3H90A

Structural basis for the autoregulation of the zinc transporter yiip
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for autoregulation of the zinc transporter YiiP.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Ferrous-iron efflux pump fieF
total genus 83
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01545 Cation_efflux Cation efflux family
A PF16916 ZT_dimer Dimerisation domain of Zinc Transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1510.10 Mainly Alpha Up-down Bundle Alpha-lytic protease prodomain-like Cation efflux protein transmembrane domain 3h90A01
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 3h90A02
3W5YA 3W5XA 3W8PA 3W63A 3W65A 3BYRA 2QFIA 3W62A 3W61A 3W8GA 3W66A 3H90A 3W64A 3W60A 3BYPA 5HSPA 3W5ZA 2ZZTA
chains in the Genus database with same CATH superfamily
4LFAF 2CJ9A 2R8HA 1FRKA 5DG7A 3HHLD 2XMWA 1F6TA 3I82A 4NLQA 4UTGA 4ZLJA 5E3PA 2MKKA 1KDNA 1IR2A 3UD4P 1SQFA 5LJ3Y 1FEHA 2OJ3A 3QMQA 5GMEA 2AX0A 5K8PA 1W2IA 2I8EA 2LQ8A 4ZA1A 3RBZA 2VH7A 1F5AA 1RACB 1HHSA 3CEDA 3ET6A 4YB1P 2D74B 2GJIA 3VAHA 5E5NA 2LXUA 4B9TA 2BRKA 1AT1B 3UVJA 3DLHA 3TZXA 3PX4A 1NK7A 4MKYA 2Y1RI 4OHVA 2QLBB 4QW8A 3K5MA 3NLCA 4WP9A 4BC9A 5ETLA 3Q2TC 1JLAA 2QX0A 1LWEB 1FXRA 1UWBB 2RIJA 1WWHA 3LA0A 1WJ9A 4J37A 2QMXA 4PUOA 1S9GA 1MNEA 4ZCKA 2GVZA 3CB4A 3GFXA 5HATA 2ZH7A 5IQ6A 4IG3B 4WK3A 2W2NP 1OY9A 4TYBA 5IT4A 3WDOA 4X66F 2IM0A 4BHQA 4J9SA 1PILA 3W8PA 3K7RA 1S0NA 2RU9A 2HHWA 3Q0AA 3PYFA 4LF6F 3QZ7A 1VRUB 2K8GA 1RTJB 2OFHX 4ID8A 3JSBA 1VS3A 3P5TL 2A6OA 4L6V3 3UN5A 4O3NA 3W2VB 4U9RA 1F0XA 3B82A 3K5LA 3M32A 2B9WA 3W62A 2V8GA 3OXGA 1EARA 2QLXA 3HSJA 3IM9A 3VF0B 5A2QU 4F50A 2FHMA 4X4RA 4ZIVA 1UAWA 2L48A 4P71A 4N76A 3W5ZA 4JI5J 1TL5A 3K2YA 2VJVA 1XMQF 4DL0C 1QY7A 3C6TB 2MKIA 1Q95G 1IKXA 2GO8A 4DR4F 1H73A 2BVZA 2HGNA 1WEYA 3SDEA 4AQYJ 3TA2A 2DH9A 2GVDA 2VBZA 2AKWB 3N79A 2ZH9A 3DMJB 3HCXA 1HI1A 5BYQA 3HP6A 2RS8A 2K3KA 3N5BA 1HBNA 3H5YA 4WCEQ 1NXIA 4DX6A 1HNIB 2H4WB 2WBRA 5SZTA 2MB0B 3C66A 5EX3A 2YWGA 3F73A 3G82B 1L3VA 4DMZA 3UDLA 5EX0A 2F5GA 2W2OP 3DOLB 1JLQB 1YSJA 4UQTA 3WIVA 1LWFB 3BR8A 2IM3A 3BQ2A 4ILLA 3GJTB 4J9RA 5KFYA 4MKBA 3Q2SC 3AOBA 2VG6B 2ZC3A 4NLDA 2DY1A 4AFFA 2W7OA 2RAQA 2BE7D 4H4OA 2EFVA 4K0KF 3HHNB 1JLFB 4U8VA 1RWXB 2BQUA 2FPHX 1SQEA 4OZLA 1TFYA 1TUWA 2CJAA 2E9RX 2FVQA 2DNPA 2PEBA 3CNQP 4AQYF 1JKHB 3BSOA 4XPEA 3Q8VA 3PFEA 2VU5A 1N5YB 4QYZK 1Y11A 1S9EB 1WEXA 1YITS 4Y2IA 4Y3CA 1HBOA 3FEXB 3CO9A 4P7TA 4WP3A 5IWAJ 1SJ4P 2LDYA 4FZVA 3AD8C 5HVFA 2MEWA 2DNGA 3OFHA 5LMNF 3N6LA 3C3LA 4C3KA 1A6LA 3EMTA 5KFSA 2MZ1A 2KM8B 2KJWA 1IVZA 5IV3A 1GT8A 3MM8B 3HX9A 3WC2A 2M4MA 2MSTA 2H54B 2KXNB 2G0CA 3DCAA 2KHCA 1FERA 2OIHA 2KT5A 4H4KA 4A8MP 4FF4A 2BJ3A 4K4XA 1SCJB 3I5BA 4NRUA 2AMCB 2D9PA 4DV3J 4XTTA 3CCUS 3THVA 1RAGB 2BMBA 2YKOA 1SJRA 2ZKTA 3EICA 5CYMA 2B9XA 3HVRA 2QN6B 2EKNA 1ICEB 4B3OB 2J0WA 4GKJF 2J6SA 4WYWA 1NPPA 5T7LA 5BYSA 2AP6A 4V19J 1RKIA 2QE5A 2CQ1A 5KG4A 4C0OC 1T9XA 4QIWD 2XMUA 4Y00A 2DVIA 3DOMB 4O0NA 1OS5A 1PJ7A 5J2PB 5L1LA 2XM3A 4JI4J 1Q7LB 4Z7CA 4QIVA 3W63A 1HI8A 2GHVC 5I42A 1VC0A 1FKAF 1T05A 3DI6A 4L75A 5C42A 2X1BA 2BKNA 3M2RA 3W2WB 3D67A 2WB1D 2DH8A 3JSYA 2HVEA 3OXFA 3KUGA 5D4PA 2C2OB 2UUAF 3EPIA 1XQIA 1YRTA 2ZOGA 4LFAJ 3FBFA 8AT1B 1FK9A 1G7CB 1FD8A 2YKMB 3CDAA 3G8QA 3GV8B 4EU0A 4C0BA 1RA7A 2I38A 3DFEA 2DR8A 2ZOFA 3BH6B 3VZHA 3LUYA 3OQ2A 2BQ3A 3RRGA 4KBIA 2WVDA 1HW8A 3LF0A 2H5JB 3WC0A 3N6NA 3OD2A 3DRSB 2XGPA 3DDKA 4HDGA 4EBEA 3LWLA 1NHVA 2VG7B 2ZBPA 3LALA 3A12A 3T5HA 4Q0BA 3JB9k 2XY7A 5E0OA 1GXUA 4DR7J 4Y2MA 2IIHA 2AGPA 3KHRA 5IOLA 3UCGA 4AL6A 3CXCR 3AB2B 2RF2A 3SFUA 3W5YA 3MOJB 2B4OA 4QU6A 1LW0A 3KLFB 4ECRA 2N4CA 1LXNA 4DUTA 2YWEA 2R8GA 2IDEA 1U1PA 2C2MB 1U2FA 3LO3A 5CABA 4P9SA 2FDNA 5DM6Q 1FK9B 1E6VB 3IGVA 4CTAB 4FNIA 2F40A 3UO0A 4BC7A 4CDIA 4NLSA 3NAIA 3MUTP 3CCLS 1SKSA 4X2BA 1EHWA 5E7OB 3M8RA 1DQAA 4M95A 4UOCA 3C19A 3PHEA 2VIHA 1U0HA 2FHJD 3BH7B 3V6KA 2J5AA 3QIPB 3QIDA 4O3OA 3DI6B 3JS9A 3VALA 3PO4A 3T9ZA 4X62J 1HWUA 4QWDA 2E7XA 1YJTA 3HFVA 2FZKB 1RABB 1AB8A 2ZE2A 4DPXA 5GAHU 1LOUA 3PW7A 4DJBA 1HQEA 5HMYA 1V6HA 1UCNA 3CCZA 3J7AN 1K73T 1BQMA 1M5PC 2Q79A 1MMDA 3PRVA 1S99A 2QO3A 5DJBA 4AE5A 2VA3A 2HEKA 4LF7F 2P2CB 1L3KA 2HLTA 3GR0A 2XO7A 4A8SA 1NRKA 2BKOA 4M5NA 4WE1B 1NB7A 4JI1F 4F4AA 4K2JA 2DT9A 8RUCA 3HKZD 1KVKA 5K8MA 3OBIA 4NCGB 5KG6A 1WF0A 5G0RA 3L4BC 3SDEB 1NCLA 1MROA 3K89A 1VJWA 3R1HA 1AFJA 1NUEA 2K1RA 3IR6B 5AJ3J 1J5EF 3Q89A 1FNXH 5D4NA 4AUKA 2UXCF 2W7PA 1TL1A 3U1NA 2IMOA 2A0FB 3MUMP 4X62F 4HYKA 1ZTWA 2DPJA 2HHUA 1T95A 2V0NA 2YX1A 2YWHA 2ZHOA 4WKRA 1RP5A 3PW0A 3W66A 3TJ8A 2Y1IA 4CP5A 2JSXA 2UUCF 5AXMA 5KFOA 2P6SA 3AOAA 4A8XA 1Q8LA 3S1TA 3PV8A 1OPZA 3CIMA 3GYXB 4LVOP 3TW0A 2M8DB 4DR5J 4OX7A 1T94A 3PG9A 3D0GE 1NJXA 3MHYA 3AAWB 1WKJA 4RWWA 3HSGA 1UA0A 1CS4B 1DURA 4WIQA 4DQRA 2EVZA 1CJVA 3MM7A 2C3YA 3CUNA 3I9V9 1NB2A 2FLOA 1DTTA 2VG6A 2YNHA 2IC3B 2CJXB 4NZ6A 3ZO7A 5J2MB 3WZ0A 3BDEA 3H20A 4ECTA 5GMDA 2AV5A 2HLUA 2GVZB 3CJSA 3RW7A 3FC9A 1TELA 3H42A 1GQEA 4EI2A 3OL9A 3H90A 3K5NA 2VG5B 4CLKA 4NXNF 1UWBA 4USKA 1B7FA 2HQDA 4DQSA 2E1RA 4WU2A 4DL7A 3ULHA 2L9NA 2HK3A 2HFZA 1CULA 3FFIA 2CQBA 1WC1A 4ZPTR 5HMXA 4OI2A 1IBCB 2R7RA 4DSLA 3A8KA 4HI2A 2VFTA 2XG8A 4YQWA 4NWBA 2A3JA 2CA9A 3MPVA 4PXBA 5HK4A 4PQUA 2WAQD 5IXUA 3GV7B 4OI4A 3W2VA 2XZTB 3MMAA 1RB0A 3EWGA 3SQOP 4DQQA 4EFAC 3KMQA 3G87A 2XLJA 4HKQA 1YBTA 3VAGA 4DV4F 2ZH8A 3IBFB 4ZPCA 2LVWA 1RTIA 3BV8A 3HFKA 5K14A 3MMBA 3R2DJ 2C2ZB 3R5AA 1YWXA 1Q5YA 1Y3KA 1W7WA 2Z58B 2JNJA 4KE5A 4ZP6A 1GTEA 1KLNA 1IM4A 1S6QA 4Z7YA 5CHCB 3K17A 4ZN1A 2ABYA 1JXVA 3T19A 5K5MA 3HJVA 2EI5A 2DIVA 3H40A 1G4CA 3VR1A 3CJRA 1JXLA 4DSIA 3OXLA 5LXYA 1LFPA 3QO9B 2K7JA 1C2PA 3JTOA 3PCOB 2MQOA 1Y4ZB 4A8WA 4G1QA 4CI0B 4UZBA 2MPUA 2ZUAA 4DUZJ 3BBCA 3C16B 2JOQA 3QFWA 2DGVA 1ZZNA 1I94J 1FJEB 3EZUA 1M1KT 2CJYB 1D09B 1Q8KA 5F8HA 1Y5NB 1RKJA 1I94F 3LGHA 4RU2A 4GO7X 3KG0A 4C48A 4BBYA 2M3DA 2MLXA 3O6QA 3Q23A 1H2TZ 1OSDA 1S6PA 2MY8A 1X4HA 4DPUA 3TQ1A 1S48A 2YWFA 3TJAA 2AWZA 4YR3A 2R8IA 1UA1A 3R6GB 1YBAA 1SH0A 3ITHB 1U1NA 3O8WA 3D0HE 1N33J 5GMKa 3BO2A 4YHHJ 2BA9A 3MI7X 1KHWA 1PIEA 1R89A 4PG6A 4UT4A 2QSWA 4L73A 5FJ4A 3CJQA 2BV3A 2EFGA 5J2NA 1C0TA 2M8HA 1XK8A 3M4XA 1CJUA 4OHXA 2WVFA 2D41A 1DLOA 1VK8A 3J7YU 2CQDA 4OL8A 2ZBRA 1YG0A 2QC3A 2I5JA 3FEZA 4NA2A 4AL7A 2YNIB 3EXCX 2UP1A 2DNYA 3FMBA 1P27B 3EDRB 2HYIB 2BJ8A 1CG2A 3HZGA 3GZ7A 3AY0A 1YX2A 4HH1A 5A0YA 7FD1A 4UQGA 1VRUA 2BR0A 3GCWP 2MMYA 1S10A 3KLIB 4KQZA 1M5OC 3U7JA 3K57A 2XY6A 2ZH1A 3VV2B 1N88A 5KG1A 1Q82T 2VZ9A 3HK2A 4PEOA 3NNCA 1T9WA 2M0GB 3VAKA 4J7CA 2FVCA 3FQKA 4ELTA 2CVEA 2E29A 4R8UA 3W5XA 3MR6A 4EZ9A 4ES1A 1HWLA 4USJC 3GQCA 4X4NA 4Q7AA 4ECVA 4TU9A 4NEYA 1HWKA 3HSDA 5GADU 2DGOA 3RBEA 2EC0A 3MMCA 1Q16B 2P9CA 3A3NB 4QPXA 4OYZA 5I3UA 1DY3A 4LR9A 1TAUA 3BGRB 1P9YA 2XHWA 2YNGB 3GP9A 3NMAA 1LQ9A 1ZPWX 5K14B 2OMLA 4IFVB 3KYLA 3K5PA 3ET6B 1TL7B 3MCNA 4HR2A 1O8BA 2F8EX 3A3PB 5EUHA 5HL7Q 5KFCA 4C8LA 2AEFA 5D3GA 2CQGA 1ULRA 1FWPA 2KHDA 1J5OB 3MZIA 1IXKA 5D77A 4B3TF 1SKUB 1M5VC 1JLGA 3JTNA 3IR5B 2ERRA 3MXHP 2E7WA 4ZOSA 1JLQA 2UUCJ 4NCAA 1KHVA 2QRRA 4ECYA 1CULB 3FFIB 2O67A 3PO5A 1Y9OA 3CWJA 4LF1A 2DGUA 1Y3JA 3BYRA 4USWA 2IMWP 3KLEB 1VCTA 4KFBA 2N7YA 4NPOA 3NWGA 3DLGA 4WP8A 3NL0A 1NO8A 4X64F 1YRXA 3AD9C 3CMES 2B56A 7FDRA 1U45A 3CVKA 1RT3B 1XWLA 1RI7A 1Q5VA 2R4FA 2ZFHA 3JQKA 4IQMA 3QWPA 2MTLA 4OLPA 1BLUA 5CCLA 4DV7J 3QT8A 1NK6A 2AZ1A 4FKYA 5IC4B 2DNNA 1DBDA 3E8OA 2AJQA 3T1AA 1RADB 1C0UB 2P8IA 3O5TB 4DSEA 1S76D 5D4OA 2Y0BB 4F4YA 2EFOA 4PWDB 1VQYA 4MK9A 3BSNA 2WRMA 2MZTA 3CDUA 1JK9B 2NZ4A 1OWXA 2MKSA 2P9GA 2H48B 4C7QA 5HVHA 1BMQB 4K0KJ 5KFVA 1G1XA 3W60A 3TR5A 2AX1A 5A6PA 3KNAA 4USUA 2HQIA 3BB5A 3AODA 2YTCA 1Q79A 3HFZB 2GJ2A 1SB6A 3HVWA 3MPUB 3GB0A 3BKTA 3GWCA 2W9BB 3M8PA 1N48A 5IFMA 4PAAA 4C0HA 4DHVA 5HJYA 2R7WA 3RR8A 1IN0A 2DCLA 2EXUA 3MAAA 3MMAB 4ZLNA 2XY5A 1EB0A 1KWMA 4LSLA 5K8OA 4RNMA 4LFBF 3R5JB 5C5JA 1NDLA 1PYSB 1D8ZA 3ZZRA 3V2UC 3FSIA 1SL1A 1DLOB 5D15A 2DH7A 2HURA 3UPFA 2ZDPA 3H25A 4DR2J 2AGOA 2ACMA 1T7PA 2HMIA 4UF4A 1LEOA 2VASA 2HHXA 2MQ8A 3LAKA 1R8AA 4HH0A 1BHNA 3KOAA 2VG5A 1Q8BA 2W7AA 3M7VA 2RHSB 2EW9A 2KRRA 2B8QA 4WFAQ 4OV1A 4PR6A 2W9CB 1R8CA 2JFKA 2GGPA 4ED6A 2MGZB 2AQ4A 2O3DA 3CJ4A 1OSCA 1R43A 1TKXA 1NK8A 2BJ9A 5DO2A 2CJBA 4A4JA 4CH0S 3OJSA 5KFHA 3IC1A 4QWCA 3CCES 3C16A 4B9LA 3V6DB 5U47A 2HHVA 1NPRA 1CC7A 1CVJA 4C4WA 2MLYA 2XSFA 1TK5A 2HRTA 1NK9A 1K1SA 2MZSA 4ECXA 4JV0A 1XR5A 2DO0A 3AJ2A 4CLPA 1QD1A 1FJCA 1S49A 1TKTA 3MEDA 1LV5A 3I32A 3JSRA 2MHEA 2VFVA 3AH6A 2QJ3A 2V5HG 2MKHA 3GIIA 4DL3A 4O23A 5I3QA 3BO3A 2YBVA 3WIUA 5J1EA 2EEYA 2UUBJ 4DUYJ 3DRRA 2UUTA 3RBDA 3RGIA 3D1HA 5LOQA 4DV1J 1MWQA 1U0SA 2PO4A 3DHXA 2MQNA 2HWIA 1RAIB 2KDOA 3LQVA 3MOZA 3LPEA 4NLYA 4DV1F 3FQLA 1FE4A 2ROEA 2GNKA 4BWJA 2H9ZA 3J7Z5 4TU7A 1ZM3A 1NZ8A 1U6ZA 4G65A 1H72C 2FGCA 2HNZB 2HRUA 2Z30B 1FVQA 3E3XA 1BQMB 1HIYA 1T0TV 3Q83A 1QAJA 3MEGA 2ZUGA 2CZVC 1S1XA 2DBBA 3GTYX 4NLOA 2IAJA 4PCQA 4P7VA 3ZZ0A 4K5SA 1PSDA 3E2EA 2NUHA 2D69A 4Q2LA 3RBXA 2BQRA 1GFWB 2IBOA 2OPPA 1ZH5A 4JI3F 2ZBQA 2HRYA 3KUEA 5C24A 3OSPA 4NLWA 2V8HA 2YXLA 4R25A 4X66J 1TKDA 3IN5A 4YDXA 1HHTP 3DM2B 2E44A 2V94A 1ZETA 1IBKF 4N47A 2VL1A 4LR8A 4ELUA 4ER8A 4L72B 1V3RA 9ATCB 5L46A 4ECSA 2QSFA 3FBBA 4URQU 5EWGA 4BS2A 5FD1A 2A2DA 1FTRA 4OI6A 1J5OA 4RUBA 4B08A 3M8PB 4JI6J 2VV5A 4DV6F 1VLOA 1J27A 1RAHB 3MCMA 4M94A 3BREA 3H2VE 4P75A 5CXTA 4L3NA 3BBFA 2QZ8A 1U2RA 1VR6A 4AYBD 4DX8H 1IR1A 1FE0A 1UFWA 4LSNB 1FWLA 4Y6IA 5HP1B 5CZVA 1KVIA 3MM8A 2RUGA 1KOOA 2AJ1A 3NEKA 2OEJA 2Z2ZA 3MEKA 3US5A 3ILLA 4F3QA 3HHDA 2BJDA 4FXWA 2C42A 4MFBB 5CYQB 3WHIA 5HQ8A 5HO4A 2XMAA 5F41A 4O44A 4CLYA 1R8BA 1UEVA 3KHGA 1XNQJ 3LP1A 1YK9A 5AE1A 2ZDOA 2VOPA 4W98A 2W4DA 4CLZA 3H5XA 4MH8A 2LQ9A 4JV1A 1G6BA 1F2HA 1Q1KA 1UFKA 2W1BA 5KFXA 1W26A 2OFGX 1YZ7A 1I5OB 4ZP7A 1J2VA 2A18A 3G96A 1T9VA 2UXCJ 1URNA 5K8NA 1RK8A 3KLIA 3PJ9A 1VQLS 1NZAA 3V4IA 4PXDA 4IG3A 4ZJQA 3CT9A 1SJ1A 1QVGR 5FDLA 2PT0A 3TOQA 3V4MA 3V6JA 4FPIA 4PUOB 2OEKA 3QBCA 