Q29A 3CNAA 1DG6A 1EUTA 3JBG3 1D4M3 4AVSA 3V0BB 2JIGA 4NPMA 2YHJA 3IN9A 3J7LA 1UY1A 3H1YA 2ZX0A 2WFF3 2WSVA 5FYBA 2A71A 5EWSA 2GP3A 1BBT2 3T0BA 3ACLA 5FLJA 4AVBA 4UBHA 4P9YA 4X6RB 5EJ3A 3K75B 2D98A 1PO22 2ZKLA 5I0DA 5FY5A 3V0BA 3D4KA 2R0FA 3I3QA 1HRI3 2XL9A 3TNQA 4CP0A 4Y1UA 3ZFGB 4BQ3A 4AVCA 5C3RA 5ANQA 1JYNA 1WMXA 3AXEA 1RHI2 1OH4A 1W6PB 4QGLA 4RGKA 4XFHA 3U4SA 5BUVA 5KHJA 5FRAA 5JI7A 4WM8B 2RV9A 4EN6B 1OMIA 3J26N 2NP0A 4L92A 1DQ4A 4QGMA 3KCCA 2F6BA 4LKSA 1J83A 3GCXA 3KCXA 2HEVF 3THTA 1JUHA 3ZFGA 2DWRA 2WINB 3WNXA 3BIWE 1FOD1 5JMCA 1H6YA 1W6PA 4S2FA 3H1WA 1UZZA 5A33B 4LT5A 3V0AB 4WM8A 2HH9A 1JZ7A 4LO6B 2D5HA 2DVBA 1XE8A 2JG9C 2Z5WA 5D8AB 3RS6A 2P2KA 1HXS1 2D7FA 3I2DA 1QQP3 1O5UA 3GM8A 1DF0A 2JDYA 1RITA 5A33A 3KB5A 5A80A 3V0AA 1U12A 1GWMA 2DTYA 3WDTA 5IVFA 5JXHA 1J58A 5D8AA 4EN0A 1W04A 1AR93 2PXJA 2VNGA 2BV4A 1P8JA 4OULA 5CVRA 2ZGUA 5FZ0A 1FOD2 4XABA 1Z78A 3RJ2X 2XVKA 1W2TA 2WYSA 1CZTA 1KRIA 1URXA 4W50A 4AVVA 2WJSA 4E9KA 1FMD2 1O3RA 1YWKA 1W9FA 3I2HA 3USSA 2CYFA 2G19A 2H0VA 2BGOA 3ZKYA 1HXS2 4RGGA 5C8CB 3N9PA 4TSVA 1C28A 2IXIA 1G9FA 3C2UA 4L9BA 4PQQA 3VBOB 4FOYA 1HB4A 5LY2A 3VHNA 5F3GA 4H7LA 5L9VA 2QDNA 4UF0B 1AL0G 1UYXA 3IMMA 2YPDA 3LWCA 1AR63 3MPPG 4DNYA 1VBB1 1H1IA 2XR4A 4QT6A 5IVVA 5C8CA 5FZ3A 4FTSA 1D7PM 1JMUB 1ZBE3 2GAUA 4EZHA 5ACA1 3VBOA 2XJTA 3WG1A 1NXMA 3WF0A 1EV11 4CU8A 1FX5A 2WDBA 1C5HA 1RYYA 3OBAA 5F5CA 5L36A 4UF0A 3ZXLA 5FPVA 4W6XA 1X9PA 2OT7A 4LHLA 1ZREA 4YRDA 1UZWA 1V70A 2VXRA 1OFNA 3MLKA 4YFZA 3O1PA 5DAQA 1SHWB 2NMOA 3T08A 4FPFA 1R081 4NPRA 2ARAA 4FI9A 4RN5A 3PUIA 5J36A 4XVHA 2IXHA 3THCA 4XJWA 3VD5A 3VBSB 2HYKA 3LF7A 3VZLA 2B39A 1RUD2 1QOSA 3OCPA 1A78A 1UNBA 4IGOA 4YFWA 5FPBA 3SC7X 5ACA2 1EV12 3P1IA 2W0XA 4OMDA 5A7SA 4AFDA 1ENXA 4TYSA 3ZIWA 3JCIA 1F15A 4XILA 1U0AA 5D2AA 3RYRA 1UXZA 3NKGA 5FUIA 3LSDA 5LZ6A 4Y1XA 4HFSA 3VBSA 1QDOA 4UW3A 4META 4D94A 1E57A 4AI3A 2VTFA 1Y43B 1AXZA 2FD8A 3Q9OA 1R082 3MI8A 3BALA 5FXXA 1OA2A 1A8MA 2UY9A 3ACHA 1BEV1 1BXHA 5DQ0A 5JPMB 1H2KA 4N7UA 1AX2A 1OVPA 4B29A 3EJKA 3M3QA 3PUAA 2J1UA 2VMFA 2IZWA 1SG3A 3B9IA 2JDNA 2TBVA 1SCRA 2Y64A 3RZMA 1N1SA 4KU8A 4FBFA 5I91A 1K5MB 3LFMA 4XBNA 1Y3TA 4LUKA 1TME2 2XDVA 3KF3A 3KVBA 1ENSA 2HYXA 4CCEA 5BYNA 4YG6A 4E8CA 3JQXA 5F5AA 5IVBA 1JZ3A 1IS5A 4OUSA 4YM2A 5CYYA 5A1LA 3H7JA 1OUSA 4OCTA 3U75A 4LOTA 1QJU3 2W1SA 4QAWA 3IZOA 4MXVA 4UXAA 4CPBA 4FFIA 1BEV2 2GNTA 2Y0IA 4A6SA 2W94A 5ANNA 3OYWB 4RFRB 3WY6A 4A3ZA 1G9CA 4GMP1 4YLZA 2Y6KA 5D21A 3I97A 1N3QA 1FV2A 3Q8AA 3TEWA 4AFAA 3APBA 1VAVA 2WO7A 5EYXA 5FBZA 2CU5A 4XURA 2R043 5L7OB 4DEQA 1LTEA 1CAXB 2YV8A 4V1PA 3MHZA 3WG2A 4UT5A 2W1UA 3LA3A 3OYWA 1JBCA 1LU1A 4HMZA 5FMOS 2DYCA 2UWCA 2VW1A 1RUF3 3ZFGC 2ZXQA 1GWLA 4CU9A 1LNSA 3ABZA 4V2VA 5FFOC 5FMOL 4LBQB 5FZHA 3U1XA 2ZAHA 5L7OA 4WM8C 2V4VA 1MZFA 1CAXA 4PIYA 4Q4Y3 2FZ2A 5F2SA 4F83A 3WP5A 1W8NA 1RMU3 3B69A 4YW4A 3BTYA 4A42A 2IFWA 3X29B 1Z7S3 4YW1A 1AR81 4ZS2A 1QF3A 2GNDA 3CLPA 2AUYA 5FZ6A 2K0GA 4LBQA 2VM9A 3AFKA 3VZOA 4GXLA 2A6ZA 3PMEA 2FCTA 5FY7A 5DAWA 3J7NA 3VUOA 1RC6A 4Q2FA 3UGGA 2CV6A 5D8AC 2ZGTA 4TWTA 1CD3G 