3H93A

Crystal structure of pseudomonas aeruginosa dsba
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
SNADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Characterization of the DsbA Oxidative Folding Catalyst from Pseudomonas aeruginosa Reveals a Highly Oxidizing Protein that Binds Small Molecules.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transcription regulator
total genus 60
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3h93A00
2R5GA 1I9DA 4F2IA 5G30A 5CNWA 3IXRA 5D93A 2V6KA 2EC4A 3HJOA 6GSWA 3A2VA 3LGCA 4L5LA 2B3SA 4QL7A 4XS4B 3FR3A 2M46A 3CRTA 4MZCA 5CAXA 1SD9A 2DIYA 3UVHA 5C04A 2FNOA 3WGXA 4DSRA 4GSTA 4ZL7A 3C1RA 1OC3A 1MEKA 1LJRA 4IELA 2I3YA 4ECJA 2VL2C 1GL8A 5ENUA 1FHEA 1E2YA 1NW2A 4F0BA 4FYCA 2C3NA 1GUMA 4G19A 4JRRA 4PQHA 3ZFLA 1UN2A 1B4PA 1NHOA 1BYEA 3H93A 5ECRB 2LV3A 2LRTA 3LFLA 1V98A 1YKCA 2H1BA 2XC2A 3KXOA 4DSQA 4HU7A 1SYXA 3WGEA 2PERA 2CVBA 2H66A 3TJJA 3GYKA 5ECOB 5D9XA 1K0NA 5GSTA 3A2XA 3ZLPA 2H75A 3HHVA 4NAXA 3E9JB 3S9FA 2L59A 3PH9A 1T4ZA 1EEJA 4LL1B 4MPFA 4FH8A 3C7MA 1GUHA 1H75A 1QK8A 2PN8A 1RK4A 1WE0A 1SU9A 3IAS2 2CVDA 1EWXA 4HDEA 1EP8A 5A5KA 3VI5A 1R7HA 5AISA 4HQZA 4IW9A 1U3AA 2H73A 2LJKA 2A2RA 4MF6A 1K0DA 5DAKA 1JLVA 3GFKA 3R2QA 1WWJA 1SK0A 4OD7A 4ZB9A 4V2LA 3IK7A 5G5EA 4ISDA 1GSFA 2OE3A 1NM3A 3A2WA 1GNWA 4XRAA 3IPZA 2CZ2A 4PQ1A 1LU4A 1EZKA 1KBNA 3LWAA 3KGKA 2P31A 2AUVA 1PMTA 2WDUA 1URMA 2F9SA 3GKNA 1T4YA 3J7Yk 4EVMA 2ZNMA 4KUNA 5IO0A 2QGVA 2H0HA 1PN9A 4HJMA 3IA1A 3BJ5A 4ZB6A 1SJIA 2JL4A 1JFUA 4ILFA 2C80A 3G7IA 2RM6A 3KZQA 1B9XC 1TK5B 3UIWA 2GTUA 4Q5FA 2YWNA 4TR1B 3LXZA 4LMWA 4Z7XA 1PKZA 5KN3A 1JZRA 3Q19A 5IMCA 4WBJA 5ID2B 4YQUA 5IMFA 2WJUA 4OFNA 3D22A 3ISOA 1OKTA 4K2DA 3NOFA 3UBKA 4ECBA 2WCIA 2PUKC 3RBTA 3TKPA 2ALBA 3ZVJA 1QGVA 3HCZA 1G6YA 3IHQA 4TW5A 3ZITA 4FYUA 2HSHA 1T1VA 2BMXA 4NV2A 4YQVA 4DSSA 2GSTA 2HSYA 2OE1A 1Z3EA 2MBSA 4I5QA 1ERVA 5IQYA 2LS5A 4PNGA 2H01A 2HRFA 3QAGA 2L6DA 1TKDB 1XWGA 3CYNA 5A4VA 2C0EA 4GF0A 3HVSA 1O7UA 2H1DA 1YY7A 2YWMA 2C0GA 2FUG2 3L9UA 4XCSA 1AQVA 1OC8A 4F82A 4GQCA 3RAZA 1FOVA 1V57A 1RW1A 3O3TA 3IOSA 3FZ4A 4MZWA 3HVVA 1R26A 4XS4A 2YN1A 3QCPA 3ERGA 4NXIA 2LEGA 4I2UA 5D9TA 1T8EB 2GS3A 1A8LA 5HR1A 4G9HA 5INYA 3DD3A 4EDYA 5AN1A 2GZYA 1GTBA 3LG6A 5ECSA 1KEBA 1B48A 1U3IA 1PSQA 4JZQA 1GSUA 3QAWA 2CQ9A 2LNTA 3TKSC 4HI7A 2VCWA 2NTOA 5JCWA 2V1MA 1ST9A 3RDWA 4O32A 2P0GA 4EDZA 1T3BA 2PWJA 2L6CA 2HYXA 2P5QA 3D0ZA 1M2BA 1K3LA 3E3EA 4V2NA 3VLNA 4V1Ag 2VD0A 4IVFA 1EV9A 1FG4A 2GQLA 1Y6EA 1ZCPA 4MCUA 3F4SA 1KNGA 5IM9A 5G5FA 5KN1A 1EP7A 3VURA 4GLTA 4ULXA 4ZBAA 2C3TA 1JZOA 2HNLA 5LNKe 1A2LA 2P5RA 3EVIA 1EV4A 5ELGA 4PXOA 3M9KA 4OFMA 4RUVA 2N5FA 2H6YA 3GL3A 3EWLA 1EGRA 1PRXA 3FZ5A 5CRHA 2B5YA 3HDCA 4JE1A 4MJCA 5JWRB 1EOHA 3LQ7A 2MMOA 2H6XA 5J4UA 3QPMA 2J9HA 3LYKA 3GTUB 3RHBA 1V2AA 17GSA 2RUEA 2LRNA 2D2ZA 2JSZA 3P90A 3BCKA 1K3YA 3HJPA 3DXBA 1EEMA 3FK8A 5J3RA 1M7TA 2NPBA 5HFIA 3HA9A 2FWEA 4JEDA 5CRDA 4EE0A 3VPTA 2I1UA 5ECNB 2IPAA 3L4NA 4POBA 3ZIVA 1H4OA 4ACSA 1FW1A 4LA1A 1A0FA 3VWVA 5IMDA 4IQ1A 4HOJA 1GSDA 16GSA 1F2EA 2FCHA 4Q5RA 1HNCA 2L57A 4JBBA 3PR8A 1WMJA 1B9YC 4TR1A 2HXKA 5J5NA 3EC3A 1XBSA 2DMLA 1TW9A 4POMA 4KAEA 5KEJA 1GTUA 14GSA 2YZUA 5ID2A 3WD6A 19GSA 2C3QA 5GSSA 1THXA 3ZZXA 5AIXA 3VWWA 1Z6NA 1XOBA 1O8WA 3NIVA 4KDUA 4NHZA 5HR2A 3FR6A 3EU3A 3PGTA 4J56E 4KGIA 2LUSA 1V58A 1M9BA 3UOMA 1O81A 1GNEA 4KB3A 4TRXA 4WEYA 1X9WB 2V6OA 4N0VA 2FA8A 3ME7A 3HZ4A 5G1LA 2R6KA 1CQGA 2LRCA 2I9HA 1A2MA 2CX3A 2RUFA 3ZRDA 4YH2A 1A24A 3EINA 3G7JA 3IV4A 1YJ6A 2HZFA 3HYPA 4MJBA 2JACA 3G7YA 3LORA 2CV4A 2IFQB 2A2SA 5ELAA 5ECLB 6GSSA 2JSYA 3DVWA 1E6BA 4XS6A 2YWOA 4X0XA 4YAVA 4CW9A 1SJZA 3GKMA 1TXXA 2DJ3A 2FLSA 2IIYA 2V41A 3GSSA 5EY6A 2DJ1A 2CT6A 3VWUA 2VUPA 2MBTA 1XFLA 4K7IA 5KN2A 1OE8A 5IOXA 1SENA 2YANA 5HQPA 1G0TA 5LD0A 2WZ9A 3M0FA 1OE7A 3DKSA 4V2MA 2EIRA 1PA3A 3TRPA 3GHAA 3CRUA 5ABRA 4EXJA 4LMVA 1MDIA 3ZMLA 4NMUA 4F0CA 3IE3A 4WR4A 1TTZA 3UL3A 2GLRA 4V1Ap 3KMNA 4L8EA 4I97A 1QUWA 2GQKA 1ML6A 2RIIA 1Z7PA 5IPGA 1O8XA 2GT6A 2H0GA 2TRCP 4HQSA 3KH9A 1BEDA 1XVQA 1Z5YE 4RQRA 5F0GA 2H0IA 2O85A 4E8HA 2H70A 1PGTA 1PD21 1PQNA 1VF4A 4MZBA 2H6ZA 3ERFA 3WYWA 4GQFA 4PUAA 1NHYA 1GP1A 4TOPA 4TXOB 3GX8A 4ID0A 3DMLA 2OBKA 2FWFA 5CYYA 3KH7A 5JCUA 2PVQA 1F3AA 2XPEA 2K9FA 1AXDA 1QMVA 4GWRA 1CQHA 1ACVA 3F0IA 4TR4A 1HNBA 2AAWA 1WRYA 3I9V2 3HXSA 2QC7A 3GN3A 4LLRA 3IBHA 1WOUA 3BOAA 3D6IA 4CHSA 3GTUA 1ZMAA 2B5EA 5LCZA 3PINA 2VO4A 1SKWB 3F4TA 3I43A 1WPIA 3VPQA 6GSTA 3EURA 5J9BA 3FYGA 4N30A 3A3TA 3N5OA 3KD0A 4MA9A 2OKAA 4ZL8A 3TRXA 1GUKA 2CZ3A 2X64A 2RLIA 3L9VA 3BBYA 1TRUA 2IMEA 3LEFA 1ERTA 4PX1A 3KEBA 2YCDA 4OMVA 5KN0A 5IOWA 3TKSE 3JCML 3UJ1A 1XPVA 4MMMA 3FHKA 1X9MB 3KMOA 4FYBA 1PL1A 2ZCTA 5DDLA 1JLWA 4MABA 1PX6A 6GSXA 3OR5A 1QQ2A 2YWIA 2CVKA 2OA7A 2DJKA 4D73B 1TP9A 4XRDA 3MWHA 1SKRB 4E8EA 5L71A 4DVCA 4XTSA 3DIEA 4TXVA 1IYIA 1IYHA 1JZWA 9GSSA 2BJXA 2LKUA 2VL3A 4EUYA 1OYJA 1TK8B 4KSMA 2CAIA 4AJ8A 1J9BA 2DBCA 1VGLA 2H1GA 2B5XA 4KCEA 3TJFA 2VL2A 5ECIB 3E0UA 2N5AA 1ZYQB 4KDYA 2IFQA 1OVNA 5CREA 2IMIA 2LNSA 5F8BA 2LQOA 2X8CA 3CSJA 4G10A 3AY8A 4QL9A 1K0AA 2DJ0A 1R5PA 5DQSA 1SYRA 1QXHA 3IRAA 2X99A 4IP1A 1J0FA 1VF1A 2ES7A 3NZNA 5DJLA 1C72A 1ERWA 1K0OA 3FZ9A 4HZ2A 2HI7A 2LSTA 1DE1A 3GKXA 3I69A 1M2AA 1ILOA 4ECIA 4I6XA 2CA8A 2Z9SA 1MDKA 3GNJA 5AGYA 3J7Yb 3QFAC 3RPPA 18GSA 1FB0A 3DRNA 4ZBDA 2YZHA 2B7KA 2FD3A 3GX0A 1TU8A 4L0WA 4MJAA 2JU5A 3VK9A 5F07A 2HZEB 1ZGNA 3H1NA 5EVOA 1N2AA 5A4UA 2OADA 2R4VA 2WGRA 4KDXA 2L5LA 1GSYA 5A4WA 1GWCA 2DJJA 3O76A 1GRXA 2L5OA 3IC4A 3F63A 2YV7A 2AHEA 3M9JA 1HQOA 2QKEA 4YQMA 4PNFA 4TXOA 2C1YA 4PURA 3CSIA 1UVZA 1YDKA 3DGQA 1DE2A 1DUGA 1MDJA 3DVXA 3HKRA 4XIHA 2GSRA 2WFCA 2GT5A 4HZ4A 2HLSA 1OC9B 4O5RA 4KE3A 4KSOA 2IMDA 2AJQB 4ZXGA 13GSA 1M2DA 4MF5A 4ZBBA 5F05A 1TJDA 2YJ7A 2XPDA 1V40A 1S3AA 5C00A 4KNDA 1PKWA 4MPGA 4GXZA 5IIZA 3TGZA 5JWOB 5CO3A 2KP1A 4I2TA 2VM2A 1GLQA 3ME8A 1F3BA 1TI3A 2FWHA 4OO4A 1FO5A 6GSVA 3CTFA 3V1WA 3ZYWA 5ECPB 3LYPA 4KA0A 2JZRA 4L5OA 1Q4JA 2H19A 4POLA 1G7EA 3N9JA 1PX7A 4MH3A 4TKYA 3D5JA 2FY6A 2FHEA 2J23A 1ZOFA 3P7XA 5G1KA 3ZVJD 1W89A 4MF7A 3MNGA 4OFTA 1YF1A 3ZREA 1FVJA 3QOUA 1TOFA 3GL5A 4POKA 5HR0A 1TU7A 3Q74A 5CP1A 3RPNA 5D9WA 1S3DA 1G7OA 3GIXA 1A23A 4HU9A 4HUAA 2HE3A 2JZTA 5H5RA 1R4WA 1SKSB 1XW5A 2F51A 1XIYA 4D73A 2H30A 1YEPA 2E0QA 2H71A 4MH2A 4ZB8A 1Z9HA 3FZAA 2DJ2A 3UARA 4MP4A 4AF2A 1JHBA 5G2ZA 5B6MA 1W4VA 5EL8A 2WS2A 4X1UA 3GSTA 3WT2A 4IJIA 5ECHB 1SJ6A 4BWSA 5IMZA 3VFIA 4F9ZA 3F3QA 4MDCA 1M9AA 3IAM2 3TOTA 4PGTA 4EL1A 2MMZA 3CXGA 3UEMA 1SL0B 2L4CA 3W8SA 3QR6A 3D21A 2DSAA 4TR0A 3BD2A 2I81A 4ZIJA 1J08A 4KX4A 2PBJA 3TKSA 3EU4A 3KP9A 3TJBA 1X9SB 1I5GA 3WGDA 4K8MA 3CBUA 2O89A 5E59A 4ZILA 3KTLA 2R37A 1X5CA 2DC5A 2YP6A 2OJLA 2R3XA 3D4TA 3VI7A 3M8NA 5DALB 3LJRA 2E7PA 3US3A 4PQIA 1U88A 3KTBA 3F4RA 5H5SA 3C8EA 1AIUA 4IHUA 2H74A 4BVXA 2C0DA 1F9MA 3QFBC 1WJKA 2MMAA 2VCTA 2KHPA 2FWGA 2PGTA 2YJHA 5JCGA 4O7HA 5IMAA 1XWKA 4NPBA 1XVWA 1DSBA 2DMMA 2IJYA 22GSA 4CDOA 2A4VA 1USBA 2HZEA 1AQWA 4IP6A 2MYGA 4TN8A 3TKQA 1BG5A 1GTIA 2VIMA 1R5AA 2GSQA 4AGSA 3DYRA 2IL3A 2REMA 4OCEA 2VAFA 5FHIA 2VD1A 4WR5A 3ZMKA 2F3MA 3SBCA 1T7PB 1A8YA 5CRGA 1XWAA 2B7JA 4GRFA 6GSYA 1F6MC 1AW9A 2VOCA 2ON5A 3EMXA 4RI7A 3APSA 3C71A 3ZTLA 2I4AA 1K0MA 4TVEA 2IMFA 1YZXA 1OC9A 2MZCA 3GURA 3L0HA 2CX4A 1M99A 2C0FA 1FB6A 1HD2A 3APOA 3UAPA 2KLXA 5ECQB 3GA4A 4EKZA 5DJMA 5DBQA 3SWLA 1GLPA 10GSA 5B6NA 4JR4A 3HVXA 2WB9A 3I6AA 3TUEA 1O73A 2PU9C 2B1LA 1A0RP 2HT9A 2K18A 4KW6A 2E2GA 1XW9A 4L0UA 4WBRD 1TRWA 3FKFA 1BAYA 1WP0A 2EIQA 5B8BA 3GMFA 4EC0A 2PPTA 4HEA2 5DCGA 2MMNA 2C4JA 2OE0A 1XOAA 3HJMA 2E2MA 4NHWA 4KH7A 3CTGA 4IGJA 1AQXA 1MD3A 2WRTA 20GSA 3FRCA 3W6GA 2CAQA 3M1GA 1SD8A 5HFKA 5HFGA 3MAKA 2ZUPA 2AB6A 1QFNA 4WKWA 4K9ZA 1GH2A 1M0UA 1B8XA 1AC1A 3C1SA 1KTEA 1G6WA 1MD4A 4MJEA 1ZZYA 2LJRA 3QD9A 4WXTA 5IO2A 3CSHA 3QMXA 5B8AA 1OAZA 1XCCA 4EF0A 1XW6A 3UVTA 2YOIA 3D4MA 4WF4A 4YAPA 4F03A 4IKHA 1B4QA 4K0NA 4OO5A 1SK1A 2V32A 5COHA 1TRVA 1TDIA 2FA4A 1Z7RA 2VLVA 1ON4A 4BPYA 1XWCA 3VWXA 5ECMB 4WETA 5HR3A 4KCAA 1T00A 1SL2B 2WULA 3Q18A 2F8AA 1FAAA 4NWYA 5IPHA 2F8FA 2NVLA 2HFDA 1EOGA 2OACA 1FVKA 4AJ7A 2XBQA 1GULA 4JR6A 3QDNA 1BJXA 3LSZA 1AUCA 3U5RE 5D73A 5DALA 5DQYA 2R2JA 3O6TA 1YEXA 3ZIJA 1EGOA 5F06A 1TK0B 3ED3A 2VCZA 1YKAA 3F9UA 2JZSA 1K3OA 5GAPD 2XHFA 3L78A 3GKKA 3C73A 4AJ6A 2H76A 2EIOA 2H72A 2PMTA 4OCFA 4ML6A 4G2EA 2GVPA 1DBYA 1X5EA 5FWGA 4H86A 2IWTA 2O7KA 2H1AA 3KP8A 3MSZA 7GSSA 5JWQB 4Q5QA 4P3YB 1ZL9A 2LTKA 1OKDA 4OWYA 4WF5A 3HZ8A 2LJAA 3FW2A 2KP2A 1VRSD 5IMVA 2VLTA 2X8HA 3RHCA 2YPMA 4BL7A 3IDVA 4RI6A 3KJYA 2M80A 3W8JA 4RQXA 1GTAA 3TOUA 3FY7A 2V2GA 3F3RA 3H79A 5AIVA 2GZPA 2N5BA 3DEXA 4BA7A 2IMKA 1X5DA 5J41A 4IBPA 4X43A 2NDOA 2KOKA 2QSIA 1PL2A 1HNAA 4GTUA 2VCXA 2O87A 1Y25A 2TRXA 3KCMA 2TIRA 3FR9A 4FO5A 3K8NA 1RQMA 3KIJA 4K6XA 4J2FA 2VM1A 3A5WA 2H8LA 1TI1A 1S3CA 1JZDA 5B7CA 4BVYA 1X0RA 5D8IA 4DEJA 1VF3A 1UA5A 3Q6OA 3GH6A 2KUCA 1WIKA 4PUFC 3F6DA 4GCIA 1ERUA 2XBIA 2B1KA 3GH9A 3TB2A 8GSSA 4JU5A 3WT1A 2JADA 4K0GA 1O85A 1ABAA 3LXTA 2YV9A 1U87A 4IN0A 3TCOA 3TJKA 2BTOT 4J57E 4IJ3A 1XWBA 4Q5NA 2GZZA 3KM6A 4N0ZA 1BQ7A 4ZL9A 3F6FA 3UBLA 5D96A 4HJ2A 4K7NA 2DLXA 5DAKB 1VF2A 2VL9A 4MK3A 1F37A 3QAVA 2K6VA 4GSNA 2G2QA 1MTCA 3HY2A 3H8QA 4XHMA 1BX9A 4N11A 1K0BA 2IN3A 2VLUA 1O6JA 1Z6MA 3GUSA 2RM5A 4NV5A 1U6TA 1K0CA 2ON7A 2C8UA 1Q98A 2G0FA 1XXUA 5DVBA 1AAZA 1TRSA 2AV4A 4BWQA 5G31A 4IS0A 2GSSA 2K8SA 2X8GA 1A2JA 4K7OA 2GGTA 5EPFA 4O92A 1GSEA 2VCQA 3G9BA 2OBIA 4XS1A 2FGXA 1NSWA 3F8UA 3MDKA 3HD5A 5H5QA 2VCVA 2B6MA 3IK9A 3UMAA 1XZOA 3IR4A 4MLYA 1V9WA 11GSA 4QQ7A 2GQMA 3ZFBA 3EMPA 4TR3A 3H4KA 1SL1B 1YF0A 5DCHA 6GSUA 4K1FA 2AYTA 4ECCA 1GSQA 2M72A 2DIZA 5E4WA 3FEUA 5CRWA 4LL4B 3GV1A 1SK2A 3P8WA 2LQQA 2GDRA 3APQA 1LBKA 2HRNA 3DWVA 1GSSA 3L9SA 3EYTA 1HYUA 3P2AA 5D9VA 4HS1A 3TRQA 3GRXA 1YQ1A 4I8BA 1THOA 4FIWA 4N10A 1N8JA 12GSA 3CMIA 4DSSB 4EO3A 2PVOC 3ERWA 3TKRA 5FT3A 3U6VA 4IQAA 1ZYEA 4ML1A 3EE2A 3ZL5A 3TDGA 5GAND 2L4QA 3TJGA 5J9CA 3M3MA 2YNXA 4GSSA 2NBSA 2K8VA 3BCIA 2O8VB 1UC7A 5ECKB 5GZZB