2CPIA 2I5JB 2RQMA 4C3LA 3IBCB 2YY3A 3RG6A 1V3ZA 1P1TA 3IBWA 1SV5B 2WK4A 3FDSA 2P6TA 1ZAXA 4LQ9A 4DFMA 2NYIA 4F26A 1U1KA 4JI7J 3P45B 2JFDA 1DAXA 2QMUB 4I68A 4LUBA 2EWHA 4X4TA 4DZ6A 3DLBA 4ED8A 5B0CA 3OPKA 1OY8A 1SC4B 2OLWA 3ETMA 3QGPA 4LBHA 1QE1B 2G9OA 2PN6A 3C14B 2K3IA 3PM9A 1I51B 4IDKB 4CO1A 1U1LA 3M30B 1BQNB 3W65A 2ZH4A 4DQPA 1PCAA 5IT9Y 2VFRA 4RNFA 3PIOQ 4YB6A 1JJ4A 2RRBA 2RDIA 5EWFA 3BYPA 3Q8PB 3RAQA 3OVBA 4J9OA 5HMWA 4CLSA 1W2BR 1ZBTA 2AYGA 4X4UA 1EKRA 2FTRA 3B4DA 1PBAA 1TKZB 4GVLA 4W4MA 5B0GA 3FNNA 4LF8J 4DF4A 2IA0A 1QAXA 2KN4A 4F02A 2HWTA 1QUVA 1Y7PA 2XBPA 3AXMA 2XMJA 1FRIA 3MWBA 4J9VA 3WX4A 4DLEA 3G6YA 1X7VA 2VPYB 4KT0C 4ZPVR 4GKJJ 2D7SA 3M6UA 1AYEA 2DEJA 1SH3A 2GQ2A 1WNEA 4U7UD 3IMQJ 5DGAA 1KBRA 4DPTA 1OO0B 1NK0A 1UFLA 4OZ0A 1Q81T 2Z2YB 3X3UA 5HBMB 2V8DA 3M30A 5C42B 1SJFA 2I6WA 4IRDA 2V68A 3RZAA 3VVTA 4CLTA 1SUQA 5AXLA 5I42B 2YX4A 1U4BA 2JVRA 4FPRA 4DF8A 1YI2S 2YNIA 1D1UA 3GG1A 3LP2B 5KFTA 3J80Y 1JLEB 2YPYA 4I67A 5KT3A 3OR1B 4GC7A 1Q78A 3W7BA 1M5SA 1AA1B 1SJQA 2VQFF 3K0JA 2KB2A 3GIRA 2AW0A 2QFIA 3KUHA 3OTBA 4CWBA 1YTYA 4FYDA 4EUVA 1NSKL 2RVJA 4S0MA 5J2QB 2AEMA 1U48A 1NHKL 1GX5A 4C2MA 2D3OR 5D0HA 2C2EA 2JVOA 2QA2A 3FSYA 5J1PA 5ETMA 2AD9A 4LMZA 4QYZJ 2ZD1B 3FK4A 2BDPA 1E6YA 2NREA 2J6UA 1XNRF 2MHNA 2EFQA 5DGBA 1PYTA 3W64A 2DRDA 1RISA 4RNNA 2E9ZA 3BDPA 1XIQA 4RBUA 2C3PA 2CWXA 5ETOA 5C7PA 3EYZA 2BJ1A 1SC6A 3HULA 3OUYA 3LP2A 1N5TA 5ETQA 3TAQA 2QFJA 1T02A 3M32B 5A8KB 5DDRC 5FLXY 3OL7A 1KNZA 1KC8T 2GFFA 4FYVB 2UV8A 1U26A 4WIIA 3UW1A 2H3EB 3DDNA 4WBFA 2E5LF 3D54A 2L08A 4TQRA 3D9BA 3BZQA 3NGRA 4L74A 3UDVA 4N56A 3G8SA 2ZM6F 2OD4A 5HJXA 2FJVA 3IWNC 1VQSA 1R0BG 3J80U 2V2VA 3R97A 2VOOA 2R8JA 4M5JA 2E5LJ 3RB3A 2HZAA 1RAFB 2N3LA 2LEBA 5HLFB 1XC9A 3FZBA 1MN9A 3KJQB 4IFYB 3M1VB 4DOZA 4A8QA 3NGKA 2UU9J 3MR7A 3ISNC 1H6KX 3PACA 2NXNA 5KFBA 3IAS9 4YR2A 2UU9F 4O4GB 1FO1A 4URSA 4NEZA 4LSZB 4NMXA 3DLGB 4M5HA 5C25A 1OMSA 2W2MP 2YNFB 3CCWA 1DZ5A 3SSRA 3M05A 3RB4A 1M1HA 1RSCA 1WOSA 1U1MA 4KHPJ 4X4QA 3BGOP 2AYMA 5KFAA 2R7VA 4M63A 2JZ5A 4LF2A 3ZNUA 4HI1A 1TU0B 4HDHA 2A6MA 4WZMA 1BGXT 4NL5A 1FKPB 3KLVA 2CJKA 3UDCA 2OPSA 7AT1B 1UVLA 4RL1A 3P5BP 2BACA 1AZSA 1FA0A 4X65J 1TV6B 3POTA 3PDNA 4ZCMA 1RT7B 4MK7A 3NKYA 4QOTA 5B0FA 1NJIT 3EVMA 2C1EB 3VGVA 5BJRA 1S1WA 1VJQA 3CMQA 2LXIA 3L95X 3BGUA 2CADA 4DI6A 5KFWA 3GSDA 4TVAB 1RA6A 3AQPA 5KFNA 4JYAF 4CO4A 3VQSA 2RF2B 1KP6A 2EG1A 4PXEA 2XO6A 2QT7A 2Z57B 3BS9A 1XMQJ 1RTDB 3W3SA 1KRPA 2KZZA 4M5KA 4OZNA 4USIA 1RHJB 3UE2A 5DDPC 4TNOA 1NDCA 1R0AA 1S1VB 4PXCA 1BWVA 2MY7A 2ZC4A 3D5MA 5HQMA 3EGNA 4ID5B 4DL6A 4FN5A 5CH7B 1SKRA 1T9TA 2CKWA 1DARA 2KYZA 4ZVEA 3Q86A 3CD7A 3ZTQA 4CT8A 1S1UB 1VHFA 1S6UA 4IDKA 4JI2F 3CF5Q 4OMFG 1PJ6A 1N8RT 2LMIA 3QRPA 2NLWA 4JUZA 1N0UA 4DS4A 2C2DA 1A7GE 1JLAB 5H1SV 1FX2A 2HK2A 2PMHA 4OYIA 4LF4J 2ZZMA 4N8OA 2HHQA 1IWGA 1UJ4A 1VRQC 2FHJA 2BW7A 4YUDA 3CCMS 3MPWA 1TP7A 4LIRA 3NNAA 3ENAA 3F41A 3C15A 1WDTA 4OZ3A 5L9NA 4ES3A 1BUXA 4D3HA 2IM1A 2OPRA 3M6XA 2MKJA 1FFGB 5IM0A 4DSJA 2K7KA 1FHTA 2PSZA 4CYUA 2JHEA 5KG7A 1Q86T 1RT5B 2B6AB 2CUYA 4JI7F 2Z0GA 3MTJA 4N7TA 1FNOA 3MR3A 2KU7A 3U1LA 4K4VA 3QFHA 4RR5A 3A8JA 4FXVA 1LWCB 2OUGA 1DJ0A 4KHRA 4FF3A 4ZVQB 4ECQA 4B3RJ 2FHOB 2NUUG 5FDLB 3OV7A 3CPWR 1UVJA 4K2XA 1TKZA 4JP8A 1RT2B 2KT2A 2ZBCA 1TUVA 3DRXA 2LQBA 1DQ8A 3T41A 4XPCA 2DRAA 4FYWB 1FDDA 3SXLA 2BOAA 2XZWA 3IS9A 1SBRA 1HLWA 2BRLA 2WSFC 3KJVA 4GKKF 1RAAB 2J7WA 2QMWA 2U1AA 2JLEA 2E5JA 1HA1A 3NCQA 2BM0A 2J7UA 3I0RB 2KVIA 3CJ5A 3C14A 2GHPA 2JH3A 1UVMA 2MXYA 5T41A 2AHOB 4O3SA 3CE8A 2L41A 1FT8A 3ELHA 2XSJA 4ALZA 1VHIA 2CDQA 4JOUA 4DCPB 3PX0A 3NMRA 1JJCB 2XCAA 4HT5A 4WYLA 5HMZA 1JLCB 1VBKA 3TVZA 4ZS6A 3CC2S 2G2ZA 4NLGA 2HVHA 2VPXB 2DB1A 1BC6A 2J9CA 4RX6A 1T9YA 3GYNA 4WXWA 4OX6A 3GJSB 1X9WA 1BWEA 1KQFB 2ZE2B 1MMLA 1QDUB 2WB4A 3GFZA 4RKUC 5J2MA 2I0XA 4HLBA 4RO0A 3DRPB 2DXFA 3CCVS 4ZMMA 4R5PB 2MYFA 2DNHA 2EC2A 3HHLA 5KAKA 4GKKJ 3NNHA 1O51A 2J9DE 2VKZG 1XTZA 2YPZA 2XZDB 2ZWPA 4KTQA 1VLYA 3MECB 4ENOA 3HKWA 3QAUA 3THTA 3Q22A 4DN9A 2ZJPQ 1X0FA 4PG5A 4PG8A 1U24A 3DYAB 5IQQA 2F8HA 2IHR1 4RW9A 5MLCV 1TK0A 3VGUA 2EKYA 3OTEA 2VPWB 5CYQA 1TQLA 4ZKAA 4JI3J 4K4YA 1C1BA 2KFYA 2OHDA 2WVCA 4I4BA 4OQJA 2HMIB 3KK1A 4KHPF 2WVEA 1G3OA 1ZM4A 3SSSA 1DRZA 4W90B 2QG9B 3V81A 1TKTB 4B9MA 3MAQA 1RU1A 2N4DA 2OGUA 3TO8A 2VG7A 1QSYA 3N5FA 2QA4G 4DV2F 1N36F 1CPZA 4OYMA 1HKAA 2BE2A 2CVIA 4RW8A 4B9UA 1LWCA 1ZM2A 3CO0P 2UXBJ 4QZVB 4ANEA 2K2PA 5H9EJ 2FZGB 1S4EA 4QIFA 1IKVB 2PA8D 3CCTA 3FBCA 2PMWA 3GE9A 2PFDA 4KH0B 4N8NA 5CQGA 4QCLA 3CJKA 3GJQB 3NAHA 1UZHA 3MPYA 5GADI 1RWVB 4G6VB 4RUAA 1LK5A 5JVHQ 3UCZP 5A0YB 1KR4A 2OPRB 3DC2A 5IM0B 3KLHA 1N34J 4DX7A 1BQNA 3J7ZT 2GQCA 3DOLA 1D0EA 3MEGB 2NYHA 3KDOA 2A10A 3CTRA 5F9LA 2W8LA 3AXKA 2ZJRQ 4IR9A 1HMVB 3I9ZA 3BGFA 1S5ZA 2HFNA 2W4CA 3O3LA 4DG1B 3HXMA 1PJ5A 4NLUA 4EYIB 4E2FB 2CNLB 2BW2A 2QA4S 1F1BB 2OO4A 3NS5A 4HL9A 4K59A 4OZ2A 5ETTA 1N36J 4CCHA 4GO5X 2UUBF 3TI0A 2YH0A 1X4DA 3B78A 5KFLA 4OI1A 2IVMA 2CPJA 3VGTA 2GVDB 2JRSA 2XYGB 4X4OA 2HZCA 3A8EA 1T05B 1R8HA 4MJKA 4U7CA 3MM9A 3SI8A 1R27B 4DL5A 1WI6A 4JI2J 2IFXA 4ID5A 5KT6A 2IY5B 3N01A 1WC4A 3ICLA 2IA6A 2HAIA 2ZVIA 3TYTA 2XULA 4DU8A 1FRMA 3MM6B 4RW6A 3TP2A 4KY3A 1KLMA 3ZFVA 5F0UA 2H65B 3LH2S 4TXSA 5DS7A 3DDIA 1SQGA 2N3OA 3G9CA 4CM0A 1N34F 4Z2XA 2R3VA 3ENWA 2VA2A 1IKWA 5D4LA 2Y1LB 1S7IA 1D3WA 3MAAB 2E66A 5IS2A 4DSKA 3HHKA 4DR5F 1SJ3P 3JQMA 5KFIA 4FS1A 4IFYA 3CJ8A 3QPIA 3JYTB 1TL7A 4BLGA 1SL2A 2IYGA 4K7QA 5HANA 4ZDNA 5H9FK 3SQGA 2CZ9A 4K8RA 3SMZA 3GCXP 3BPSP 1RTZA 1LKZA 1P6TA 2GGPB 3Q8RB 3AFGA 2XMKA 3B54A 1D8YA 4J9NA 4I7FA 2KO1A 3F44A 4A48A 1FKPA 2ZITA 5JXSA 2EPIA 2EFPA 2K06A 3F56A 5B09A 3OLBA 2J9EA 1DQ9A 5CZXA 4Q8EA 4EBDA 1FJGF 4O3PA 1X4FA 2R7QA 1C0UA 4PABA 3IWXA 1Z2ZA 3QZ8A 3IRXA 4NRTA 2DGXA 1HNIA 1TV6A 2DITA 4K4WA 1K0TA 4LRFA 4DZDA 1S6OA 2EG2A 1CEZA 2ZNYA 4ZPWR 3FRYA 2ILZA 4DR6F 2IRYA 3DLEB 3GU0A 1YJRA 3IG1A 4WFXA 3M6WA 5F3TA 4U7UK 4WTOB 2YKQA 3AJDA 3OJUA 1K8AT 2KYXA 2ZHBA 3HT0A 3QWUA 1KQSR 3TZWA 2W4PA 4KKOB 2RDDA 4HHUA 1NBEB 4H4KC 3PYEA 1ZZFA 1FRXA 3RTVA 1JLCA 5DLFA 2XB2D 1UW9A 5KT7A 1QLNA 4DEZA 1X5SA 3TAMA 4RNOA 2HSEB 5GAGU 4DFPA 4ED7A 2GHWA 3BR9A 4RUCA 3D6HB 3DLJA 3KNGA 1KEKA 1RWOB 3D1QA 2Q6CA 4OIXA 3RRHA 1TAQA 3MDFA 4LF5J 2AZ3A 4NI2B 3PNIA 1PAEX 2AEJA 3MCOA 3Q8YA 1Y10A 4QW9A 4ZK7M 3OLAA 3BSAA 4IOBA 5D3GB 2BE9B 4IKAA 1R7IA 4IFVA 4OYAA 1X4BA 2NPFA 4C8YA 2V34A 2OMOA 4DV7F 1Q7YT 1K47A 4H4MA 3QSIA 4NMLA 4KRWA 4YB7A 3DLKB 4DR6J 4FBTA 1DTQB 4B3TJ 4TQSA 4ZPBA 4IYQA 4DV0J 4LBPA 1T11A 1NKEA 1ZOTA 1I3OB 1F9EB 3FMWA 4OYXA 3F0NA 3S01A 3TAMB 4O0IA 1VIOA 1H2UX 2BJ7A 1TMMA 3JQJA 3KLEA 1RHRB 2KI2A 2FVRA 1M90T 4CLFA 2EK6A 2HFOA 3V6DA 2RMLA 1HQ2A 4M1KA 3D68A 3CDEA 3MM6A 3T9NA 3RW6A 5DG9A 2VJUA 3DHWC 3X1LB 2XMVA 3OR1A 3MFIA 1TK8A 2Z4PA 1FWKA 2E1AA 2XYHB 4OJHA 1RWKB 2XS5A 3IM8A 2VC0A 4DR3F 2FLNA 4ICLB 1RWWB 3MEEB 5FLXU 4M5IA 4KV8B 2V8PA 4YY3F 1EP4B 2Y0SD 4M5GA 3SV3A 5HROB 3KK2B 4DL2A 2DR7A 3FEYB 2FJDB 2KH9A 4B9NA 1ZA2B 1C0TB 1GXLA 2H4YB 4ZVHA 5AE3A 2HS4A 3G6XA 1O5JA 5I3UB 3J81Y 2HHTA 2M7SA 1YJUA 3T5JA 3I87A 2R8KA 1HPZB 2Y3YA 2V8VA 5T14A 3BSCA 1KFSA 2CNOB 3I4PA 1F5BA 5C25B 2MQPA 4ANDA 4I6WA 2UV8G 1LW2B 5ETRA 4F3OA 1RTJA 3PKMA 2IVFB 3N9UC 2D3O1 1NK4A 1HW9A 2VBYA 3NOGA 3UWTA 3EDQB 4OYWA 1WOOA 2EK1A 2H5IB 2IDLA 2Y8WA 5G4DA 2E5GA 1VQKS 3VHQA 4DR4J 3MMBB 4KGZB 1C1CA 3AA8A 5B7WA 4DFKA 5DRKA 1HNXJ 3NY0A 4FKXA 1IBMF 4G1QB 2W2PP 4PPZA 1F9FA 3KKFA 4FS2A 2V4RA 4L3KA 1QAYA 5DZ6A 5JVGQ 2HHPA 2V4JA 3H5UA 1KTVA 3QO9A 4DFJA 4LT6A 1HI0P 1HL6A 1U8WA 2OI2A 4RW4A 3MUVP 4LREA 2CPFA 3L7UA 3K8WA 4IH5A 3LPYA 4I2PA 1XR6A 5GAHI 1MSWD 1ZPVA 1TVRB 4DCJB 4BDPA 1EZZB 1S1WB 2FY8A 5BR8J 3I55S 2CZ4A 4N5SA 5L1IA 2BANB 4DUZF 2ADBA 3NS7B 3W9HA 4ZVOB 2RDJA 4B3MF 3NGUA 3QQCD 4M5MA 5BXIA 4U67Q 2G4BA 1CC8A 2HFSA 2RQ4A 3ITHA 1T03A 2CQCA 1N32J 4CH1A 2C2KB 2C3MA 4QIGA 4RW9B 1U1QA 2GJFA 2Q3PA 3V4IB 4WFZA 3HVAA 4ANCA 2L3MA 5DLGA 2CRLA 2LU1A 4P6QA 1IKYA 1GMWD 4KFBB 3LAMA 1IJFB 4F4ZA 1HNXF 3ILOA 5EN1A 1Q8IA 1SV5A 4C8NA 4USTA 3E01B 2FD2A 4NASA 5B0DA 3JSMB 5H9EK 3M8QA 3ZZPA 2GV1A 4JV5J 2MLZA 3DGPB 3OSNA 2E1MC 3DOKA 4KJIA 1D9DA 3AA9A 2UXDF 2QEXS 1NEEA 1BXNA 3TA1A 1S1TB 2R7TA 4AXIA 2FLLA 4BCAA 2OKQA 3M8YA 4J9MA 3DLKA 2GIRA 1NU4A 5KG2A 4RU9A 1VC6A 1FFWB 2HVDA 3OL8A 2HNYB 3MCSA 4RWXA 3M8SA 1RCOB 3D6MB 1QSLA 1RT6B 4A8YA 2XS2A 1IKVA 2VBWA 3L9ZA 2FY1A 3VQTA 1H74A 2ALYB 1FEEA 3OTOJ 2IJRA 2LKZA 4NCGA 3GILA 3U1MA 2WOMB 3FKBA 3MMCB 1WI8A 2WONB 4J9QA 5A8RB 1S9EA 3D0IE 3TANA 2DO4A 2DK2A 2RD5C 2CG4A 2UZAA 1CLFA 4OHWA 3Q8QB 3KK3A 1U47A 4ELVA 2LEPA 2HQGA 2XMMA 3TJ9A 1YKWA 4ZVGA 1CQMA 5HI7A 3Q8UA 1VK3A 2HIQA 2GIFA 2ILYA 4DPOA 3KK1B 4FNHA 4KC5A 4CQ1A 5F8GA 4LF5F 3A3OB 1YHQS 1JNRB 1X5OA 1TL3B 4FYYB 2W24A 5A6WA 2BM1A 4PKDB 4ZHRB 1RHKB 4HACA 3GR1A 3R9LA 3DRSA 2P9EA 3HO1A 1S1XB 1OPIA 1WC3A 4A8KA 3OHAA 3R2CJ 4OHYA 1FKOA 5J2QA 2GMLA 2YQ3A 2L9WA 2AIRB 2O01C 3GONA 1WSRA 4YN3B 1XNRJ 5AJ3F 5CYJA 1JX4A 1CJUB 2V63A 3TQEA 3MD3A 3QT7A 2J76E 1YBUA 1RT5A 2JJ4D 4TLQA 2QYCA 4EYHB 2M2BA 1HQEB 2HNDB 4P2XA 2A1BA 1L3UA 4E0DA 2G0IA 4AD6A 1NJWA 1LW0B 1RQ0A 2OPQA 3N6MA 1KQKA 3KLFA 2JLFA 3PTWA 4TY9A 2MQLA 4I7FB 3QJLA 1CJTA 2HAFA 3G71S 4F2RA 4B17A 4OZJA 3R3TA 4LRAA 4G3IA 1RXOB 2J6TA 3D3BJ 4F7VA 1YQHA 2JX2A 1RGVA 3O1LA 2ZH2A 2K1RB 3CJ0A 2X7IA 1IUJA 3T6BA 4OYBA 1RJJA 4CNZA 5EGYA 2XQCA 4PYDA 2KJVA 1CQNA 2F7VA 4RW4B 1FKOB 3BN7A 5M2RA 2VQEJ 1IBLJ 1RWNB 2VF3A 3BKUA 3NGSA 5E2QA 3FRZA 1SC1B 2ASYA 1YJWS 4U8YA 2IPOB 2Z8QA 5JMNA 2R7SA 1F9HA 1W25A 1X4EA 2DHHA 2XC9A 1XEZA 2FJBB 1RTHA 3B4MA 1QSSA 2IRUA 1VQ6S 4IOAQ 1XBWA 3J81j 1N56A 2MGZA 1TR0A 3CC7S 4ZP9A 3TUZC 1X4AA 3MFHA 5DDOC 3OTOF 1RAOA 2KM8C 3CCJS 1FDBA 2D1CA 4LF8F 4OI0A 1JLBB 3ETOA 4CO0A 3L09A 3OW2R 3QIPA 2WOMA 4KB7A 2B9EA 4EWTA 1FRJA 1NSAA 4YDDB 4RW7B 3CW2C 1QTMA 2AF6A 4WXOA 1DFDA 3VAFA 4DL4A 1UW4A 4OHZA 5E3QA 1U7LA 2KRBA 5CD4H 5A2QY 1B0TA 2ZNZA 2VQEF 4R5PA 1C1BB 1X0PA 3JAMU 3FBEA 1H7XA 2OPPB 3W61A 4FF2A 3MM5B 3OVSA 4F67A 1K9MT 3HJFA 2KXHA 2PMZD 2V67A 2XMTA 1YGYA 3EGWB 3G8TA 5CD4A 1VQ9S 4F25A 