3WCSA 1A8DA 5FP9A 5DZEA 2Y33A 4AG4A 1A6CA 2A73B 1AYN2 1OBNA 2WBKA 2Y38A 4GWJA 1XU2A 4Q5OA 4P9GA 2AZ5A 3I2KA 2EA7A 2GC2A 2XJUA 2DU0A 1Q43A 1O4YA 2OQ7A 5BNNB 2D6PA 3I4IA 4QQ2A 4ET7A 2ZEXA 1NLQA 1RXGA 3WF3A 5T5PA 3E6CC 1PO11 1WLCA 4OUMA 1MS5A 4BIFA 4N43B 3GBWA 3KS7A 3UGHA 4XQ4A 1J84A 1ST8A 4ZPIA 3CEWA 1ZBA2 2GALA 5FYYA 5GKAC 4RHV1 3UGFA 1AR82 3DKWA 3FUQA 2A5ZA 3TNPB 1YFXA 1LAJA 4NO4A 5BNNA 4QHZA 4GWMA 3N7JA 4HK9A 4XACA 3IPVB 4CDQB 4CP9B 1MACA 4CUCA 2G4IA 2WZEA 2ARXA 2JDPA 5E89A 2Z42A 5C8CC 1SDDB 2WRAA 3I3DA 3AMMA 3Q8BA 1ALYA 1KGYA 3KHBA 3VBOC 1B35B 4Q4X1 3K4ZA 2OIIA 3THPA 1UOGA 2VY0A 2ZGSA 3BVCA 3I3BA 3SCHA 1Y7BA 4A7YA 4A7ZA 4BB3A 3B5LB 3KLSA 1IPKA 1D0GA 1LHVA 2OVUA 3IPVA 1PO12 2BRTA 2WFPA 2ZTNA 1HV0A 4FPLA 5FK8A 5SV5A 3ZO0B 4CP9A 1Q5OA 1H8TB 3T2QA 4FAHA 1EYBA 2UURA 4ONUA 1QH7A 3VBHB 3D6EA 3HQUA 4K40A 4RHV2 3C3VA 3MV11 3WQ1A 4NROA 4XXPA 2NMNA 3H8OA 4LIVA 1B35A 1OKQA 4MH0E 4DXZA 1GLHA 3FFZA 5T5OA 1VPHA 4H14A 3B01A 4Q0PA 2GH8A 3PURA 2FDFA 5SV8A 2JDMA 4KGQA 1I6XA 3RI8A 5CFDB 1H8TA 1OD3A 4BU2A 1SEFA 3VBHA 1YI9A 1T6BX 3WOGA 5B4NA 5J09A 4Q4X2 2OX0A 3VHPA 3VHRA 3AZVA 4NRPA 2ETEA 2QQNA 1W9SA 2WWJA 1ULGA 5FY8A 4Q4V3 2YC2A 4JDMA 1DGRA 2X09A 1W8WA 4XIKA 2GNBA 3LQCA 1F4HA 5FYIA 4FPCA 1ZA7A 5CFDA 3W21A 1OSGA 5FXWA 3WF2A 4LXLA 2ID4A 1XYPA 2R063 2YBPA 4XUQA 1QGLA 3ORJA 2W3JA 4H7MA 1AHSA 1FAYA 2KXLA 2XHNA 4G9SB 2E26A 2VQUA 2WAAA 2Y0OA 5KC5A 2QQLA 1L7QA 5C7GA 1QQP2 1TE1B 2HWE1 4XCAA 1UOJA 2VC9A 3K3NA 3MEPA 2DUOA 3SCGA 4UW5A 3AYDA 1XYNA 1OPMA 3S7IA 2C5DA 4G3YC 4EV0A 3SXWA 1AJKA 5LEJA 3ASIA 1MVEA 5FY0A 3GXUA 3NQHA 4NHYA 2VNRA 4LQRA 3LE0A 3ZVXA 5KBFA 3N3HA 1RVF3 3ZR5A 1DQ2A 1Q56A 2VJXA 1UU5A 3PU8A 2AR6A 5FREA 1PIV1 3HEIA 3IDAA 2D5FA 2P3JA 4HETA 1VB2A 4EJRA 1H8VA 4IE7A 2V72A 4UAPA 3ILFA 4AZZA 4JTNA 5K0UB 5JAXA 4NHKA 1N1VA 1VALA 2WNEA 2C1FA 3K48A 1GP4A 3POGA 1RUG3 1S0FA 5A7PA 4MGTA 2RMU1 1S0CA 3FBMA 4QM9A 1X8MA 1V6IA 3OGRA 1KXGA 1AR62 1CN1A 3RFRA 4AR2A 1YYNA 4BA6A 2QQWA 2VCAA 3FC0A 4UW4A 5K0UA 4FT8A 1VBE3 5A6YA 2FHRA 1EAH1 2VBDA 4YGDA 3OPZA 5FBJA 2DU1A 3ZPOA 4LA3A 4LO8A 4LR4A 4QPYA 4R9BA 1BBT3 1D2QA 1K5JA 2BDRA 3GBGA 3ZOIA 4DY3A 3DKQA 3G6JB 3LA7A 4MV2A 5FLHA 5FZKA 3ZYIB 4XUPA 5FOBB 1JZ2A 3RQ0A 4ZKTB 5JIUA 1ZRCA 1ULCA 1F2NA 1R091 1SLBA 4EWDA 2R0HA 4I02A 3I49A 3EO6A 2K46A 3I3EA 3M7AA 4UOJA 1DLLA 2IVJA 1WD3A 1GNYA 1UD1A 1VBD1 1NCQB 1RHI3 1VBA1 2TEPA 5F3EA 4JZRA 1QJEA 1ND3B 4K8RB 2VH9A 2YC4A 2YGMA 1EAH2 2X53S 1FV3A 3AKSA 4KU7A 5JXIA 4YW5A 3H0OA 3E6BA 3I2IA 3NNFA 1YFUA 1GUIA 2DVFA 3GBFA 2YUEA 4DS0A 2NYYA 2QJVA 4K1YA 2WABA 4BQYA 2RS11 1JYTA 1NCQA 2ERFA 1JHJA 1ND2B 1WA6X 3LZZA 2DFBA 2PLV1 3POIA 1CGPA 2GP5A 3NJYA 1ND3A 4FO9A 1DZRA 1OQ1A 1R092 3C7EA 4PCRA 2YY1A 4Y22B 1OPOA 4IEQA 3ILNA 4LEJA 5K9YA 3UK9A 4BQ4A 1GOFA 4AOCA 1VBA2 1H6XA 1CAVA 4A6OA 1ND2A 5DAPA 4JKKA 2AACA 5A1FA 1JW6A 5BNNC 2OZ6A 3BTZA 3OPWA 4S2DA 4BE3A 5JUVA 1JTZX 1RUE1 2N7GA 1RUH1 2D40A 4WV8A 4Y22A 1RJ8A 1FOD3 4XF3A 3QD6A 4QKFA 3UYJA 4QU2A 2K2SA 5C71A 3WNKA 2PLV2 4FPKA 4HN1A 4PQ9A 5H9QA 1AVBA 1UYYA 2BFUS 4CDQC 2Q8OA 1QH6A 1H2NA 3DGTA 5GJ6A 1ZYBA 