chains in the Genus database with same CATH superfamily
2R5GA 4O5QA 1I9DA 4F2IA 5G30A 5CNWA 3IXRA 5D93A 2V6KA 2EC4A 3HJOA 6GSWA 3A2VA 3LGCA 4L5LA 2B3SA 4QL7A 4XS4B 3FR3A 2M46A 3CRTA 4MZCA 5CAXA 1SD9A 2DIYA 3UVHA 5C04A 2FNOA 3WGXA 4DSRA 4GSTA 4ZL7A 3C1RA 1OC3A 1MEKA 1LJRA 4IELA 2I3YA 4ECJA 2VL2C 1GL8A 5ENUA 1FHEA 1E2YA 1NW2A 4F0BA 4FYCA 2C3NA 1GUMA 4G19A 4JRRA 4PQHA 3ZFLA 1UN2A 1B4PA 1XG8A 1NHOA 1BYEA 3H93A 5ECRB 2LV3A 2LRTA 3LFLA 1V98A 1YKCA 2H1BA 2XC2A 3KXOA 4DSQA 4HU7A 1SYXA 3WGEA 2PERA 4G0LA 2CVBA 2H66A 3TJJA 3GYKA 5ECOB 5D9XA 1K0NA 5GSTA 2A4HA 3A2XA 3ZLPA 2H75A 3HHVA 3MIXA 4NAXA 3E9JB 3S9FA 2L59A 3PH9A 1T4ZA 1EEJA 4LL1B 4MPFA 4FH8A 3C7MA 1GUHA 1H75A 1QK8A 2PN8A 1RK4A 1WE0A 1SU9A 3IAS2 2CVDA 1EWXA 4HDEA 1EP8A 5A5KA 3VI5A 1R7HA 2HRAA 5AISA 4HQZA 4IW9A 1U3AA 2H73A 2LJKA 2A2RA 4MF6A 1K0DA 5DAKA 1JLVA 3GFKA 3R2QA 1WWJA 2HRKA 1SK0A 4OD7A 4ZB9A 4V2LA 3IK7A 5G5EA 4ISDA 1GSFA 2OE3A 1NM3A 3A2WA 1GNWA 1ZYNA 4XRAA 3IPZA 2CZ2A 4PQ1A 1LU4A 1EZKA 1KBNA 3LWAA 3KGKA 2P31A 2AUVA 1PMTA 2WDUA 1URMA 2F9SA 3GKNA 1T4YA 3J7Yk 4EVMA 2ZNMA 4KUNA 5IO0A 2QGVA 2H0HA 1PN9A 4HJMA 3IA1A 3BJ5A 4ZB6A 1SJIA 2JL4A 1JFUA 4ILFA 2C80A 3G7IA 2RM6A 3KZQA 1B9XC 1TK5B 3UIWA 2GTUA 4Q5FA 2YWNA 4TR1B 3LXZA 4LMWA 4Z7XA 1PKZA 5KN3A 1JZRA 3Q19A 5IMCA 4WBJA 5ID2B 4YQUA 5IMFA 2WJUA 4OFNA 3D22A 3ISOA 1OKTA 4K2DA 3NOFA 3UBKA 4ECBA 2WCIA 2PUKC 3RBTA 3TKPA 2ALBA 3ZVJA 1QGVA 3HCZA 1G6YA 3IHQA 4TW5A 3ZITA 4FYUA 2HSHA 1T1VA 2BMXA 4NV2A 4YQVA 4DSSA 2GSTA 2HSYA 4ICYA 2OE1A 1Z3EA 2MBSA 4I5QA 1ERVA 5IQYA 2LS5A 4PNGA 2H01A 2HRFA 3QAGA 2L6DA 1TKDB 1XWGA 3CYNA 5A4VA 2R0GA 2C0EA 4GF0A 3HVSA 1O7UA 2H1DA 1YY7A 2YWMA 2C0GA 2FUG2 3L9UA 4XCSA 1AQVA 1OC8A 4F82A 4GQCA 3RAZA 1FOVA 1V57A 1RW1A 3O3TA 3IOSA 3FZ4A 4MZWA 3HVVA 1R26A 4XS4A 4EIQA 2YN1A 3QCPA 3ERGA 4NXIA 2LEGA 4I2UA 5D9TA 1T8EB 2GS3A 1A8LA 5HR1A 4G9HA 5INYA 3DD3A 4EDYA 5AN1A 2GZYA 2R0CA 1GTBA 3LG6A 5ECSA 1KEBA 1B48A 1U3IA 1PSQA 4JZQA 1GSUA 3QAWA 2CQ9A 2LNTA 3TKSC 4HI7A 2VCWA 2NTOA 5JCWA 2V1MA 1ST9A 3RDWA 4O32A 2P0GA 4EDZA 1T3BA 2PWJA 2L6CA 2HYXA 2P5QA 3D0ZA 1M2BA 1K3LA 3E3EA 4V2NA 3VLNA 4V1Ag 2VD0A 4IVFA 1EV9A 1FG4A 4FQUA 2GQLA 1Y6EA 1ZCPA 4MCUA 3F4SA 1KNGA 5IM9A 5G5FA 5KN1A 1EP7A 3VURA 4GLTA 4ULXA 4ZBAA 2C3TA 1JZOA 2HNLA 5LNKe 1A2LA 2P5RA 3EVIA 1EV4A 5ELGA 4PXOA 3M9KA 4OFMA 4RUVA 2N5FA 2H6YA 3GL3A 3EWLA 1EGRA 1PRXA 3FZ5A 5CRHA 2B5YA 3HDCA 4JE1A 4MJCA 5JWRB 1EOHA 3LQ7A 4CY6A 2MMOA 2H6XA 5J4UA 3QPMA 2J9HA 3LYKA 3GTUB 3RHBA 1V2AA 17GSA 2RUEA 2LRNA 2D2ZA 2JSZA 3P90A 3BCKA 1K3YA 3HJPA 4CY8A 3DXBA 1EEMA 3FK8A 5J3RA 1M7TA 2NPBA 5HFIA 4Z2TA 3HA9A 2FWEA 4JEDA 5CRDA 4EE0A 3VPTA 2I1UA 5ECNB 2IPAA 3L4NA 4POBA 3ZIVA 1H4OA 4ACSA 1FW1A 4LA1A 1A0FA 3VWVA 5IMDA 4IQ1A 4HOJA 1GSDA 16GSA 1F2EA 2FCHA 4Q5RA 1HNCA 2L57A 4JBBA 3PR8A 1WMJA 1B9YC 4TR1A 2HXKA 5J5NA 3EC3A 1XBSA 2DMLA 1TW9A 4POMA 4KAEA 5KEJA 1GTUA 14GSA 2YZUA 5ID2A 3WD6A 19GSA 2C3QA 5GSSA 1THXA 3ZZXA 5AIXA 3VWWA 1Z6NA 1XOBA 1O8WA 3NIVA 4KDUA 4NHZA 5HR2A 3FR6A 3EU3A 3PGTA 4J56E 4KGIA 2LUSA 1V58A 1M9BA 3UOMA 1O81A 1GNEA 4KB3A 4TRXA 4WEYA 1X9WB 2V6OA 4N0VA 2FA8A 3ME7A 3HZ4A 5G1LA 2R6KA 1CQGA 2LRCA 2I9HA 1A2MA 2CX3A 5BMUA 2RUFA 3ZRDA 4YH2A 1A24A 3EINA 3G7JA 3IV4A 1YJ6A 2HZFA 3HYPA 4MJBA 2JACA 3G7YA 3LORA 2CV4A 2IFQB 2A2SA 5ELAA 5ECLB 6GSSA 2JSYA 3DVWA 1E6BA 4XS6A 2YWOA 4X0XA 4YAVA 4CW9A 1SJZA 3GKMA 1TXXA 3LW9A 2DJ3A 2FLSA 2IIYA 2V41A 3GSSA 5EY6A 2DJ1A 2A2PA 2CT6A 3VWUA 2VUPA 2MBTA 1XFLA 4K7IA 5KN2A 1OE8A 5IOXA 1SENA 2YANA 5HQPA 1G0TA 5LD0A 2WZ9A 3M0FA 1OE7A 3DKSA 4V2MA 2EIRA 1PA3A 3TRPA 3GHAA 3CRUA 5ABRA 4K5RA 4EXJA 4LMVA 1MDIA 3ZMLA 4NMUA 4F0CA 3IE3A 4WR4A 1TTZA 3UL3A 2GLRA 4V1Ap 3KMNA 4L8EA 4I97A 1QUWA 2GQKA 1ML6A 2RIIA 1Z7PA 5IPGA 1O8XA 2GT6A 2H0GA 2TRCP 4HQSA 3KH9A 1BEDA 1XVQA 1Z5YE 4RQRA 5F0GA 2H0IA 2O85A 4E8HA 2H70A 1PGTA 1PD21 1PQNA 1VF4A 4MZBA 2H6ZA 3ERFA 3WYWA 4GQFA 4PUAA 1NHYA 1GP1A 4TOPA 4TXOB 3GX8A 4ID0A 3DMLA 2OBKA 2FWFA 5CYYA 3KH7A 5JCUA 2PVQA 1F3AA 2XPEA 2K9FA 1AXDA 1QMVA 4GWRA 1CQHA 1ACVA 3F0IA 4TR4A 1HNBA 2AAWA 1WRYA 3I9V2 3HXSA 2QC7A 3GN3A 4LLRA 3IBHA 1WOUA 3BOAA 3D6IA 4CHSA 3GTUA 1ZMAA 2B5EA 5LCZA 3PINA 2VO4A 1SKWB 3F4TA 3I43A 1WPIA 3VPQA 4KF9A 6GSTA 3EURA 5J9BA 3FYGA 4N30A 3A3TA 3N5OA 3KD0A 4MA9A 2OKAA 4ZL8A 3TRXA 1GUKA 2CZ3A 2X64A 2RLIA 3L9VA 3BBYA 1TRUA 2IMEA 3LEFA 1ERTA 4PX1A 3KEBA 2YCDA 4OMVA 5KN0A 1PN0A 5IOWA 3TKSE 3JCML 3UJ1A 1XPVA 4MMMA 3FHKA 1X9MB 3KMOA 4FYBA 1PL1A 2ZCTA 5DDLA 1JLWA 4MABA 1PX6A 6GSXA 3OR5A 1QQ2A 2YWIA 2CVKA 2OA7A 2DJKA 4D73B 1TP9A 4XRDA 3MWHA 1SKRB 4E8EA 5L71A 4DVCA 4XTSA 1PFOA 3DIEA 4TXVA 1IYIA 1IYHA 1JZWA 9GSSA 2BJXA 2LKUA 2VL3A 4EUYA 1OYJA 1TK8B 4KSMA 2CAIA 4AJ8A 1J9BA 2DBCA 1VGLA 2H1GA 2B5XA 4KCEA 2QA2A 3TJFA 2VL2A 5ECIB 3E0UA 2N5AA 1ZYQB 4KDYA 2IFQA 1OVNA 5CREA 2IMIA 2LNSA 5F8BA 2LQOA 2X8CA 3CSJA 4G10A 3AY8A 4QL9A 1K0AA 4A5PA 2DJ0A 1R5PA 4HSCX 5DQSA 1SYRA 1QXHA 3IRAA 2X99A 4IP1A 1J0FA 1VF1A 2ES7A 3NZNA 5DJLA 1C72A 1ERWA 1K0OA 3FZ9A 4HZ2A 2HI7A 2LSTA 1DE1A 3GKXA 3I69A 1M2AA 1ILOA 4BVXB 4ECIA 4I6XA 2CA8A 2Z9SA 1MDKA 3GNJA 5AGYA 3J7Yb 3QFAC 3RPPA 18GSA 1FB0A 3DRNA 4ZBDA 2YZHA 2B7KA 5BRTA 2FD3A 3GX0A 1TU8A 4L0WA 4MJAA 2JU5A 3VK9A 5F07A 2HZEB 1ZGNA 3H1NA 5EVOA 1N2AA 5A4UA 2OADA 2R4VA 2WGRA 4KDXA 2L5LA 1GSYA 5A4WA 1GWCA 2DJJA 3O76A 1GRXA 2L5OA 3IC4A 3F63A 2YV7A 2AHEA 3M9JA 1HQOA 2QKEA 4YQMA 4PNFA 4TXOA 2C1YA 4PURA 3CSIA 1UVZA 1YDKA 3DGQA 1DE2A 1DUGA 4YKFA 1MDJA 3DVXA 3HKRA 4XIHA 2GSRA 2WFCA 2GT5A 4HZ4A 2HLSA 1OC9B 4O5RA 4KE3A 4KSOA 2IMDA 2AJQB 4ZXGA 13GSA 1M2DA 4MF5A 4ZBBA 5F05A 1TJDA 2YJ7A 2XPDA 1V40A 1S3AA 5C00A 4KNDA 1PKWA 4MPGA 4GXZA 5IIZA 3TGZA 5JWOB 5CO3A 2KP1A 4I2TA 2VM2A 1GLQA 3ME8A 1F3BA 1TI3A 2FWHA 4OO4A 1FO5A 6GSVA 3CTFA 3V1WA 3ZYWA 5ECPB 3LYPA 4KA0A 2JZRA 4L5OA 1Q4JA 2H19A 4POLA 5KOWA 1G7EA 3N9JA 1PX7A 4MH3A 4TKYA 4G0KA 3D5JA 2FY6A 2FHEA 2J23A 1ZOFA 3P7XA 5G1KA 3ZVJD 1W89A 4MF7A 3MNGA 4OFTA 1YF1A 3ZREA 1FVJA 3QOUA 1TOFA 3GL5A 3HVNA 4POKA 5HR0A 1TU7A 3Q74A 5CP1A 3RPNA 5D9WA 1S3DA 1G7OA 3GIXA 1A23A 4HU9A 1ZYPA 4HUAA 2HE3A 2JZTA 5H5RA 1R4WA 1SKSB 1XW5A 2F51A 1XIYA 4D73A 2H30A 1YEPA 2E0QA 2H71A 4MH2A 4ZB8A 1Z9HA 3FZAA 2DJ2A 3UARA 4MP4A 4AF2A 1JHBA 5G2ZA 5B6MA 1W4VA 5EL8A 2WS2A 4X1UA 3GSTA 3WT2A 4IJIA 5ECHB 1SJ6A 4BWSA 5IMZA 3VFIA 4F9ZA 3F3QA 4MDCA 1M9AA 3IAM2 3TOTA 4PGTA 4EL1A 2MMZA 3CXGA 3UEMA 1SL0B 2L4CA 3W8SA 3QR6A 3D21A 2DSAA 4TR0A 3BD2A 2I81A 4ZIJA 1J08A 4KX4A 2PBJA 3TKSA 3EU4A 3KP9A 3TJBA 1X9SB 1I5GA 3WGDA 4K8MA 3CBUA 2O89A 5E59A 4ZILA 3EPTA 3KTLA 2R37A 1X5CA 2DC5A 2YP6A 2OJLA 2R3XA 3D4TA 3VI7A 3M8NA 5DALB 3LJRA 2E7PA 3US3A 4PQIA 1U88A 3KTBA 3F4RA 5H5SA 3C8EA 1AIUA 4IHUA 2H74A 4BVXA 2C0DA 1F9MA 3QFBC 1WJKA 2MMAA 2VCTA 2KHPA 2FWGA 2PGTA 2YJHA 5JCGA 4O7HA 5IMAA 1XWKA 4NPBA 1XVWA 1DSBA 2DMMA 2IJYA 22GSA 4CDOA 2A4VA 1USBA 2HZEA 1AQWA 3PPUA 4IP6A 2MYGA 4TN8A 3TKQA 1BG5A 1GTIA 2VIMA 1R5AA 2GSQA 4AGSA 3DYRA 2IL3A 2REMA 4OCEA 4K5SA 2VAFA 5FHIA 4BL7B 2VD1A 4WR5A 3ZMKA 2F3MA 3SBCA 1T7PB 1A8YA 5CRGA 1XWAA 2B7JA 4GRFA 2R0PA 6GSYA 1F6MC 1AW9A 2VOCA 2ON5A 3EMXA 4RI7A 3APSA 3C71A 3ZTLA 2I4AA 4Z2UA 1K0MA 4TVEA 2IMFA 1YZXA 1OC9A 2MZCA 3GURA 3L0HA 2CX4A 1M99A 2C0FA 1FB6A 1HD2A 3APOA 3UAPA 2KLXA 5ECQB 3GA4A 4EKZA 5DJMA 2QA1A 5DBQA 3SWLA 1GLPA 10GSA 5B6NA 4JR4A 3HVXA 2WB9A 3I6AA 3TUEA 1O73A 2PU9C 2B1LA 1A0RP 4BVYB 2HT9A 2K18A 4KW6A 2E2GA 1XW9A 4L0UA 4WBRD 1TRWA 3FKFA 1BAYA 1WP0A 2EIQA 5B8BA 3GMFA 4EC0A 2PPTA 4HEA2 5DCGA 2MMNA 2C4JA 2OE0A 1XOAA 3HJMA 2E2MA 4NHWA 4KH7A 3CTGA 4IGJA 1AQXA 1MD3A 2WRTA 20GSA 3FRCA 3W6GA 2CAQA 3M1GA 1SD8A 5HFKA 5HFGA 3MAKA 2ZUPA 2HSMA 2AB6A 1QFNA 4WKWA 4K9ZA 1GH2A 1M0UA 1B8XA 1AC1A 3C1SA 1KTEA 1G6WA 1MD4A 4MJEA 1ZZYA 2LJRA 3QD9A 4WXTA 4PTSA 5IO2A 3CSHA 3QMXA 5B8AA 1OAZA 2UZ8A 1XCCA 3IC8A 4EF0A 1XW6A 3UVTA 2YOIA 3D4MA 4WF4A 4YAPA 4F03A 4IKHA 1B4QA 4K0NA 4OO5A 1SK1A 2V32A 5COHA 1TRVA 1TDIA 2FA4A 4O5UA 1Z7RA 2VLVA 1ON4A 4BPYA 1XWCA 3VWXA 5ECMB 4WETA 5HR3A 2X49A 4KCAA 1T00A 1SL2B 2WULA 3Q18A 2X4AA 2F8AA 1FAAA 4NWYA 5IPHA 2F8FA 2NVLA 2HFDA 1EOGA 3MYDA 2OACA 3CQFA 1FVKA 4AJ7A 2XBQA 1GULA 4JR6A 3QDNA 