4IRKA 2GS8A 4Q2MA 1WF2A 4NXNJ 1OJ4A 4UY85 4LIWA 4KGMA 1U6BA 2KTQA 2QL5B 3KLGA 2MQQA 1PO6A 5D78A 5HN0A 3IO1A 4DPWA 4DSFA 2PC6A 1REVA 3O2IA 4PZVA 3EX7B 2QIFA 5FIIA 4BWMA 4M5DA 3HSZA 2F1FA 5B0AA 5A8RA 5MAOA 2IJFA 1GMUA 3TEGA 1IQZA 2J0XA 4C8MA 2ASJA 2C2NA 2E7VA 4I69A 1PGZA 3HHLC 1K44A 1URRA 3I4HX 1T03B 1FXDA 4ATNA 2PI4A 5HAOA 2GO9A 1WD6A 4CRJA 3VCDA 2MZJA 4LVNP 1WC5A 2VD3A 3FUYA 3KDNA 4USVA 3PEJA 3H59A 2CQIA 5F8MA 4ES2A 1RTDA 1R8PA 4OYOA 1FDNA 3H4BA 3TAPA 1CJKB 2J8AA 5KT2A 4EGLA 2FC9A 2UUWA 3NG8A 3H2UB 3OR2B 3ZC4A 1GTHA 3HLUA 3OFGA 1LWXA 2F3JA 2NXJA 1YJ7A 3BKFA 2HQFA 4KGVB 4NYPA 4D3GA 4MMOA 3RB6A 1TFWA 3CD6S 1BQXA 3EGZA 2GC8A 5IC6B 2C22A 1NSQA 1NHUA 3R7BB 4DLGA 2CDRB 1WF1A 2HNYA 1L3SA 3D2WA 1GMVA 3HHLB 3NRBA 4Q5VA 5CA5A 1XMOJ 1RT1A 3QJPA 1TKXB 3FJ2A 4MKAA 3W1YC 3GJRB 1GH8A 2B9YA 3PR4A 2XS7A 1OY6A 1AROP 2GAHC 2KXFA 4MAKA 1QAIA 3VAIA 1YZ6A 2JWNA 2HGMA 4YHHF 3MF5A 4EO8A 1H2VZ 2XLIA 1R0CB 2OSQA 3T1YF 2FLPA 3OTDA 1HPZA 4JB8B 1XNQF 2WVBA 3E01A 3TZZA 5DG8A 2YWWA 2B51A 1NDKA 2MSSA 3FZ2A 4AXJA 1TTHB 2FYXA 4CH7A 2X51A 2PI5A 4CO5A 5GAEI 1FDAA 4I6YA 3CCRS 4GRSA 2R9LA 3DGVA 2J9DA 4YEAA 3W9IA 2JC1A 4P74A 3UR0A 3DMJA 2JL9A 1UETA 3QGIA 3SFGA 4ZLLA 4ECUA 5E41A 4KPCA 1HBOB 1WOPA 3DN9A 3PY8A 1NPKA 2G2YA 1WG1A 1HFEL 3EXYA 2LYVA 4ZCLA 5HBMA 2YVSA 4QR0A 1VDHA 4XK8C 3W9JA 2RQCA 1KONA 2ACYA 4WFBQ 1UTAA 3BEGB 5ETPA 3JTPA 2R2RA 2NCKL 2E1PA 4JI5F 1IBKJ 2NZCA 2BANA 3BBBA 2VPZB 3BF4A 3BGRA 1BD6A 3LANA 1RT2A 3N4WA 4I64A 4C6AA 2JEJA 4OZ5A 1WHYA 2YX7A 1U8SA 3QAEA 5A8WA 2XGQA 3GIJA 2B4PA 2F63A 2DGSA 4ETXA 1X4GA 4USHA 5KFKA 1QJHA 3DOKB 2YWKA 2VKRA 4QU7A 1O0PA 1MWZA 1S1UA 2BYCA 1U49A 3KHLA 4NYZA 4KPYA 2Z56B 2NXUA 4IH7A 3JSMA 2XWXA 2CPXA 3TNVA 2UVVA 3C2PA 1KLMB 4QQBA 3MPDA 1NMEB 4MK8A 4UUWA 3D6FB 4C11A 3VTIA 1M1GA 1CBKA 1B0PA 3PX6A 2Y9HA 3K8VA 2HHHF 1F3FA 2VFSA 2ZD1A 2GX8A 5IV4A 2XNRA 3MM9B 4UOHA 1JXEA 3CSKA 2DNMA 5JUMA 2DHAA 2E5IA 4IOCQ 1V3SA 1VI7A 2KZMA 4LQ3A 1NKBA 1VOMA 4NA3A 2QV6A 1NH7A 1H0HB 2CAJA 4E98A 1UJ6A 3ADAC 5F9NA 4Y65A 2QLJB 2DKOB 2FQQB 2MKYA 2NPIA 3UVJB 4C11B 4F36A 1WTFA 5HSPA 1X5PA 3C46A 3ZNJ1 3A13A 3SV4A 3CULA 3QNWB 4KKOA 2QL9B 4XO0A 3OVAA 4F0KA 2IBKA 1P9QC 3NGDA 3R5GA 5LT5A 4XIUA 3R7NB 3R5BA 4DV5J 4IO9Q 1ZYQA 4DV2J 2POKA 2FC8A 2VICA 3AJ1A 2RRNA 2CQ3A 2DNOA 2HBZB 2JEIA 3M1VA 4HTJA 5F8IA 2KFNA 2LECA 3QGGA 2LLZA 2Y8YA 2EBGA 5HLFA 3AD7C 1RT4A 1SI9A 3AT1B 1R0AB 2HHHJ 4RLEA 5L39A 4DR2F 4P10A 1RWMB 2V2QA 5HQLA 1SC3B 4F4WA 5EWEA 4K50A 1WKKA 2FUG9 3A8IA 1B7YB 2VQFJ 1NK5A 1AUSL 1UPMB 3EM1A 3UN3A 2FIUA 1IBLF 2RH3A 5ETVA 3EGVA 5B0EA 3PJWA 2OEMA 3QT5A 4F2SA 3P3DA 2M9KA 5KFJA 5LMNJ 1F2GA 4Y2AA 2FVPA 4O4GA 1UKUA 4YS2A 3PW2A 4KGXB 1LWEA 1P8GA 4RNHA 4TN2A 1LXJA 3QSYB 1XR7A 1FRLA 2B8PA 1N5YA 4UUXA 1XMBA 2M70A 3J7YI 2DXEA 3EVWA 3ILIA 4TY8B 2BXJA 3JXOA 1WEZA 4OJGA 3GMGA 4DV5F 1RT4B 2B0GA 4TLRA 4H4OB 1N6QA 2KG1A 2F9DA 5KT4A 1Z2LA 1Z1ZA 3PW4A 2FGOA 1KKHA 3LW5C 4GVBA 4Y2KA 5ADZA 4FVMA 2BJEA 4CLWA 1HR0J 4NZ7A 5KG5A 4EK2A 5I4MA 1KTQA 2O1PA 3A4TA 3QATA 4OV6A 4JI0J 3MGJA 2R2TA 2WW4A 1RHMB 2F8MA 2WSEC 4OYPA 4JV2A 4IQXA 2YKPA 5AE2A 4EEYA 2E5HA 2F4VJ 2J0QD 1YDLA 3P4UB 1PAUB 2M52A 4WFYA 5BYRA 1N5QA 2NSBA 2Q1LA 4OZ1A 5DZ7A 3SIPB 2ADCA 1KQGB 2BX6A 4TKTA 3GSIA 1HQUA 3UNGC 2WZ1A 1X9SA 1HD0A 3FCVA 2F4FA 3M9MB 1NM2A 3DU6A 1B4SA 2Q43A 4XDDA 3BPDA 3SQGB 4N41A 3SZ2A 1TL4A 4IG0A 3GIKA 2HKEA 4HVZA 5IT9U 4NI2A 1TVRA 4RW7A 3DXSX 1MLAA 5KFDA 3LGMA 4Q44A 1A0OB 5A8KA 4ZP8A 1SL0A 2OELA 3R8YA 3KLHB 4WE1A 4FBUA 1N33F 5J1EB 4R8UB 1AFIA 4PYAA 1SXLA 2CQ2A 2FZCB 1WSVA 3IRWP 5HP1A 2F4VF 2ZJQQ 2X1FA 2DYAA 3CJKB 4NOHA 3Q24A 3HDSA 4TU8A 1MROB 2ASDA 2HFVA 2AT1B 2D3ZA 4Q0BB 2PIIA 2PEHA 5G0RB 2SXLA 3QLHA 3DLEA 2ZH5A 1YLXA 4MYTA 3I31A 2G13A 4I2QA 1MWYA 4KYZA 2B7CB 2UUAJ 2UVRA 4I0WA 4M5DB 4NLXA 3KMSA 2BOPA 5ETKA 4ZPAA 1OQ6A 1VIXA 4WZQA 3CD5A 5GAGI 4EBCA 3EZOA 1E6VA 1S7HA 3S6EA 1TMJA 2LA6A 2PD1A 4RW6B 3HHEA 3SCJE 4CTAA 5C24B 2XHCA 4A8FA 1BY9A 4QR1A 2CWKA 1WELA 4QJVA 2RU3A 2VHGA 2ZBIA 2MQMA 4B3SJ 4X64J 2CNKB 1L3TA 4DWIA 4ZVSB 1U1OA 5F3ZA 4NLRA 3DYAA 3CJ2A 3HMJG 1REGX 1FVSA 1U0HB 1DTTB 1HNVB 1WHVA 2DNLA 2HQCA 3I5CA 4C8KA 3TRGA 1CJVB 3MM7B 1RTHB 1OYDA 3CIZA 4W92B 1VQ5S 4F04B 4NLPA 1O6XA 2ZEJA 4GC6A 3T1HJ 2V2KA 4LF9J 3SSQA 4KIAA 1KFDA 2E9TA 5HVGA 2LU2A 1IKWB 1WUUA 2W01A 1EETA 3FCWA 4NYOA 5AT1B 5SUHA 4JI8F 3CGIA 4URGA 3BN4A 2GIQA 2GMHA 1C4AA 2W9AA 5ITHA 1KD1T 5A8WB 2MJUA 1XJWB 4ZVUB 1TL1B 1FTCA 2HS3A 5J1NA 5LMUF 2P5VA 2DR9A 3MEDB 4OX9F 4C3MA 4CM2A 2OTJS 1UZDA 3ONQA 1CJTB 4QIEA 2J7KA 3VWSA 4CO3A 2OH2A 4NXMF 4V19X 4AL5A 5I3PA 1N32F 1ROFA 2RUSA 4UOFA 4EO6A 3M2UA 1RAEB 1VQ7S 1V9OA 2CPHA 2HNDA 5KFUA 2PE8A 1D9AA 2AYBA 2H1YA 1N52B 4B9SA 4LF7J 4C9DA 2RKIA 4P52A 4DPYA 2AJ4A 4ED1A 3T1HF 2UVUA 3TWZA 2CIMA 2DR5A 4DG1A 2HHSA 2DGTA 3PRDA 3D1OA 1T9UA 4K5RA 3EJMA 5D0EA 5KFFA 2APOA 4ERDA 3TEHB 4B3OA 3EZ5A 1PBUA 1WKLA 1GEHA 3A1YG 3HZEA 5CYMB 5KFRA 4DX5A 5F8NA 3R6LB 4F8RA 1I1GA 3LP0B 2H5EA 3M8QB 4KO0A 4PRFA 1Y00A 4WKYA 2QL7B 4LRDA 4DR1F 1SIWB 1GNKA 4X4VA 3HVTA 4DR1J 2ALZA 3C8YA 3EPGA 5T7LB 4KGKA 1P1LA 1EJ7L 2HFUA 3Q8SB 1RUSA 4I56A 1U1RA 3GV5B 2J8SA 3PZPA 3NCPA 1U2CA 3QLHB 1K1QA 1R6YA 3KG1A 5ETNA 3J81U 4ECZA 3ISZA 4MFBA 1N6QB 3VVUA 1NJZA 3V81B 4Q8FA 1KOHA 5L38A 3IR7B 3IS9B 1FESA 4WFNQ 2AGQA 1C4CA 1RHUB 2Z2MA 3QJJA 1Q53A 4CLUA 4DV3F 1FX4A 2ZOMA 2C2RA 3R5DA 2XSJB 3IXQA 3KJFB 1R3NA 3BGLA 4K4UA 4P2FA 2DD8S 1WHXA 2DXDA 3MAHA 3MMJA 4IUFA 1FJ7A 5D8HB 3GPAA 1QTNB 2BUNA 4ZPDA 1B99A 1R31A 3MECA 1ZA1B 2W25A 4NX9A 4J9LA 1OYEA 3L3CA 3NXZA 2B5JA 1S72S 2ROGA 3VAJA 1L5UA 5L1JA 2G2OA 3H2LA 4R0EA 1FNMA 1S1VA 4DR7F 4UZCA 1RLDA 2VDHA 3SEOA 2B6AA 3RR7A 4ZVRB 3S8SA 2J0SD 1FXLA 1HQUB 5DETA 1S1TA 3LP0A 2KG0A 4H54A 2ZH6A 2R7XA 2RRAA 1HWJA 2OPQB 1HHQA 2YKNA 3DGPA 4K4TA 2HGLA 1H98A 1U02A 3CD0A 6AT1B 3C6TA 1PG5B 4CIOA 3I56S 2H51B 2DNQA 2L9DA 3B6BA 3OFEA 2X3GA 5F8JA 5LJ5Y 1X9MA 1IKYB 3SCLE 4ED2A 5KFEA 1RT7A 2DPIA 4MT1A 4PG4A 2N7CA 1JLGB 3C6UB 3PIPQ 4KHMA 1AZSB 2G0JA 2CFXA 3GFYA 4YOEA 1YVFA 4JI6F 3TUJC 1FI4A 1U6FA 2YKAA 1EKSA 3H0PA 4PG7A 3KJVB 2WCXA 1S9FA 1S0MA 1C1CB 4FYXB 4CT9A 4P2SA 4NZ0A 1HNWJ 2DJWA 4PWDA 2C3OA 2HVZA 2GAGC 4RBVA 5KOXA 1QM9A 3FVYA 2FJEB 1HBUB 3PJXA 4MTPA 4K4ZA 2GZOA 5IZHA 4XDCA 1F3VA 5M2PA 1X31C 5E3CA 2COLA 2ATCB 5L9XA 4B3SF 1VGYA 4JBCA 4YMEA 1AXQA 1UEKA 1VBYA 4I1TA 2QYGA 3NGTA 5L8RC 5LSRA 5RUBA 1HWIA 2B7BB 2HBQB 4OFZA 3KG4A 2DEIA 4CO2A 4FXDA 2FHKA 1S4FA 3TVYA 5JJBA 2MDAA 5A76A 4UY8T 3IGNA 5CAAA 2MZRA 4KV8A 4LF6J 3ENVA 1WG4A 2X1AA 1IBMJ 4ICLA 4YR0A 2DIUA 2BABA 4X84A 4JYAJ 1ITPA 3WX8A 3PEHA 1QE1A 5L1KA 3SYZA 4Y34A 4DU7A 1RLCL 4NXMJ 2WTFA 3OTCA 1QVFR 3QT6A 2BBEA 2GA7A 1JB0C 2QA1A 3IA0A 2BZ2A 4J5OA 3R7SB 5J2PA 5J2NB 3ZZOA 2ROPA 4PWWA 4B02A 4A8OA 4ZVTB 1F5CA 1RBAA 3PRBA 3QYYA 2ZH3A 4NLVA 2NSCA 3POTB 3TZYA 3D28A 3MR2A 2PDAA 4LSLB 3ZTPA 2ASLA 1EIYB 3MR5A 1E6YB 1VQNS 1RT3A 1SH2A 2Q6BA 4ITSA 2XEXA 2DHXA 3KTQA 1G2EA 2JEGA 2ZWOA 1UWAA 2DNZA 6FDRA 1HBMA 2WSCC 2RSQA 4ZVPB 4TY8A 1PYOB 2HS0A 2CPEA 1WORA 4ZJLA 1VRTA 5E3RA 3CDBA 5D6GA 1RCXB 2CG8A 1KS2A 1YRUA 1TUGB 3FCHA 2XI3A 3GYGA 4J9PA 4GVBB 4JI8J 3TX8A 1SKWA 4Q43A 1FRHA 1SUQB 3OUYB 2V4JB 3D4JA 1HYSB 1I6JA 2CQPA 1CJKA 5E33A 4QWAA 1S0VA 3TARA 1MU2A 3N28A 1FFSB 5DDQC 1N4LA 4IG0B 1TZ0A 4DS5A 1N5SA 2GMJA 2PGCA 2QLFB 4OX9J 3CCQS 1RYRA 2CNNB 1KN6A 2HPUA 2Q66A 3RU0A 2DY9A 4DR3J 3CCSS 2BEFA 4LFBJ 3D7SB 3L7PA 4R0JA 5IWAF 1LWFA 3BQ1A 2JLGA 1CSJA 2OD6A 3CJTA 3UQSA 3UI3A 1RWUA 4QR2A 1T3OA 1UL3A 1YJNS 5D0RA 2ZKUA 3IRXB 1REVB 5EHHA 4K4SA 1ZAWA 4PPDA 4C97A 1RWPB 1JQGA 4E8UA 2RQKA 1T3NA 5KFZA 3P49B 1Q4RA 1Y5IB 3RAXA 1YIJS 2CQ4A 2NS1B 1UVIA 2EFNA 3IWLA 5CCMA 2NXEA 5DM7Q 1EP4A 1Z4UA 1RE1B 4WJBA 1H3DA 4U96A 2IAJB 2QGFB 3OHBA 2FJWA 3RAMA 1VQ4S 3KWMA 2YNHB 3M8ZA 1MN7A 3HI9A 1HR0F 2G1HA 3N0VA 4KR0B 4ED0A 1WDDA 5GVQA 3R5CA 1S0OA 2O66A 2VBXA 4N77A 1MG7A 3HPOA 1V5VA 4J9KA 1QUPA 2MJNA 2AJFE 3OT9A 4MKVA 3K59A 4ILRA 2HZVA 1FCAA 2HIYA 2V2ZA 2UVWA 3NBPB 2ZHAA 4HHJA 4O4RA 2RS2A 4GMKA 3UDEA 3ZZZA 2DISA 2RJZA 3CMAS 1VQ8S 8ATCB 5LL6d 2RT3A 4IRCA 3M2VA 4ETZA 4O3RA 2XLKA 1UEUA 4F0HA 3H7HB 5BR8F 3M8WA 4KAIA 4DCOB 2G1DA 1VBXA 4WTYA 4B3MJ 3GLJA 1UP1A 1J5EJ 2AYEA 1NH8A 1HBMB 2Z2LA 3G86A 3D66A 2VDIA 1RTIB 2BKPA 1VMBA 3MD1A 1HNWF 1N5VA 3EE3A 4ZITA 1VBZA 1LFWA 2NXCA 1H38A 1X4CA 2IYIA 3LWMA 2KKHA 3LGNA 2BE2B 4RW8B 1S9GB 5KOWA 1S77D 1WG5A 4MIWA 1S79A 3D6TB 3DRYA 1DHMA 3NBPA 4WWSA 3SBMA 3VAMA 1VQPS 3P8BB 3HT3A 1A9NB 4FF1A 3PYDA 3GIMA 5THWA 4P73A 3ZZTA 1X5TA 2X1GA 1S57A 1HMVA 4LRBA 4RJVA 4Q45A 1M5HA 3BM7A 3NWRA 2YKNB 4NA1A 3T5LA 2R42A 4J9UE 4NE9C 3U02A 2YH1A 4LFCJ 4ZJOA 2RHQB 1HARA 2RILA 3MEEA 4LFCF 3P6YC 3IG1B 4IH6A 1B64A 4O3QA 3NS6A 3RYLA 1S6PB 2DCUB 1NSPA 3ZTOA 4QPTA 4Y2CA 5H9FJ 2KL8A 1HNZF 3E51A 5KTQA 1RBOB 2R2UA 1VQOS 3DM2A 5C2CA 3L7OA 4MIBA 2KT3A 2JDJA 2IJNA 2LP4A 2O5DA 3I0SB 3LTOA 4UW2A 3UD5A 4RZRA 1HNZJ 3T3FA 1B0VA 2R2SA 4AT1B 2I2YA 4G1IA 3CJ3A 2LA4A 4DV6J 3OR2A 5K20B 2XI2A 5B0BA 1RYSA 2IC3A 1AUDA 1RHQB 4X4SA 2N82B 3DU5A 1TL3A 3HD2A 1IQTA 3AOCA 3EVOA 1F60B 1RT1B 2XTJP 3HF5A 3S7RA 1EX8A 1RBLA 1ZS6A 1N54B 4OI3A 1Q0NA 4OX8A 4CNYA 2RKIB 3RB0A 4DDFA 3JYTA 3FSXA 4JI1J 2FB0A 2CPYA 4ED5A 1UMJA 5DQGA 3PYGA 1NAQA 3LP1B 4TYAA 3GFHA 2CPDA 2DHGA 5KFQA 1MMNA 2AU0A 4O44B 5KG0A 3DLLQ 4P72A 4C8OA 4EZ6A 3NCRA 1NJYA 1SVDA 1B3TA 3DRRB 4X65F 3EUNA 1EAYC 1JNZB 3G4SS 3SCKE 1ELOA 4MYUA 4CLLA 4ZLPA 2LCWA 3HVTB 4JI0F 3MURP 2LFVA 1ACMB 2HG4A 4KSEB 2DTJA 2M5YA 4CZCA 1BE4A 4PQAA 2V6AA 3D3CJ 4ZVFA 3TX0A 1PKUA 3P96A 4A47A 3PW5A 3UD3P 3O44A 1RDRA 1Y5LB 4YP3A 1D9FA 4YB5A 4J91A 5AXKA 4C8ZA 1XN9A 2DGQA 2UXDJ 3MM5A 2AJ0A 2KVQE 1GXTA 5DQIA 4IR1A 1K0VA 4IO1A 2C28A 4ECWA 1CS4A 1HYSA 2GCFA 5M2UA 5F0WA 1T8EA 2HBRB 1PC5A 2IRXA 1X8DA 3H4DA 5D0GA 3M9NB 1XMOF 2ZVSA 3IAM9 3PVXA 3NOCA 4OJ1A 3M2UB 5F8LA 1JLEA 1JJHA 2WHOA 3K58A 3BQ0A 1RU2A 4U6PA 2CPZA 3PKYA 2DR6A 4B3RF 4UOGA 4A46A 4ZN3A 5C2GA 1IKXB 3BJYA 1GAOA 1KSPA 2I1RA 1WTBA 4HEA9 2MZQA 4ED3A 5LSOA 1RAJA 3UNYA 1XERA 2WBMA 2VC1A 4L76A 5LXRA 4QWEA 1NLKL 4WK1A 3PXGa 1JJ2R 2FJXA 1M5KC 4JV5F 2V4QA 2PFFB 3KK3B 