1FPN1 2BFUL 1HXS3 4BXFA 2JIJA 4ZZ5A 1B35C 1W8TA 5A7QA 1YIFA 2R49A 1JN2P 4JHZA 1ZZBA 3POWA 1JZ5A 5LA0A 4W65A 1C8M1 1H8TC 1RUE2 3QACA 1RUH2 4KI5M 3VBHC 4LK6A 3OG2A 2VVEA 4LO4B 4ZU7A 3S0MA 2B4KA 2ZGQA 1W8UA 4TZDA 1RXFA 2UU8A 4JAAA 2DCZA 3WDWA 1DYOA 1ZZCA 2KA3A 3AP7A 3JUUA 4UFHA 3VKFC 2J22A 4AAXA 2OXBA 4PLMA 2R1DA 5DDJ1 4UWDA 1BLZA 5CFDC 1FPN2 1YQ5A 5FO8B 4MX3A 4R52A 1U5XA 3URFA 2ZACA 4Q4Y2 2OA2A 1VBC1 2VTXJ 5EIYB 3ZSLA 4Z1VA 1WCQA 2V5YA 1UY0A 2BGPA 3R05A 4OQ8A 1QIQA 1C8M2 2AC1A 1PMHX 4N90A 5I0RA 4LBOA 4C91A 5JSRA 5FWJA 3W5NA 1VBB3 1XSQA 1J1LA 3PL0A 1PZ8A 3WDVA 2OS2A 3O1MA 5ACA3 1EV13 3ZYFA 4RQPB 4GH4B 1DIWA 2E31A 2I74A 5BPXA 3CJXA 3RMYA 1BK0A 3DYPA 3ROUA 5DDJ2 1GWKA 2VPVA 4LBLA 1W28A 1NA1B 1W6OB 2DCJA 5J96B 1DLCA 4FAGA 4XTPA 1ULPA 3PIJA 5HV0A 1LENA 1MEC1 1VBC2 5KWRA 4BK5A 3TYJA 2F4PA 4Y5Z0 4RQPA 4GH4A 1R083 5IUQA 4XJ9A 4MSVA 2PQSA 2VCBA 2A6YA 4CXWA 1NA1A 1VMJA 1W6OA 4PIZA 1PGL1 4D8MA 1VR3A 4V2WA 3WG4A 4FQ4A 2CGPA 1PHMA 2A7AA 4RYDA 4AGRA 1KDMA 5FDBA 1AL21 3JQWA 4P5YA 2GSYA 3CJIC 4MGZE 4HVOA 4YNIA 3ZYRA 4B4RA 5K0UC 2XPJA 1F5JA 5F8PA 2W52A 2D93A 4NAOA 1POV0 3J9SA 3EMRA 3JU9A 4YPJA 3TAYA 3GJAA 4QKBA 1MEC2 4KQ7A 1PX4A 3UV9A 3POFA 3ATGA 4CVUA 3N9LA 4Q4W1 2QQIA 1OF3A 1BEV3 2A1XA 3RZHA 1J1TA 3ZFFB 1GICA 3SISA 3GF6A 4O9EA 3WHUA 1W8HA 2OUHA 3WP6A 2CAUA 2YB7A 4PT6A 5KHKA 1DQ6A 1K3IA 4QHOA 2JD4A 3S5QA 4ZXEA 1AL22 2UWAA 2BNMA 3I7DA 3B02A 3ZYJB 2VXJA 1AF9A 4HXCA 3V65A 3POBA 2P34A 1WCKA 2VOXA 4C90A 1R64A 2IC1A 5GLUA 2BNNA 2V4AA 5A32B 3T1LA 1NT0A 4L8QA 1REDA 3AP6A 3ZFFA 2D97A 1ASJ1 1U5YA 1JH5A 4BQWA 4GKYA 3U78A 3NV4A 1BVVA 4QQHA 1RUJ1 1NCQC 4IETA 3AVRA 3NWKA 4LBMA 5GZDA 5F1RA 1W39A 2ZZJA 2IXJA 2VOVA 3HJRA 3B9CA 3HQXA 1HLCA 3NVCA 1ND3C 2OPKA 4Q4W2 2Z69A 1I1EA 2BBAA 2DTWA 4YSFA 5A32A 3VKLA 2PHWA 4GMP3 3D3AA 2BOJA 5GALA 1NG0A 4EN7B 5H9PA 1JHNA 1UMZA 3MLLA 5G04L 4C1XA 1AR71 2JKBA 4XZPA 3AP9A 3TEZA 2KM2A 2RJLA 1ND2C 4XTMA 1LHNA 4M0HA 2BNOA 1V6MA 3U11A 4AVTA 5CADA 2RG4A 3AKRA 5I8YA 2D6OX 1IG3A 1ASJ2 5H9RA 4FXGB 4HBNA 2OQ6A 5I0UA 1RUJ2 3AK0A 4BQ1A 1CESA 3N35A 3VD9A 5KXBA 2JB8A 2RDQA 4JQTA 1NLRA 4IEVA 5FP3A 3MW3A 4FOWA 2X5IB 5HXMA 1PVXA 1FXZA 3ZSKA 5G05L 3AYCA 4DINB 3ZYPA 2XLFA 1HW5A 5B4XA 5H9SA 1MS4A 1AR72 1X33A 2GNMA 3U4XA 1AR83 5JZGB 4AI0A 2ZX3A 3IDEA 4NR1A 4KGGA 1M4WA 1NKGA 3CDZB 2Q8DA 1EUUA 5GLZA 4PIXA 2X5IA 3GALA 4GB31 5EV7A 5C5TA 2WQ4A 2CDOA 5JI9A 5A3OA 1IGOA 4XJAA 3VDAA 3AMNA 3HNMA 4JC1A 1D4VB 1XC6A 4L0PA 1MS0A 3QCWA 4JRAA 5FKCA 5JZGA 3OUJA 5FAXA 4YG0A 1OXCA 1Y9QA 4IERA 4Z92B 4R4XA 3VBRC 4UFMA 1QJY1 1PO13 3I59B 2XJRA 5A7NA 3ECQA 1I5ZA 4FFGA 1LEMA 4FPOB 4O9GA 4XCBA 4RHV3 3ENRA 1COV1 2IXLA 2RDRA 3ZMNA 1QHDA 1W9WA 1WCDJ 5FZ1A 4EQVA 2ILMA 3IAPA 4RS5B 1OD5A 2WWSA 1NUKA 5LA9A 4B4QA 1ZM1A 2PHFA 3H50A 4E4DX 3I59A 4QMAA 5F32A 2E9QA 2D6MA 1BHGA 2XMLA 4PBOA 4DXTA 4EE2A 2RHPA 5BNOB 4Q4X3 1H0BA 4OHVA 2D44A 1RGSA 3MDPA 4RS5A 4S2GA 4YM1A 3KVAA 3AZWA 4P9LA 1NQJA 1QJY2 3H9AA 2AEZA 3FHIB 4FPGA 3UJOA 1ENQA 2J7MA 2JX9A 3JXSA 5F6KA 2VGDA 4YZ3A 3ZXJA 3OUIA 5CEHA 4OI4A 1COV2 2TNFA 3H8XA 1Q8SA 1YQ2A 5ISLA 5BNOA 