1BJXA 3LSZA 1AUCA 3U5RE 5D73A 5DALA 5DQYA 1M3IA 2R2JA 3O6TA 1YEXA 3ZIJA 1EGOA 5F06A 1TK0B 3ED3A 2VCZA 1YKAA 3F9UA 2JZSA 1K3OA 5GAPD 4YKGA 2XHFA 3L78A 3GKKA 3C73A 4AJ6A 2H76A 2EIOA 2H72A 2PMTA 4OCFA 4ML6A 4G2EA 2GVPA 1DBYA 1X5EA 5FWGA 4H86A 2IWTA 2O7KA 2H1AA 3KP8A 3MSZA 7GSSA 5JWQB 4Q5QA 4P3YB 1ZL9A 2LTKA 1OKDA 4OWYA 4WF5A 3HZ8A 2LJAA 3FW2A 2KP2A 1VRSD 4EIPA 5IMVA 2VLTA 2X8HA 3RHCA 2YPMA 4BL7A 3IDVA 1FOHA 4RI6A 3KJYA 2M80A 3W8JA 4RQXA 1GTAA 3TOUA 3FY7A 2V2GA 3F3RA 3H79A 5AIVA 2GZPA 2N5BA 3DEXA 4BA7A 2IMKA 1X5DA 5J41A 4IBPA 4X43A 2NDOA 2KOKA 2QSIA 1PL2A 1HNAA 3IHGA 4GTUA 2VCXA 2O87A 1Y25A 2TRXA 3KCMA 2TIRA 3FR9A 4FO5A 3K8NA 1RQMA 3KIJA 4K6XA 1M3JA 4J2FA 2VM1A 3A5WA 2H8LA 4USSA 1TI1A 1S3CA 1JZDA 5B7CA 4BVYA 1X0RA 5D8IA 4DEJA 1VF3A 1UA5A 3Q6OA 3GH6A 2KUCA 1WIKA 4PUFC 2DKHA 3F6DA 4GCIA 1ERUA 2XBIA 2B1KA 3GH9A 3TB2A 8GSSA 4JU5A 3WT1A 2JADA 4K0GA 1O85A 1ABAA 3LXTA 2YV9A 1U87A 4IN0A 3TCOA 3TJKA 2BTOT 4J57E 4IJ3A 1XWBA 4Q5NA 4Z2RA 2GZZA 3KM6A 4N0ZA 1BQ7A 4ZL9A 3F6FA 3UBLA 5D96A 4HJ2A 4K7NA 2DLXA 5DAKB 1VF2A 2VL9A 4MK3A 1F37A 3QAVA 2K6VA 4GSNA 2G2QA 1MTCA 3HY2A 3H8QA 4XHMA 1BX9A 4N11A 1K0BA 3A5IA 2IN3A 2VLUA 1O6JA 1Z6MA 3GUSA 2RM5A 4NV5A 1U6TA 2DKIA 1K0CA 2ON7A 2C8UA 1Q98A 2G0FA 1XXUA 5DVBA 1AAZA 1TRSA 4G0IA 2AV4A 4BWQA 4X4JA 4MNNA 5G31A 4IS0A 2GSSA 2K8SA 2X8GA 1A2JA 4K7OA 2GGTA 5EPFA 4O92A 1GSEA 2VCQA 3G9BA 2OBIA 4XS1A 2FGXA 3R3EA 1NSWA 3F8UA 3MDKA 3HD5A 5H5QA 2VCVA 2B6MA 3IK9A 3UMAA 1XZOA 3IR4A 4MLYA 1V9WA 11GSA 4QQ7A 2GQMA 3ZFBA 3EMPA 4TR3A 3H4KA 1SL1B 1YF0A 5DCHA 6GSUA 4K1FA 5KOXA 2AYTA 4K2XA 4ECCA 1GSQA 2M72A 2DIZA 5E4WA 3FEUA 5CRWA 4LL4B 3GV1A 1SK2A 3P8WA 2LQQA 2GDRA 3APQA 1LBKA 2HRNA 3DWVA 1GSSA 3L9SA 3EYTA 1HYUA 3P2AA 5D9VA 4HS1A 3TRQA 3GRXA 1YQ1A 4I8BA 1THOA 4FIWA 4N10A 1N8JA 12GSA 3CMIA 4DSSB 4EO3A 4BIKA 2PVOC 3ERWA 3TKRA 5FT3A 3U6VA 4IQAA 1ZYEA 1S3RA 4ML1A 3EE2A 3ZL5A 3TDGA 5GAND 2L4QA 3TJGA 5J9CA 3M3MA 2YNXA 4GSSA 2NBSA 3FMWA 2K8VA 3BCIA 2O8VB 1UC7A 5ECKB 5GZZB
chains in the Genus database with same CATH topology
2R5GA 4O5QA 1I9DA 4F2IA 5G30A 5CNWA 3IXRA 5D93A 2V6KA 2EC4A 3HJOA 6GSWA 3A2VA 3LGCA 4L5LA 2B3SA 4QL7A 4XS4B 3FR3A 2M46A 3CRTA 4MZCA 5CAXA 1SD9A 2DIYA 3UVHA 5C04A 2FNOA 3WGXA 4DSRA 4GSTA 4ZL7A 3C1RA 1OC3A 1MEKA 1LJRA 4IELA 2I3YA 4ECJA 2VL2C 1GL8A 5ENUA 1FHEA 1E2YA 1NW2A 4F0BA 4FYCA 2C3NA 1GUMA 4G19A 4JRRA 4PQHA 3ZFLA 1UN2A 1B4PA 1NHOA 1BYEA 3H93A 5ECRB 2LV3A 2LRTA 3LFLA 1V98A 1YKCA 2H1BA 2XC2A 3KXOA 4DSQA 4HU7A 1SYXA 3WGEA 2PERA 4G0LA 2CVBA 2H66A 3TJJA 3GYKA 5ECOB 5D9XA 1K0NA 5GSTA 2A4HA 3A2XA 3ZLPA 2H75A 3HHVA 3MIXA 4NAXA 3E9JB 3S9FA 2L59A 3PH9A 1T4ZA 1EEJA 4LL1B 4MPFA 4FH8A 3C7MA 1GUHA 1H75A 1QK8A 2PN8A 1RK4A 1WE0A 1SU9A 3IAS2 2CVDA 1EWXA 4HDEA 1EP8A 5A5KA 3VI5A 1R7HA 2HRAA 5AISA 4HQZA 4IW9A 1U3AA 2H73A 2LJKA 2A2RA 4MF6A 1K0DA 5DAKA 1JLVA 3GFKA 3R2QA 1WWJA 2HRKA 1SK0A 4OD7A 4ZB9A 4V2LA 3IK7A 5G5EA 4ISDA 1GSFA 2OE3A 1NM3A 3A2WA 1GNWA 1ZYNA 4XRAA 3IPZA 2CZ2A 4PQ1A 1LU4A 1EZKA 1KBNA 3LWAA 3KGKA 2P31A 2AUVA 1PMTA 2WDUA 1URMA 2F9SA 3GKNA 1T4YA 3J7Yk 4EVMA 2ZNMA 4KUNA 5IO0A 2QGVA 2H0HA 1PN9A 4HJMA 3IA1A 3BJ5A 4ZB6A 1SJIA 2JL4A 1JFUA 4ILFA 2C80A 3G7IA 2RM6A 3KZQA 1B9XC 1TK5B 3UIWA 2GTUA 4Q5FA 2YWNA 4TR1B 3LXZA 4LMWA 4Z7XA 1PKZA 5KN3A 1JZRA 3Q19A 5IMCA 4WBJA 5ID2B 4YQUA 5IMFA 2WJUA 4OFNA 3D22A 3ISOA 1OKTA 4K2DA 3NOFA 3UBKA 4ECBA 2WCIA 2PUKC 3RBTA 3TKPA 2ALBA 3ZVJA 1QGVA 3HCZA 1G6YA 3IHQA 4TW5A 3ZITA 4FYUA 2HSHA 1T1VA 2BMXA 4NV2A 4YQVA 4DSSA 2GSTA 2HSYA 4ICYA 2OE1A 1Z3EA 2MBSA 4I5QA 1ERVA 5IQYA 2LS5A 4PNGA 2H01A 2HRFA 3QAGA 2L6DA 1TKDB 1XWGA 3CYNA 5A4VA 2R0GA 2C0EA 4GF0A 3HVSA 1O7UA 2H1DA 1YY7A 2YWMA 2C0GA 2FUG2 3L9UA 4XCSA 1AQVA 1OC8A 4F82A 4GQCA 3RAZA 1FOVA 1V57A 1RW1A 3O3TA 3IOSA 3FZ4A 4MZWA 3HVVA 1R26A 4XS4A 4EIQA 2YN1A 3QCPA 3ERGA 4NXIA 2LEGA 4I2UA 5D9TA 1T8EB 2GS3A 1A8LA 5HR1A 4G9HA 5INYA 3DD3A 4EDYA 5AN1A 2GZYA 2R0CA 1GTBA 3LG6A 5ECSA 1KEBA 1B48A 1U3IA 1PSQA 4JZQA 1GSUA 3QAWA 2CQ9A 2LNTA 3TKSC 4HI7A 2VCWA 2NTOA 5JCWA 2V1MA 1ST9A 3RDWA 4O32A 2P0GA 4EDZA 1T3BA 2PWJA 2L6CA 2HYXA 2P5QA 3D0ZA 1M2BA 1K3LA 3E3EA 4V2NA 3VLNA 4V1Ag 2VD0A 4IVFA 1EV9A 1FG4A 4FQUA 2GQLA 1Y6EA 1ZCPA 4MCUA 3F4SA 1KNGA 5IM9A 5G5FA 5KN1A 1EP7A 3VURA 4GLTA 4ULXA 4ZBAA 2C3TA 1JZOA 2HNLA 5LNKe 1A2LA 2P5RA 3EVIA 1EV4A 5ELGA 4PXOA 3M9KA 4OFMA 4RUVA 2N5FA 2H6YA 3GL3A 3EWLA 1EGRA 1PRXA 3FZ5A 5CRHA 2B5YA 3HDCA 4JE1A 4MJCA 5JWRB 1EOHA 3LQ7A 4CY6A 2MMOA 2H6XA 5J4UA 3QPMA 2J9HA 3LYKA 3GTUB 3RHBA 1V2AA 17GSA 2RUEA 2LRNA 2D2ZA 2JSZA 3P90A 3BCKA 1K3YA 3HJPA 4CY8A 3DXBA 1EEMA 3FK8A 5J3RA 1M7TA 2NPBA 5HFIA 4Z2TA 3HA9A 2FWEA 4JEDA 5CRDA 4EE0A 3VPTA 2I1UA 5ECNB 2IPAA 3L4NA 4POBA 3ZIVA 1H4OA 4ACSA 1FW1A 4LA1A 1A0FA 3VWVA 5IMDA 4IQ1A 4HOJA 1GSDA 16GSA 1F2EA 2FCHA 4Q5RA 1HNCA 2L57A 4JBBA 3PR8A 1WMJA 1B9YC 4TR1A 2HXKA 5J5NA 3EC3A 1XBSA 2DMLA 1TW9A 4POMA 4KAEA 5KEJA 1GTUA 14GSA 2YZUA 5ID2A 3WD6A 19GSA 2C3QA 5GSSA 1THXA 3ZZXA 5AIXA 3VWWA 1Z6NA 1XOBA 1O8WA 3NIVA 4KDUA 4NHZA 5HR2A 3FR6A 3EU3A 3PGTA 4J56E 4KGIA 2LUSA 1V58A 1M9BA 3UOMA 1O81A 1GNEA 4KB3A 4TRXA 4WEYA 1X9WB 2V6OA 4N0VA 2FA8A 3ME7A 3HZ4A 5G1LA 2R6KA 1CQGA 2LRCA 2I9HA 1A2MA 2CX3A 5BMUA 2RUFA 3ZRDA 4YH2A 1A24A 3EINA 3G7JA 3IV4A 1YJ6A 2HZFA 3HYPA 4MJBA 2JACA 3G7YA 3LORA 2CV4A 2IFQB 2A2SA 5ELAA 5ECLB 6GSSA 2JSYA 3DVWA 1E6BA 4XS6A 2YWOA 4X0XA 4YAVA 4CW9A 1SJZA 3GKMA 1TXXA 3LW9A 2DJ3A 2FLSA 2IIYA 2V41A 3GSSA 5EY6A 2DJ1A 2A2PA 2CT6A 3VWUA 2VUPA 2MBTA 1XFLA 4K7IA 5KN2A 1OE8A 5IOXA 1SENA 2YANA 5HQPA 1G0TA 5LD0A 2WZ9A 3M0FA 1OE7A 3DKSA 4V2MA 2EIRA 1PA3A 3TRPA 3GHAA 3CRUA 5ABRA 4K5RA 4EXJA 4LMVA 1MDIA 3ZMLA 4NMUA 4F0CA 3IE3A 4WR4A 1TTZA 3UL3A 2GLRA 4V1Ap 3KMNA 4L8EA 4I97A 1QUWA 2GQKA 1ML6A 2RIIA 1Z7PA 5IPGA 1O8XA 2GT6A 2H0GA 2TRCP 4HQSA 3KH9A 1BEDA 1XVQA 1Z5YE 4RQRA 5F0GA 2H0IA 2O85A 4E8HA 2H70A 1PGTA 1PD21 1PQNA 1VF4A 4MZBA 2H6ZA 3ERFA 3WYWA 4GQFA 4PUAA 1NHYA 1GP1A 4TOPA 4TXOB 3GX8A 4ID0A 3DMLA 2OBKA 2FWFA 5CYYA 3KH7A 5JCUA 2PVQA 1F3AA 2XPEA 2K9FA 1AXDA 1QMVA 4GWRA 1CQHA 1ACVA 3F0IA 4TR4A 1HNBA 2AAWA 1WRYA 3I9V2 3HXSA 2QC7A 3GN3A 4LLRA 3IBHA 1WOUA 3BOAA 3D6IA 4CHSA 3GTUA 1ZMAA 2B5EA 5LCZA 3PINA 2VO4A 1SKWB 3F4TA 3I43A 1WPIA 3VPQA 4KF9A 6GSTA 3EURA 5J9BA 3FYGA 4N30A 3A3TA 3N5OA 3KD0A 4MA9A 2OKAA 4ZL8A 3TRXA 1GUKA 2CZ3A 2X64A 2RLIA 3L9VA 3BBYA 1TRUA 2IMEA 3LEFA 1ERTA 4PX1A 3KEBA 2YCDA 4OMVA 5KN0A 1PN0A 5IOWA 3TKSE 3JCML 3UJ1A 1XPVA 4MMMA 3FHKA 1X9MB 3KMOA 4FYBA 1PL1A 2ZCTA 5DDLA 1JLWA 4MABA 1PX6A 6GSXA 3OR5A 1QQ2A 2YWIA 2CVKA 2OA7A 2DJKA 4D73B 1TP9A 4XRDA 3MWHA 1SKRB 4E8EA 5L71A 4DVCA 4XTSA 3DIEA 4TXVA 1IYIA 1IYHA 1JZWA 9GSSA 2BJXA 2LKUA 2VL3A 4EUYA 1OYJA 1TK8B 4KSMA 2CAIA 4AJ8A 1J9BA 2DBCA 1VGLA 2H1GA 2B5XA 4KCEA 2QA2A 3TJFA 2VL2A 5ECIB 3E0UA 2N5AA 1ZYQB 4KDYA 2IFQA 1OVNA 5CREA 2IMIA 2LNSA 5F8BA 2LQOA 2X8CA 3CSJA 4G10A 3AY8A 4QL9A 1K0AA 4A5PA 2DJ0A 1R5PA 5DQSA 1SYRA 1QXHA 3IRAA 2X99A 4IP1A 1J0FA 1VF1A 2ES7A 3NZNA 5DJLA 1C72A 1ERWA 1K0OA 3FZ9A 4HZ2A 2HI7A 2LSTA 1DE1A 3GKXA 3I69A 1M2AA 1ILOA 4BVXB 4ECIA 4I6XA 2CA8A 2Z9SA 1MDKA 3GNJA 5AGYA 3J7Yb 3QFAC 3RPPA 18GSA 1FB0A 3DRNA 4ZBDA 2YZHA 2B7KA 5BRTA 2FD3A 3GX0A 1TU8A 4L0WA 4MJAA 2JU5A 3VK9A 5F07A 2HZEB 1ZGNA 3H1NA 5EVOA 1N2AA 5A4UA 2OADA 2R4VA 2WGRA 4KDXA 2L5LA 1GSYA 5A4WA 1GWCA 2DJJA 3O76A 1GRXA 2L5OA 3IC4A 3F63A 2YV7A 2AHEA 3M9JA 1HQOA 2QKEA 4YQMA 4PNFA 4TXOA 2C1YA 4PURA 3CSIA 1UVZA 1YDKA 3DGQA 1DE2A 1DUGA 4YKFA 1MDJA 3DVXA 3HKRA 4XIHA 2GSRA 2WFCA 2GT5A 4HZ4A 2HLSA 1OC9B 4O5RA 4KE3A 4KSOA 2IMDA 2AJQB 4ZXGA 13GSA 1M2DA 4MF5A 4ZBBA 5F05A 1TJDA 2YJ7A 2XPDA 1V40A 1S3AA 5C00A 4KNDA 1PKWA 4MPGA 4GXZA 5IIZA 3TGZA 5JWOB 5CO3A 2KP1A 4I2TA 2VM2A 1GLQA 3ME8A 1F3BA 1TI3A 2FWHA 4OO4A 1FO5A 6GSVA 3CTFA 3V1WA 3ZYWA 5ECPB 3LYPA 4KA0A 2JZRA 4L5OA 1Q4JA 2H19A 4POLA 5KOWA 1G7EA 3N9JA 1PX7A 4MH3A 4TKYA 4G0KA 3D5JA 2FY6A 2FHEA 2J23A 1ZOFA 3P7XA 5G1KA 3ZVJD 1W89A 4MF7A 3MNGA 4OFTA 1YF1A 3ZREA 1FVJA 3QOUA 1TOFA 3GL5A 4POKA 5HR0A 1TU7A 3Q74A 5CP1A 3RPNA 5D9WA 1S3DA 1G7OA 3GIXA 1A23A 4HU9A 1ZYPA 4HUAA 2HE3A 2JZTA 5H5RA 1R4WA 1SKSB 1XW5A 2F51A 1XIYA 4D73A 2H30A 1YEPA 2E0QA 2H71A 4MH2A 4ZB8A 1Z9HA 3FZAA 2DJ2A 3UARA 4MP4A 4AF2A 1JHBA 5G2ZA 5B6MA 1W4VA 5EL8A 2WS2A 4X1UA 3GSTA 3WT2A 4IJIA 5ECHB 1SJ6A 4BWSA 5IMZA 3VFIA 4F9ZA 3F3QA 4MDCA 1M9AA 3IAM2 3TOTA 4PGTA 4EL1A 2MMZA 3CXGA 3UEMA 1SL0B 2L4CA 3W8SA 3QR6A 3D21A 2DSAA 4TR0A 3BD2A 2I81A 4ZIJA 1J08A 4KX4A 2PBJA 3TKSA 3EU4A 3KP9A 3TJBA 1X9SB 1I5GA 3WGDA 4K8MA 3CBUA 2O89A 5E59A 4ZILA 3EPTA 3KTLA 2R37A 1X5CA 2DC5A 2YP6A 2OJLA 2R3XA 3D4TA 3VI7A 3M8NA 5DALB 3LJRA 2E7PA 3US3A 4PQIA 1U88A 3KTBA 3F4RA 5H5SA 3C8EA 1AIUA 4IHUA 2H74A 4BVXA 2C0DA 1F9MA 3QFBC 1WJKA 2MMAA 2VCTA 2KHPA 2FWGA 2PGTA 2YJHA 5JCGA 4O7HA 5IMAA 1XWKA 4NPBA 1XVWA 1DSBA 2DMMA 2IJYA 22GSA 4CDOA 2A4VA 1USBA 2HZEA 1AQWA 3PPUA 4IP6A 2MYGA 4TN8A 3TKQA 1BG5A 1GTIA 2VIMA 1R5AA 2GSQA 4AGSA 3DYRA 2IL3A 2REMA 4OCEA 4K5SA 2VAFA 5FHIA 4BL7B 2VD1A 4WR5A 3ZMKA 2F3MA 3SBCA 1T7PB 1A8YA 5CRGA 1XWAA 2B7JA 4GRFA 2R0PA 6GSYA 1F6MC 1AW9A 2VOCA 2ON5A 3EMXA 4RI7A 3APSA 3C71A 3ZTLA 2I4AA 4Z2UA 1K0MA 4TVEA 