4C98A 4NCBA 4X4PA 2W2QP 1FD2A 4I2QB 5KT5A 1WC6A 1LNQA 1OIAA 1JLBA 2JC0A 3I0RA 2IVYA 3UFCX 2OP5A 1HD1A 3SCIE 5B08A 2KFZA 2LQ5A 3OFFA 1R6VA 2YKMA 1WHWA 3W8GA 1N0VC 3CDWA 3IP0A 5DQHA 3V6HA 3J7A1 4XAKA 2CJQA 1Y0HA 3AHPA 3I96A 2JEFA 4KO0B 1S59A 3KLGB 3T6JA 2XCPA 1YJ9S 2EBEA 1GK8A 2VUGA 2F9JA 1EETB 4ZIWA 1V5IB 3VGSA 1KVJA 4EMDA 5KFPA 4DUYF 3C15B 3THPA 2V69A 1GMWA 3M9OB 2OSRA 2RNEA 3C6UA 3M6VA 3ZTRA 1IM6A 3H8YA 5AXNA 4V1Ak 3I0SA 1WC0A 2VODA 3T5KA 3RUBL 1NDPA 1HBNB 3KXDA 2W8KA 5HROA 2CXEA 4Y0FA 1HNVA 4KH1B 4CYUB 2RB7A 3NP5A 1VFJA 3R1LA 3H98A 3DRPA 2A2CA 2W9CA 4DV0F 4QYRA 4DN0A 2QTWA 4RPFA 3WQPA 2W9BA 4G1PA 3TVKA 6FD1A 2OTLS 4F0MA 1ZM9A 5LMUJ 3DOMA 1FF2A 4DBQA 1PC4A 3MTKA 2XYPB 3VZIA 2HBYB 1UVKA 2U2FA 2B4VA 3DNCA 4I2PB 2F65A 2B5JB 3M2VB 5E3AA 3UR3C 4LF9F 3ZXWA 1EQMA 1SIZA 2D3UA 3I6PA 4M5LA 3ZZUA 1VISA 5LM7E 1M0SA 4QBUA 2WONA 2V9KA 2DRBA 4WPAA 4Z37A 2LQJA 4U95A 1OQ3A 3AQOA 3K5OA 4NLTA 2RE1A 1VC5A 2X3DA 4HACB 4YY3J 2ZM6J 2R7OA 4LBIA 3WBZA 3PFOA 2HWHA 4ZHRA 2B43A 2FJAB 3R27A 2CQHA 2ZZTA 4OLOA 4HHHA 1MW7A 4F4KA 2DHSA 3RJMB 1VQMS 2FVSA 3QGHA 4LSNA 1JLFA 3DXBA 1B70B 3M2RB 4FDFA 1JMTA 1NNDA 5K9FA 3W2WA 3TUIC 3HD1A 3V5RA 3KFWX 4PQUB 2B4UA 3KJNB 4WU3A 2Y1JA 1JWWA 2V9WA 3OL6A 1AW0A 2XNQA 3UN2A 4FVCA 5KG3A 4MIAA 4ED4A 1JKHA 5LSLA 3GG0A 1ZTTA 3QRRA 3H5SA 2LEAA 3KK2A 4RUHA 4F4XA 3KHHA 1RZMA 3G6ES 2AJ2A 1EQ0A 3CC4S 4DXLA 3G2XA 2I9SA 3ILJA 1YJVA 2GW8A 2OPSB 2VB6A 3ZTSA 4JI4F 1UVNA 2GQQA 1IWAA 4LR7A 2D9OA 9RUBA 2UXBF 1GX6A 2R7UA 4DV4J 1IR0A 2LXFA 3LOUA 2V50A 4P2MA 3UCUP 3AB4B 2HNZA 2HQ3A 1U25A 1SPBP 2B3TB 2DNRA 2C3UA 2PA3A 2YNGA 5ETSA 2DGWA 4HT7A 1LK7A 1MU2B 2CYYA 4F3MA 4ZCIA 2YNFA 2VFUA 1S12A 4PWUA 2QLWA 3IFEA 3FGVA 2ZZNA 1IJEB 2VONA 2IM2A 2MKCA 1VYAA 1UJ5A 2XWYA 3BO4A 3PR5B 1DTQA 2YQ1A 3PHTA 4LRCA 3QRQA 3RRKA 5KFGA 1NKCA 1APSA 1X60A 2LDIA 4DQIA 4H4MB 4QWBA 2NR0A 1RT6A 1WACA 2DNKA 5KFMA 3T1YJ 3ENQA 3JAMY 4YFUA 2E1CA 3HM9A 2HVIA 2YQ0A 5IT0A 4RBTA 5EDWA 4ILMA 4J90A 3DKDA 4B9VA 4M8LA 3G6VA 2OAUA 1JIHA 2M88A 5GAEU 4WF9Q 3TUPA 4LJMA 2ATLA 1LW2A 4USMA 4FP9A 3TA0A 1UPPA 1H7WA 2WW8A 4OJ3A 1S97A 3U27A 2HW3A 1ZAVA 3B8HA 4I6AA 4HTIA 4LF4F 1VRTB 3I5AA 1S6QB 3G82A 3ZZYA 1FJGJ 1HBUA 4Y28C 2NQPA 1U09A 3ISND 2CQ0A
chains in the Genus database with same CATH topology
3W5YA 3W5XA 3W8PA 3W63A 3W65A 3BYRA 2QFIA 3W62A 3W61A 3W8GA 3W66A 3H90A 3W64A 3W60A 3BYPA 5HSPA 3W5ZA 2ZZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5Y A;  3W5X A;  3W8P A;  3W63 A;  3W65 A;  3BYR A;  2QFI A;  3W62 A;  3W61 A;  3W8G A;  3W66 A;  3H90 A;  3W64 A;  3W60 A;  3BYP A;  5HSP A;  3W5Z A;  2ZZT A; 
#chains in the Genus database with same CATH topology
 4LFA F;  2CJ9 A;  2R8H A;  1FRK A;  5DG7 A;  3HHL D;  2XMW A;  1F6T A;  3I82 A;  4NLQ A;  4UTG A;  4ZLJ A;  5E3P A;  2MKK A;  1KDN A;  1IR2 A;  3UD4 P;  1SQF A;  5LJ3 Y;  1FEH A;  2OJ3 A;  3QMQ A;  5GME A;  2AX0 A;  5K8P A;  1W2I A;  2I8E A;  2LQ8 A;  4ZA1 A;  3RBZ A;  2VH7 A;  1F5A A;  1RAC B;  1HHS A;  3CED A;  3ET6 A;  4YB1 P;  2D74 B;  2GJI A;  3VAH A;  5E5N A;  2LXU A;  4B9T A;  2BRK A;  1AT1 B;  3UVJ A;  3DLH A;  3TZX A;  3PX4 A;  1NK7 A;  4MKY A;  2Y1R I;  4OHV A;  2QLB B;  4QW8 A;  3K5M A;  3NLC A;  4WP9 A;  4BC9 A;  5ETL A;  3Q2T C;  1JLA A;  2QX0 A;  1LWE B;  1FXR A;  1UWB B;  2RIJ A;  1WWH A;  3LA0 A;  1WJ9 A;  4J37 A;  2QMX A;  4PUO A;  1S9G A;  1MNE A;  4ZCK A;  2GVZ A;  3CB4 A;  3GFX A;  5HAT A;  2ZH7 A;  5IQ6 A;  4IG3 B;  4WK3 A;  2W2N P;  1OY9 A;  4TYB A;  5IT4 A;  3WDO A;  4X66 F;  2IM0 A;  4BHQ A;  4J9S A;  1PIL A;  3W8P A;  3K7R A;  1S0N A;  2RU9 A;  2HHW A;  3Q0A A;  3PYF A;  4LF6 F;  3QZ7 A;  1VRU B;  2K8G A;  1RTJ B;  2OFH X;  4ID8 A;  3JSB A;  1VS3 A;  3P5T L;  2A6O A;  4L6V 3;  3UN5 A;  4O3N A;  3W2V B;  4U9R A;  1F0X A;  3B82 A;  3K5L A;  3M32 A;  2B9W A;  3W62 A;  2V8G A;  3OXG A;  1EAR A;  2QLX A;  3HSJ A;  3IM9 A;  3VF0 B;  5A2Q U;  4F50 A;  2FHM A;  4X4R A;  4ZIV A;  1UAW A;  2L48 A;  4P71 A;  4N76 A;  3W5Z A;  4JI5 J;  1TL5 A;  3K2Y A;  2VJV A;  1XMQ F;  4DL0 C;  1QY7 A;  3C6T B;  2MKI A;  1Q95 G;  1IKX A;  2GO8 A;  4DR4 F;  1H73 A;  2BVZ A;  2HGN A;  1WEY A;  3SDE A;  4AQY J;  3TA2 A;  2DH9 A;  2GVD A;  2VBZ A;  2AKW B;  3N79 A;  2ZH9 A;  3DMJ B;  3HCX A;  1HI1 A;  5BYQ A;  3HP6 A;  2RS8 A;  2K3K A;  3N5B A;  1HBN A;  3H5Y A;  4WCE Q;  1NXI A;  4DX6 A;  1HNI B;  2H4W B;  2WBR A;  5SZT A;  2MB0 B;  3C66 A;  5EX3 A;  2YWG A;  3F73 A;  3G82 B;  1L3V A;  4DMZ A;  3UDL A;  5EX0 A;  2F5G A;  2W2O P;  3DOL B;  1JLQ B;  1YSJ A;  4UQT A;  3WIV A;  1LWF B;  3BR8 A;  2IM3 A;  3BQ2 A;  4ILL A;  3GJT B;  4J9R A;  5KFY A;  4MKB A;  3Q2S C;  3AOB A;  2VG6 B;  2ZC3 A;  4NLD A;  2DY1 A;  4AFF A;  2W7O A;  2RAQ A;  2BE7 D;  4H4O A;  2EFV A;  4K0K F;  3HHN B;  1JLF B;  4U8V A;  1RWX B;  2BQU A;  2FPH X;  1SQE A;  4OZL A;  1TFY A;  1TUW A;  2CJA A;  2E9R X;  2FVQ A;  2DNP A;  2PEB A;  3CNQ P;  4AQY F;  1JKH B;  3BSO A;  4XPE A;  3Q8V A;  3PFE A;  2VU5 A;  1N5Y B;  4QYZ K;  1Y11 A;  1S9E B;  1WEX A;  1YIT S;  4Y2I A;  4Y3C A;  1HBO A;  3FEX B;  3CO9 A;  4P7T A;  4WP3 A;  5IWA J;  1SJ4 P;  2LDY A;  4FZV A;  3AD8 C;  5HVF A;  2MEW A;  2DNG A;  3OFH A;  5LMN F;  3N6L A;  3C3L A;  4C3K A;  1A6L A;  3EMT A;  5KFS A;  2MZ1 A;  2KM8 B;  2KJW A;  1IVZ A;  5IV3 A;  1GT8 A;  3MM8 B;  3HX9 A;  3WC2 A;  2M4M A;  2MST A;  2H54 B;  2KXN B;  2G0C A;  3DCA A;  2KHC A;  1FER A;  2OIH A;  2KT5 A;  4H4K A;  4A8M P;  4FF4 A;  2BJ3 A;  4K4X A;  1SCJ B;  3I5B A;  4NRU A;  2AMC B;  2D9P A;  4DV3 J;  4XTT A;  3CCU S;  3THV A;  1RAG B;  2BMB A;  2YKO A;  1SJR A;  2ZKT A;  3EIC A;  5CYM A;  2B9X A;  3HVR A;  2QN6 B;  2EKN A;  1ICE B;  4B3O B;  2J0W A;  4GKJ F;  2J6S A;  4WYW A;  1NPP A;  5T7L A;  5BYS A;  2AP6 A;  4V19 J;  1RKI A;  2QE5 A;  2CQ1 A;  5KG4 A;  4C0O C;  1T9X A;  4QIW D;  2XMU A;  4Y00 A;  2DVI A;  3DOM B;  4O0N A;  1OS5 A;  1PJ7 A;  5J2P B;  5L1L A;  2XM3 A;  4JI4 J;  1Q7L B;  4Z7C A;  4QIV A;  3W63 A;  1HI8 A;  2GHV C;  5I42 A;  1VC0 A;  1FKA F;  1T05 A;  3DI6 A;  4L75 A;  5C42 A;  2X1B A;  2BKN A;  3M2R A;  3W2W B;  3D67 A;  2WB1 D;  2DH8 A;  3JSY A;  2HVE A;  3OXF A;  3KUG A;  5D4P A;  2C2O B;  2UUA F;  3EPI A;  1XQI A;  1YRT A;  2ZOG A;  4LFA J;  3FBF A;  8AT1 B;  1FK9 A;  1G7C B;  1FD8 A;  2YKM B;  3CDA A;  3G8Q A;  3GV8 B;  4EU0 A;  4C0B A;  1RA7 A;  2I38 A;  3DFE A;  2DR8 A;  2ZOF A;  3BH6 B;  3VZH A;  3LUY A;  3OQ2 A;  2BQ3 A;  3RRG A;  4KBI A;  2WVD A;  1HW8 A;  3LF0 A;  2H5J B;  3WC0 A;  3N6N A;  3OD2 A;  3DRS B;  2XGP A;  3DDK A;  4HDG A;  4EBE A;  3LWL A;  1NHV A;  2VG7 B;  2ZBP A;  3LAL A;  3A12 A;  3T5H A;  4Q0B A;  3JB9 k;  2XY7 A;  5E0O A;  1GXU A;  4DR7 J;  4Y2M A;  2IIH A;  2AGP A;  3KHR A;  5IOL A;  3UCG A;  4AL6 A;  3CXC R;  3AB2 B;  2RF2 A;  3SFU A;  3W5Y A;  3MOJ B;  2B4O A;  4QU6 A;  1LW0 A;  3KLF B;  4ECR A;  2N4C A;  1LXN A;  4DUT A;  2YWE A;  2R8G A;  2IDE A;  1U1P A;  2C2M B;  1U2F A;  3LO3 A;  5CAB A;  4P9S A;  2FDN A;  5DM6 Q;  1FK9 B;  1E6V B;  3IGV A;  4CTA B;  4FNI A;  2F40 A;  3UO0 A;  4BC7 A;  4CDI A;  4NLS A;  3NAI A;  3MUT P;  3CCL S;  1SKS A;  4X2B A;  1EHW A;  5E7O B;  3M8R A;  1DQA A;  4M95 A;  4UOC A;  3C19 A;  3PHE A;  2VIH A;  1U0H A;  2FHJ D;  3BH7 B;  3V6K A;  2J5A A;  3QIP B;  3QID A;  4O3O A;  3DI6 B;  3JS9 A;  3VAL A;  3PO4 A;  3T9Z A;  4X62 J;  1HWU A;  4QWD A;  2E7X A;  1YJT A;  3HFV A;  2FZK B;  1RAB B;  1AB8 A;  2ZE2 A;  4DPX A;  5GAH U;  1LOU A;  3PW7 A;  4DJB A;  1HQE A;  5HMY A;  1V6H A;  1UCN A;  3CCZ A;  3J7A N;  1K73 T;  1BQM A;  1M5P C;  2Q79 A;  1MMD A;  3PRV A;  1S99 A;  2QO3 A;  5DJB A;  4AE5 A;  2VA3 A;  2HEK A;  4LF7 F;  2P2C B;  1L3K A;  2HLT A;  3GR0 A;  2XO7 A;  4A8S A;  1NRK A;  2BKO A;  4M5N A;  4WE1 B;  1NB7 A;  4JI1 F;  4F4A A;  4K2J A;  2DT9 A;  8RUC A;  3HKZ D;  1KVK A;  5K8M A;  3OBI A;  4NCG B;  5KG6 A;  1WF0 A;  5G0R A;  3L4B C;  3SDE B;  1NCL A;  1MRO A;  3K89 A;  1VJW A;  3R1H A;  1AFJ A;  1NUE A;  2K1R A;  3IR6 B;  5AJ3 J;  1J5E F;  3Q89 A;  1FNX H;  5D4N A;  4AUK A;  2UXC F;  2W7P A;  1TL1 A;  3U1N A;  2IMO A;  2A0F B;  3MUM P;  4X62 F;  4HYK A;  1ZTW A;  2DPJ A;  2HHU A;  1T95 A;  2V0N A;  2YX1 A;  2YWH A;  2ZHO A;  4WKR A;  1RP5 A;  3PW0 A;  3W66 A;  3TJ8 A;  2Y1I A;  4CP5 A;  2JSX A;  2UUC F;  5AXM A;  5KFO A;  2P6S A;  3AOA A;  4A8X A;  1Q8L A;  3S1T A;  3PV8 A;  1OPZ A;  3CIM A;  3GYX B;  4LVO P;  3TW0 A;  2M8D B;  4DR5 J;  4OX7 A;  1T94 A;  3PG9 A;  3D0G E;  1NJX A;  3MHY A;  3AAW B;  1WKJ A;  4RWW A;  3HSG A;  1UA0 A;  1CS4 B;  1DUR A;  4WIQ A;  4DQR A;  2EVZ A;  1CJV A;  3MM7 A;  2C3Y A;  3CUN A;  3I9V 9;  1NB2 A;  2FLO A;  1DTT A;  2VG6 A;  2YNH A;  2IC3 B;  2CJX B;  4NZ6 A;  3ZO7 A;  5J2M B;  3WZ0 A;  3BDE A;  3H20 A;  4ECT A;  5GMD A;  2AV5 A;  2HLU A;  2GVZ B;  3CJS A;  3RW7 A;  3FC9 A;  1TEL A;  3H42 A;  1GQE A;  4EI2 A;  3OL9 A;  3H90 A;  3K5N A;  2VG5 B;  4CLK A;  4NXN F;  1UWB A;  4USK A;  1B7F A;  2HQD A;  4DQS A;  2E1R A;  4WU2 A;  4DL7 A;  3ULH A;  2L9N A;  2HK3 A;  2HFZ A;  1CUL A;  3FFI A;  2CQB A;  1WC1 A;  4ZPT R;  5HMX A;  4OI2 A;  1IBC B;  2R7R A;  4DSL A;  3A8K A;  4HI2 A;  2VFT A;  2XG8 A;  4YQW A;  4NWB A;  2A3J A;  2CA9 A;  3MPV A;  4PXB A;  5HK4 A;  4PQU A;  2WAQ D;  5IXU A;  3GV7 B;  4OI4 A;  3W2V A;  2XZT B;  3MMA A;  1RB0 A;  3EWG A;  3SQO P;  4DQQ A;  4EFA C;  3KMQ A;  3G87 A;  2XLJ A;  4HKQ A;  1YBT A;  3VAG A;  4DV4 F;  2ZH8 A;  3IBF B;  4ZPC A;  2LVW A;  1RTI A;  3BV8 A;  3HFK A;  5K14 A;  3MMB A;  3R2D J;  2C2Z B;  3R5A A;  1YWX A;  1Q5Y A;  1Y3K A;  1W7W A;  2Z58 B;  2JNJ A;  4KE5 A;  4ZP6 A;  1GTE A;  1KLN A;  1IM4 A;  1S6Q A;  4Z7Y A;  5CHC B;  3K17 A;  4ZN1 A;  2ABY A;  1JXV A;  3T19 A;  5K5M A;  3HJV A;  2EI5 A;  2DIV A;  3H40 A;  1G4C A;  3VR1 A;  3CJR A;  1JXL A;  4DSI A;  3OXL A;  5LXY A;  1LFP A;  3QO9 B;  2K7J A;  1C2P A;  3JTO A;  3PCO B;  2MQO A;  1Y4Z B;  4A8W A;  4G1Q A;  4CI0 