1DGWA 1NAEA 1JOBA 1NCRB 2P3KA 3M3IA 4RQPC 4GH4C 2PELA 3QH7A 4JGZB 1S1AA 1BVP1 5EPAA 5A6ZA 1E5HA 1SMVA 4CEWB 2VAUA 3IKWA 1NA1C 3F95A 3IBMA 2P3YA 3HIFA 3ZXAC 1V6JA 4NAMA 1UU6A 5E8AA 4DXRA 1LECA 5DABA 1DQ1A 4I2OA 5LK5A 3IAQA 1HB1A 1NCRA 4XUNA 3RZJA 3M1HA 5E88A 4JGZA 1YQCA 1HJGA 1CIYA 4FXKB 2UYBA 3A4UA 4GAZA 4CEWA 3KHCA 3T1MA 2DURA 4FCAA 4W6WA 2XJPA 4NVPA 4F7ZA 1YIPA 3CZJA 2AGSA 2CHHA 3WW1A 2J1TA 3IIAA 4KH9A 4C0HA 1W0PA 2QKDA 1B09A 3HQRA 5FY9A 3SCFA 4BQ2A 1MS8A 2HWD1 1WW7A 1IKQA 2WQZC 4LKFA 3NV1A 2VECA 2HWE3 3BOWA 1WBLA 5FO7B 1XPWA 2VVFA 4FVVA 1X9TA 5KXDA 5LA1A 1LU2A 1L3JA 5CU1A 2ZS6B 3HT1A 2VZTA 3AC0A 1QY4A 4Q1PA 4LHNA 5KHIA 2ZX1A 2W9XA 2CGNA 1G6NA 1H4GA 1I5PA 3ACIA 2GN3A 3MGUA 4XETA 3ZFFC 4D3WA 3RSJA 4AYUA 4COVA 5IVJA 4CDWA 4CCJA 3OF1A 1VRH1 4FFFA 1YI7A 1PIV3 5FZBA 1W6NB 4QX2A 4XQDA 1HN0A 1VE0A 2LROA 3DEMA 5EQUA 3OGSA 1WD4A 3GYDA 3CL1A 4AFCA 1S0GA 4CCDA 3HVDA 2VMGA 3PVEA 4MHRA 4CXXA 2XG3A 5IK8A 1S2KA 4IE4A 2RMU3 1DU3D 1HKDA 2LALA 5GZFA 1PZ9A 5GZCA 4E2QA 1W6NA 1VBB2 1RUNA 4HKOA 3VL8A 3AX4A 2HWF1 1EAH3 3CMGA 5FR3A 1Q3EA 3N9MA 4AQ6A 2PA7A 3MUY1 1OQEA 4QXKA 4GA9A 3WD5A 4ATFA 2V73A 4B8EA 4OI0A 3SITA 1O4TA 1UXXX 3JZVA 4IEOA 4CU7A 2W39A 2PAKA 3NNLA 4FP2A 3VBUB 5FK7A 4K20A 2QVSB 4FQZA 1IKPA 1PNFA 1RINA 1RJ7A 3O0WA 1R093 2PHXA 4XF0A 3FJSA 1BMV1 1KJLA 4QHBA 2RJKA 4QU1A 1CAWB 4H2AA 5L73A 1CJPA 5JIAA 4CEYB 3DXTA 1VBD3 5FYMA 4DUVA 4CCLA 1VBA3 3VBUA 4D7SA 1S0BA 2GZWA 1G9BA 3K2OA 3SQOA 4OHYA 2VUCA 1XNKA 2WO1A 1IZ3A 2X5IC 3AP4A 3TBDA 2QQPA 1V6NA 3WW4A 1LEDA 1HB3A 3T4VA 3AJZA 2FBEA 3OJBA 3PTRB 3WW2A 1XSRA 5IWFA 2I07B 1CAWA 4Q27A 1O3TA 4QKNA 4J25A 4CEYA 5JZGC 2R30A 2WT1A 1YNAA 2RS13 3PDQA 5A3WA 2PLV3 1SLAA 3BU0A 1UX7A 3M3CA 4AAPA 4E4HA 2E32A 5A70A 1AUYA 2DFCA 2P3IA 3P5BA 1BMV2 3UETA 1WMEA 2W95A 4FPJA 3Q8CA 5CISA 3T2PA 1QEXA 3OD4A 4BK4A 1FI2A 1G86A 3I8TA 4YWAA 3WUDA 4XC9A 1JZ8A 2C24A 3J8F1 3PUSA 2RS51 5FP8A 2UWBA 2WZ8A 4RFT0 2YXSA 4XDQA 5C3SA 2QE3A 1O7FA 1RUE3 1RUH3 4XE9A 2Y6HA 4JVAA 2GC1A 5FJHA 4HLTA 2RS31 3LEGA 3U07A 3ES4A 4QPGB 4NOTA 1MZ6A 3MLJA 4COUA 1LOGA 4RS5C 4YG3A 4INDA 3PVBB 5CIRA 5CKMA 1E5SA 4NJ4A 4BIOA 3TEYA 3H42B 1W05A 2A6XA 3K77A 1FPN3 2PYTA 1GZWA 4XAAA 3PNAA 4A2UA 5BNOC 3WZ1A 2KD7A 5DUVA 3GCWA 2CSGA 4Q0QA 4QPGA 4B1LA 5FPXA 5FYTA 3E97A 4OMCA 1W3XA 2RS52 3LEKA 3VKNA 1XNAA 1GQGA 5LRSA 3MFAA 1UWWA 3L2YA 1R1ZA 5IT6A 1C8M3 2V09A 2RR11 5CG8A 5HV4A 2BVBA 4O65A 1F31A 3NJVA 2RS32 3ZPYA 4CCMA 2TUNA 2Y6GA 3EYPA 5LASA 1XE7A 1EPWA 1NCRC 1PM7A 2SLIA 3AB0A 3SH4A 3NJXA 4JGZC 3HAGA 1GYKA 1KFXL 2PAMA 2XLAA 2DVGA 2LS6A 4AI8A 5IAVA 4MYEA 5FO9B 1X36A 3ZX7A 4CEWC 3AMHA 4HKLA 2H0BA 5DDJ3 3NW4A 2QCSB 4YM0A 2JE9A 4QX1A 1LOBA 3VDDC 1VBC3 1O91A 5CNAA 1K45A 2YPJA 4R4ZA 4WVMB 1ZRRA 1ZX5A 4D6RA 4Q8KA 1QU0A 2W1WA 1O8SA 5LBEA 1JYIA 2XVLA 4LBKA 3RYPA 3RYKA 1FNZA 1LHUA 3OBTA 1NYWA 3K4DA 1VB4A 2Q5TA 4QPWA 1UL9A 1V00A 1L7RA 2HKXA 4KWKA 4PJYA 1PK6B 1AYM1 5A3TA 2E63A 1F9KA 2BJSA 2O8QA 3OGGA 1WKYA 2BUKA 4WVMA 4KBZA 4E4ZA 2G1MA 4B7EA 3W58A 4MGSA 2R7EB 2VUAA 3LB9A 3E6DA 3OBZA 4CUAA 5LWBA 2ZHNA 2D6KA 4CDWC 4M4PA 5KHHA 1RUI1 