2IMFA 1YZXA 1OC9A 2MZCA 3GURA 3L0HA 2CX4A 1M99A 2C0FA 1FB6A 1HD2A 3APOA 3UAPA 2KLXA 5ECQB 3GA4A 4EKZA 5DJMA 2QA1A 5DBQA 3SWLA 1GLPA 10GSA 5B6NA 4JR4A 3HVXA 2WB9A 3I6AA 3TUEA 1O73A 2PU9C 2B1LA 1A0RP 4BVYB 2HT9A 2K18A 4KW6A 2E2GA 1XW9A 4L0UA 4WBRD 1TRWA 3FKFA 1BAYA 1WP0A 2EIQA 5B8BA 3GMFA 4EC0A 2PPTA 4HEA2 5DCGA 2MMNA 2C4JA 2OE0A 1XOAA 3HJMA 2E2MA 4NHWA 4KH7A 3CTGA 4IGJA 1AQXA 1MD3A 2WRTA 20GSA 3FRCA 3W6GA 2CAQA 3M1GA 1SD8A 5HFKA 5HFGA 3MAKA 2ZUPA 2HSMA 2AB6A 1QFNA 4WKWA 4K9ZA 1GH2A 1M0UA 1B8XA 1AC1A 3C1SA 1KTEA 1G6WA 1MD4A 4MJEA 1ZZYA 2LJRA 3QD9A 4WXTA 4PTSA 5IO2A 3CSHA 3QMXA 5B8AA 1OAZA 2UZ8A 1XCCA 3IC8A 4EF0A 1XW6A 3UVTA 2YOIA 3D4MA 4WF4A 4YAPA 4F03A 4IKHA 1B4QA 4K0NA 4OO5A 1SK1A 2V32A 5COHA 1TRVA 1TDIA 2FA4A 4O5UA 1Z7RA 2VLVA 1ON4A 4BPYA 1XWCA 3VWXA 5ECMB 4WETA 5HR3A 2X49A 4KCAA 1T00A 1SL2B 2WULA 3Q18A 2X4AA 2F8AA 1FAAA 4NWYA 5IPHA 2F8FA 2NVLA 2HFDA 1EOGA 3MYDA 2OACA 1FVKA 4AJ7A 2XBQA 1GULA 4JR6A 3QDNA 1BJXA 3LSZA 1AUCA 3U5RE 5D73A 5DALA 5DQYA 2R2JA 3O6TA 1YEXA 3ZIJA 1EGOA 5F06A 1TK0B 3ED3A 2VCZA 1YKAA 3F9UA 2JZSA 1K3OA 5GAPD 4YKGA 2XHFA 3L78A 3GKKA 3C73A 4AJ6A 2H76A 2EIOA 2H72A 2PMTA 4OCFA 4ML6A 4G2EA 2GVPA 1DBYA 1X5EA 5FWGA 4H86A 2IWTA 2O7KA 2H1AA 3KP8A 3MSZA 7GSSA 5JWQB 4Q5QA 4P3YB 1ZL9A 2LTKA 1OKDA 4OWYA 4WF5A 3HZ8A 2LJAA 3FW2A 2KP2A 1VRSD 4EIPA 5IMVA 2VLTA 2X8HA 3RHCA 2YPMA 4BL7A 3IDVA 1FOHA 4RI6A 3KJYA 2M80A 3W8JA 4RQXA 1GTAA 3TOUA 3FY7A 2V2GA 3F3RA 3H79A 5AIVA 2GZPA 2N5BA 3DEXA 4BA7A 2IMKA 1X5DA 5J41A 4IBPA 4X43A 2NDOA 2KOKA 2QSIA 1PL2A 1HNAA 3IHGA 4GTUA 2VCXA 2O87A 1Y25A 2TRXA 3KCMA 2TIRA 3FR9A 4FO5A 3K8NA 1RQMA 3KIJA 4K6XA 4J2FA 2VM1A 3A5WA 2H8LA 4USSA 1TI1A 1S3CA 1JZDA 5B7CA 4BVYA 1X0RA 5D8IA 4DEJA 1VF3A 1UA5A 3Q6OA 3GH6A 2KUCA 1WIKA 4PUFC 2DKHA 3F6DA 4GCIA 1ERUA 2XBIA 2B1KA 3GH9A 3TB2A 8GSSA 4JU5A 3WT1A 2JADA 4K0GA 1O85A 1ABAA 3LXTA 2YV9A 1U87A 4IN0A 3TCOA 3TJKA 2BTOT 4J57E 4IJ3A 1XWBA 4Q5NA 4Z2RA 2GZZA 3KM6A 4N0ZA 1BQ7A 4ZL9A 3F6FA 3UBLA 5D96A 4HJ2A 4K7NA 2DLXA 5DAKB 1VF2A 2VL9A 4MK3A 1F37A 3QAVA 2K6VA 4GSNA 2G2QA 1MTCA 3HY2A 3H8QA 4XHMA 1BX9A 4N11A 1K0BA 3A5IA 2IN3A 2VLUA 1O6JA 1Z6MA 3GUSA 2RM5A 4NV5A 1U6TA 2DKIA 1K0CA 2ON7A 2C8UA 1Q98A 2G0FA 1XXUA 5DVBA 1AAZA 1TRSA 4G0IA 2AV4A 4BWQA 4X4JA 4MNNA 5G31A 4IS0A 2GSSA 2K8SA 2X8GA 1A2JA 4K7OA 2GGTA 5EPFA 4O92A 1GSEA 2VCQA 3G9BA 2OBIA 4XS1A 2FGXA 3R3EA 1NSWA 3F8UA 3MDKA 3HD5A 5H5QA 2VCVA 2B6MA 3IK9A 3UMAA 1XZOA 3IR4A 4MLYA 1V9WA 11GSA 4QQ7A 2GQMA 3ZFBA 3EMPA 4TR3A 3H4KA 1SL1B 1YF0A 5DCHA 6GSUA 4K1FA 5KOXA 2AYTA 4K2XA 4ECCA 1GSQA 2M72A 2DIZA 5E4WA 3FEUA 5CRWA 4LL4B 3GV1A 1SK2A 3P8WA 2LQQA 2GDRA 3APQA 1LBKA 2HRNA 3DWVA 1GSSA 3L9SA 3EYTA 1HYUA 3P2AA 5D9VA 4HS1A 3TRQA 3GRXA 1YQ1A 4I8BA 1THOA 4FIWA 4N10A 1N8JA 12GSA 3CMIA 4DSSB 4EO3A 2PVOC 3ERWA 3TKRA 5FT3A 3U6VA 4IQAA 1ZYEA 4ML1A 3EE2A 3ZL5A 3TDGA 5GAND 2L4QA 3TJGA 5J9CA 3M3MA 2YNXA 4GSSA 2NBSA 3FMWA 2K8VA 3BCIA 2O8VB 1UC7A 5ECKB 5GZZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5G A;  1I9D A;  4F2I A;  5G30 A;  5CNW A;  3IXR A;  5D93 A;  2V6K A;  2EC4 A;  3HJO A;  6GSW A;  3A2V A;  3LGC A;  4L5L A;  2B3S A;  4QL7 A;  4XS4 B;  3FR3 A;  2M46 A;  3CRT A;  4MZC A;  5CAX A;  1SD9 A;  2DIY A;  3UVH A;  5C04 A;  2FNO A;  3WGX A;  4DSR A;  4GST A;  4ZL7 A;  3C1R A;  1OC3 A;  1MEK A;  1LJR A;  4IEL A;  2I3Y A;  4ECJ A;  2VL2 C;  1GL8 A;  5ENU A;  1FHE A;  1E2Y A;  1NW2 A;  4F0B A;  4FYC A;  2C3N A;  1GUM A;  4G19 A;  4JRR A;  4PQH A;  3ZFL A;  1UN2 A;  1B4P A;  1NHO A;  1BYE A;  3H93 A;  5ECR B;  2LV3 A;  2LRT A;  3LFL A;  1V98 A;  1YKC A;  2H1B A;  2XC2 A;  3KXO A;  4DSQ A;  4HU7 A;  1SYX A;  3WGE A;  2PER A;  2CVB A;  2H66 A;  3TJJ A;  3GYK A;  5ECO B;  5D9X A;  1K0N A;  5GST A;  3A2X A;  3ZLP A;  2H75 A;  3HHV A;  4NAX A;  3E9J B;  3S9F A;  2L59 A;  3PH9 A;  1T4Z A;  1EEJ A;  4LL1 B;  4MPF A;  4FH8 A;  3C7M A;  1GUH A;  1H75 A;  1QK8 A;  2PN8 A;  1RK4 A;  1WE0 A;  1SU9 A;  3IAS 2;  2CVD A;  1EWX A;  4HDE A;  1EP8 A;  5A5K A;  3VI5 A;  1R7H A;  5AIS A;  4HQZ A;  4IW9 A;  1U3A A;  2H73 A;  2LJK A;  2A2R A;  4MF6 A;  1K0D A;  5DAK A;  1JLV A;  3GFK A;  3R2Q A;  1WWJ A;  1SK0 A;  4OD7 A;  4ZB9 A;  4V2L A;  3IK7 A;  5G5E A;  4ISD A;  1GSF A;  2OE3 A;  1NM3 A;  3A2W A;  1GNW A;  4XRA A;  3IPZ A;  2CZ2 A;  4PQ1 A;  1LU4 A;  1EZK A;  1KBN A;  3LWA A;  3KGK A;  2P31 A;  2AUV A;  1PMT A;  2WDU A;  1URM A;  2F9S A;  3GKN A;  1T4Y A;  3J7Y k;  4EVM A;  2ZNM A;  4KUN A;  5IO0 A;  2QGV A;  2H0H A;  1PN9 A;  4HJM A;  3IA1 A;  3BJ5 A;  4ZB6 A;  1SJI A;  2JL4 A;  1JFU A;  4ILF A;  2C80 A;  3G7I A;  2RM6 A;  3KZQ A;  1B9X C;  1TK5 B;  3UIW A;  2GTU A;  4Q5F A;  2YWN A;  4TR1 B;  3LXZ A;  4LMW A;  4Z7X A;  1PKZ A;  5KN3 A;  1JZR A;  3Q19 A;  5IMC A;  4WBJ A;  5ID2 B;  4YQU A;  5IMF A;  2WJU A;  4OFN A;  3D22 A;  3ISO A;  1OKT A;  4K2D A;  3NOF A;  3UBK A;  4ECB A;  2WCI A;  2PUK C;  3RBT A;  3TKP A;  2ALB A;  3ZVJ A;  1QGV A;  3HCZ A;  1G6Y A;  3IHQ A;  4TW5 A;  3ZIT A;  4FYU A;  2HSH A;  1T1V A;  2BMX A;  4NV2 A;  4YQV A;  4DSS A;  2GST A;  2HSY A;  2OE1 A;  1Z3E A;  2MBS A;  4I5Q A;  1ERV A;  5IQY A;  2LS5 A;  4PNG A;  2H01 A;  2HRF A;  3QAG A;  2L6D A;  1TKD B;  1XWG A;  3CYN A;  5A4V A;  2C0E A;  4GF0 A;  3HVS A;  1O7U A;  2H1D A;  1YY7 A;  2YWM A;  2C0G A;  2FUG 2;  3L9U A;  4XCS A;  1AQV A;  1OC8 A;  4F82 A;  4GQC A;  3RAZ A;  1FOV A;  1V57 A;  1RW1 A;  3O3T A;  3IOS A;  3FZ4 A;  4MZW A;  3HVV A;  1R26 A;  4XS4 A;  2YN1 A;  3QCP A;  3ERG A;  4NXI A;  2LEG A;  4I2U A;  5D9T A;  1T8E B;  2GS3 A;  1A8L A;  5HR1 A;  4G9H A;  5INY A;  3DD3 A;  4EDY A;  5AN1 A;  2GZY A;  1GTB A;  3LG6 A;  5ECS A;  1KEB A;  1B48 A;  1U3I A;  1PSQ A;  4JZQ A;  1GSU A;  3QAW A;  2CQ9 A;  2LNT A;  3TKS C;  4HI7 A;  2VCW A;  2NTO A;  5JCW A;  2V1M A;  1ST9 A;  3RDW A;  4O32 A;  2P0G A;  4EDZ A;  1T3B A;  2PWJ A;  2L6C A;  2HYX A;  2P5Q A;  3D0Z A;  1M2B A;  1K3L A;  3E3E A;  4V2N A;  3VLN A;  4V1A g;  2VD0 A;  4IVF A;  1EV9 A;  1FG4 A;  2GQL A;  1Y6E A;  1ZCP A;  4MCU A;  3F4S A;  1KNG A;  5IM9 A;  5G5F A;  5KN1 A;  1EP7 A;  3VUR A;  4GLT A;  4ULX A;  4ZBA A;  2C3T A;  1JZO A;  2HNL A;  5LNK e;  1A2L A;  2P5R A;  3EVI A;  1EV4 A;  5ELG A;  4PXO A;  3M9K A;  4OFM A;  4RUV A;  2N5F A;  2H6Y A;  3GL3 A;  3EWL A;  1EGR A;  1PRX A;  3FZ5 A;  5CRH A;  2B5Y A;  3HDC A;  4JE1 A;  4MJC A;  5JWR B;  1EOH A;  3LQ7 A;  2MMO A;  2H6X A;  5J4U A;  3QPM A;  2J9H A;  3LYK A;  3GTU B;  3RHB A;  1V2A A;  17GS A;  2RUE A;  2LRN A;  2D2Z A;  2JSZ A;  3P90 A;  3BCK A;  1K3Y A;  3HJP A;  3DXB A;  1EEM A;  3FK8 A;  5J3R A;  1M7T A;  2NPB A;  5HFI A;  3HA9 A;  2FWE A;  4JED A;  5CRD A;  4EE0 A;  3VPT A;  2I1U A;  5ECN B;  2IPA A;  3L4N A;  4POB A;  3ZIV A;  1H4O A;  4ACS A;  1FW1 A;  4LA1 A;  1A0F A;  3VWV A;  5IMD A;  4IQ1 A;  4HOJ A;  1GSD A;  16GS A;  1F2E A;  2FCH A;  4Q5R A;  1HNC A;  2L57 A;  4JBB A;  3PR8 A;  1WMJ A;  1B9Y C;  4TR1 A;  2HXK A;  5J5N A;  3EC3 A;  1XBS A;  2DML A;  1TW9 A;  4POM A;  4KAE A;  5KEJ A;  1GTU A;  14GS A;  2YZU A;  5ID2 A;  3WD6 A;  19GS A;  2C3Q A;  5GSS A;  1THX A;  3ZZX A;  5AIX A;  3VWW A;  1Z6N A;  1XOB A;  1O8W A;  3NIV A;  4KDU A;  4NHZ A;  5HR2 A;  3FR6 A;  3EU3 A;  3PGT A;  4J56 E;  4KGI A;  2LUS A;  1V58 A;  1M9B A;  3UOM A;  1O81 A;  1GNE A;  4KB3 A;  4TRX A;  4WEY A;  1X9W B;  2V6O A;  4N0V A;  2FA8 A;  3ME7 A;  3HZ4 A;  5G1L A;  2R6K A;  1CQG A;  2LRC A;  2I9H A;  1A2M A;  2CX3 A;  2RUF A;  3ZRD A;  4YH2 A;  1A24 A;  3EIN A;  3G7J A;  3IV4 A;  1YJ6 A;  2HZF A;  3HYP A;  4MJB A;  2JAC A;  3G7Y A;  3LOR A;  2CV4 A;  2IFQ B;  2A2S A;  5ELA A;  5ECL B;  6GSS A;  2JSY A;  3DVW A;  1E6B A;  4XS6 A;  2YWO A;  4X0X A;  4YAV A;  4CW9 A;  1SJZ A;  3GKM A;  1TXX A;  2DJ3 A;  2FLS A;  2IIY A;  2V41 A;  3GSS A;  5EY6 A;  2DJ1 A;  2CT6 A;  3VWU A;  2VUP A;  2MBT A;  1XFL A;  4K7I A;  5KN2 A;  1OE8 A;  5IOX A;  1SEN A;  2YAN A;  5HQP A;  1G0T A;  5LD0 A;  2WZ9 A;  3M0F A;  1OE7 A;  3DKS A;  4V2M A;  2EIR A;  1PA3 A;  3TRP A;  3GHA A;  3CRU A;  5ABR A;  4EXJ A;  4LMV A;  1MDI A;  3ZML A;  4NMU A;  4F0C A;  3IE3 A;  4WR4 A;  1TTZ A;  3UL3 A;  2GLR A;  4V1A p;  3KMN A;  4L8E A;  4I97 A;  1QUW A;  2GQK A;  1ML6 A;  2RII A;  1Z7P A;  5IPG A;  1O8X A;  2GT6 A;  2H0G A;  2TRC P;  4HQS A;  3KH9 A;  1BED A;  1XVQ A;  1Z5Y E;  4RQR A;  5F0G A;  2H0I A;  2O85 A;  4E8H A;  2H70 A;  1PGT A;  1PD2 1;  1PQN A;  1VF4 A;  4MZB A;  2H6Z A;  3ERF A;  3WYW A;  4GQF A;  4PUA A;  1NHY A;  1GP1 A;  4TOP A;  4TXO B;  3GX8 A;  4ID0 A;  3DML A;  2OBK A;  2FWF A;  5CYY A;  3KH7 A;  5JCU A;  2PVQ A;  1F3A A;  2XPE A;  2K9F A;  1AXD A;  1QMV A;  4GWR A;  1CQH A;  1ACV A;  3F0I A;  4TR4 A;  1HNB A;  2AAW A;  1WRY A;  3I9V 2;  3HXS A;  2QC7 A;  3GN3 A;  4LLR A;  3IBH A;  1WOU A;  3BOA A;  3D6I A;  4CHS A;  3GTU A;  1ZMA A;  2B5E A;  5LCZ A;  3PIN A;  2VO4 A;  1SKW B;  3F4T A;  3I43 A;  1WPI A;  3VPQ A;  6GST A;  3EUR A;  5J9B A;  3FYG A;  4N30 A;  3A3T A;  3N5O A;  