B;  4UZB A;  2MPU A;  2ZUA A;  4DUZ J;  3BBC A;  3C16 B;  2JOQ A;  3QFW A;  2DGV A;  1ZZN A;  1I94 J;  1FJE B;  3EZU A;  1M1K T;  2CJY B;  1D09 B;  1Q8K A;  5F8H A;  1Y5N B;  1RKJ A;  1I94 F;  3LGH A;  4RU2 A;  4GO7 X;  3KG0 A;  4C48 A;  4BBY A;  2M3D A;  2MLX A;  3O6Q A;  3Q23 A;  1H2T Z;  1OSD A;  1S6P A;  2MY8 A;  1X4H A;  4DPU A;  3TQ1 A;  1S48 A;  2YWF A;  3TJA A;  2AWZ A;  4YR3 A;  2R8I A;  1UA1 A;  3R6G B;  1YBA A;  1SH0 A;  3ITH B;  1U1N A;  3O8W A;  3D0H E;  1N33 J;  5GMK a;  3BO2 A;  4YHH J;  2BA9 A;  3MI7 X;  1KHW A;  1PIE A;  1R89 A;  4PG6 A;  4UT4 A;  2QSW A;  4L73 A;  5FJ4 A;  3CJQ A;  2BV3 A;  2EFG A;  5J2N A;  1C0T A;  2M8H A;  1XK8 A;  3M4X A;  1CJU A;  4OHX A;  2WVF A;  2D41 A;  1DLO A;  1VK8 A;  3J7Y U;  2CQD A;  4OL8 A;  2ZBR A;  1YG0 A;  2QC3 A;  2I5J A;  3FEZ A;  4NA2 A;  4AL7 A;  2YNI B;  3EXC X;  2UP1 A;  2DNY A;  3FMB A;  1P27 B;  3EDR B;  2HYI B;  2BJ8 A;  1CG2 A;  3HZG A;  3GZ7 A;  3AY0 A;  1YX2 A;  4HH1 A;  5A0Y A;  7FD1 A;  4UQG A;  1VRU A;  2BR0 A;  3GCW P;  2MMY A;  1S10 A;  3KLI B;  4KQZ A;  1M5O C;  3U7J A;  3K57 A;  2XY6 A;  2ZH1 A;  3VV2 B;  1N88 A;  5KG1 A;  1Q82 T;  2VZ9 A;  3HK2 A;  4PEO A;  3NNC A;  1T9W A;  2M0G B;  3VAK A;  4J7C A;  2FVC A;  3FQK A;  4ELT A;  2CVE A;  2E29 A;  4R8U A;  3W5X A;  3MR6 A;  4EZ9 A;  4ES1 A;  1HWL A;  4USJ C;  3GQC A;  4X4N A;  4Q7A A;  4ECV A;  4TU9 A;  4NEY A;  1HWK A;  3HSD A;  5GAD U;  2DGO A;  3RBE A;  2EC0 A;  3MMC A;  1Q16 B;  2P9C A;  3A3N B;  4QPX A;  4OYZ A;  5I3U A;  1DY3 A;  4LR9 A;  1TAU A;  3BGR B;  1P9Y A;  2XHW A;  2YNG B;  3GP9 A;  3NMA A;  1LQ9 A;  1ZPW X;  5K14 B;  2OML A;  4IFV B;  3KYL A;  3K5P A;  3ET6 B;  1TL7 B;  3MCN A;  4HR2 A;  1O8B A;  2F8E X;  3A3P B;  5EUH A;  5HL7 Q;  5KFC A;  4C8L A;  2AEF A;  5D3G A;  2CQG A;  1ULR A;  1FWP A;  2KHD A;  1J5O B;  3MZI A;  1IXK A;  5D77 A;  4B3T F;  1SKU B;  1M5V C;  1JLG A;  3JTN A;  3IR5 B;  2ERR A;  3MXH P;  2E7W A;  4ZOS A;  1JLQ A;  2UUC J;  4NCA A;  1KHV A;  2QRR A;  4ECY A;  1CUL B;  3FFI B;  2O67 A;  3PO5 A;  1Y9O A;  3CWJ A;  4LF1 A;  2DGU A;  1Y3J A;  3BYR A;  4USW A;  2IMW P;  3KLE B;  1VCT A;  4KFB A;  2N7Y A;  4NPO A;  3NWG A;  3DLG A;  4WP8 A;  3NL0 A;  1NO8 A;  4X64 F;  1YRX A;  3AD9 C;  3CME S;  2B56 A;  7FDR A;  1U45 A;  3CVK A;  1RT3 B;  1XWL A;  1RI7 A;  1Q5V A;  2R4F A;  2ZFH A;  3JQK A;  4IQM A;  3QWP A;  2MTL A;  4OLP A;  1BLU A;  5CCL A;  4DV7 J;  3QT8 A;  1NK6 A;  2AZ1 A;  4FKY A;  5IC4 B;  2DNN A;  1DBD A;  3E8O A;  2AJQ A;  3T1A A;  1RAD B;  1C0U B;  2P8I A;  3O5T B;  4DSE A;  1S76 D;  5D4O A;  2Y0B B;  4F4Y A;  2EFO A;  4PWD B;  1VQY A;  4MK9 A;  3BSN A;  2WRM A;  2MZT A;  3CDU A;  1JK9 B;  2NZ4 A;  1OWX A;  2MKS A;  2P9G A;  2H48 B;  4C7Q A;  5HVH A;  1BMQ B;  4K0K J;  5KFV A;  1G1X A;  3W60 A;  3TR5 A;  2AX1 A;  5A6P A;  3KNA A;  4USU A;  2HQI A;  3BB5 A;  3AOD A;  2YTC A;  1Q79 A;  3HFZ B;  2GJ2 A;  1SB6 A;  3HVW A;  3MPU B;  3GB0 A;  3BKT A;  3GWC A;  2W9B B;  3M8P A;  1N48 A;  5IFM A;  4PAA A;  4C0H A;  4DHV A;  5HJY A;  2R7W A;  3RR8 A;  1IN0 A;  2DCL A;  2EXU A;  3MAA A;  3MMA B;  4ZLN A;  2XY5 A;  1EB0 A;  1KWM A;  4LSL A;  5K8O A;  4RNM A;  4LFB F;  3R5J B;  5C5J A;  1NDL A;  1PYS B;  1D8Z A;  3ZZR A;  3V2U C;  3FSI A;  1SL1 A;  1DLO B;  5D15 A;  2DH7 A;  2HUR A;  3UPF A;  2ZDP A;  3H25 A;  4DR2 J;  2AGO A;  2ACM A;  1T7P A;  2HMI A;  4UF4 A;  1LEO A;  2VAS A;  2HHX A;  2MQ8 A;  3LAK A;  1R8A A;  4HH0 A;  1BHN A;  3KOA A;  2VG5 A;  1Q8B A;  2W7A A;  3M7V A;  2RHS B;  2EW9 A;  2KRR A;  2B8Q A;  4WFA Q;  4OV1 A;  4PR6 A;  2W9C B;  1R8C A;  2JFK A;  2GGP A;  4ED6 A;  2MGZ B;  2AQ4 A;  2O3D A;  3CJ4 A;  1OSC A;  1R43 A;  1TKX A;  1NK8 A;  2BJ9 A;  5DO2 A;  2CJB A;  4A4J A;  4CH0 S;  3OJS A;  5KFH A;  3IC1 A;  4QWC A;  3CCE S;  3C16 A;  4B9L A;  3V6D B;  5U47 A;  2HHV A;  1NPR A;  1CC7 A;  1CVJ A;  4C4W A;  2MLY A;  2XSF A;  1TK5 A;  2HRT A;  1NK9 A;  1K1S A;  2MZS A;  4ECX A;  4JV0 A;  1XR5 A;  2DO0 A;  3AJ2 A;  4CLP A;  1QD1 A;  1FJC A;  1S49 A;  1TKT A;  3MED A;  1LV5 A;  3I32 A;  3JSR A;  2MHE A;  2VFV A;  3AH6 A;  2QJ3 A;  2V5H G;  2MKH A;  3GII A;  4DL3 A;  4O23 A;  5I3Q A;  3BO3 A;  2YBV A;  3WIU A;  5J1E A;  2EEY A;  2UUB J;  4DUY J;  3DRR A;  2UUT A;  3RBD A;  3RGI A;  3D1H A;  5LOQ A;  4DV1 J;  1MWQ A;  1U0S A;  2PO4 A;  3DHX A;  2MQN A;  2HWI A;  1RAI B;  2KDO A;  3LQV A;  3MOZ A;  3LPE A;  4NLY A;  4DV1 F;  3FQL A;  1FE4 A;  2ROE A;  2GNK A;  4BWJ A;  2H9Z A;  3J7Z 5;  4TU7 A;  1ZM3 A;  1NZ8 A;  1U6Z A;  4G65 A;  1H72 C;  2FGC A;  2HNZ B;  2HRU A;  2Z30 B;  1FVQ A;  3E3X A;  1BQM B;  1HIY A;  1T0T V;  3Q83 A;  1QAJ A;  3MEG A;  2ZUG A;  2CZV C;  1S1X A;  2DBB A;  3GTY X;  4NLO A;  2IAJ A;  4PCQ A;  4P7V A;  3ZZ0 A;  4K5S A;  1PSD A;  3E2E A;  2NUH A;  2D69 A;  4Q2L A;  3RBX A;  2BQR A;  1GFW B;  2IBO A;  2OPP A;  1ZH5 A;  4JI3 F;  2ZBQ A;  2HRY A;  3KUE A;  5C24 A;  3OSP A;  4NLW A;  2V8H A;  2YXL A;  4R25 A;  4X66 J;  1TKD A;  3IN5 A;  4YDX A;  1HHT P;  3DM2 B;  2E44 A;  2V94 A;  1ZET A;  1IBK F;  4N47 A;  2VL1 A;  4LR8 A;  4ELU A;  4ER8 A;  4L72 B;  1V3R A;  9ATC B;  5L46 A;  4ECS A;  2QSF A;  3FBB A;  4URQ U;  5EWG A;  4BS2 A;  5FD1 A;  2A2D A;  1FTR A;  4OI6 A;  1J5O A;  4RUB A;  4B08 A;  3M8P B;  4JI6 J;  2VV5 A;  4DV6 F;  1VLO A;  1J27 A;  1RAH B;  3MCM A;  4M94 A;  3BRE A;  3H2V E;  4P75 A;  5CXT A;  4L3N A;  3BBF A;  2QZ8 A;  1U2R A;  1VR6 A;  4AYB D;  4DX8 H;  1IR1 A;  1FE0 A;  1UFW A;  4LSN B;  1FWL A;  4Y6I A;  5HP1 B;  5CZV A;  1KVI A;  3MM8 A;  2RUG A;  1KOO A;  2AJ1 A;  3NEK A;  2OEJ A;  2Z2Z A;  3MEK A;  3US5 A;  3ILL A;  4F3Q A;  3HHD A;  2BJD A;  4FXW A;  2C42 A;  4MFB B;  5CYQ B;  3WHI A;  5HQ8 A;  5HO4 A;  2XMA A;  5F41 A;  4O44 A;  4CLY A;  1R8B A;  1UEV A;  3KHG A;  1XNQ J;  3LP1 A;  1YK9 A;  5AE1 A;  2ZDO A;  2VOP A;  4W98 A;  2W4D A;  4CLZ A;  3H5X A;  4MH8 A;  2LQ9 A;  4JV1 A;  1G6B A;  1F2H A;  1Q1K A;  1UFK A;  2W1B A;  5KFX A;  1W26 A;  2OFG X;  1YZ7 A;  1I5O B;  4ZP7 A;  1J2V A;  2A18 A;  3G96 A;  1T9V A;  2UXC J;  1URN A;  5K8N A;  1RK8 A;  3KLI A;  3PJ9 A;  1VQL S;  1NZA A;  3V4I A;  4PXD A;  4IG3 A;  4ZJQ A;  3CT9 A;  1SJ1 A;  1QVG R;  5FDL A;  2PT0 A;  3TOQ A;  3V4M A;  3V6J A;  4FPI A;  4PUO B;  2OEK A;  3QBC A;  2CPI A;  2I5J B;  2RQM A;  4C3L A;  3IBC B;  2YY3 A;  3RG6 A;  1V3Z A;  1P1T A;  3IBW A;  1SV5 B;  2WK4 A;  3FDS A;  2P6T A;  1ZAX A;  4LQ9 A;  4DFM A;  2NYI A;  4F26 A;  1U1K A;  4JI7 J;  3P45 B;  2JFD A;  1DAX A;  2QMU B;  4I68 A;  4LUB A;  2EWH A;  4X4T A;  4DZ6 A;  3DLB A;  4ED8 A;  5B0C A;  3OPK A;  1OY8 A;  1SC4 B;  2OLW A;  3ETM A;  3QGP A;  4LBH A;  1QE1 B;  2G9O A;  2PN6 A;  3C14 B;  2K3I A;  3PM9 A;  1I51 B;  4IDK B;  4CO1 A;  1U1L A;  3M30 B;  1BQN B;  3W65 A;  2ZH4 A;  4DQP A;  1PCA A;  5IT9 Y;  2VFR A;  4RNF A;  3PIO Q;  4YB6 A;  1JJ4 A;  2RRB A;  2RDI A;  5EWF A;  3BYP A;  3Q8P B;  3RAQ A;  3OVB A;  4J9O A;  5HMW A;  4CLS A;  1W2B R;  1ZBT A;  2AYG A;  4X4U A;  1EKR A;  2FTR A;  3B4D A;  1PBA A;  1TKZ B;  4GVL A;  4W4M A;  5B0G A;  3FNN A;  4LF8 J;  4DF4 A;  2IA0 A;  1QAX A;  2KN4 A;  4F02 A;  2HWT A;  1QUV A;  1Y7P A;  2XBP A;  3AXM A;  2XMJ A;  1FRI A;  3MWB A;  4J9V A;  3WX4 A;  4DLE A;  3G6Y A;  1X7V A;  2VPY B;  4KT0 C;  4ZPV R;  4GKJ J;  2D7S A;  3M6U A;  1AYE A;  2DEJ A;  1SH3 A;  2GQ2 A;  1WNE A;  4U7U D;  3IMQ J;  5DGA A;  1KBR A;  4DPT A;  1OO0 B;  1NK0 A;  1UFL A;  4OZ0 A;  1Q81 T;  2Z2Y B;  3X3U A;  5HBM B;  2V8D A;  3M30 A;  5C42 B;  1SJF A;  2I6W A;  4IRD A;  2V68 A;  3RZA A;  3VVT A;  4CLT A;  1SUQ A;  5AXL A;  5I42 B;  2YX4 A;  1U4B A;  2JVR A;  4FPR A;  4DF8 A;  1YI2 S;  2YNI A;  1D1U A;  3GG1 A;  3LP2 B;  5KFT A;  3J80 Y;  1JLE B;  2YPY A;  4I67 A;  5KT3 A;  3OR1 B;  4GC7 A;  1Q78 A;  3W7B A;  1M5S A;  1AA1 B;  1SJQ A;  2VQF F;  3K0J A;  2KB2 A;  3GIR A;  2AW0 A;  2QFI A;  3KUH A;  3OTB A;  4CWB A;  1YTY A;  4FYD A;  4EUV A;  1NSK L;  2RVJ A;  4S0M A;  5J2Q B;  2AEM A;  1U48 A;  1NHK L;  1GX5 A;  4C2M A;  2D3O R;  5D0H A;  2C2E A;  2JVO A;  2QA2 A;  3FSY A;  5J1P A;  5ETM A;  2AD9 A;  4LMZ A;  4QYZ J;  2ZD1 B;  3FK4 A;  2BDP A;  1E6Y A;  2NRE A;  2J6U A;  1XNR F;  2MHN A;  2EFQ A;  5DGB A;  1PYT A;  3W64 A;  2DRD A;  1RIS A;  4RNN A;  2E9Z A;  3BDP A;  1XIQ A;  4RBU A;  2C3P A;  2CWX A;  5ETO A;  5C7P A;  3EYZ A;  2BJ1 A;  1SC6 A;  3HUL A;  3OUY A;  3LP2 A;  1N5T A;  5ETQ A;  3TAQ A;  2QFJ A;  1T02 A;  3M32 B;  5A8K B;  5DDR C;  5FLX Y;  3OL7 A;  1KNZ A;  1KC8 T;  2GFF A;  4FYV B;  2UV8 A;  1U26 A;  4WII A;  3UW1 A;  2H3E B;  3DDN A;  4WBF A;  2E5L F;  3D54 A;  2L08 A;  4TQR A;  3D9B A;  3BZQ A;  3NGR A;  4L74 A;  3UDV A;  4N56 A;  3G8S A;  2ZM6 F;  2OD4 A;  5HJX A;  2FJV A;  3IWN C;  1VQS A;  1R0B G;  3J80 U;  2V2V A;  3R97 A;  2VOO A;  2R8J A;  4M5J A;  2E5L J;  3RB3 A;  2HZA A;  1RAF B;  2N3L A;  2LEB A;  5HLF B;  1XC9 A;  3FZB A;  1MN9 A;  3KJQ B;  4IFY B;  3M1V B;  4DOZ A;  4A8Q A;  3NGK A;  2UU9 J;  3MR7 A;  3ISN C;  1H6K X;  3PAC A;  2NXN A;  5KFB A;  3IAS 9;  4YR2 A;  2UU9 F;  4O4G B;  1FO1 A;  4URS A;  4NEZ A;  4LSZ B;  4NMX A;  3DLG B;  4M5H A;  5C25 A;  1OMS A;  2W2M P;  2YNF B;  3CCW A;  1DZ5 A;  3SSR A;  3M05 A;  3RB4 A;  1M1H A;  1RSC A;  1WOS A;  1U1M A;  4KHP J;  4X4Q A;  3BGO P;  2AYM A;  5KFA A;  2R7V A;  4M63 A;  2JZ5 A;  4LF2 A;  3ZNU A;  4HI1 A;  1TU0 B;  4HDH A;  2A6M A;  4WZM A;  1BGX T;  4NL5 A;  1FKP B;  3KLV A;  2CJK A;  3UDC A;  2OPS A;  7AT1 B;  1UVL A;  4RL1 A;  3P5B P;  2BAC A;  1AZS A;  1FA0 A;  4X65 J;  1TV6 B;  3POT A;  3PDN A;  4ZCM A;  1RT7 B;  4MK7 A;  3NKY A;  4QOT A;  5B0F A;  1NJI T;  3EVM A;  2C1E B;  3VGV A;  5BJR A;  1S1W A;  1VJQ A;  3CMQ A;  2LXI A;  3L95 X;  3BGU A;  2CAD A;  4DI6 A;  5KFW A;  3GSD A;  4TVA B;  1RA6 A;  3AQP A;  5KFN A;  4JYA F;  4CO4 A;  3VQS A;  2RF2 B;  1KP6 A;  2EG1 A;  4PXE