5FY1A 2J1SA 1PK6A 3RG0A 3KGLA 4FP3A 1MEC3 1UOBA 1O3QA 4SLIA 5IK4A 4AEDB 4ZONA 3ACGA 4Y4YA 3MICA 3LSEA 1GMMA 1IQAA 1UMIA 4ZHNA 4JRLA 3CO2A 2VD7A 3L2HA 3ST7A 1W99A 1AL23 2Y26A 2GMMA 4YGBA 4PLNA 4AEDA 4E8DA 3DL3A 4XMAA 3GNEA 4LMFA 2B46X 1OOPB 1RUI2 1LOAA 4HONA 1CONA 5J98B 2QQKA 3C8XA 1ACCA 3V56A 2AYHA 3C7FA 2I45A 3B94A 4GQ7A 1HIXA 4N53A 4Q4W3 1JS9A 2LUWA 1W8OA 4IE5A 1ULFA 1ZNPA 4XHBA 5AFEA 3DCQA 3WEZA 1H9PA 2CL2A 1OOPA 2VO5A 5FZ7A 3RZKA 1BYHA 5CG9A 1DQ5A 3T2OA 1TMF1 2A75A 2IVIB 3LIGA 4IEUA 5FMBA 4IXLA 4LNVA 3S30A 3VBUC 3ZIXA 1SLIA 3FZ3A 1G8WA 2WS91 3VKOA 1FATA 1FNYA 4FOQA 2Z4FA 1LR5A 1ASJ3 1AJOA 2ENRA 5LB6A 2Q8EA 1HN1A 1HJFA 2VCMA 2JKXA 2Q1FA 2B9VA 4M3CB 4CEYC 1RUJ3 4OYUA 1CWPA 2F4LA 3O5SA 2ATFA 5IVCA 3WG3A 1ULDA 5HBAA 4UFKA 5KXCA 1PM4A 4WVWA 2WKKA 3HOBA 2W87A 3ZSJA 4E27A 4XFFA 3QBQA 3QOPA 4M0NA 1JODA 4FTEA 1TMF2 2RM21 4M3CA 5JSOA 3CJIB 1AR73 1PNGA 1GZCA 4NWWA 4L2NA 4NRQA 2HWE2 4IUGA 3C7GA 3N4MA 4MGIE 2DBNA 4DXSA 1ZZ7A 4K21A 3T09A 1SBEA 4M4RA 1RUC1 3PLQA 1HQNA 3VZNA 2W5FA 5GZEA 3AP5A 1UN1A 4PDWC 2V5DA 4XJZA 4AK3A 3CJIA 1S2BA 4JKMA 2VW2A 2QBXA 5F3IA 5T55A 3DECA 3A0KA 4X8PA 5EJ1B 3ZXDA 4BDVB 4BQ5A 4OHZA 4D69A 3ON7A 3AJYA 3ZFEB 2ORXA 3DUIA 5FYUA 4HSJA 2QQMA 2XWBB 3E5QA 1LGBA 1JYVA 2JE7A 1S0EA 1Q8OA 4COZA 1PIV2 2RM22 1POV1 1V6KA 5FZEA 3BI3A 4EYUA 2NN8A 4QPGC 1REEA 3WNPA 4XFCA 4W4ZA 1OI6A 1N3OA 2PHDA 1AX1A 3Q8FA 3ZFEA 4EZ4A 2VZVA 1OLME 4GB33 2RMU2 1XB9A 5AC91 3ZN4A 1APNA 2PHTA 1UOFA 4R9DA 3SEPA 2GU9A 4NRMA 4M00A 2PQQA 4R9AA 3H1MA 2Q30A 5FZAA 3WLUA 1TVGA 2XLGA 5HI0A 1UQXA 2DVAA 2ORZA 3PU3A 5F3CA 2BZDA 2Z2SB 2ZMKA 3SLIA 2VMIA 4CUGA 2AH2A 1QJY3 1GOHA 3AZZA 5FJKA 5JOZA 5DG2A 1SDWA 4GD4A 1CAVB 1SQ4A 4Y33A 5IW0A 4CE8A 2QQJA 2VQAA 1W8FA 1COV3 4QXCA 3LA2A 2LRPA 5C3QA 1WLTA 2W08A 4GJZA 4GZ9A 1NE4A 4CU6A 5C4WA 2D6LX 2PN5A 4XFAA 3RJRA 1DGWX 3TN91 4CSWA 4XOGA 2ADDA 4R9CA 4UW6A 1OA4A 1VBD2 5LBBA 2FCVA 4YARA 2WUHA 2WZPP 1IPJA 3IDCB 1A34A 3WDYA 4OFGA 5CAZA 5K8SA 3BTXA 4IEPA 2XVGA 3FLRA 3VZJA 2WZR1 4Q26A 1KQRA 1UAIA 2GC3A 4XW3A 1WBFA 1ZRIA 4PBPA 2RS12 2JG8B 2XBO1 1NY71 2VUDA 1PK6C 2VZ3A 2XUMA 3C7HA 3T0AA 4AXOA 2R071 3VGIA 3ZYBA 5L9RA 3WDXA 4OI1A 1F5FA
chains in the Genus database with same CATH topology
4CTEA 5JSPA 1GR3A 1X7NA 4JDNA 1LGCA 5J37A 5E1RA 1RB8G 3CF6E 3O14A 3WP3A 2QZ2A 2W68A 2JG8A 5FCCA 1UX6A 2WIIB 4WM7B 3RNSA 3WINE 2VVDA 2CY6A 4X8NA 3VBRB 4EN8B 1YRZA 2X29A 3UL2A 4S2HA 5HCFA 4RR3C 4FTBA 2DCTA 1BKZA 3AKPA 3ZSEA 3QH6A 4AEDC 3R4DB 3OGJA 2ES3A 1H30A 2XBO2 1NY72 2LTNA 2A3XA 3I54A 4MVTA 1C4RA 4WM7A 3AFGA 5F9TA 3VBRA 1QNYA 2HWB1 1H2LA 4I0WB 2GC0A 4N53C 2ZGLA 1MZEA 1DGRN 5FQ0B 2HWD3 1QJX1 1X82A 1OOPC 4C0BA 5JCTA 3RWNA 1HRV1 2CNAA 3LAGA 3M70A 4M01A 2ZKNA 1YUDA 1LKNA 3M2MA 4XF1A 1C1FA 4AWDA 5FQ0A 2Q1ZB 4HZFA 4DOUA 3JB8A 2Q0AA 3TB0A 1KS4A 1YO8A 2HJIA 4FOVA 1O3SA 1QKQA 2A3WA 1LCLA 3N36A 1DDLA 5EYYA 1VRH3 2HEYF 2HWB2 1V9U1 3H8UA 3GZAA 1MVQA 1R1A1 1QJX2 4WZCA 1F8VA 2D3RA 4QM8A 4XYXA 5GLWA 1N1YA 1MS1A 1G9AA 1HRV2 1SLLA 1DZQA 5I0SA 4BH9A 1LOCA 2B7YA 2HWF3 2PHUA 2DUQA 4AI1A 5TSWA 3LGRA 4K7JA 1UIKA 5BNQA 