3KD0 A;  4MA9 A;  2OKA A;  4ZL8 A;  3TRX A;  1GUK A;  2CZ3 A;  2X64 A;  2RLI A;  3L9V A;  3BBY A;  1TRU A;  2IME A;  3LEF A;  1ERT A;  4PX1 A;  3KEB A;  2YCD A;  4OMV A;  5KN0 A;  5IOW A;  3TKS E;  3JCM L;  3UJ1 A;  1XPV A;  4MMM A;  3FHK A;  1X9M B;  3KMO A;  4FYB A;  1PL1 A;  2ZCT A;  5DDL A;  1JLW A;  4MAB A;  1PX6 A;  6GSX A;  3OR5 A;  1QQ2 A;  2YWI A;  2CVK A;  2OA7 A;  2DJK A;  4D73 B;  1TP9 A;  4XRD A;  3MWH A;  1SKR B;  4E8E A;  5L71 A;  4DVC A;  4XTS A;  3DIE A;  4TXV A;  1IYI A;  1IYH A;  1JZW A;  9GSS A;  2BJX A;  2LKU A;  2VL3 A;  4EUY A;  1OYJ A;  1TK8 B;  4KSM A;  2CAI A;  4AJ8 A;  1J9B A;  2DBC A;  1VGL A;  2H1G A;  2B5X A;  4KCE A;  3TJF A;  2VL2 A;  5ECI B;  3E0U A;  2N5A A;  1ZYQ B;  4KDY A;  2IFQ A;  1OVN A;  5CRE A;  2IMI A;  2LNS A;  5F8B A;  2LQO A;  2X8C A;  3CSJ A;  4G10 A;  3AY8 A;  4QL9 A;  1K0A A;  2DJ0 A;  1R5P A;  5DQS A;  1SYR A;  1QXH A;  3IRA A;  2X99 A;  4IP1 A;  1J0F A;  1VF1 A;  2ES7 A;  3NZN A;  5DJL A;  1C72 A;  1ERW A;  1K0O A;  3FZ9 A;  4HZ2 A;  2HI7 A;  2LST A;  1DE1 A;  3GKX A;  3I69 A;  1M2A A;  1ILO A;  4ECI A;  4I6X A;  2CA8 A;  2Z9S A;  1MDK A;  3GNJ A;  5AGY A;  3J7Y b;  3QFA C;  3RPP A;  18GS A;  1FB0 A;  3DRN A;  4ZBD A;  2YZH A;  2B7K A;  2FD3 A;  3GX0 A;  1TU8 A;  4L0W A;  4MJA A;  2JU5 A;  3VK9 A;  5F07 A;  2HZE B;  1ZGN A;  3H1N A;  5EVO A;  1N2A A;  5A4U A;  2OAD A;  2R4V A;  2WGR A;  4KDX A;  2L5L A;  1GSY A;  5A4W A;  1GWC A;  2DJJ A;  3O76 A;  1GRX A;  2L5O A;  3IC4 A;  3F63 A;  2YV7 A;  2AHE A;  3M9J A;  1HQO A;  2QKE A;  4YQM A;  4PNF A;  4TXO A;  2C1Y A;  4PUR A;  3CSI A;  1UVZ A;  1YDK A;  3DGQ A;  1DE2 A;  1DUG A;  1MDJ A;  3DVX A;  3HKR A;  4XIH A;  2GSR A;  2WFC A;  2GT5 A;  4HZ4 A;  2HLS A;  1OC9 B;  4O5R A;  4KE3 A;  4KSO A;  2IMD A;  2AJQ B;  4ZXG A;  13GS A;  1M2D A;  4MF5 A;  4ZBB A;  5F05 A;  1TJD A;  2YJ7 A;  2XPD A;  1V40 A;  1S3A A;  5C00 A;  4KND A;  1PKW A;  4MPG A;  4GXZ A;  5IIZ A;  3TGZ A;  5JWO B;  5CO3 A;  2KP1 A;  4I2T A;  2VM2 A;  1GLQ A;  3ME8 A;  1F3B A;  1TI3 A;  2FWH A;  4OO4 A;  1FO5 A;  6GSV A;  3CTF A;  3V1W A;  3ZYW A;  5ECP B;  3LYP A;  4KA0 A;  2JZR A;  4L5O A;  1Q4J A;  2H19 A;  4POL A;  1G7E A;  3N9J A;  1PX7 A;  4MH3 A;  4TKY A;  3D5J A;  2FY6 A;  2FHE A;  2J23 A;  1ZOF A;  3P7X A;  5G1K A;  3ZVJ D;  1W89 A;  4MF7 A;  3MNG A;  4OFT A;  1YF1 A;  3ZRE A;  1FVJ A;  3QOU A;  1TOF A;  3GL5 A;  4POK A;  5HR0 A;  1TU7 A;  3Q74 A;  5CP1 A;  3RPN A;  5D9W A;  1S3D A;  1G7O A;  3GIX A;  1A23 A;  4HU9 A;  4HUA A;  2HE3 A;  2JZT A;  5H5R A;  1R4W A;  1SKS B;  1XW5 A;  2F51 A;  1XIY A;  4D73 A;  2H30 A;  1YEP A;  2E0Q A;  2H71 A;  4MH2 A;  4ZB8 A;  1Z9H A;  3FZA A;  2DJ2 A;  3UAR A;  4MP4 A;  4AF2 A;  1JHB A;  5G2Z A;  5B6M A;  1W4V A;  5EL8 A;  2WS2 A;  4X1U A;  3GST A;  3WT2 A;  4IJI A;  5ECH B;  1SJ6 A;  4BWS A;  5IMZ A;  3VFI A;  4F9Z A;  3F3Q A;  4MDC A;  1M9A A;  3IAM 2;  3TOT A;  4PGT A;  4EL1 A;  2MMZ A;  3CXG A;  3UEM A;  1SL0 B;  2L4C A;  3W8S A;  3QR6 A;  3D21 A;  2DSA A;  4TR0 A;  3BD2 A;  2I81 A;  4ZIJ A;  1J08 A;  4KX4 A;  2PBJ A;  3TKS A;  3EU4 A;  3KP9 A;  3TJB A;  1X9S B;  1I5G A;  3WGD A;  4K8M A;  3CBU A;  2O89 A;  5E59 A;  4ZIL A;  3KTL A;  2R37 A;  1X5C A;  2DC5 A;  2YP6 A;  2OJL A;  2R3X A;  3D4T A;  3VI7 A;  3M8N A;  5DAL B;  3LJR A;  2E7P A;  3US3 A;  4PQI A;  1U88 A;  3KTB A;  3F4R A;  5H5S A;  3C8E A;  1AIU A;  4IHU A;  2H74 A;  4BVX A;  2C0D A;  1F9M A;  3QFB C;  1WJK A;  2MMA A;  2VCT A;  2KHP A;  2FWG A;  2PGT A;  2YJH A;  5JCG A;  4O7H A;  5IMA A;  1XWK A;  4NPB A;  1XVW A;  1DSB A;  2DMM A;  2IJY A;  22GS A;  4CDO A;  2A4V A;  1USB A;  2HZE A;  1AQW A;  4IP6 A;  2MYG A;  4TN8 A;  3TKQ A;  1BG5 A;  1GTI A;  2VIM A;  1R5A A;  2GSQ A;  4AGS A;  3DYR A;  2IL3 A;  2REM A;  4OCE A;  2VAF A;  5FHI A;  2VD1 A;  4WR5 A;  3ZMK A;  2F3M A;  3SBC A;  1T7P B;  1A8Y A;  5CRG A;  1XWA A;  2B7J A;  4GRF A;  6GSY A;  1F6M C;  1AW9 A;  2VOC A;  2ON5 A;  3EMX A;  4RI7 A;  3APS A;  3C71 A;  3ZTL A;  2I4A A;  1K0M A;  4TVE A;  2IMF A;  1YZX A;  1OC9 A;  2MZC A;  3GUR A;  3L0H A;  2CX4 A;  1M99 A;  2C0F A;  1FB6 A;  1HD2 A;  3APO A;  3UAP A;  2KLX A;  5ECQ B;  3GA4 A;  4EKZ A;  5DJM A;  5DBQ A;  3SWL A;  1GLP A;  10GS A;  5B6N A;  4JR4 A;  3HVX A;  2WB9 A;  3I6A A;  3TUE A;  1O73 A;  2PU9 C;  2B1L A;  1A0R P;  2HT9 A;  2K18 A;  4KW6 A;  2E2G A;  1XW9 A;  4L0U A;  4WBR D;  1TRW A;  3FKF A;  1BAY A;  1WP0 A;  2EIQ A;  5B8B A;  3GMF A;  4EC0 A;  2PPT A;  4HEA 2;  5DCG A;  2MMN A;  2C4J A;  2OE0 A;  1XOA A;  3HJM A;  2E2M A;  4NHW A;  4KH7 A;  3CTG A;  4IGJ A;  1AQX A;  1MD3 A;  2WRT A;  20GS A;  3FRC A;  3W6G A;  2CAQ A;  3M1G A;  1SD8 A;  5HFK A;  5HFG A;  3MAK A;  2ZUP A;  2AB6 A;  1QFN A;  4WKW A;  4K9Z A;  1GH2 A;  1M0U A;  1B8X A;  1AC1 A;  3C1S A;  1KTE A;  1G6W A;  1MD4 A;  4MJE A;  1ZZY A;  2LJR A;  3QD9 A;  4WXT A;  5IO2 A;  3CSH A;  3QMX A;  5B8A A;  1OAZ A;  1XCC A;  4EF0 A;  1XW6 A;  3UVT A;  2YOI A;  3D4M A;  4WF4 A;  4YAP A;  4F03 A;  4IKH A;  1B4Q A;  4K0N A;  4OO5 A;  1SK1 A;  2V32 A;  5COH A;  1TRV A;  1TDI A;  2FA4 A;  1Z7R A;  2VLV A;  1ON4 A;  4BPY A;  1XWC A;  3VWX A;  5ECM B;  4WET A;  5HR3 A;  4KCA A;  1T00 A;  1SL2 B;  2WUL A;  3Q18 A;  2F8A A;  1FAA A;  4NWY A;  5IPH A;  2F8F A;  2NVL A;  2HFD A;  1EOG A;  2OAC A;  1FVK A;  4AJ7 A;  2XBQ A;  1GUL A;  4JR6 A;  3QDN A;  1BJX A;  3LSZ A;  1AUC A;  3U5R E;  5D73 A;  5DAL A;  5DQY A;  2R2J A;  3O6T A;  1YEX A;  3ZIJ A;  1EGO A;  5F06 A;  1TK0 B;  3ED3 A;  2VCZ A;  1YKA A;  3F9U A;  2JZS A;  1K3O A;  5GAP D;  2XHF A;  3L78 A;  3GKK A;  3C73 A;  4AJ6 A;  2H76 A;  2EIO A;  2H72 A;  2PMT A;  4OCF A;  4ML6 A;  4G2E A;  2GVP A;  1DBY A;  1X5E A;  5FWG A;  4H86 A;  2IWT A;  2O7K A;  2H1A A;  3KP8 A;  3MSZ A;  7GSS A;  5JWQ B;  4Q5Q A;  4P3Y B;  1ZL9 A;  2LTK A;  1OKD A;  4OWY A;  4WF5 A;  3HZ8 A;  2LJA A;  3FW2 A;  2KP2 A;  1VRS D;  5IMV A;  2VLT A;  2X8H A;  3RHC A;  2YPM A;  4BL7 A;  3IDV A;  4RI6 A;  3KJY A;  2M80 A;  3W8J A;  4RQX A;  1GTA A;  3TOU A;  3FY7 A;  2V2G A;  3F3R A;  3H79 A;  5AIV A;  2GZP A;  2N5B A;  3DEX A;  4BA7 A;  2IMK A;  1X5D A;  5J41 A;  4IBP A;  4X43 A;  2NDO A;  2KOK A;  2QSI A;  1PL2 A;  1HNA A;  4GTU A;  2VCX A;  2O87 A;  1Y25 A;  2TRX A;  3KCM A;  2TIR A;  3FR9 A;  4FO5 A;  3K8N A;  1RQM A;  3KIJ A;  4K6X A;  4J2F A;  2VM1 A;  3A5W A;  2H8L A;  1TI1 A;  1S3C A;  1JZD A;  5B7C A;  4BVY A;  1X0R A;  5D8I A;  4DEJ A;  1VF3 A;  1UA5 A;  3Q6O A;  3GH6 A;  2KUC A;  1WIK A;  4PUF C;  3F6D A;  4GCI A;  1ERU A;  2XBI A;  2B1K A;  3GH9 A;  3TB2 A;  8GSS A;  4JU5 A;  3WT1 A;  2JAD A;  4K0G A;  1O85 A;  1ABA A;  3LXT A;  2YV9 A;  1U87 A;  4IN0 A;  3TCO A;  3TJK A;  2BTO T;  4J57 E;  4IJ3 A;  1XWB A;  4Q5N A;  2GZZ A;  3KM6 A;  4N0Z A;  1BQ7 A;  4ZL9 A;  3F6F A;  3UBL A;  5D96 A;  4HJ2 A;  4K7N A;  2DLX A;  5DAK B;  1VF2 A;  2VL9 A;  4MK3 A;  1F37 A;  3QAV A;  2K6V A;  4GSN A;  2G2Q A;  1MTC A;  3HY2 A;  3H8Q A;  4XHM A;  1BX9 A;  4N11 A;  1K0B A;  2IN3 A;  2VLU A;  1O6J A;  1Z6M A;  3GUS A;  2RM5 A;  4NV5 A;  1U6T A;  1K0C A;  2ON7 A;  2C8U A;  1Q98 A;  2G0F A;  1XXU A;  5DVB A;  1AAZ A;  1TRS A;  2AV4 A;  4BWQ A;  5G31 A;  4IS0 A;  2GSS A;  2K8S A;  2X8G A;  1A2J A;  4K7O A;  2GGT A;  5EPF A;  4O92 A;  1GSE A;  2VCQ A;  3G9B A;  2OBI A;  4XS1 A;  2FGX A;  1NSW A;  3F8U A;  3MDK A;  3HD5 A;  5H5Q A;  2VCV A;  2B6M A;  3IK9 A;  3UMA A;  1XZO A;  3IR4 A;  4MLY A;  1V9W A;  11GS A;  4QQ7 A;  2GQM A;  3ZFB A;  3EMP A;  4TR3 A;  3H4K A;  1SL1 B;  1YF0 A;  5DCH A;  6GSU A;  4K1F A;  2AYT A;  4ECC A;  1GSQ A;  2M72 A;  2DIZ A;  5E4W A;  3FEU A;  5CRW A;  4LL4 B;  3GV1 A;  1SK2 A;  3P8W A;  2LQQ A;  2GDR A;  3APQ A;  1LBK A;  2HRN A;  3DWV A;  1GSS A;  3L9S A;  3EYT A;  1HYU A;  3P2A A;  5D9V A;  4HS1 A;  3TRQ A;  3GRX A;  1YQ1 A;  4I8B A;  1THO A;  4FIW A;  4N10 A;  1N8J A;  12GS A;  3CMI A;  4DSS B;  4EO3 A;  2PVO C;  3ERW A;  3TKR A;  5FT3 A;  3U6V A;  4IQA A;  1ZYE A;  4ML1 A;  3EE2 A;  3ZL5 A;  3TDG A;  5GAN D;  2L4Q A;  3TJG A;  5J9C A;  3M3M A;  2YNX A;  4GSS A;  2NBS A;  2K8V A;  3BCI A;  2O8V B;  1UC7 A;  5ECK B;  5GZZ B; 
#chains in the Genus database with same CATH topology