A;  2XO6 A;  2QT7 A;  2Z57 B;  3BS9 A;  1XMQ J;  1RTD B;  3W3S A;  1KRP A;  2KZZ A;  4M5K A;  4OZN A;  4USI A;  1RHJ B;  3UE2 A;  5DDP C;  4TNO A;  1NDC A;  1R0A A;  1S1V B;  4PXC A;  1BWV A;  2MY7 A;  2ZC4 A;  3D5M A;  5HQM A;  3EGN A;  4ID5 B;  4DL6 A;  4FN5 A;  5CH7 B;  1SKR A;  1T9T A;  2CKW A;  1DAR A;  2KYZ A;  4ZVE A;  3Q86 A;  3CD7 A;  3ZTQ A;  4CT8 A;  1S1U B;  1VHF A;  1S6U A;  4IDK A;  4JI2 F;  3CF5 Q;  4OMF G;  1PJ6 A;  1N8R T;  2LMI A;  3QRP A;  2NLW A;  4JUZ A;  1N0U A;  4DS4 A;  2C2D A;  1A7G E;  1JLA B;  5H1S V;  1FX2 A;  2HK2 A;  2PMH A;  4OYI A;  4LF4 J;  2ZZM A;  4N8O A;  2HHQ A;  1IWG A;  1UJ4 A;  1VRQ C;  2FHJ A;  2BW7 A;  4YUD A;  3CCM S;  3MPW A;  1TP7 A;  4LIR A;  3NNA A;  3ENA A;  3F41 A;  3C15 A;  1WDT A;  4OZ3 A;  5L9N A;  4ES3 A;  1BUX A;  4D3H A;  2IM1 A;  2OPR A;  3M6X A;  2MKJ A;  1FFG B;  5IM0 A;  4DSJ A;  2K7K A;  1FHT A;  2PSZ A;  4CYU A;  2JHE A;  5KG7 A;  1Q86 T;  1RT5 B;  2B6A B;  2CUY A;  4JI7 F;  2Z0G A;  3MTJ A;  4N7T A;  1FNO A;  3MR3 A;  2KU7 A;  3U1L A;  4K4V A;  3QFH A;  4RR5 A;  3A8J A;  4FXV A;  1LWC B;  2OUG A;  1DJ0 A;  4KHR A;  4FF3 A;  4ZVQ B;  4ECQ A;  4B3R J;  2FHO B;  2NUU G;  5FDL B;  3OV7 A;  3CPW R;  1UVJ A;  4K2X A;  1TKZ A;  4JP8 A;  1RT2 B;  2KT2 A;  2ZBC A;  1TUV A;  3DRX A;  2LQB A;  1DQ8 A;  3T41 A;  4XPC A;  2DRA A;  4FYW B;  1FDD A;  3SXL A;  2BOA A;  2XZW A;  3IS9 A;  1SBR A;  1HLW A;  2BRL A;  2WSF C;  3KJV A;  4GKK F;  1RAA B;  2J7W A;  2QMW A;  2U1A A;  2JLE A;  2E5J A;  1HA1 A;  3NCQ A;  2BM0 A;  2J7U A;  3I0R B;  2KVI A;  3CJ5 A;  3C14 A;  2GHP A;  2JH3 A;  1UVM A;  2MXY A;  5T41 A;  2AHO B;  4O3S A;  3CE8 A;  2L41 A;  1FT8 A;  3ELH A;  2XSJ A;  4ALZ A;  1VHI A;  2CDQ A;  4JOU A;  4DCP B;  3PX0 A;  3NMR A;  1JJC B;  2XCA A;  4HT5 A;  4WYL A;  5HMZ A;  1JLC B;  1VBK A;  3TVZ A;  4ZS6 A;  3CC2 S;  2G2Z A;  4NLG A;  2HVH A;  2VPX B;  2DB1 A;  1BC6 A;  2J9C A;  4RX6 A;  1T9Y A;  3GYN A;  4WXW A;  4OX6 A;  3GJS B;  1X9W A;  1BWE A;  1KQF B;  2ZE2 B;  1MML A;  1QDU B;  2WB4 A;  3GFZ A;  4RKU C;  5J2M A;  2I0X A;  4HLB A;  4RO0 A;  3DRP B;  2DXF A;  3CCV S;  4ZMM A;  4R5P B;  2MYF A;  2DNH A;  2EC2 A;  3HHL A;  5KAK A;  4GKK J;  3NNH A;  1O51 A;  2J9D E;  2VKZ G;  1XTZ A;  2YPZ A;  2XZD B;  2ZWP A;  4KTQ A;  1VLY A;  3MEC B;  4ENO A;  3HKW A;  3QAU A;  3THT A;  3Q22 A;  4DN9 A;  2ZJP Q;  1X0F A;  4PG5 A;  4PG8 A;  1U24 A;  3DYA B;  5IQQ A;  2F8H A;  2IHR 1;  4RW9 A;  5MLC V;  1TK0 A;  3VGU A;  2EKY A;  3OTE A;  2VPW B;  5CYQ A;  1TQL A;  4ZKA A;  4JI3 J;  4K4Y A;  1C1B A;  2KFY A;  2OHD A;  2WVC A;  4I4B A;  4OQJ A;  2HMI B;  3KK1 A;  4KHP F;  2WVE A;  1G3O A;  1ZM4 A;  3SSS A;  1DRZ A;  4W90 B;  2QG9 B;  3V81 A;  1TKT B;  4B9M A;  3MAQ A;  1RU1 A;  2N4D A;  2OGU A;  3TO8 A;  2VG7 A;  1QSY A;  3N5F A;  2QA4 G;  4DV2 F;  1N36 F;  1CPZ A;  4OYM A;  1HKA A;  2BE2 A;  2CVI A;  4RW8 A;  4B9U A;  1LWC A;  1ZM2 A;  3CO0 P;  2UXB J;  4QZV B;  4ANE A;  2K2P A;  5H9E J;  2FZG B;  1S4E A;  4QIF A;  1IKV B;  2PA8 D;  3CCT A;  3FBC A;  2PMW A;  3GE9 A;  2PFD A;  4KH0 B;  4N8N A;  5CQG A;  4QCL A;  3CJK A;  3GJQ B;  3NAH A;  1UZH A;  3MPY A;  5GAD I;  1RWV B;  4G6V B;  4RUA A;  1LK5 A;  5JVH Q;  3UCZ P;  5A0Y B;  1KR4 A;  2OPR B;  3DC2 A;  5IM0 B;  3KLH A;  1N34 J;  4DX7 A;  1BQN A;  3J7Z T;  2GQC A;  3DOL A;  1D0E A;  3MEG B;  2NYH A;  3KDO A;  2A10 A;  3CTR A;  5F9L A;  2W8L A;  3AXK A;  2ZJR Q;  4IR9 A;  1HMV B;  3I9Z A;  3BGF A;  1S5Z A;  2HFN A;  2W4C A;  3O3L A;  4DG1 B;  3HXM A;  1PJ5 A;  4NLU A;  4EYI B;  4E2F B;  2CNL B;  2BW2 A;  2QA4 S;  1F1B B;  2OO4 A;  3NS5 A;  4HL9 A;  4K59 A;  4OZ2 A;  5ETT A;  1N36 J;  4CCH A;  4GO5 X;  2UUB F;  3TI0 A;  2YH0 A;  1X4D A;  3B78 A;  5KFL A;  4OI1 A;  2IVM A;  2CPJ A;  3VGT A;  2GVD B;  2JRS A;  2XYG B;  4X4O A;  2HZC A;  3A8E A;  1T05 B;  1R8H A;  4MJK A;  4U7C A;  3MM9 A;  3SI8 A;  1R27 B;  4DL5 A;  1WI6 A;  4JI2 J;  2IFX A;  4ID5 A;  5KT6 A;  2IY5 B;  3N01 A;  1WC4 A;  3ICL A;  2IA6 A;  2HAI A;  2ZVI A;  3TYT A;  2XUL A;  4DU8 A;  1FRM A;  3MM6 B;  4RW6 A;  3TP2 A;  4KY3 A;  1KLM A;  3ZFV A;  5F0U A;  2H65 B;  3LH2 S;  4TXS A;  5DS7 A;  3DDI A;  1SQG A;  2N3O A;  3G9C A;  4CM0 A;  1N34 F;  4Z2X A;  2R3V A;  3ENW A;  2VA2 A;  1IKW A;  5D4L A;  2Y1L B;  1S7I A;  1D3W A;  3MAA B;  2E66 A;  5IS2 A;  4DSK A;  3HHK A;  4DR5 F;  1SJ3 P;  3JQM A;  5KFI A;  4FS1 A;  4IFY A;  3CJ8 A;  3QPI A;  3JYT B;  1TL7 A;  4BLG A;  1SL2 A;  2IYG A;  4K7Q A;  5HAN A;  4ZDN A;  5H9F K;  3SQG A;  2CZ9 A;  4K8R A;  3SMZ A;  3GCX P;  3BPS P;  1RTZ A;  1LKZ A;  1P6T A;  2GGP B;  3Q8R B;  3AFG A;  2XMK A;  3B54 A;  1D8Y A;  4J9N A;  4I7F A;  2KO1 A;  3F44 A;  4A48 A;  1FKP A;  2ZIT A;  5JXS A;  2EPI A;  2EFP A;  2K06 A;  3F56 A;  5B09 A;  3OLB A;  2J9E A;  1DQ9 A;  5CZX A;  4Q8E A;  4EBD A;  1FJG F;  4O3P A;  1X4F A;  2R7Q A;  1C0U A;  4PAB A;  3IWX A;  1Z2Z A;  3QZ8 A;  3IRX A;  4NRT A;  2DGX A;  1HNI A;  1TV6 A;  2DIT A;  4K4W A;  1K0T A;  4LRF A;  4DZD A;  1S6O A;  2EG2 A;  1CEZ A;  2ZNY A;  4ZPW R;  3FRY A;  2ILZ A;  4DR6 F;  2IRY A;  3DLE B;  3GU0 A;  1YJR A;  3IG1 A;  4WFX A;  3M6W A;  5F3T A;  4U7U K;  4WTO B;  2YKQ A;  3AJD A;  3OJU A;  1K8A T;  2KYX A;  2ZHB A;  3HT0 A;  3QWU A;  1KQS R;  3TZW A;  2W4P A;  4KKO B;  2RDD A;  4HHU A;  1NBE B;  4H4K C;  3PYE A;  1ZZF A;  1FRX A;  3RTV A;  1JLC A;  5DLF A;  2XB2 D;  1UW9 A;  5KT7 A;  1QLN A;  4DEZ A;  1X5S A;  3TAM A;  4RNO A;  2HSE B;  5GAG U;  4DFP A;  4ED7 A;  2GHW A;  3BR9 A;  4RUC A;  3D6H B;  3DLJ A;  3KNG A;  1KEK A;  1RWO B;  3D1Q A;  2Q6C A;  4OIX A;  3RRH A;  1TAQ A;  3MDF A;  4LF5 J;  2AZ3 A;  4NI2 B;  3PNI A;  1PAE X;  2AEJ A;  3MCO A;  3Q8Y A;  1Y10 A;  4QW9 A;  4ZK7 M;  3OLA A;  3BSA A;  4IOB A;  5D3G B;  2BE9 B;  4IKA A;  1R7I A;  4IFV A;  4OYA A;  1X4B A;  2NPF A;  4C8Y A;  2V34 A;  2OMO A;  4DV7 F;  1Q7Y T;  1K47 A;  4H4M A;  3QSI A;  4NML A;  4KRW A;  4YB7 A;  3DLK B;  4DR6 J;  4FBT A;  1DTQ B;  4B3T J;  4TQS A;  4ZPB A;  4IYQ A;  4DV0 J;  4LBP A;  1T11 A;  1NKE A;  1ZOT A;  1I3O B;  1F9E B;  3FMW A;  4OYX A;  3F0N A;  3S01 A;  3TAM B;  4O0I A;  1VIO A;  1H2U X;  2BJ7 A;  1TMM A;  3JQJ A;  3KLE A;  1RHR B;  2KI2 A;  2FVR A;  1M90 T;  4CLF A;  2EK6 A;  2HFO A;  3V6D A;  2RML A;  1HQ2 A;  4M1K A;  3D68 A;  3CDE A;  3MM6 A;  3T9N A;  3RW6 A;  5DG9 A;  2VJU A;  3DHW C;  3X1L B;  2XMV A;  3OR1 A;  3MFI A;  1TK8 A;  2Z4P A;  1FWK A;  2E1A A;  2XYH B;  4OJH A;  1RWK B;  2XS5 A;  3IM8 A;  2VC0 A;  4DR3 F;  2FLN A;  4ICL B;  1RWW B;  3MEE B;  5FLX U;  4M5I A;  4KV8 B;  2V8P A;  4YY3 F;  1EP4 B;  2Y0S D;  4M5G A;  3SV3 A;  5HRO B;  3KK2 B;  4DL2 A;  2DR7 A;  3FEY B;  2FJD B;  2KH9 A;  4B9N A;  1ZA2 B;  1C0T B;  1GXL A;  2H4Y B;  4ZVH A;  5AE3 A;  2HS4 A;  3G6X A;  1O5J A;  5I3U B;  3J81 Y;  2HHT A;  2M7S A;  1YJU A;  3T5J A;  3I87 A;  2R8K A;  1HPZ B;  2Y3Y A;  2V8V A;  5T14 A;  3BSC A;  1KFS A;  2CNO B;  3I4P A;  1F5B A;  5C25 B;  2MQP A;  4AND A;  4I6W A;  2UV8 G;  1LW2 B;  5ETR A;  4F3O A;  1RTJ A;  3PKM A;  2IVF B;  3N9U C;  2D3O 1;  1NK4 A;  1HW9 A;  2VBY A;  3NOG A;  3UWT A;  3EDQ B;  4OYW A;  1WOO A;  2EK1 A;  2H5I B;  2IDL A;  2Y8W A;  5G4D A;  2E5G A;  1VQK S;  3VHQ A;  4DR4 J;  3MMB B;  4KGZ B;  1C1C A;  3AA8 A;  5B7W A;  4DFK A;  5DRK A;  1HNX J;  3NY0 A;  4FKX A;  1IBM F;  4G1Q B;  2W2P P;  4PPZ A;  1F9F A;  3KKF A;  4FS2 A;  2V4R A;  4L3K A;  1QAY A;  5DZ6 A;  5JVG Q;  2HHP A;  2V4J A;  3H5U A;  1KTV A;  3QO9 A;  4DFJ A;  4LT6 A;  1HI0 P;  1HL6 A;  1U8W A;  2OI2 A;  4RW4 A;  3MUV P;  4LRE A;  2CPF A;  3L7U A;  3K8W A;  4IH5 A;  3LPY A;  4I2P A;  1XR6 A;  5GAH I;  1MSW D;  1ZPV A;  1TVR B;  4DCJ B;  4BDP A;  1EZZ B;  1S1W B;  2FY8 A;  5BR8 J;  3I55 S;  2CZ4 A;  4N5S A;  5L1I A;  2BAN B;  4DUZ F;  2ADB A;  3NS7 B;  3W9H A;  4ZVO B;  2RDJ A;  4B3M F;  3NGU A;  3QQC D;  4M5M A;  5BXI A;  4U67 Q;  2G4B A;  1CC8 A;  2HFS A;  2RQ4 A;  3ITH A;  1T03 A;  2CQC A;  1N32 J;  4CH1 A;  2C2K B;  2C3M A;  4QIG A;  4RW9 B;  1U1Q A;  2GJF A;  2Q3P A;  3V4I B;  4WFZ A;  3HVA A;  4ANC A;  2L3M A;  5DLG A;  2CRL A;  2LU1 A;  4P6Q A;  1IKY A;  1GMW D;  4KFB B;  3LAM A;  1IJF B;  4F4Z A;  1HNX F;  3ILO A;  5EN1 A;  1Q8I A;  1SV5 A;  4C8N A;  4UST A;  3E01 B;  2FD2 A;  4NAS A;  5B0D A;  3JSM B;  5H9E K;  3M8Q A;  3ZZP A;  2GV1 A;  4JV5 J;  2MLZ A;  3DGP B;  3OSN A;  2E1M C;  3DOK A;  4KJI A;  1D9D A;  3AA9 A;  2UXD F;  2QEX S;  1NEE A;  1BXN A;  3TA1 A;  1S1T B;  2R7T A;  4AXI A;  2FLL A;  4BCA A;  2OKQ A;  3M8Y A;  4J9M A;  3DLK A;  2GIR A;  1NU4 A;  5KG2 A;  4RU9 A;  1VC6 A;  1FFW B;  2HVD A;  3OL8 A;  2HNY B;  3MCS A;  4RWX A;  3M8S A;  1RCO B;  3D6M B;  1QSL A;  1RT6 B;  4A8Y A;  2XS2 A;  1IKV A;  2VBW A;  3L9Z A;  2FY1 A;  3VQT A;  1H74 A;  2ALY B;  1FEE A;  3OTO J;  2IJR A;  2LKZ A;  4NCG A;  3GIL A;  3U1M A;  2WOM B;  3FKB A;  3MMC B;  1WI8 A;  2WON B;  4J9Q A;  5A8R B;  1S9E A;  3D0I E;  3TAN A;  2DO4 A;  2DK2 A;  2RD5 C;  2CG4 A;  2UZA A;  1CLF A;  4OHW A;  3Q8Q B;  3KK3 A;  1U47 A;  4ELV A;  2LEP A;  2HQG A;  2XMM A;  3TJ9 A;  1YKW A;  4ZVG A;  1CQM A;  5HI7 A;  3Q8U A;  1VK3 A;  2HIQ A;  2GIF A;  2ILY A;  4DPO A;  3KK1 B;  4FNH A;  4KC5 A;  4CQ1 A;  5F8G A;  4LF5 F;  3A3O B;  1YHQ S;  1JNR B;  1X5O A;  1TL3 B;  4FYY B;  2W24 A;  5A6W A;  2BM1 A;  4PKD B;  4ZHR B;  1RHK B;  4HAC A;  3GR1 A;  3R9L A;  3DRS A;  2P9E A;  3HO1 A;  1S1X B;  1OPI A;  1WC3 A;  4A8K A;  3OHA A;  3R2C J;  4OHY A;  1FKO A;  5J2Q A;  2GML A;  2YQ3 A;  2L9W A;  2AIR B;  2O01 C;  3GON A;  1WSR A;  4YN3 B;  1XNR J;  5AJ3 F;  5CYJ A;  1JX4 A;  1CJU B;  2V63 A;  3TQE A;  3MD3 A;  3QT7 A;  2J76 E;  1YBU A;  1RT5 A;  2JJ4 D;  4TLQ A;  2QYC A;  4EYH B;  2M2B A;  1HQE B;  2HND B;  4P2X A;  2A1B A;  1L3U A;  4E0D A;  2G0I A;  4AD6 A;  1NJW A;  1LW0 B;  1RQ0 A;  2OPQ A;  3N6M A;  1KQK A;  3KLF A;  