4Y1YA 3VKMA 1V9U2 3JD71 4LO5B 4QQOA 1S0DA 1R1A2 2XKOA 1PVC1 4YGCA 4QX5A 2B5HA 2MEV1 3ELNA 4IL7A 2VOKA 4XIOA 2JECA 1SFNA 3M4FA 1UZYA 3M3OA 3HMYA 5KC6A 4DY5A 3VLBB 3B93A 3H3UA 4XF4A 1CIWA 4SBVA 1ULEA 3KT1A 4JDOA 3ZFEC 4PF5A 3NV2A 4L97A 2BW8A 3AZYA 4ISQA 1XYOA 3JD72 2DVDA 3U10A 3S6PA 1CPNA 3FBYA 1PVC2 4U2AA 3E5UA 4CRQA 1LRHA 1O5LA 3MYXA 2MEV2 4MGKE 3EHKA 4BHPA 1YHFA 4YZ4A 1CVNA 1W0OA 2ZHMA 4L11A 2R6QA 5C4WC 5HCAA 4DZGA 3J8F3 2RS53 3IMNA 2ZA9A 3FX3A 2ZOEB 4P9WA 4AGVA 1BK1A 5DUXA 4EWAA 4AFBA 3R6SA 2ZGPA 2RS33 1MR5A 1SLCA 1TQ5A 4EWEA 3VZKA 4I30A 1UIJA 2E6VA 4D7TA 1GZ9A 1VAMA 4AQTA 1KFUL 2HWC1 2NLRA 4BLIA 2Z79A 1W6QB 1J3QA 4KG0A 5CB7A 5C9AB 3M8LA 2EXHA 2JG8C 3H7YA 2RR13 3P3NA 4HSLA 3SH5A 1VIWB 1ZZ6A 1SACA 1WUVA 2VUJA 2ZGNA 4HANA 4CYDA 2JDZA 4KL1A 4M3CE 1WA4A 1W6QA 3N7KA 4J6GA 5T54A 4Y24A 5A3LA 1WLDA 5C9AA 4I3PA 3VBFB 3E5XA 4QQLA 4WM7C 1BCXA 2R1BA 3PVOA 5JOWA 1V6OA 1XXNA 4YGEA 4QD2A 1PO21 4I01A 3VBFA 2VW0A 5JOXA 2E7TA 4YYOA 2PTMA 4K6BA 1AYM3 2AENA 3ZXKA 2G9FA 4ATEA 1CPMA 4GB32 1SLTA 3HT2A 1NXD1 1HDKA 2Q1MA 2ZHKA 4JGYC 1NLSA 2QDRA 1V6LA 4AHYA 1OLQA 4URTA 1QXRA 5T52A 3MIBA 1RUI3 4HN0A 1SFYA 4YM3A 1QXPA 4YVWB 4QGNA 3SNMA 2D43A 2EXIA 2A6VA 3O12A 4OHXA 1O4ZA 3DV8A 1IHMA 1VLNA 2VQ0A 3GZTB 5T5LA 4W6YA 4Q0UA 3KMHA 3MF9A 4YVWA 3ZYGA 2WLQA 4QPIB 1U5IA 3A0NA 1LHOA 4I09A 5BY5A 1LESA 3HN1A 3L9JT 4COWA 3MPBA 4R8HA 2B9UA 3UKNA 3VDDB 1MS3A 1GV9A 3BCWA 1XU1A 2NPIA 4Y26A 5K7PA 2NQYA 4NHLA 4QPIA 1S55A 1FMD1 1S0JA 3RI9A 5GZGA 2DCKA 2UY8A 3KZ4C 2JICA 2Q4SA 4Z07A 3VV1A 3FFQA 1DGLA 4G4FA 2ZMNA 3USUB 3VDDA 1BQPA 1TMF3 1OA3A 2JENA 1GANA 4X6QB 2WL1A 4CDWB 2WS93 2H6BA 1GNZA 3D0JA 4KNCA 3KGZA 4Z82A 2VOWA 3N7MA 5T50A 1XQNA 3RRDA 2IXKA 3J4UH 3USUA 3AYEA 1PGL1 2ZBJA 1QJZA 3OBRA 4Z2WA 3ZXFA 1Z0HA 5F5QA 1Q8VA 4MGYE 5GM0A 4ES8A 2BWAA 4YVSB 5HCBA 4IEWA 3ILRA 1AZDA 1ENRA 3NJZA 4M3CF 5JVVA 4AE2A 3MIGA 1UW8A 2RM23 3ZSMA 4BYYA 2XJSA 2WNUB 3FMGA 2BYVE 2HWD2 3TRSB 1QOTA 5B2GB 4WVVA 4Q0VA 2GH2A 1HV1A 3RZZA 3VZMA 1NQDA 1RUC3 4YVSA 1QMJA 1PGL2 1YCIA 4Y20B 3BODA 1GKBA 1RUD1 2NZ9A 2WNUA 1VAKA 3MF6A 1YJKA 1UU4A 4ZU5A 1DZTA 1C57A 4KG8A 5AVAA 1AXYA 1VRH2 3AMPA 3ME2A 1QDCA 1QNWA 2DF7A 4NWVA 1LOFA 4Y20A 4HPKB 1POV3 4E2SA 4ITCA 3M3EA 2EALA 4COYA 2PAEA 3R0RA 5JLVA 2VULA 2B8MA 1DFQA 1ZZ8A 5A3MA 3GZUC 1WW6A 5AC93 5I8SA 1D0HA 3UJQA 4HPKA 4NN0A 2EAAA 3FE5A 2HWF2 2B42B 4BCUA 1TME1 4LE3A 3MW2A 3D5OA 5C9AC 2ZGOA 4K3UA 4E2QA 2ZX2A 3K51A 4A3XA 1KD7A 3WCRA 2OZJA 3KT4A 3LOBA 4DPNA 2VU9A 1RIRA 2DUPA 3PTYA 4J1WA 3W9AA 3GHNA 4HL0A 3KD4A 3SH3A 3WDUA 1VJ2A 3AKTA 3MIHA 1ZVFA 3D0SA 4PDWB 3TN93 3VBFC 5C33A 3PHMA 4YZ1A 4XEZA 3OD0A 3ZXGA 3IDBB 3NV3A 4LBNA 4P9XA 1WMFA 1KITA 2BPA2 1QOOA 1CX4A 1H2MA 2WZR3 1GZWB 3WQ7A 2VNOA 2YC0A 4PDWA 1REFA 2YMZA 4MZUA 1JOJA 2XBO3 1M06G 2EF6A 2R073 1FT9A 2WSUA 2GMPA 4JTOA 4GALA 1K5MA 2P37A 5BNPB 2ZHLA 3MW4A 4ORFA 1EY2A 3H3ZA 4BM8A 1PZ7A 4Y1VA 4ASMB 4BLJA 2HEWF 3LOIA 3EXUA 4YVWC 5J3UA 3J8F2 4XXAA 4Q1RA 4Q8LA 5BNPA 5DZGA 4C1WA 4AHWA 4ZXKA 4I0BA 2MNGA 2ZGMA 4JV4A 4XMIA 1ZZ9A 2QNKA 4AHXA 4ASLA 2IFRA 2ZABA 4AEKA 3AZXA 1AYN1 