 2R5G A;  4O5Q A;  1I9D A;  4F2I A;  5G30 A;  5CNW A;  3IXR A;  5D93 A;  2V6K A;  2EC4 A;  3HJO A;  6GSW A;  3A2V A;  3LGC A;  4L5L A;  2B3S A;  4QL7 A;  4XS4 B;  3FR3 A;  2M46 A;  3CRT A;  4MZC A;  5CAX A;  1SD9 A;  2DIY A;  3UVH A;  5C04 A;  2FNO A;  3WGX A;  4DSR A;  4GST A;  4ZL7 A;  3C1R A;  1OC3 A;  1MEK A;  1LJR A;  4IEL A;  2I3Y A;  4ECJ A;  2VL2 C;  1GL8 A;  5ENU A;  1FHE A;  1E2Y A;  1NW2 A;  4F0B A;  4FYC A;  2C3N A;  1GUM A;  4G19 A;  4JRR A;  4PQH A;  3ZFL A;  1UN2 A;  1B4P A;  1XG8 A;  1NHO A;  1BYE A;  3H93 A;  5ECR B;  2LV3 A;  2LRT A;  3LFL A;  1V98 A;  1YKC A;  2H1B A;  2XC2 A;  3KXO A;  4DSQ A;  4HU7 A;  1SYX A;  3WGE A;  2PER A;  4G0L A;  2CVB A;  2H66 A;  3TJJ A;  3GYK A;  5ECO B;  5D9X A;  1K0N A;  5GST A;  2A4H A;  3A2X A;  3ZLP A;  2H75 A;  3HHV A;  3MIX A;  4NAX A;  3E9J B;  3S9F A;  2L59 A;  3PH9 A;  1T4Z A;  1EEJ A;  4LL1 B;  4MPF A;  4FH8 A;  3C7M A;  1GUH A;  1H75 A;  1QK8 A;  2PN8 A;  1RK4 A;  1WE0 A;  1SU9 A;  3IAS 2;  2CVD A;  1EWX A;  4HDE A;  1EP8 A;  5A5K A;  3VI5 A;  1R7H A;  2HRA A;  5AIS A;  4HQZ A;  4IW9 A;  1U3A A;  2H73 A;  2LJK A;  2A2R A;  4MF6 A;  1K0D A;  5DAK A;  1JLV A;  3GFK A;  3R2Q A;  1WWJ A;  2HRK A;  1SK0 A;  4OD7 A;  4ZB9 A;  4V2L A;  3IK7 A;  5G5E A;  4ISD A;  1GSF A;  2OE3 A;  1NM3 A;  3A2W A;  1GNW A;  1ZYN A;  4XRA A;  3IPZ A;  2CZ2 A;  4PQ1 A;  1LU4 A;  1EZK A;  1KBN A;  3LWA A;  3KGK A;  2P31 A;  2AUV A;  1PMT A;  2WDU A;  1URM A;  2F9S A;  3GKN A;  1T4Y A;  3J7Y k;  4EVM A;  2ZNM A;  4KUN A;  5IO0 A;  2QGV A;  2H0H A;  1PN9 A;  4HJM A;  3IA1 A;  3BJ5 A;  4ZB6 A;  1SJI A;  2JL4 A;  1JFU A;  4ILF A;  2C80 A;  3G7I A;  2RM6 A;  3KZQ A;  1B9X C;  1TK5 B;  3UIW A;  2GTU A;  4Q5F A;  2YWN A;  4TR1 B;  3LXZ A;  4LMW A;  4Z7X A;  1PKZ A;  5KN3 A;  1JZR A;  3Q19 A;  5IMC A;  4WBJ A;  5ID2 B;  4YQU A;  5IMF A;  2WJU A;  4OFN A;  3D22 A;  3ISO A;  1OKT A;  4K2D A;  3NOF A;  3UBK A;  4ECB A;  2WCI A;  2PUK C;  3RBT A;  3TKP A;  2ALB A;  3ZVJ A;  1QGV A;  3HCZ A;  1G6Y A;  3IHQ A;  4TW5 A;  3ZIT A;  4FYU A;  2HSH A;  1T1V A;  2BMX A;  4NV2 A;  4YQV A;  4DSS A;  2GST A;  2HSY A;  4ICY A;  2OE1 A;  1Z3E A;  2MBS A;  4I5Q A;  1ERV A;  5IQY A;  2LS5 A;  4PNG A;  2H01 A;  2HRF A;  3QAG A;  2L6D A;  1TKD B;  1XWG A;  3CYN A;  5A4V A;  2R0G A;  2C0E A;  4GF0 A;  3HVS A;  1O7U A;  2H1D A;  1YY7 A;  2YWM A;  2C0G A;  2FUG 2;  3L9U A;  4XCS A;  1AQV A;  1OC8 A;  4F82 A;  4GQC A;  3RAZ A;  1FOV A;  1V57 A;  1RW1 A;  3O3T A;  3IOS A;  3FZ4 A;  4MZW A;  3HVV A;  1R26 A;  4XS4 A;  4EIQ A;  2YN1 A;  3QCP A;  3ERG A;  4NXI A;  2LEG A;  4I2U A;  5D9T A;  1T8E B;  2GS3 A;  1A8L A;  5HR1 A;  4G9H A;  5INY A;  3DD3 A;  4EDY A;  5AN1 A;  2GZY A;  2R0C A;  1GTB A;  3LG6 A;  5ECS A;  1KEB A;  1B48 A;  1U3I A;  1PSQ A;  4JZQ A;  1GSU A;  3QAW A;  2CQ9 A;  2LNT A;  3TKS C;  4HI7 A;  2VCW A;  2NTO A;  5JCW A;  2V1M A;  1ST9 A;  3RDW A;  4O32 A;  2P0G A;  4EDZ A;  1T3B A;  2PWJ A;  2L6C A;  2HYX A;  2P5Q A;  3D0Z A;  1M2B A;  1K3L A;  3E3E A;  4V2N A;  3VLN A;  4V1A g;  2VD0 A;  4IVF A;  1EV9 A;  1FG4 A;  4FQU A;  2GQL A;  1Y6E A;  1ZCP A;  4MCU A;  3F4S A;  1KNG A;  5IM9 A;  5G5F A;  5KN1 A;  1EP7 A;  3VUR A;  4GLT A;  4ULX A;  4ZBA A;  2C3T A;  1JZO A;  2HNL A;  5LNK e;  1A2L A;  2P5R A;  3EVI A;  1EV4 A;  5ELG A;  4PXO A;  3M9K A;  4OFM A;  4RUV A;  2N5F A;  2H6Y A;  3GL3 A;  3EWL A;  1EGR A;  1PRX A;  3FZ5 A;  5CRH A;  2B5Y A;  3HDC A;  4JE1 A;  4MJC A;  5JWR B;  1EOH A;  3LQ7 A;  4CY6 A;  2MMO A;  2H6X A;  5J4U A;  3QPM A;  2J9H A;  3LYK A;  3GTU B;  3RHB A;  1V2A A;  17GS A;  2RUE A;  2LRN A;  2D2Z A;  2JSZ A;  3P90 A;  3BCK A;  1K3Y A;  3HJP A;  4CY8 A;  3DXB A;  1EEM A;  3FK8 A;  5J3R A;  1M7T A;  2NPB A;  5HFI A;  4Z2T A;  3HA9 A;  2FWE A;  4JED A;  5CRD A;  4EE0 A;  3VPT A;  2I1U A;  5ECN B;  2IPA A;  3L4N A;  4POB A;  3ZIV A;  1H4O A;  4ACS A;  1FW1 A;  4LA1 A;  1A0F A;  3VWV A;  5IMD A;  4IQ1 A;  4HOJ A;  1GSD A;  16GS A;  1F2E A;  2FCH A;  4Q5R A;  1HNC A;  2L57 A;  4JBB A;  3PR8 A;  1WMJ A;  1B9Y C;  4TR1 A;  2HXK A;  5J5N A;  3EC3 A;  1XBS A;  2DML A;  1TW9 A;  4POM A;  4KAE A;  5KEJ A;  1GTU A;  14GS A;  2YZU A;  5ID2 A;  3WD6 A;  19GS A;  2C3Q A;  5GSS A;  1THX A;  3ZZX A;  5AIX A;  3VWW A;  1Z6N A;  1XOB A;  1O8W A;  3NIV A;  4KDU A;  4NHZ A;  5HR2 A;  3FR6 A;  3EU3 A;  3PGT A;  4J56 E;  4KGI A;  2LUS A;  1V58 A;  1M9B A;  3UOM A;  1O81 A;  1GNE A;  4KB3 A;  4TRX A;  4WEY A;  1X9W B;  2V6O A;  4N0V A;  2FA8 A;  3ME7 A;  3HZ4 A;  5G1L A;  2R6K A;  1CQG A;  2LRC A;  2I9H A;  1A2M A;  2CX3 A;  5BMU A;  2RUF A;  3ZRD A;  4YH2 A;  1A24 A;  3EIN A;  3G7J A;  3IV4 A;  1YJ6 A;  2HZF A;  3HYP A;  4MJB A;  2JAC A;  3G7Y A;  3LOR A;  2CV4 A;  2IFQ B;  2A2S A;  5ELA A;  5ECL B;  6GSS A;  2JSY A;  3DVW A;  1E6B A;  4XS6 A;  2YWO A;  4X0X A;  4YAV A;  4CW9 A;  1SJZ A;  3GKM A;  1TXX A;  3LW9 A;  2DJ3 A;  2FLS A;  2IIY A;  2V41 A;  3GSS A;  5EY6 A;  2DJ1 A;  2A2P A;  2CT6 A;  3VWU A;  2VUP A;  2MBT A;  1XFL A;  4K7I A;  5KN2 A;  1OE8 A;  5IOX A;  1SEN A;  2YAN A;  5HQP A;  1G0T A;  5LD0 A;  2WZ9 A;  3M0F A;  1OE7 A;  3DKS A;  4V2M A;  2EIR A;  1PA3 A;  3TRP A;  3GHA A;  3CRU A;  5ABR A;  4K5R A;  4EXJ A;  4LMV A;  1MDI A;  3ZML A;  4NMU A;  4F0C A;  3IE3 A;  4WR4 A;  1TTZ A;  3UL3 A;  2GLR A;  4V1A p;  3KMN A;  4L8E A;  4I97 A;  1QUW A;  2GQK A;  1ML6 A;  2RII A;  1Z7P A;  5IPG A;  1O8X A;  2GT6 A;  2H0G A;  2TRC P;  4HQS A;  3KH9 A;  1BED A;  1XVQ A;  1Z5Y E;  4RQR A;  5F0G A;  2H0I A;  2O85 A;  4E8H A;  2H70 A;  1PGT A;  1PD2 1;  1PQN A;  1VF4 A;  4MZB A;  2H6Z A;  3ERF A;  3WYW A;  4GQF A;  4PUA A;  1NHY A;  1GP1 A;  4TOP A;  4TXO B;  3GX8 A;  4ID0 A;  3DML A;  2OBK A;  2FWF A;  5CYY A;  3KH7 A;  5JCU A;  2PVQ A;  1F3A A;  2XPE A;  2K9F A;  1AXD A;  1QMV A;  4GWR A;  1CQH A;  1ACV A;  3F0I A;  4TR4 A;  1HNB A;  2AAW A;  1WRY A;  3I9V 2;  3HXS A;  2QC7 A;  3GN3 A;  4LLR A;  3IBH A;  1WOU A;  3BOA A;  3D6I A;  4CHS A;  3GTU A;  1ZMA A;  2B5E A;  5LCZ A;  3PIN A;  2VO4 A;  1SKW B;  3F4T A;  3I43 A;  1WPI A;  3VPQ A;  4KF9 A;  6GST A;  3EUR A;  5J9B A;  3FYG A;  4N30 A;  3A3T A;  3N5O A;  3KD0 A;  4MA9 A;  2OKA A;  4ZL8 A;  3TRX A;  1GUK A;  2CZ3 A;  2X64 A;  2RLI A;  3L9V A;  3BBY A;  1TRU A;  2IME A;  3LEF A;  1ERT A;  4PX1 A;  3KEB A;  2YCD A;  4OMV A;  5KN0 A;  1PN0 A;  5IOW A;  3TKS E;  3JCM L;  3UJ1 A;  1XPV A;  4MMM A;  3FHK A;  1X9M B;  3KMO A;  4FYB A;  1PL1 A;  2ZCT A;  5DDL A;  1JLW A;  4MAB A;  1PX6 A;  6GSX A;  3OR5 A;  1QQ2 A;  2YWI A;  2CVK A;  2OA7 A;  2DJK A;  4D73 B;  1TP9 A;  4XRD A;  3MWH A;  1SKR B;  4E8E A;  5L71 A;  4DVC A;  4XTS A;  1PFO A;  3DIE A;  4TXV A;  1IYI A;  1IYH A;  1JZW A;  9GSS A;  2BJX A;  2LKU A;  2VL3 A;  4EUY A;  1OYJ A;  1TK8 B;  4KSM A;  2CAI A;  4AJ8 A;  1J9B A;  2DBC A;  1VGL A;  2H1G A;  2B5X A;  4KCE A;  2QA2 A;  3TJF A;  2VL2 A;  5ECI B;  3E0U A;  2N5A A;  1ZYQ B;  4KDY A;  2IFQ A;  1OVN A;  5CRE A;  2IMI A;  2LNS A;  5F8B A;  2LQO A;  2X8C A;  3CSJ A;  4G10 A;  3AY8 A;  4QL9 A;  1K0A A;  4A5P A;  2DJ0 A;  1R5P A;  4HSC X;  5DQS A;  1SYR A;  1QXH A;  3IRA A;  2X99 A;  4IP1 A;  1J0F A;  1VF1 A;  2ES7 A;  3NZN A;  5DJL A;  1C72 A;  1ERW A;  1K0O A;  3FZ9 A;  4HZ2 A;  2HI7 A;  2LST A;  1DE1 A;  3GKX A;  3I69 A;  1M2A A;  1ILO A;  4BVX B;  4ECI A;  4I6X A;  2CA8 A;  2Z9S A;  1MDK A;  3GNJ A;  5AGY A;  3J7Y b;  3QFA C;  3RPP A;  18GS A;  1FB0 A;  3DRN A;  4ZBD A;  2YZH A;  2B7K A;  5BRT A;  2FD3 A;  3GX0 A;  1TU8 A;  4L0W A;  4MJA A;  2JU5 A;  3VK9 A;  5F07 A;  2HZE B;  1ZGN A;  3H1N A;  5EVO A;  1N2A A;  5A4U A;  2OAD A;  2R4V A;  2WGR A;  4KDX A;  2L5L A;  1GSY A;  5A4W A;  1GWC A;  2DJJ A;  3O76 A;  1GRX A;  2L5O A;  3IC4 A;  3F63 A;  2YV7 A;  2AHE A;  3M9J A;  1HQO A;  2QKE A;  4YQM A;  4PNF A;  4TXO A;  2C1Y A;  4PUR A;  3CSI A;  1UVZ A;  1YDK A;  3DGQ A;  1DE2 A;  1DUG A;  4YKF A;  1MDJ A;  3DVX A;  3HKR A;  4XIH A;  2GSR A;  2WFC A;  2GT5 A;  4HZ4 A;  2HLS A;  1OC9 B;  4O5R A;  4KE3 A;  4KSO A;  2IMD A;  2AJQ B;  4ZXG A;  13GS A;  1M2D A;  4MF5 A;  4ZBB A;  5F05 A;  1TJD A;  2YJ7 A;  2XPD A;  1V40 A;  1S3A A;  5C00 A;  4KND A;  1PKW A;  4MPG A;  4GXZ A;  5IIZ A;  3TGZ A;  5JWO B;  5CO3 A;  2KP1 A;  4I2T A;  2VM2 A;  1GLQ A;  3ME8 A;  1F3B A;  1TI3 A;  2FWH A;  4OO4 A;  1FO5 A;  6GSV A;  3CTF A;  3V1W A;  3ZYW A;  5ECP B;  3LYP A;  4KA0 A;  2JZR A;  4L5O A;  1Q4J A;  2H19 A;  4POL A;  5KOW A;  1G7E A;  3N9J A;  1PX7 A;  4MH3 A;  4TKY A;  4G0K A;  3D5J A;  2FY6 A;  2FHE A;  2J23 A;  1ZOF A;  3P7X A;  5G1K A;  3ZVJ D;  1W89 A;  4MF7 A;  3MNG A;  4OFT A;  1YF1 A;  3ZRE A;  1FVJ A;  3QOU A;  1TOF A;  3GL5 A;  3HVN A;  4POK A;  5HR0 A;  1TU7 A;  3Q74 A;  5CP1 A;  3RPN A;  5D9W A;  1S3D A;  1G7O A;  3GIX A;  1A23 A;  4HU9 A;  1ZYP A;  4HUA A;  2HE3 A;  2JZT A;  5H5R A;  1R4W A;  1SKS B;  1XW5 A;  2F51 A;  1XIY A;  4D73 A;  2H30 A;  1YEP A;  2E0Q A;  2H71 A;  4MH2 A;  4ZB8 A;  1Z9H A;  3FZA A;  2DJ2 A;  3UAR A;  4MP4 A;  4AF2 A;  1JHB A;  5G2Z A;  5B6M A;  1W4V A;  5EL8 A;  2WS2 A;  4X1U A;  3GST A;  3WT2 A;  4IJI A;  5ECH B;  1SJ6 A;  4BWS A;  5IMZ A;  3VFI A;  4F9Z A;  3F3Q A;  4MDC A;  1M9A A;  3IAM 2;  3TOT A;  4PGT A;  4EL1 A;  2MMZ A;  3CXG A;  3UEM A;  1SL0 B;  2L4C A;  3W8S A;  3QR6 A;  3D21 A;  2DSA A;  4TR0 A;  3BD2 A;  2I81 A;  4ZIJ A;  1J08 A;  4KX4 A;  2PBJ A;  3TKS A;  3EU4 A;  3KP9 A;  3TJB A;  1X9S B;  1I5G A;  3WGD A;  4K8M A;  3CBU A;  2O89 A;  5E59 A;  4ZIL A;  3EPT A;  3KTL A;  2R37 A;  1X5C A;  2DC5 A;  2YP6 A;  2OJL A;  2R3X A;  3D4T A;  3VI7 A;  3M8N A;  5DAL B;  3LJR A;  2E7P A;  3US3 A;  