2JLF A;  3PTW A;  4TY9 A;  2MQL A;  4I7F B;  3QJL A;  1CJT A;  2HAF A;  3G71 S;  4F2R A;  4B17 A;  4OZJ A;  3R3T A;  4LRA A;  4G3I A;  1RXO B;  2J6T A;  3D3B J;  4F7V A;  1YQH A;  2JX2 A;  1RGV A;  3O1L A;  2ZH2 A;  2K1R B;  3CJ0 A;  2X7I A;  1IUJ A;  3T6B A;  4OYB A;  1RJJ A;  4CNZ A;  5EGY A;  2XQC A;  4PYD A;  2KJV A;  1CQN A;  2F7V A;  4RW4 B;  1FKO B;  3BN7 A;  5M2R A;  2VQE J;  1IBL J;  1RWN B;  2VF3 A;  3BKU A;  3NGS A;  5E2Q A;  3FRZ A;  1SC1 B;  2ASY A;  1YJW S;  4U8Y A;  2IPO B;  2Z8Q A;  5JMN A;  2R7S A;  1F9H A;  1W25 A;  1X4E A;  2DHH A;  2XC9 A;  1XEZ A;  2FJB B;  1RTH A;  3B4M A;  1QSS A;  2IRU A;  1VQ6 S;  4IOA Q;  1XBW A;  3J81 j;  1N56 A;  2MGZ A;  1TR0 A;  3CC7 S;  4ZP9 A;  3TUZ C;  1X4A A;  3MFH A;  5DDO C;  3OTO F;  1RAO A;  2KM8 C;  3CCJ S;  1FDB A;  2D1C A;  4LF8 F;  4OI0 A;  1JLB B;  3ETO A;  4CO0 A;  3L09 A;  3OW2 R;  3QIP A;  2WOM A;  4KB7 A;  2B9E A;  4EWT A;  1FRJ A;  1NSA A;  4YDD B;  4RW7 B;  3CW2 C;  1QTM A;  2AF6 A;  4WXO A;  1DFD A;  3VAF A;  4DL4 A;  1UW4 A;  4OHZ A;  5E3Q A;  1U7L A;  2KRB A;  5CD4 H;  5A2Q Y;  1B0T A;  2ZNZ A;  2VQE F;  4R5P A;  1C1B B;  1X0P A;  3JAM U;  3FBE A;  1H7X A;  2OPP B;  3W61 A;  4FF2 A;  3MM5 B;  3OVS A;  4F67 A;  1K9M T;  3HJF A;  2KXH A;  2PMZ D;  2V67 A;  2XMT A;  1YGY A;  3EGW B;  3G8T A;  5CD4 A;  1VQ9 S;  4F25 A;  4IRK A;  2GS8 A;  4Q2M A;  1WF2 A;  4NXN J;  1OJ4 A;  4UY8 5;  4LIW A;  4KGM A;  1U6B A;  2KTQ A;  2QL5 B;  3KLG A;  2MQQ A;  1PO6 A;  5D78 A;  5HN0 A;  3IO1 A;  4DPW A;  4DSF A;  2PC6 A;  1REV A;  3O2I A;  4PZV A;  3EX7 B;  2QIF A;  5FII A;  4BWM A;  4M5D A;  3HSZ A;  2F1F A;  5B0A A;  5A8R A;  5MAO A;  2IJF A;  1GMU A;  3TEG A;  1IQZ A;  2J0X A;  4C8M A;  2ASJ A;  2C2N A;  2E7V A;  4I69 A;  1PGZ A;  3HHL C;  1K44 A;  1URR A;  3I4H X;  1T03 B;  1FXD A;  4ATN A;  2PI4 A;  5HAO A;  2GO9 A;  1WD6 A;  4CRJ A;  3VCD A;  2MZJ A;  4LVN P;  1WC5 A;  2VD3 A;  3FUY A;  3KDN A;  4USV A;  3PEJ A;  3H59 A;  2CQI A;  5F8M A;  4ES2 A;  1RTD A;  1R8P A;  4OYO A;  1FDN A;  3H4B A;  3TAP A;  1CJK B;  2J8A A;  5KT2 A;  4EGL A;  2FC9 A;  2UUW A;  3NG8 A;  3H2U B;  3OR2 B;  3ZC4 A;  1GTH A;  3HLU A;  3OFG A;  1LWX A;  2F3J A;  2NXJ A;  1YJ7 A;  3BKF A;  2HQF A;  4KGV B;  4NYP A;  4D3G A;  4MMO A;  3RB6 A;  1TFW A;  3CD6 S;  1BQX A;  3EGZ A;  2GC8 A;  5IC6 B;  2C22 A;  1NSQ A;  1NHU A;  3R7B B;  4DLG A;  2CDR B;  1WF1 A;  2HNY A;  1L3S A;  3D2W A;  1GMV A;  3HHL B;  3NRB A;  4Q5V A;  5CA5 A;  1XMO J;  1RT1 A;  3QJP A;  1TKX B;  3FJ2 A;  4MKA A;  3W1Y C;  3GJR B;  1GH8 A;  2B9Y A;  3PR4 A;  2XS7 A;  1OY6 A;  1ARO P;  2GAH C;  2KXF A;  4MAK A;  1QAI A;  3VAI A;  1YZ6 A;  2JWN A;  2HGM A;  4YHH F;  3MF5 A;  4EO8 A;  1H2V Z;  2XLI A;  1R0C B;  2OSQ A;  3T1Y F;  2FLP A;  3OTD A;  1HPZ A;  4JB8 B;  1XNQ F;  2WVB A;  3E01 A;  3TZZ A;  5DG8 A;  2YWW A;  2B51 A;  1NDK A;  2MSS A;  3FZ2 A;  4AXJ A;  1TTH B;  2FYX A;  4CH7 A;  2X51 A;  2PI5 A;  4CO5 A;  5GAE I;  1FDA A;  4I6Y A;  3CCR S;  4GRS A;  2R9L A;  3DGV A;  2J9D A;  4YEA A;  3W9I A;  2JC1 A;  4P74 A;  3UR0 A;  3DMJ A;  2JL9 A;  1UET A;  3QGI A;  3SFG A;  4ZLL A;  4ECU A;  5E41 A;  4KPC A;  1HBO B;  1WOP A;  3DN9 A;  3PY8 A;  1NPK A;  2G2Y A;  1WG1 A;  1HFE L;  3EXY A;  2LYV A;  4ZCL A;  5HBM A;  2YVS A;  4QR0 A;  1VDH A;  4XK8 C;  3W9J A;  2RQC A;  1KON A;  2ACY A;  4WFB Q;  1UTA A;  3BEG B;  5ETP A;  3JTP A;  2R2R A;  2NCK L;  2E1P A;  4JI5 F;  1IBK J;  2NZC A;  2BAN A;  3BBB A;  2VPZ B;  3BF4 A;  3BGR A;  1BD6 A;  3LAN A;  1RT2 A;  3N4W A;  4I64 A;  4C6A A;  2JEJ A;  4OZ5 A;  1WHY A;  2YX7 A;  1U8S A;  3QAE A;  5A8W A;  2XGQ A;  3GIJ A;  2B4P A;  2F63 A;  2DGS A;  4ETX A;  1X4G A;  4USH A;  5KFK A;  1QJH A;  3DOK B;  2YWK A;  2VKR A;  4QU7 A;  1O0P A;  1MWZ A;  1S1U A;  2BYC A;  1U49 A;  3KHL A;  4NYZ A;  4KPY A;  2Z56 B;  2NXU A;  4IH7 A;  3JSM A;  2XWX A;  2CPX A;  3TNV A;  2UVV A;  3C2P A;  1KLM B;  4QQB A;  3MPD A;  1NME B;  4MK8 A;  4UUW A;  3D6F B;  4C11 A;  3VTI A;  1M1G A;  1CBK A;  1B0P A;  3PX6 A;  2Y9H A;  3K8V A;  2HHH F;  1F3F A;  2VFS A;  2ZD1 A;  2GX8 A;  5IV4 A;  2XNR A;  3MM9 B;  4UOH A;  1JXE A;  3CSK A;  2DNM A;  5JUM A;  2DHA A;  2E5I A;  4IOC Q;  1V3S A;  1VI7 A;  2KZM A;  4LQ3 A;  1NKB A;  1VOM A;  4NA3 A;  2QV6 A;  1NH7 A;  1H0H B;  2CAJ A;  4E98 A;  1UJ6 A;  3ADA C;  5F9N A;  4Y65 A;  2QLJ B;  2DKO B;  2FQQ B;  2MKY A;  2NPI A;  3UVJ B;  4C11 B;  4F36 A;  1WTF A;  5HSP A;  1X5P A;  3C46 A;  3ZNJ 1;  3A13 A;  3SV4 A;  3CUL A;  3QNW B;  4KKO A;  2QL9 B;  4XO0 A;  3OVA A;  4F0K A;  2IBK A;  1P9Q C;  3NGD A;  3R5G A;  5LT5 A;  4XIU A;  3R7N B;  3R5B A;  4DV5 J;  4IO9 Q;  1ZYQ A;  4DV2 J;  2POK A;  2FC8 A;  2VIC A;  3AJ1 A;  2RRN A;  2CQ3 A;  2DNO A;  2HBZ B;  2JEI A;  3M1V A;  4HTJ A;  5F8I A;  2KFN A;  2LEC A;  3QGG A;  2LLZ A;  2Y8Y A;  2EBG A;  5HLF A;  3AD7 C;  1RT4 A;  1SI9 A;  3AT1 B;  1R0A B;  2HHH J;  4RLE A;  5L39 A;  4DR2 F;  4P10 A;  1RWM B;  2V2Q A;  5HQL A;  1SC3 B;  4F4W A;  5EWE A;  4K50 A;  1WKK A;  2FUG 9;  3A8I A;  1B7Y B;  2VQF J;  1NK5 A;  1AUS L;  1UPM B;  3EM1 A;  3UN3 A;  2FIU A;  1IBL F;  2RH3 A;  5ETV A;  3EGV A;  5B0E A;  3PJW A;  2OEM A;  3QT5 A;  4F2S A;  3P3D A;  2M9K A;  5KFJ A;  5LMN J;  1F2G A;  4Y2A A;  2FVP A;  4O4G A;  1UKU A;  4YS2 A;  3PW2 A;  4KGX B;  1LWE A;  1P8G A;  4RNH A;  4TN2 A;  1LXJ A;  3QSY B;  1XR7 A;  1FRL A;  2B8P A;  1N5Y A;  4UUX A;  1XMB A;  2M70 A;  3J7Y I;  2DXE A;  3EVW A;  3ILI A;  4TY8 B;  2BXJ A;  3JXO A;  1WEZ A;  4OJG A;  3GMG A;  4DV5 F;  1RT4 B;  2B0G A;  4TLR A;  4H4O B;  1N6Q A;  2KG1 A;  2F9D A;  5KT4 A;  1Z2L A;  1Z1Z A;  3PW4 A;  2FGO A;  1KKH A;  3LW5 C;  4GVB A;  4Y2K A;  5ADZ A;  4FVM A;  2BJE A;  4CLW A;  1HR0 J;  4NZ7 A;  5KG5 A;  4EK2 A;  5I4M A;  1KTQ A;  2O1P A;  3A4T A;  3QAT A;  4OV6 A;  4JI0 J;  3MGJ A;  2R2T A;  2WW4 A;  1RHM B;  2F8M A;  2WSE C;  4OYP A;  4JV2 A;  4IQX A;  2YKP A;  5AE2 A;  4EEY A;  2E5H A;  2F4V J;  2J0Q D;  1YDL A;  3P4U B;  1PAU B;  2M52 A;  4WFY A;  5BYR A;  1N5Q A;  2NSB A;  2Q1L A;  4OZ1 A;  5DZ7 A;  3SIP B;  2ADC A;  1KQG B;  2BX6 A;  4TKT A;  3GSI A;  1HQU A;  3UNG C;  2WZ1 A;  1X9S A;  1HD0 A;  3FCV A;  2F4F A;  3M9M B;  1NM2 A;  3DU6 A;  1B4S A;  2Q43 A;  4XDD A;  3BPD A;  3SQG B;  4N41 A;  3SZ2 A;  1TL4 A;  4IG0 A;  3GIK A;  2HKE A;  4HVZ A;  5IT9 U;  4NI2 A;  1TVR A;  4RW7 A;  3DXS X;  1MLA A;  5KFD A;  3LGM A;  4Q44 A;  1A0O B;  5A8K A;  4ZP8 A;  1SL0 A;  2OEL A;  3R8Y A;  3KLH B;  4WE1 A;  4FBU A;  1N33 F;  5J1E B;  4R8U B;  1AFI A;  4PYA A;  1SXL A;  2CQ2 A;  2FZC B;  1WSV A;  3IRW P;  5HP1 A;  2F4V F;  2ZJQ Q;  2X1F A;  2DYA A;  3CJK B;  4NOH A;  3Q24 A;  3HDS A;  4TU8 A;  1MRO B;  2ASD A;  2HFV A;  2AT1 B;  2D3Z A;  4Q0B B;  2PII A;  2PEH A;  5G0R B;  2SXL A;  3QLH A;  3DLE A;  2ZH5 A;  1YLX A;  4MYT A;  3I31 A;  2G13 A;  4I2Q A;  1MWY A;  4KYZ A;  2B7C B;  2UUA J;  2UVR A;  4I0W A;  4M5D B;  4NLX A;  3KMS A;  2BOP A;  5ETK A;  4ZPA A;  1OQ6 A;  1VIX A;  4WZQ A;  3CD5 A;  5GAG I;  4EBC A;  3EZO A;  1E6V A;  1S7H A;  3S6E A;  1TMJ A;  2LA6 A;  2PD1 A;  4RW6 B;  3HHE A;  3SCJ E;  4CTA A;  5C24 B;  2XHC A;  4A8F A;  1BY9 A;  4QR1 A;  2CWK A;  1WEL A;  4QJV A;  2RU3 A;  2VHG A;  2ZBI A;  2MQM A;  4B3S J;  4X64 J;  2CNK B;  1L3T A;  4DWI A;  4ZVS B;  1U1O A;  5F3Z A;  4NLR A;  3DYA A;  3CJ2 A;  3HMJ G;  1REG X;  1FVS A;  1U0H B;  1DTT B;  1HNV B;  1WHV A;  2DNL A;  2HQC A;  3I5C A;  4C8K A;  3TRG A;  1CJV B;  3MM7 B;  1RTH B;  1OYD A;  3CIZ A;  4W92 B;  1VQ5 S;  4F04 B;  4NLP A;  1O6X A;  2ZEJ A;  4GC6 A;  3T1H J;  2V2K A;  4LF9 J;  3SSQ A;  4KIA A;  1KFD A;  2E9T A;  5HVG A;  2LU2 A;  1IKW B;  1WUU A;  2W01 A;  1EET A;  3FCW A;  4NYO A;  5AT1 B;  5SUH A;  4JI8 F;  3CGI A;  4URG A;  3BN4 A;  2GIQ A;  2GMH A;  1C4A A;  2W9A A;  5ITH A;  1KD1 T;  5A8W B;  2MJU A;  1XJW B;  4ZVU B;  1TL1 B;  1FTC A;  2HS3 A;  5J1N A;  5LMU F;  2P5V A;  2DR9 A;  3MED B;  4OX9 F;  4C3M A;  4CM2 A;  2OTJ S;  1UZD A;  3ONQ A;  1CJT B;  4QIE A;  2J7K A;  3VWS A;  4CO3 A;  2OH2 A;  4NXM F;  4V19 X;  4AL5 A;  5I3P A;  1N32 F;  1ROF A;  2RUS A;  4UOF A;  4EO6 A;  3M2U A;  1RAE B;  1VQ7 S;  1V9O A;  2CPH A;  2HND A;  5KFU A;  2PE8 A;  1D9A A;  2AYB A;  2H1Y A;  1N52 B;  4B9S A;  4LF7 J;  4C9D A;  2RKI A;  4P52 A;  4DPY A;  2AJ4 A;  4ED1 A;  3T1H F;  2UVU A;  3TWZ A;  2CIM A;  2DR5 A;  4DG1 A;  2HHS A;  2DGT A;  3PRD A;  3D1O A;  1T9U A;  4K5R A;  3EJM A;  5D0E A;  5KFF A;  2APO A;  4ERD A;  3TEH B;  4B3O A;  3EZ5 A;  1PBU A;  1WKL A;  1GEH A;  3A1Y G;  3HZE A;  5CYM B;  5KFR A;  4DX5 A;  5F8N A;  3R6L B;  4F8R A;  1I1G A;  3LP0 B;  2H5E A;  3M8Q B;  4KO0 A;  4PRF A;  1Y00 A;  4WKY A;  2QL7 B;  4LRD A;  4DR1 F;  1SIW B;  1GNK A;  4X4V A;  3HVT A;  4DR1 J;  2ALZ A;  3C8Y A;  3EPG A;  5T7L B;  4KGK A;  1P1L A;  1EJ7 L;  2HFU A;  3Q8S B;  1RUS A;  4I56 A;  1U1R A;  3GV5 B;  2J8S A;  3PZP A;  3NCP A;  1U2C A;  3QLH B;  1K1Q A;  1R6Y A;  3KG1 A;  5ETN A;  3J81 U;  4ECZ A;  3ISZ A;  4MFB A;  1N6Q B;  3VVU A;  1NJZ A;  3V81 B;  4Q8F A;  1KOH A;  5L38 A;  3IR7 B;  3IS9 B;  1FES A;  4WFN Q;  2AGQ A;  1C4C A;  1RHU B;  2Z2M A;  3QJJ A;  1Q53 A;  4CLU A;  4DV3 F;  1FX4 A;  2ZOM A;  2C2R A;  3R5D A;  2XSJ B;  3IXQ A;  3KJF B;  1R3N A;  3BGL A;  4K4U A;  4P2F A;  2DD8 S;  1WHX A;  2DXD A;  3MAH A;  3MMJ A;  4IUF A;  1FJ7 A;  5D8H B;  3GPA A;  1QTN B;  2BUN A;  4ZPD A;  1B99 A;  1R31 A;  3MEC A;  1ZA1 B;  2W25 A;  4NX9 A;  4J9L A;  1OYE A;  3L3C A;  3NXZ A;  2B5J A;  1S72 S;  2ROG A;  3VAJ A;  1L5U A;  5L1J A;  2G2O A;  3H2L A;  4R0E A;  1FNM A;  1S1V A;  4DR7 F;  4UZC A;  1RLD A;  2VDH A;  3SEO A;  2B6A A;  3RR7 A;  4ZVR B;  3S8S A;  2J0S D;  1FXL A;  1HQU B;  5DET A;  1S1T A;  3LP0 A;  2KG0 A;  4H54 A;  2ZH6 A;  2R7X A;  2RRA A;  1HWJ A;  2OPQ B;  1HHQ A;  2YKN A;  3DGP A;  4K4T A;  2HGL A;  1H98 