4QPIC 5JOYA 4DRRA 1G9DA 4XHXA 2HWB3 1OLRA 4GKXA 4LE4A 1QJX3 2XJQA 1XRUA 4RSUA 1ZBA1 1LGNA 1WW4A 1HX6A 1HRV3 4AI2A 1ONAA 4GWNA 2WA4A 4RD7A 5IK7A 3S7EA 2MHFA 2RR12 2R16A 1W6MB 2BEOA 4KWJA 2GDFA 2A3YA 2EXJA 4P9IA 1J3RA 1MQTB 5ABJB 4IEXA 1LODA 3JBG1 5F6LB 1D4M1 1V9U3 3AKQA 1GNHA 1R1A3 2WFF1 1W6MA 4PLOA 1G7YA 4AEMA 1TNRA 3R4UA 5T3NA 1JXNA 1MQTA 5ABJA 3ES1A 4RR3B 3O7OA 4LBJA 4U36A 4GULA 2E51A 1T6GC 1LULA 1HRI1 4IV1B 1AYM2 5HXVA 1XNBA 4YVSC 3AYAA 4N43A 2AREA 4OI2A 2C0ZA 2QZ3A 4FPHA 4IEYA 4N53B 4RA0A 2WNUC 4EROA 4RR3A 1LB2A 3JBG2 4OVEA 2DCYA 1D4M2 2WNVB 3JD73 1DBNA 3ETQA 3MFCA 4A7KA 2OUJA 3WQ0A 1UKRA 2WFF2 1PVC3 1MZ5A 3OY8B 4IV1A 5JDBA 3BOPA 4GIQA 2MEV3 1LOFC 4Q0SA 4QQPA 2XJVA 5CFCB 4AGGA 5EZWA 3GHMA 2GMEA 4MUVA 3WHTA 3QLQA 2WNVA 2D6NA 1HRI2 2A70A 3OY8A 1QQP1 1BJQA 1H4HA 1CR7A 4N7IA 2PHRA 4XFGA 5CFCA 3KM5A 4F3JA 1N3PA 3VL9A 1AR91 1KS5A 2QUOA 2CTVA 3POSA 3ZXEA 4WVZA 3VBSC 4Z8BA 2EIGA 5AVPA 1PMIA 5CA6A 1H9WA 2WA3A 5JPNB 1ZA4A 3R4SA 2ARBA 4CDXB 2X8KA 4D7YA 4TLFA 4AVAA 2WT0A 4K9SA 5KXEA 1CAUB 3EQEA 3WXPA 4LULA 4ES9A 5GLTA 5JR7B 2WS92 2XHKA 1LJ7A 2BQPA 3D8CA 1AR92 4CDXA 1AR61 3B3QE 2E53A 2JXAA 5C8WA 3WR0A 1ZBE1 4XF9A 1CAUA 4K1ZA 5DUUA 2ET7A 4XQWA 3WT3A 1TEIA 4HKWA 2HWC3 3FUOA 3NO8A 3HR9A 1K5MC 4GMP0 3NAPB 1CQ9A 1X8EA 1UKGA 2BTVC 3PJYA 5AFBA 3WVJA 2OYZA 3MIDA 1WW5A 1IS6A 4L99A 3NKTA 3U0ZA 1NOVA 2D3SA 1H1AA 3DPRB 2K9ZA 5BNPC 1RUC2 1SCSA 1IOAA 3NAPA 3ZN6B 2IWGB 4DB5A 4I0AA 1ZBE2 2WLPA 2YGLA 4AQSA 3LKJA 4LLOA 3PVNA 2XGXA 3N7LA 1TNFA 5C4WB 1BZWA 1GBGA 1YLLA 3JB4C 3OTFA 3DPRA 4J1XA 5L7OC 4E4SA 5BXXA 3ZN6A 1PGSA 4P14A 4AHZA 1YXWA 2YYOA 1PO23 4N9IA 2E7QA 3BTAA 1KDKA 5J48A 4LBQD 4BZ4A 4LO7A 3IT8A 2ZAAA 2FMDA 2ZZQA 2CAVA 4HVRA 5FPZA 2ZX4A 2O1QA 3WP4A 5D1IA 5AC92 1WLWA 2JJ6A 3HD8B 1RTVA 3BU7A 4IEZA 2ZPXA 3ALQA 1RL3A 1VP6A 1WMDA 4OLLA 4CP2A 4WBBA 2XWJB 3INAA 3G7DA 1EPZA 1GQHA 1QJU1 3O0VA 1C5IA 1MQTC 5ABJC 1WGPA 4B7KA 4OHWA 3TN92 2XL7A 4ISRA 2DV9A 1EP0A 3HBZA 4N43C 4KWLA 2R32A 1UF2C 1U5ZA 2YZ4A 1SBDA 4RGAA 2R041 3ZMOA 4YZ5A 3SHRA 4CDUB 2WZR2 1D2SA 1S0IA 4NHMA 5DUWA 2XKPA 3UKTA 3O0XA 2EAKA 1FMD3 4IV1C 1RUF1 2BVVA 5E16A 2R072 4IV3B 1PGW1 1QJU2 4AQ2A 5L19A 2ZMLA 5FTTC 1YFYA 2BWCA 1YFWA 4HVQA 4JGYB 4XFBA 4MXWB 4N9HA 4BPZA 4CDUA 1QWRA 4Q4Y1 2FMYA 2WNVC 2YDEA 5FLIA 3ZN5A 5BV6A 3VN4A 1C1LA 1RMU1 1N47A 4XJ8A 4Y1ZA 4KBBA 1Z7S1 2FQPA 3FWEA 4IV3A 4FSJA 2WC2A 1I9RA 4AFMA 4YW3A 2FZ1A 1OHFA 1XNCA 5CFCC 2R042 5LRRA 1H1MA 2OW4A 4K8FA 4JGYA 4P9JA 4MXWA 3SMHA 1GFF2 1OQDA 4UBGA 5DG1A 4E2GA 2EVXA 3CU7A 4MLOA 1IS3A 1DYKA 1RUF2 4HK8A 2CWSA 3T2TA 1PGW2 2D3PA 3RPQA 4FPYA 4B3NA 2UYAA 4BMBA 1RMU2 2BGCA 4XPVA 4OZXA 4DMIA 3BPZA 3AM2A 4IESA 4HT1T 1KJRA 1Z7S2 2A6WA 1UPSA 4H55A 5DZFA 2H6CA 3WUCA 1YJLA 2XB6C 3KCYA 1C3HA 2ZJCA 1RUD3 3UKVA 1GSLA 2B45X 2LM3A 1LHWA 2JG9B 3PMSA 3W59A 4CDXC 3MZHA 4CZSA 2I2SA 2QFEA 5EFUA 3AMQA 5I0TA 1J3PA 4LLFA 4XFIA 2BBVA 1WCSA 2G9GA 1ZRFA 4CP1A 3AXDA 3BB6A 2JG9A 2O0OA 4AEJA 1X50A 2CGOA 4YW2A 1CJDA 2GN7A 3WX5A 2YROA 1XNDA 1Q8QA 5LEKA 1W2UA 4ZU4A 3V64A 4XJUA 3NAPC 1TME3 5FOJB 3IM0A 2WT2A 2VG9A 4JQRA 2IXCA 