4PQI A;  1U88 A;  3KTB A;  3F4R A;  5H5S A;  3C8E A;  1AIU A;  4IHU A;  2H74 A;  4BVX A;  2C0D A;  1F9M A;  3QFB C;  1WJK A;  2MMA A;  2VCT A;  2KHP A;  2FWG A;  2PGT A;  2YJH A;  5JCG A;  4O7H A;  5IMA A;  1XWK A;  4NPB A;  1XVW A;  1DSB A;  2DMM A;  2IJY A;  22GS A;  4CDO A;  2A4V A;  1USB A;  2HZE A;  1AQW A;  3PPU A;  4IP6 A;  2MYG A;  4TN8 A;  3TKQ A;  1BG5 A;  1GTI A;  2VIM A;  1R5A A;  2GSQ A;  4AGS A;  3DYR A;  2IL3 A;  2REM A;  4OCE A;  4K5S A;  2VAF A;  5FHI A;  4BL7 B;  2VD1 A;  4WR5 A;  3ZMK A;  2F3M A;  3SBC A;  1T7P B;  1A8Y A;  5CRG A;  1XWA A;  2B7J A;  4GRF A;  2R0P A;  6GSY A;  1F6M C;  1AW9 A;  2VOC A;  2ON5 A;  3EMX A;  4RI7 A;  3APS A;  3C71 A;  3ZTL A;  2I4A A;  4Z2U A;  1K0M A;  4TVE A;  2IMF A;  1YZX A;  1OC9 A;  2MZC A;  3GUR A;  3L0H A;  2CX4 A;  1M99 A;  2C0F A;  1FB6 A;  1HD2 A;  3APO A;  3UAP A;  2KLX A;  5ECQ B;  3GA4 A;  4EKZ A;  5DJM A;  2QA1 A;  5DBQ A;  3SWL A;  1GLP A;  10GS A;  5B6N A;  4JR4 A;  3HVX A;  2WB9 A;  3I6A A;  3TUE A;  1O73 A;  2PU9 C;  2B1L A;  1A0R P;  4BVY B;  2HT9 A;  2K18 A;  4KW6 A;  2E2G A;  1XW9 A;  4L0U A;  4WBR D;  1TRW A;  3FKF A;  1BAY A;  1WP0 A;  2EIQ A;  5B8B A;  3GMF A;  4EC0 A;  2PPT A;  4HEA 2;  5DCG A;  2MMN A;  2C4J A;  2OE0 A;  1XOA A;  3HJM A;  2E2M A;  4NHW A;  4KH7 A;  3CTG A;  4IGJ A;  1AQX A;  1MD3 A;  2WRT A;  20GS A;  3FRC A;  3W6G A;  2CAQ A;  3M1G A;  1SD8 A;  5HFK A;  5HFG A;  3MAK A;  2ZUP A;  2HSM A;  2AB6 A;  1QFN A;  4WKW A;  4K9Z A;  1GH2 A;  1M0U A;  1B8X A;  1AC1 A;  3C1S A;  1KTE A;  1G6W A;  1MD4 A;  4MJE A;  1ZZY A;  2LJR A;  3QD9 A;  4WXT A;  4PTS A;  5IO2 A;  3CSH A;  3QMX A;  5B8A A;  1OAZ A;  2UZ8 A;  1XCC A;  3IC8 A;  4EF0 A;  1XW6 A;  3UVT A;  2YOI A;  3D4M A;  4WF4 A;  4YAP A;  4F03 A;  4IKH A;  1B4Q A;  4K0N A;  4OO5 A;  1SK1 A;  2V32 A;  5COH A;  1TRV A;  1TDI A;  2FA4 A;  4O5U A;  1Z7R A;  2VLV A;  1ON4 A;  4BPY A;  1XWC A;  3VWX A;  5ECM B;  4WET A;  5HR3 A;  2X49 A;  4KCA A;  1T00 A;  1SL2 B;  2WUL A;  3Q18 A;  2X4A A;  2F8A A;  1FAA A;  4NWY A;  5IPH A;  2F8F A;  2NVL A;  2HFD A;  1EOG A;  3MYD A;  2OAC A;  3CQF A;  1FVK A;  4AJ7 A;  2XBQ A;  1GUL A;  4JR6 A;  3QDN A;  1BJX A;  3LSZ A;  1AUC A;  3U5R E;  5D73 A;  5DAL A;  5DQY A;  1M3I A;  2R2J A;  3O6T A;  1YEX A;  3ZIJ A;  1EGO A;  5F06 A;  1TK0 B;  3ED3 A;  2VCZ A;  1YKA A;  3F9U A;  2JZS A;  1K3O A;  5GAP D;  4YKG A;  2XHF A;  3L78 A;  3GKK A;  3C73 A;  4AJ6 A;  2H76 A;  2EIO A;  2H72 A;  2PMT A;  4OCF A;  4ML6 A;  4G2E A;  2GVP A;  1DBY A;  1X5E A;  5FWG A;  4H86 A;  2IWT A;  2O7K A;  2H1A A;  3KP8 A;  3MSZ A;  7GSS A;  5JWQ B;  4Q5Q A;  4P3Y B;  1ZL9 A;  2LTK A;  1OKD A;  4OWY A;  4WF5 A;  3HZ8 A;  2LJA A;  3FW2 A;  2KP2 A;  1VRS D;  4EIP A;  5IMV A;  2VLT A;  2X8H A;  3RHC A;  2YPM A;  4BL7 A;  3IDV A;  1FOH A;  4RI6 A;  3KJY A;  2M80 A;  3W8J A;  4RQX A;  1GTA A;  3TOU A;  3FY7 A;  2V2G A;  3F3R A;  3H79 A;  5AIV A;  2GZP A;  2N5B A;  3DEX A;  4BA7 A;  2IMK A;  1X5D A;  5J41 A;  4IBP A;  4X43 A;  2NDO A;  2KOK A;  2QSI A;  1PL2 A;  1HNA A;  3IHG A;  4GTU A;  2VCX A;  2O87 A;  1Y25 A;  2TRX A;  3KCM A;  2TIR A;  3FR9 A;  4FO5 A;  3K8N A;  1RQM A;  3KIJ A;  4K6X A;  1M3J A;  4J2F A;  2VM1 A;  3A5W A;  2H8L A;  4USS A;  1TI1 A;  1S3C A;  1JZD A;  5B7C A;  4BVY A;  1X0R A;  5D8I A;  4DEJ A;  1VF3 A;  1UA5 A;  3Q6O A;  3GH6 A;  2KUC A;  1WIK A;  4PUF C;  2DKH A;  3F6D A;  4GCI A;  1ERU A;  2XBI A;  2B1K A;  3GH9 A;  3TB2 A;  8GSS A;  4JU5 A;  3WT1 A;  2JAD A;  4K0G A;  1O85 A;  1ABA A;  3LXT A;  2YV9 A;  1U87 A;  4IN0 A;  3TCO A;  3TJK A;  2BTO T;  4J57 E;  4IJ3 A;  1XWB A;  4Q5N A;  4Z2R A;  2GZZ A;  3KM6 A;  4N0Z A;  1BQ7 A;  4ZL9 A;  3F6F A;  3UBL A;  5D96 A;  4HJ2 A;  4K7N A;  2DLX A;  5DAK B;  1VF2 A;  2VL9 A;  4MK3 A;  1F37 A;  3QAV A;  2K6V A;  4GSN A;  2G2Q A;  1MTC A;  3HY2 A;  3H8Q A;  4XHM A;  1BX9 A;  4N11 A;  1K0B A;  3A5I A;  2IN3 A;  2VLU A;  1O6J A;  1Z6M A;  3GUS A;  2RM5 A;  4NV5 A;  1U6T A;  2DKI A;  1K0C A;  2ON7 A;  2C8U A;  1Q98 A;  2G0F A;  1XXU A;  5DVB A;  1AAZ A;  1TRS A;  4G0I A;  2AV4 A;  4BWQ A;  4X4J A;  4MNN A;  5G31 A;  4IS0 A;  2GSS A;  2K8S A;  2X8G A;  1A2J A;  4K7O A;  2GGT A;  5EPF A;  4O92 A;  1GSE A;  2VCQ A;  3G9B A;  2OBI A;  4XS1 A;  2FGX A;  3R3E A;  1NSW A;  3F8U A;  3MDK A;  3HD5 A;  5H5Q A;  2VCV A;  2B6M A;  3IK9 A;  3UMA A;  1XZO A;  3IR4 A;  4MLY A;  1V9W A;  11GS A;  4QQ7 A;  2GQM A;  3ZFB A;  3EMP A;  4TR3 A;  3H4K A;  1SL1 B;  1YF0 A;  5DCH A;  6GSU A;  4K1F A;  5KOX A;  2AYT A;  4K2X A;  4ECC A;  1GSQ A;  2M72 A;  2DIZ A;  5E4W A;  3FEU A;  5CRW A;  4LL4 B;  3GV1 A;  1SK2 A;  3P8W A;  2LQQ A;  2GDR A;  3APQ A;  1LBK A;  2HRN A;  3DWV A;  1GSS A;  3L9S A;  3EYT A;  1HYU A;  3P2A A;  5D9V A;  4HS1 A;  3TRQ A;  3GRX A;  1YQ1 A;  4I8B A;  1THO A;  4FIW A;  4N10 A;  1N8J A;  12GS A;  3CMI A;  4DSS B;  4EO3 A;  4BIK A;  2PVO C;  3ERW A;  3TKR A;  5FT3 A;  3U6V A;  4IQA A;  1ZYE A;  1S3R A;  4ML1 A;  3EE2 A;  3ZL5 A;  3TDG A;  5GAN D;  2L4Q A;  3TJG A;  5J9C A;  3M3M A;  2YNX A;  4GSS A;  2NBS A;  3FMW A;  2K8V A;  3BCI A;  2O8V B;  1UC7 A;  5ECK B;  5GZZ B; 
#chains in the Genus database with same CATH homology
 2R5G A;  4O5Q A;  1I9D A;  4F2I A;  5G30 A;  5CNW A;  3IXR A;  5D93 A;  2V6K A;  2EC4 A;  3HJO A;  6GSW A;  3A2V A;  3LGC A;  4L5L A;  2B3S A;  4QL7 A;  4XS4 B;  3FR3 A;  2M46 A;  3CRT A;  4MZC A;  5CAX A;  1SD9 A;  2DIY A;  3UVH A;  5C04 A;  2FNO A;  3WGX A;  4DSR A;  4GST A;  4ZL7 A;  3C1R A;  1OC3 A;  1MEK A;  1LJR A;  4IEL A;  2I3Y A;  4ECJ A;  2VL2 C;  1GL8 A;  5ENU A;  1FHE A;  1E2Y A;  1NW2 A;  4F0B A;  4FYC A;  2C3N A;  1GUM A;  4G19 A;  4JRR A;  4PQH A;  3ZFL A;  1UN2 A;  1B4P A;  1NHO A;  1BYE A;  3H93 A;  5ECR B;  2LV3 A;  2LRT A;  3LFL A;  1V98 A;  1YKC A;  2H1B A;  2XC2 A;  3KXO A;  4DSQ A;  4HU7 A;  1SYX A;  3WGE A;  2PER A;  4G0L A;  2CVB A;  2H66 A;  3TJJ A;  3GYK A;  5ECO B;  5D9X A;  1K0N A;  5GST A;  2A4H A;  3A2X A;  3ZLP A;  2H75 A;  3HHV A;  3MIX A;  4NAX A;  3E9J B;  3S9F A;  2L59 A;  3PH9 A;  1T4Z A;  1EEJ A;  4LL1 B;  4MPF A;  4FH8 A;  3C7M A;  1GUH A;  1H75 A;  1QK8 A;  2PN8 A;  1RK4 A;  1WE0 A;  1SU9 A;  3IAS 2;  2CVD A;  1EWX A;  4HDE A;  1EP8 A;  5A5K A;  3VI5 A;  1R7H A;  2HRA A;  5AIS A;  4HQZ A;  4IW9 A;  1U3A A;  2H73 A;  2LJK A;  2A2R A;  4MF6 A;  1K0D A;  5DAK A;  1JLV A;  3GFK A;  3R2Q A;  1WWJ A;  2HRK A;  1SK0 A;  4OD7 A;  4ZB9 A;  4V2L A;  3IK7 A;  5G5E A;  4ISD A;  1GSF A;  2OE3 A;  1NM3 A;  3A2W A;  1GNW A;  1ZYN A;  4XRA A;  3IPZ A;  2CZ2 A;  4PQ1 A;  1LU4 A;  1EZK A;  1KBN A;  3LWA A;  3KGK A;  2P31 A;  2AUV A;  1PMT A;  2WDU A;  1URM A;  2F9S A;  3GKN A;  1T4Y A;  3J7Y k;  4EVM A;  2ZNM A;  4KUN A;  5IO0 A;  2QGV A;  2H0H A;  1PN9 A;  4HJM A;  3IA1 A;  3BJ5 A;  4ZB6 A;  1SJI A;  2JL4 A;  1JFU A;  4ILF A;  2C80 A;  3G7I A;  2RM6 A;  3KZQ A;  1B9X C;  1TK5 B;  3UIW A;  2GTU A;  4Q5F A;  2YWN A;  4TR1 B;  3LXZ A;  4LMW A;  4Z7X A;  1PKZ A;  5KN3 A;  1JZR A;  3Q19 A;  5IMC A;  4WBJ A;  5ID2 B;  4YQU A;  5IMF A;  2WJU A;  4OFN A;  3D22 A;  3ISO A;  1OKT A;  4K2D A;  3NOF A;  3UBK A;  4ECB A;  2WCI A;  2PUK C;  3RBT A;  3TKP A;  2ALB A;  3ZVJ A;  1QGV A;  3HCZ A;  1G6Y A;  3IHQ A;  4TW5 A;  3ZIT A;  4FYU A;  2HSH A;  1T1V A;  2BMX A;  4NV2 A;  4YQV A;  4DSS A;  2GST A;  2HSY A;  4ICY A;  2OE1 A;  1Z3E A;  2MBS A;  4I5Q A;  1ERV A;  5IQY A;  2LS5 A;  4PNG A;  2H01 A;  2HRF A;  3QAG A;  2L6D A;  1TKD B;  1XWG A;  3CYN A;  5A4V A;  2R0G A;  2C0E A;  4GF0 A;  3HVS A;  1O7U A;  2H1D A;  1YY7 A;  2YWM A;  2C0G A;  2FUG 2;  3L9U A;  4XCS A;  1AQV A;  1OC8 A;  4F82 A;  4GQC A;  3RAZ A;  1FOV A;  1V57 A;  1RW1 A;  3O3T A;  3IOS A;  3FZ4 A;  4MZW A;  3HVV A;  1R26 A;  4XS4 A;  4EIQ A;  2YN1 A;  3QCP A;  3ERG A;  4NXI A;  2LEG A;  4I2U A;  5D9T A;  1T8E B;  2GS3 A;  1A8L A;  5HR1 A;  4G9H A;  5INY A;  3DD3 A;  4EDY A;  5AN1 A;  2GZY A;  2R0C A;  1GTB A;  3LG6 A;  5ECS A;  1KEB A;  1B48 A;  1U3I A;  1PSQ A;  4JZQ A;  1GSU A;  3QAW A;  2CQ9 A;  2LNT A;  3TKS C;  4HI7 A;  2VCW A;  2NTO A;  5JCW A;  2V1M A;  1ST9 A;  3RDW A;  4O32 A;  2P0G A;  4EDZ A;  1T3B A;  2PWJ A;  2L6C A;  2HYX A;  2P5Q A;  3D0Z A;  1M2B A;  1K3L A;  3E3E A;  4V2N A;  3VLN A;  4V1A g;  2VD0 A;  4IVF A;  1EV9 A;  1FG4 A;  4FQU A;  2GQL A;  1Y6E A;  1ZCP A;  4MCU A;  3F4S A;  1KNG A;  5IM9 A;  5G5F A;  5KN1 A;  1EP7 A;  3VUR A;  4GLT A;  4ULX A;  4ZBA A;  2C3T A;  1JZO A;  2HNL A;  5LNK e;  1A2L A;  2P5R A;  3EVI A;  1EV4 A;  5ELG A;  4PXO A;  3M9K A;  4OFM A;  4RUV A;  2N5F A;  2H6Y A;  3GL3 A;  3EWL A;  1EGR A;  1PRX A;  3FZ5 A;  5CRH A;  2B5Y A;  3HDC A;  4JE1 A;  4MJC A;  5JWR B;  1EOH A;  3LQ7 A;  4CY6 A;  2MMO A;  2H6X A;  5J4U A;  3QPM A;  2J9H A;  3LYK A;  3GTU B;  3RHB A;  1V2A A;  17GS A;  2RUE A;  2LRN A;  2D2Z A;  2JSZ A;  3P90 A;  3BCK A;  1K3Y A;  3HJP A;  4CY8 A;  3DXB A;  1EEM A;  3FK8 A;  5J3R