A;  1U02 A;  3CD0 A;  6AT1 B;  3C6T A;  1PG5 B;  4CIO A;  3I56 S;  2H51 B;  2DNQ A;  2L9D A;  3B6B A;  3OFE A;  2X3G A;  5F8J A;  5LJ5 Y;  1X9M A;  1IKY B;  3SCL E;  4ED2 A;  5KFE A;  1RT7 A;  2DPI A;  4MT1 A;  4PG4 A;  2N7C A;  1JLG B;  3C6U B;  3PIP Q;  4KHM A;  1AZS B;  2G0J A;  2CFX A;  3GFY A;  4YOE A;  1YVF A;  4JI6 F;  3TUJ C;  1FI4 A;  1U6F A;  2YKA A;  1EKS A;  3H0P A;  4PG7 A;  3KJV B;  2WCX A;  1S9F A;  1S0M A;  1C1C B;  4FYX B;  4CT9 A;  4P2S A;  4NZ0 A;  1HNW J;  2DJW A;  4PWD A;  2C3O A;  2HVZ A;  2GAG C;  4RBV A;  5KOX A;  1QM9 A;  3FVY A;  2FJE B;  1HBU B;  3PJX A;  4MTP A;  4K4Z A;  2GZO A;  5IZH A;  4XDC A;  1F3V A;  5M2P A;  1X31 C;  5E3C A;  2COL A;  2ATC B;  5L9X A;  4B3S F;  1VGY A;  4JBC A;  4YME A;  1AXQ A;  1UEK A;  1VBY A;  4I1T A;  2QYG A;  3NGT A;  5L8R C;  5LSR A;  5RUB A;  1HWI A;  2B7B B;  2HBQ B;  4OFZ A;  3KG4 A;  2DEI A;  4CO2 A;  4FXD A;  2FHK A;  1S4F A;  3TVY A;  5JJB A;  2MDA A;  5A76 A;  4UY8 T;  3IGN A;  5CAA A;  2MZR A;  4KV8 A;  4LF6 J;  3ENV A;  1WG4 A;  2X1A A;  1IBM J;  4ICL A;  4YR0 A;  2DIU A;  2BAB A;  4X84 A;  4JYA J;  1ITP A;  3WX8 A;  3PEH A;  1QE1 A;  5L1K A;  3SYZ A;  4Y34 A;  4DU7 A;  1RLC L;  4NXM J;  2WTF A;  3OTC A;  1QVF R;  3QT6 A;  2BBE A;  2GA7 A;  1JB0 C;  2QA1 A;  3IA0 A;  2BZ2 A;  4J5O A;  3R7S B;  5J2P A;  5J2N B;  3ZZO A;  2ROP A;  4PWW A;  4B02 A;  4A8O A;  4ZVT B;  1F5C A;  1RBA A;  3PRB A;  3QYY A;  2ZH3 A;  4NLV A;  2NSC A;  3POT B;  3TZY A;  3D28 A;  3MR2 A;  2PDA A;  4LSL B;  3ZTP A;  2ASL A;  1EIY B;  3MR5 A;  1E6Y B;  1VQN S;  1RT3 A;  1SH2 A;  2Q6B A;  4ITS A;  2XEX A;  2DHX A;  3KTQ A;  1G2E A;  2JEG A;  2ZWO A;  1UWA A;  2DNZ A;  6FDR A;  1HBM A;  2WSC C;  2RSQ A;  4ZVP B;  4TY8 A;  1PYO B;  2HS0 A;  2CPE A;  1WOR A;  4ZJL A;  1VRT A;  5E3R A;  3CDB A;  5D6G A;  1RCX B;  2CG8 A;  1KS2 A;  1YRU A;  1TUG B;  3FCH A;  2XI3 A;  3GYG A;  4J9P A;  4GVB B;  4JI8 J;  3TX8 A;  1SKW A;  4Q43 A;  1FRH A;  1SUQ B;  3OUY B;  2V4J B;  3D4J A;  1HYS B;  1I6J A;  2CQP A;  1CJK A;  5E33 A;  4QWA A;  1S0V A;  3TAR A;  1MU2 A;  3N28 A;  1FFS B;  5DDQ C;  1N4L A;  4IG0 B;  1TZ0 A;  4DS5 A;  1N5S A;  2GMJ A;  2PGC A;  2QLF B;  4OX9 J;  3CCQ S;  1RYR A;  2CNN B;  1KN6 A;  2HPU A;  2Q66 A;  3RU0 A;  2DY9 A;  4DR3 J;  3CCS S;  2BEF A;  4LFB J;  3D7S B;  3L7P A;  4R0J A;  5IWA F;  1LWF A;  3BQ1 A;  2JLG A;  1CSJ A;  2OD6 A;  3CJT A;  3UQS A;  3UI3 A;  1RWU A;  4QR2 A;  1T3O A;  1UL3 A;  1YJN S;  5D0R A;  2ZKU A;  3IRX B;  1REV B;  5EHH A;  4K4S A;  1ZAW A;  4PPD A;  4C97 A;  1RWP B;  1JQG A;  4E8U A;  2RQK A;  1T3N A;  5KFZ A;  3P49 B;  1Q4R A;  1Y5I B;  3RAX A;  1YIJ S;  2CQ4 A;  2NS1 B;  1UVI A;  2EFN A;  3IWL A;  5CCM A;  2NXE A;  5DM7 Q;  1EP4 A;  1Z4U A;  1RE1 B;  4WJB A;  1H3D A;  4U96 A;  2IAJ B;  2QGF B;  3OHB A;  2FJW A;  3RAM A;  1VQ4 S;  3KWM A;  2YNH B;  3M8Z A;  1MN7 A;  3HI9 A;  1HR0 F;  2G1H A;  3N0V A;  4KR0 B;  4ED0 A;  1WDD A;  5GVQ A;  3R5C A;  1S0O A;  2O66 A;  2VBX A;  4N77 A;  1MG7 A;  3HPO A;  1V5V A;  4J9K A;  1QUP A;  2MJN A;  2AJF E;  3OT9 A;  4MKV A;  3K59 A;  4ILR A;  2HZV A;  1FCA A;  2HIY A;  2V2Z A;  2UVW A;  3NBP B;  2ZHA A;  4HHJ A;  4O4R A;  2RS2 A;  4GMK A;  3UDE A;  3ZZZ A;  2DIS A;  2RJZ A;  3CMA S;  1VQ8 S;  8ATC B;  5LL6 d;  2RT3 A;  4IRC A;  3M2V A;  4ETZ A;  4O3R A;  2XLK A;  1UEU A;  4F0H A;  3H7H B;  5BR8 F;  3M8W A;  4KAI A;  4DCO B;  2G1D A;  1VBX A;  4WTY A;  4B3M J;  3GLJ A;  1UP1 A;  1J5E J;  2AYE A;  1NH8 A;  1HBM B;  2Z2L A;  3G86 A;  3D66 A;  2VDI A;  1RTI B;  2BKP A;  1VMB A;  3MD1 A;  1HNW F;  1N5V A;  3EE3 A;  4ZIT A;  1VBZ A;  1LFW A;  2NXC A;  1H38 A;  1X4C A;  2IYI A;  3LWM A;  2KKH A;  3LGN A;  2BE2 B;  4RW8 B;  1S9G B;  5KOW A;  1S77 D;  1WG5 A;  4MIW A;  1S79 A;  3D6T B;  3DRY A;  1DHM A;  3NBP A;  4WWS A;  3SBM A;  3VAM A;  1VQP S;  3P8B B;  3HT3 A;  1A9N B;  4FF1 A;  3PYD A;  3GIM A;  5THW A;  4P73 A;  3ZZT A;  1X5T A;  2X1G A;  1S57 A;  1HMV A;  4LRB A;  4RJV A;  4Q45 A;  1M5H A;  3BM7 A;  3NWR A;  2YKN B;  4NA1 A;  3T5L A;  2R42 A;  4J9U E;  4NE9 C;  3U02 A;  2YH1 A;  4LFC J;  4ZJO A;  2RHQ B;  1HAR A;  2RIL A;  3MEE A;  4LFC F;  3P6Y C;  3IG1 B;  4IH6 A;  1B64 A;  4O3Q A;  3NS6 A;  3RYL A;  1S6P B;  2DCU B;  1NSP A;  3ZTO A;  4QPT A;  4Y2C A;  5H9F J;  2KL8 A;  1HNZ F;  3E51 A;  5KTQ A;  1RBO B;  2R2U A;  1VQO S;  3DM2 A;  5C2C A;  3L7O A;  4MIB A;  2KT3 A;  2JDJ A;  2IJN A;  2LP4 A;  2O5D A;  3I0S B;  3LTO A;  4UW2 A;  3UD5 A;  4RZR A;  1HNZ J;  3T3F A;  1B0V A;  2R2S A;  4AT1 B;  2I2Y A;  4G1I A;  3CJ3 A;  2LA4 A;  4DV6 J;  3OR2 A;  5K20 B;  2XI2 A;  5B0B A;  1RYS A;  2IC3 A;  1AUD A;  1RHQ B;  4X4S A;  2N82 B;  3DU5 A;  1TL3 A;  3HD2 A;  1IQT A;  3AOC A;  3EVO A;  1F60 B;  1RT1 B;  2XTJ P;  3HF5 A;  3S7R A;  1EX8 A;  1RBL A;  1ZS6 A;  1N54 B;  4OI3 A;  1Q0N A;  4OX8 A;  4CNY A;  2RKI B;  3RB0 A;  4DDF A;  3JYT A;  3FSX A;  4JI1 J;  2FB0 A;  2CPY A;  4ED5 A;  1UMJ A;  5DQG A;  3PYG A;  1NAQ A;  3LP1 B;  4TYA A;  3GFH A;  2CPD A;  2DHG A;  5KFQ A;  1MMN A;  2AU0 A;  4O44 B;  5KG0 A;  3DLL Q;  4P72 A;  4C8O A;  4EZ6 A;  3NCR A;  1NJY A;  1SVD A;  1B3T A;  3DRR B;  4X65 F;  3EUN A;  1EAY C;  1JNZ B;  3G4S S;  3SCK E;  1ELO A;  4MYU A;  4CLL A;  4ZLP A;  2LCW A;  3HVT B;  4JI0 F;  3MUR P;  2LFV A;  1ACM B;  2HG4 A;  4KSE B;  2DTJ A;  2M5Y A;  4CZC A;  1BE4 A;  4PQA A;  2V6A A;  3D3C J;  4ZVF A;  3TX0 A;  1PKU A;  3P96 A;  4A47 A;  3PW5 A;  3UD3 P;  3O44 A;  1RDR A;  1Y5L B;  4YP3 A;  1D9F A;  4YB5 A;  4J91 A;  5AXK A;  4C8Z A;  1XN9 A;  2DGQ A;  2UXD J;  3MM5 A;  2AJ0 A;  2KVQ E;  1GXT A;  5DQI A;  4IR1 A;  1K0V A;  4IO1 A;  2C28 A;  4ECW A;  1CS4 A;  1HYS A;  2GCF A;  5M2U A;  5F0W A;  1T8E A;  2HBR B;  1PC5 A;  2IRX A;  1X8D A;  3H4D A;  5D0G A;  3M9N B;  1XMO F;  2ZVS A;  3IAM 9;  3PVX A;  3NOC A;  4OJ1 A;  3M2U B;  5F8L A;  1JLE A;  1JJH A;  2WHO A;  3K58 A;  3BQ0 A;  1RU2 A;  4U6P A;  2CPZ A;  3PKY A;  2DR6 A;  4B3R F;  4UOG A;  4A46 A;  4ZN3 A;  5C2G A;  1IKX B;  3BJY A;  1GAO A;  1KSP A;  2I1R A;  1WTB A;  4HEA 9;  2MZQ A;  4ED3 A;  5LSO A;  1RAJ A;  3UNY A;  1XER A;  2WBM A;  2VC1 A;  4L76 A;  5LXR A;  4QWE A;  1NLK L;  4WK1 A;  3PXG a;  1JJ2 R;  2FJX A;  1M5K C;  4JV5 F;  2V4Q A;  2PFF B;  3KK3 B;  4C98 A;  4NCB A;  4X4P A;  2W2Q P;  1FD2 A;  4I2Q B;  5KT5 A;  1WC6 A;  1LNQ A;  1OIA A;  1JLB A;  2JC0 A;  3I0R A;  2IVY A;  3UFC X;  2OP5 A;  1HD1 A;  3SCI E;  5B08 A;  2KFZ A;  2LQ5 A;  3OFF A;  1R6V A;  2YKM A;  1WHW A;  3W8G A;  1N0V C;  3CDW A;  3IP0 A;  5DQH A;  3V6H A;  3J7A 1;  4XAK A;  2CJQ A;  1Y0H A;  3AHP A;  3I96 A;  2JEF A;  4KO0 B;  1S59 A;  3KLG B;  3T6J A;  2XCP A;  1YJ9 S;  2EBE A;  1GK8 A;  2VUG A;  2F9J A;  1EET B;  4ZIW A;  1V5I B;  3VGS A;  1KVJ A;  4EMD A;  5KFP A;  4DUY F;  3C15 B;  3THP A;  2V69 A;  1GMW A;  3M9O B;  2OSR A;  2RNE A;  3C6U A;  3M6V A;  3ZTR A;  1IM6 A;  3H8Y A;  5AXN A;  4V1A k;  3I0S A;  1WC0 A;  2VOD A;  3T5K A;  3RUB L;  1NDP A;  1HBN B;  3KXD A;  2W8K A;  5HRO A;  2CXE A;  4Y0F A;  1HNV A;  4KH1 B;  4CYU B;  2RB7 A;  3NP5 A;  1VFJ A;  3R1L A;  3H98 A;  3DRP A;  2A2C A;  2W9C A;  4DV0 F;  4QYR A;  4DN0 A;  2QTW A;  4RPF A;  3WQP A;  2W9B A;  4G1P A;  3TVK A;  6FD1 A;  2OTL S;  4F0M A;  1ZM9 A;  5LMU J;  3DOM A;  1FF2 A;  4DBQ A;  1PC4 A;  3MTK A;  2XYP B;  3VZI A;  2HBY B;  1UVK A;  2U2F A;  2B4V A;  3DNC A;  4I2P B;  2F65 A;  2B5J B;  3M2V B;  5E3A A;  3UR3 C;  4LF9 F;  3ZXW A;  1EQM A;  1SIZ A;  2D3U A;  3I6P A;  4M5L A;  3ZZU A;  1VIS A;  5LM7 E;  1M0S A;  4QBU A;  2WON A;  2V9K A;  2DRB A;  4WPA A;  4Z37 A;  2LQJ A;  4U95 A;  1OQ3 A;  3AQO A;  3K5O A;  4NLT A;  2RE1 A;  1VC5 A;  2X3D A;  4HAC B;  4YY3 J;  2ZM6 J;  2R7O A;  4LBI A;  3WBZ A;  3PFO A;  2HWH A;  4ZHR A;  2B43 A;  2FJA B;  3R27 A;  2CQH A;  2ZZT A;  4OLO A;  4HHH A;  1MW7 A;  4F4K A;  2DHS A;  3RJM B;  1VQM S;  2FVS A;  3QGH A;  4LSN A;  1JLF A;  3DXB A;  1B70 B;  3M2R B;  4FDF A;  1JMT A;  1NND A;  5K9F A;  3W2W A;  3TUI C;  3HD1 A;  3V5R A;  3KFW X;  4PQU B;  2B4U A;  3KJN B;  4WU3 A;  2Y1J A;  1JWW A;  2V9W A;  3OL6 A;  1AW0 A;  2XNQ A;  3UN2 A;  4FVC A;  5KG3 A;  4MIA A;  4ED4 A;  1JKH A;  5LSL A;  3GG0 A;  1ZTT A;  3QRR A;  3H5S A;  2LEA A;  3KK2 A;  4RUH A;  4F4X A;  3KHH A;  1RZM A;  3G6E S;  2AJ2 A;  1EQ0 A;  3CC4 S;  4DXL A;  3G2X A;  2I9S A;  3ILJ A;  1YJV A;  2GW8 A;  2OPS B;  2VB6 A;  3ZTS A;  4JI4 F;  1UVN A;  2GQQ A;  1IWA A;  4LR7 A;  2D9O A;  9RUB A;  2UXB F;  1GX6 A;  2R7U A;  4DV4 J;  1IR0 A;  2LXF A;  3LOU A;  2V50 A;  4P2M A;  3UCU P;  3AB4 B;  2HNZ A;  2HQ3 A;  1U25 A;  1SPB P;  2B3T B;  2DNR A;  2C3U A;  2PA3 A;  2YNG A;  5ETS A;  2DGW A;  4HT7 A;  1LK7 A;  1MU2 B;  2CYY A;  4F3M A;  4ZCI A;  2YNF A;  2VFU A;  1S12 A;  4PWU A;  2QLW A;  3IFE A;  3FGV A;  2ZZN A;  1IJE B;  2VON A;  2IM2 A;  2MKC A;  1VYA A;  1UJ5 A;  2XWY A;  3BO4 A;  3PR5 B;  1DTQ A;  2YQ1 A;  3PHT A;  4LRC A;  3QRQ A;  3RRK A;  5KFG A;  1NKC A;  1APS A;  1X60 A;  2LDI A;  4DQI A;  4H4M B;  4QWB A;  2NR0 A;  1RT6 A;  1WAC A;  2DNK A;  5KFM A;  3T1Y J;  3ENQ A;  3JAM Y;  4YFU A;  2E1C A;  3HM9 A;  2HVI A;  2YQ0 A;  5IT0 A;  4RBT A;  5EDW A;  4ILM A;  4J90 A;  3DKD A;  4B9V A;  4M8L A;  3G6V A;  2OAU A;  1JIH A;  2M88 A;  5GAE U;  4WF9 Q;  3TUP A;  4LJM A;  2ATL A;  1LW2 A;  4USM A;  4FP9 A;  3TA0 A;  1UPP A;  1H7W A;  2WW8 A;  4OJ3 A;  1S97 A;  3U27 A;  2HW3 A;  1ZAV A;  3B8H A;  4I6A A;  4HTI A;  4LF4 F;  1VRT B;  3I5A A;  1S6Q B;  3G82 A;  3ZZY A;  1FJG J;  1HBU A;  4Y28 C;  2NQP A;  1U09 A;  3ISN D;  2CQ0 A; 
#chains in the Genus database with same CATH homology
 3W5Y A;  3W5X A;  3W8P A;  3W63 A;  3W65 A;  3BYR A;  2QFI A;  3W62 A;  3W61 A;  3W8G A;  3W66 A;  3H90 A;  3W64 A;  3W60 A;  3BYP A;  5HSP A;  3W5Z A;  2ZZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...