1UCXA 1C8NA 2C9AA 4YZ2A 3EBRA 3MIEA 4Q4V1 1DQ0A 1LOEA 3TOJA 4EN9B 3DPRC 4LTAA 4I3GA 4B4PA 2CWMA 1SBFA 3FLPA 2ZCWA 1DHKB 4P5HA 2R061 1JUIA 2XH6A 3DF0A 4FPEA 2NM1A 2PFWA 4DFSA 4DQAA 4BOWA 1IS4A 2ZGRA 2O8OA 5CBLA 2E7AA 3P3PA 1N1TA 2EXKA 1FYUA 3KSCA 4IQPA 1J59A 1HQWA 4XBLA 3RMXA 3MIFA 3NL1A 4LA2A 4Q4V2 3DN7A 4BMEA 1RUOA 5IK5A 1OFSA 5T5JA 3D82A 2R062 1RVF1 3ZDSA 3LCPA 5I8TA 5GLVA 3HWJA 4WZFA 4AW7A 3PJQA 3VHOA 3B7MA 4JCKA 4LHKA 1RUG1 1MS9A 4XBQA 4DRVA 4LUMA 1A3KA 1AYN3 5DXDA 1VBE1 1I3HA 2P17A 3TWIA 4AF9A 5LK7B 2JEMA 4H3WA 3WV6A 3B00A 4RL7A 3FLTA 1RVF2 5C6CA 1QXJA 2HWC2 1JYCA 3RDIA 2VMHA 1BBT1 1NZCA 1ZRDA 1ZBA3 5KHGA 1AX0A 1AXKA 4CDUC 2MPFA 4BWOA 3KT7A 4F8AA 2RE9A 2ZGKA 1Q8PA 1RUG2 2ET1A 1HQLA 5JWPA 1UPIA 5EXOA 4IV3C 3WW3A 1NE6A 2SBAA 1DYPA 1RHI1 3IWZA 3KQRA 3NSTA 3POYA 1VBE2 2PHLA 4Q29A 3CNAA 1DG6A 3JBG3 3V0BB 1D4M3 4AVSA 2YHJA 3IN9A 3H1YA 2ZX0A 2WFF3 2WSVA 2A71A 5EWSA 1BBT2 3ACLA 5FLJA 4AVBA 4UBHA 4P9YA 4X6RB 5EJ3A 2D98A 1PO22 2ZKLA 3V0BA 3D4KA 2R0FA 1HRI3 2XL9A 3TNQA 4CP0A 4Y1UA 3ZFGB 4AVCA 3AXEA 1RHI2 1W6PB 4QGLA 4XFHA 5BUVA 5KHJA 5FRAA 5JI7A 4WM8B 4EN6B 1OMIA 3J26N 2NP0A 4L92A 1DQ4A 4QGMA 3KCCA 2F6BA 3KCXA 2HEVF 3THTA 1JUHA 3ZFGA 2DWRA 2WINB 3WNXA 3BIWE 1FOD1 5JMCA 1W6PA 4S2FA 3H1WA 1UZZA 5A33B 4LT5A 3V0AB 4WM8A 4LO6B 2D5HA 2DVBA 1XE8A 2JG9C 2Z5WA 5D8AB 3RS6A 2P2KA 1HXS1 2D7FA 3I2DA 1QQP3 1O5UA 1DF0A 1RITA 5A33A 3KB5A 3V0AA 1U12A 2DTYA 3WDTA 1J58A 5D8AA 4EN0A 1AR93 2VNGA 5CVRA 4OULA 2ZGUA 1FOD2 1Z78A 3RJ2X 2XVKA 1KRIA 1URXA 4AVVA 4E9KA 2WJSA 1FMD2 1O3RA 1YWKA 3USSA 2CYFA 2H0VA 1HXS2 4RGGA 5C8CB 4TSVA 1C28A 2IXIA 1G9FA 3C2UA 4L9BA 3VBOB 4FOYA 3VHNA 4H7LA 2QDNA 1AL0G 3LWCA 1AR63 3MPPG 4DNYA 1VBB1 1H1IA 4QT6A 5C8CA 4FTSA 1ZBE3 2GAUA 5ACA1 3VBOA 2XJTA 3WG1A 1NXMA 1EV11 1FX5A 1C5HA 5L36A 3ZXLA 4W6XA 4LHLA 1ZREA 4YRDA 1V70A 2VXRA 1OFNA 3MLKA 4YFZA 2NMOA 4FPFA 1R081 4NPRA 5J36A 2IXHA 4XJWA 3VBSB 2HYKA 3VZLA 2B39A 1RUD2 1QOSA 3OCPA 1A78A 4YFWA 5ACA2 1EV12 2W0XA 4AFDA 1ENXA 4TYSA 3ZIWA 3JCIA 4XILA 1U0AA 3RYRA 3NKGA 3LSDA 4Y1XA 4HFSA 3VBSA 1QDOA 4UW3A 4META 4D94A 1E57A 4AI3A 1Y43B 1AXZA 3Q9OA 1R082 3MI8A 3BALA 1OA2A 1A8MA 2UY9A 1BEV1 1BXHA 5JPMB 1H2KA 4N7UA 1AX2A 4B29A 3EJKA 3M3QA 2IZWA 3B9IA 2TBVA 1SCRA 1N1SA 4KU8A 4FBFA 5I91A 1K5MB 4XBNA 1Y3TA 4LUKA 1TME2 1ENSA 5BYNA 4YG6A 3JQXA 1IS5A 4OUSA 4YM2A 3H7JA 1QJU3 4MXVA 4UXAA 1BEV2 2GNTA 2Y0IA 3OYWB 3WY6A 1G9CA 4GMP1 4YLZA 1N3QA 1FV2A 4AFAA 3APBA 1VAVA 5EYXA 5FBZA 2R043 5L7OB 1LTEA 1CAXB 2YV8A 4V1PA 3WG2A 3LA3A 3OYWA 1JBCA 1LU1A 4HMZA 5FMOS 2DYCA 2UWCA 2VW1A 1RUF3 3ZFGC 5FFOC 5FMOL 4LBQB 2ZAHA 5L7OA 4WM8C 1MZFA 1CAXA 4PIYA 4Q4Y3 2FZ2A 4F83A 3WP5A 4YW4A 1RMU3 3B69A 2IFWA 3X29B 1Z7S3 4YW1A 1AR81 1QF3A 2GNDA 3CLPA 2AUYA 2K0GA 4LBQA 3AFKA 3VZOA 4GXLA 2A6ZA 3PMEA 3VUOA 1RC6A 4Q2FA 2CV6A 5D8AC 2ZGTA 4TWTA 1CD3G 3WCSA 1A8DA 5DZEA 4AG4A 1A6CA 2A73B 1AYN2 2Y38A 1XU2A 4P9GA 2AZ5A 2EA7A 2GC2A 2XJUA 2DU0A 1Q43A 1O4YA 5BNNB 2D6PA 3I4IA 4QQ2A 5T5PA 3E6CC 1PO11 1WLCA 4OUMA 1MS5A 4BIFA 4N43B 3GBWA 3KS7A 4XQ4A 5GKAC 3CEWA 1ZBA2 2GALA 4RHV1 1AR82 3DKWA 3FUQA