A;  1M7T A;  2NPB A;  5HFI A;  4Z2T A;  3HA9 A;  2FWE A;  4JED A;  5CRD A;  4EE0 A;  3VPT A;  2I1U A;  5ECN B;  2IPA A;  3L4N A;  4POB A;  3ZIV A;  1H4O A;  4ACS A;  1FW1 A;  4LA1 A;  1A0F A;  3VWV A;  5IMD A;  4IQ1 A;  4HOJ A;  1GSD A;  16GS A;  1F2E A;  2FCH A;  4Q5R A;  1HNC A;  2L57 A;  4JBB A;  3PR8 A;  1WMJ A;  1B9Y C;  4TR1 A;  2HXK A;  5J5N A;  3EC3 A;  1XBS A;  2DML A;  1TW9 A;  4POM A;  4KAE A;  5KEJ A;  1GTU A;  14GS A;  2YZU A;  5ID2 A;  3WD6 A;  19GS A;  2C3Q A;  5GSS A;  1THX A;  3ZZX A;  5AIX A;  3VWW A;  1Z6N A;  1XOB A;  1O8W A;  3NIV A;  4KDU A;  4NHZ A;  5HR2 A;  3FR6 A;  3EU3 A;  3PGT A;  4J56 E;  4KGI A;  2LUS A;  1V58 A;  1M9B A;  3UOM A;  1O81 A;  1GNE A;  4KB3 A;  4TRX A;  4WEY A;  1X9W B;  2V6O A;  4N0V A;  2FA8 A;  3ME7 A;  3HZ4 A;  5G1L A;  2R6K A;  1CQG A;  2LRC A;  2I9H A;  1A2M A;  2CX3 A;  5BMU A;  2RUF A;  3ZRD A;  4YH2 A;  1A24 A;  3EIN A;  3G7J A;  3IV4 A;  1YJ6 A;  2HZF A;  3HYP A;  4MJB A;  2JAC A;  3G7Y A;  3LOR A;  2CV4 A;  2IFQ B;  2A2S A;  5ELA A;  5ECL B;  6GSS A;  2JSY A;  3DVW A;  1E6B A;  4XS6 A;  2YWO A;  4X0X A;  4YAV A;  4CW9 A;  1SJZ A;  3GKM A;  1TXX A;  3LW9 A;  2DJ3 A;  2FLS A;  2IIY A;  2V41 A;  3GSS A;  5EY6 A;  2DJ1 A;  2A2P A;  2CT6 A;  3VWU A;  2VUP A;  2MBT A;  1XFL A;  4K7I A;  5KN2 A;  1OE8 A;  5IOX A;  1SEN A;  2YAN A;  5HQP A;  1G0T A;  5LD0 A;  2WZ9 A;  3M0F A;  1OE7 A;  3DKS A;  4V2M A;  2EIR A;  1PA3 A;  3TRP A;  3GHA A;  3CRU A;  5ABR A;  4K5R A;  4EXJ A;  4LMV A;  1MDI A;  3ZML A;  4NMU A;  4F0C A;  3IE3 A;  4WR4 A;  1TTZ A;  3UL3 A;  2GLR A;  4V1A p;  3KMN A;  4L8E A;  4I97 A;  1QUW A;  2GQK A;  1ML6 A;  2RII A;  1Z7P A;  5IPG A;  1O8X A;  2GT6 A;  2H0G A;  2TRC P;  4HQS A;  3KH9 A;  1BED A;  1XVQ A;  1Z5Y E;  4RQR A;  5F0G A;  2H0I A;  2O85 A;  4E8H A;  2H70 A;  1PGT A;  1PD2 1;  1PQN A;  1VF4 A;  4MZB A;  2H6Z A;  3ERF A;  3WYW A;  4GQF A;  4PUA A;  1NHY A;  1GP1 A;  4TOP A;  4TXO B;  3GX8 A;  4ID0 A;  3DML A;  2OBK A;  2FWF A;  5CYY A;  3KH7 A;  5JCU A;  2PVQ A;  1F3A A;  2XPE A;  2K9F A;  1AXD A;  1QMV A;  4GWR A;  1CQH A;  1ACV A;  3F0I A;  4TR4 A;  1HNB A;  2AAW A;  1WRY A;  3I9V 2;  3HXS A;  2QC7 A;  3GN3 A;  4LLR A;  3IBH A;  1WOU A;  3BOA A;  3D6I A;  4CHS A;  3GTU A;  1ZMA A;  2B5E A;  5LCZ A;  3PIN A;  2VO4 A;  1SKW B;  3F4T A;  3I43 A;  1WPI A;  3VPQ A;  4KF9 A;  6GST A;  3EUR A;  5J9B A;  3FYG A;  4N30 A;  3A3T A;  3N5O A;  3KD0 A;  4MA9 A;  2OKA A;  4ZL8 A;  3TRX A;  1GUK A;  2CZ3 A;  2X64 A;  2RLI A;  3L9V A;  3BBY A;  1TRU A;  2IME A;  3LEF A;  1ERT A;  4PX1 A;  3KEB A;  2YCD A;  4OMV A;  5KN0 A;  1PN0 A;  5IOW A;  3TKS E;  3JCM L;  3UJ1 A;  1XPV A;  4MMM A;  3FHK A;  1X9M B;  3KMO A;  4FYB A;  1PL1 A;  2ZCT A;  5DDL A;  1JLW A;  4MAB A;  1PX6 A;  6GSX A;  3OR5 A;  1QQ2 A;  2YWI A;  2CVK A;  2OA7 A;  2DJK A;  4D73 B;  1TP9 A;  4XRD A;  3MWH A;  1SKR B;  4E8E A;  5L71 A;  4DVC A;  4XTS A;  3DIE A;  4TXV A;  1IYI A;  1IYH A;  1JZW A;  9GSS A;  2BJX A;  2LKU A;  2VL3 A;  4EUY A;  1OYJ A;  1TK8 B;  4KSM A;  2CAI A;  4AJ8 A;  1J9B A;  2DBC A;  1VGL A;  2H1G A;  2B5X A;  4KCE A;  2QA2 A;  3TJF A;  2VL2 A;  5ECI B;  3E0U A;  2N5A A;  1ZYQ B;  4KDY A;  2IFQ A;  1OVN A;  5CRE A;  2IMI A;  2LNS A;  5F8B A;  2LQO A;  2X8C A;  3CSJ A;  4G10 A;  3AY8 A;  4QL9 A;  1K0A A;  4A5P A;  2DJ0 A;  1R5P A;  5DQS A;  1SYR A;  1QXH A;  3IRA A;  2X99 A;  4IP1 A;  1J0F A;  1VF1 A;  2ES7 A;  3NZN A;  5DJL A;  1C72 A;  1ERW A;  1K0O A;  3FZ9 A;  4HZ2 A;  2HI7 A;  2LST A;  1DE1 A;  3GKX A;  3I69 A;  1M2A A;  1ILO A;  4BVX B;  4ECI A;  4I6X A;  2CA8 A;  2Z9S A;  1MDK A;  3GNJ A;  5AGY A;  3J7Y b;  3QFA C;  3RPP A;  18GS A;  1FB0 A;  3DRN A;  4ZBD A;  2YZH A;  2B7K A;  5BRT A;  2FD3 A;  3GX0 A;  1TU8 A;  4L0W A;  4MJA A;  2JU5 A;  3VK9 A;  5F07 A;  2HZE B;  1ZGN A;  3H1N A;  5EVO A;  1N2A A;  5A4U A;  2OAD A;  2R4V A;  2WGR A;  4KDX A;  2L5L A;  1GSY A;  5A4W A;  1GWC A;  2DJJ A;  3O76 A;  1GRX A;  2L5O A;  3IC4 A;  3F63 A;  2YV7 A;  2AHE A;  3M9J A;  1HQO A;  2QKE A;  4YQM A;  4PNF A;  4TXO A;  2C1Y A;  4PUR A;  3CSI A;  1UVZ A;  1YDK A;  3DGQ A;  1DE2 A;  1DUG A;  4YKF A;  1MDJ A;  3DVX A;  3HKR A;  4XIH A;  2GSR A;  2WFC A;  2GT5 A;  4HZ4 A;  2HLS A;  1OC9 B;  4O5R A;  4KE3 A;  4KSO A;  2IMD A;  2AJQ B;  4ZXG A;  13GS A;  1M2D A;  4MF5 A;  4ZBB A;  5F05 A;  1TJD A;  2YJ7 A;  2XPD A;  1V40 A;  1S3A A;  5C00 A;  4KND A;  1PKW A;  4MPG A;  4GXZ A;  5IIZ A;  3TGZ A;  5JWO B;  5CO3 A;  2KP1 A;  4I2T A;  2VM2 A;  1GLQ A;  3ME8 A;  1F3B A;  1TI3 A;  2FWH A;  4OO4 A;  1FO5 A;  6GSV A;  3CTF A;  3V1W A;  3ZYW A;  5ECP B;  3LYP A;  4KA0 A;  2JZR A;  4L5O A;  1Q4J A;  2H19 A;  4POL A;  5KOW A;  1G7E A;  3N9J A;  1PX7 A;  4MH3 A;  4TKY A;  4G0K A;  3D5J A;  2FY6 A;  2FHE A;  2J23 A;  1ZOF A;  3P7X A;  5G1K A;  3ZVJ D;  1W89 A;  4MF7 A;  3MNG A;  4OFT A;  1YF1 A;  3ZRE A;  1FVJ A;  3QOU A;  1TOF A;  3GL5 A;  4POK A;  5HR0 A;  1TU7 A;  3Q74 A;  5CP1 A;  3RPN A;  5D9W A;  1S3D A;  1G7O A;  3GIX A;  1A23 A;  4HU9 A;  1ZYP A;  4HUA A;  2HE3 A;  2JZT A;  5H5R A;  1R4W A;  1SKS B;  1XW5 A;  2F51 A;  1XIY A;  4D73 A;  2H30 A;  1YEP A;  2E0Q A;  2H71 A;  4MH2 A;  4ZB8 A;  1Z9H A;  3FZA A;  2DJ2 A;  3UAR A;  4MP4 A;  4AF2 A;  1JHB A;  5G2Z A;  5B6M A;  1W4V A;  5EL8 A;  2WS2 A;  4X1U A;  3GST A;  3WT2 A;  4IJI A;  5ECH B;  1SJ6 A;  4BWS A;  5IMZ A;  3VFI A;  4F9Z A;  3F3Q A;  4MDC A;  1M9A A;  3IAM 2;  3TOT A;  4PGT A;  4EL1 A;  2MMZ A;  3CXG A;  3UEM A;  1SL0 B;  2L4C A;  3W8S A;  3QR6 A;  3D21 A;  2DSA A;  4TR0 A;  3BD2 A;  2I81 A;  4ZIJ A;  1J08 A;  4KX4 A;  2PBJ A;  3TKS A;  3EU4 A;  3KP9 A;  3TJB A;  1X9S B;  1I5G A;  3WGD A;  4K8M A;  3CBU A;  2O89 A;  5E59 A;  4ZIL A;  3EPT A;  3KTL A;  2R37 A;  1X5C A;  2DC5 A;  2YP6 A;  2OJL A;  2R3X A;  3D4T A;  3VI7 A;  3M8N A;  5DAL B;  3LJR A;  2E7P A;  3US3 A;  4PQI A;  1U88 A;  3KTB A;  3F4R A;  5H5S A;  3C8E A;  1AIU A;  4IHU A;  2H74 A;  4BVX A;  2C0D A;  1F9M A;  3QFB C;  1WJK A;  2MMA A;  2VCT A;  2KHP A;  2FWG A;  2PGT A;  2YJH A;  5JCG A;  4O7H A;  5IMA A;  1XWK A;  4NPB A;  1XVW A;  1DSB A;  2DMM A;  2IJY A;  22GS A;  4CDO A;  2A4V A;  1USB A;  2HZE A;  1AQW A;  3PPU A;  4IP6 A;  2MYG A;  4TN8 A;  3TKQ A;  1BG5 A;  1GTI A;  2VIM A;  1R5A A;  2GSQ A;  4AGS A;  3DYR A;  2IL3 A;  2REM A;  4OCE A;  4K5S A;  2VAF A;  5FHI A;  4BL7 B;  2VD1 A;  4WR5 A;  3ZMK A;  2F3M A;  3SBC A;  1T7P B;  1A8Y A;  5CRG A;  1XWA A;  2B7J A;  4GRF A;  2R0P A;  6GSY A;  1F6M C;  1AW9 A;  2VOC A;  2ON5 A;  3EMX A;  4RI7 A;  3APS A;  3C71 A;  3ZTL A;  2I4A A;  4Z2U A;  1K0M A;  4TVE A;  2IMF A;  1YZX A;  1OC9 A;  2MZC A;  3GUR A;  3L0H A;  2CX4 A;  1M99 A;  2C0F A;  1FB6 A;  1HD2 A;  3APO A;  3UAP A;  2KLX A;  5ECQ B;  3GA4 A;  4EKZ A;  5DJM A;  2QA1 A;  5DBQ A;  3SWL A;  1GLP A;  10GS A;  5B6N A;  4JR4 A;  3HVX A;  2WB9 A;  3I6A A;  3TUE A;  1O73 A;  2PU9 C;  2B1L A;  1A0R P;  4BVY B;  2HT9 A;  2K18 A;  4KW6 A;  2E2G A;  1XW9 A;  4L0U A;  4WBR D;  1TRW A;  3FKF A;  1BAY A;  1WP0 A;  2EIQ A;  5B8B A;  3GMF A;  4EC0 A;  2PPT A;  4HEA 2;  5DCG A;  2MMN A;  2C4J A;  2OE0 A;  1XOA A;  3HJM A;  2E2M A;  4NHW A;  4KH7 A;  3CTG A;  4IGJ A;  1AQX A;  1MD3 A;  2WRT A;  20GS A;  3FRC A;  3W6G A;  2CAQ A;  3M1G A;  1SD8 A;  5HFK A;  5HFG A;  3MAK A;  2ZUP A;  2HSM A;  2AB6 A;  1QFN A;  4WKW A;  4K9Z A;  1GH2 A;  1M0U A;  1B8X A;  1AC1 A;  3C1S A;  1KTE A;  1G6W A;  1MD4 A;  4MJE A;  1ZZY A;  2LJR A;  3QD9 A;  4WXT A;  4PTS A;  5IO2 A;  3CSH A;  3QMX A;  5B8A A;  1OAZ A;  2UZ8 A;  1XCC A;  3IC8 A;  4EF0 A;  1XW6 A;  3UVT A;  2YOI A;  3D4M A;  4WF4 A;  4YAP A;  4F03 A;  4IKH A;  1B4Q A;  4K0N A;  4OO5 A;  1SK1 A;  2V32 A;  5COH A;  1TRV A;  1TDI A;  2FA4 A;  4O5U A;  1Z7R A;  2VLV A;  1ON4 A;  4BPY A;  1XWC A;  3VWX A;  5ECM B;  4WET A;  5HR3 A;  2X49 A;  4KCA A;  1T00 A;  1SL2 B;  2WUL A;  3Q18 A;  2X4A A;  2F8A A;  1FAA A;  4NWY A;  5IPH A;  2F8F A;  2NVL A;  2HFD A;  1EOG A;  3MYD A;  2OAC A;  1FVK A;  4AJ7 A;  2XBQ A;  1GUL A;  4JR6 A;  3QDN A;  1BJX A;  3LSZ A;  1AUC A;  3U5R E;  5D73 A;  5DAL A;  5DQY A;  2R2J A;  3O6T A;  1YEX A;  3ZIJ A;  1EGO A;  5F06 A;  1TK0 B;  3ED3 A;  2VCZ A;  1YKA A;  3F9U A;  2JZS A;  1K3O A;  5GAP D;  4YKG A;  2XHF A;  3L78 A;  3GKK A;  3C73 A;  4AJ6 A;  2H76 A;  2EIO A;  2H72 A;  2PMT A;  4OCF A;  4ML6 A;  4G2E A;  2GVP A;  1DBY A;  1X5E A;  5FWG A;  4H86 A;  2IWT A;  2O7K A;  2H1A A;  3KP8 A;  3MSZ A;  7GSS A;  5JWQ B;  4Q5Q A;  4P3Y B;  1ZL9 A;  2LTK A;  1OKD A;  4OWY A;  4WF5 A;  3HZ8 A;  2LJA A;  3FW2 A;  2KP2 A;  1VRS D;  4EIP A;  5IMV A;  2VLT A;  2X8H A;  3RHC A;  2YPM A;  4BL7 A;  3IDV A;  1FOH A;  4RI6 A;  3KJY A;  2M80 A;  3W8J A;  4RQX A;  1GTA A;  3TOU A;  3FY7 A;  2V2G A;  3F3R A;  3H79 A;  5AIV A;  2GZP A;  2N5B A;  3DEX A;  4BA7 A;  2IMK A;  1X5D A;  5J41 A;  4IBP A;  4X43 A;  2NDO A;  2KOK A;  2QSI A;  1PL2 A;  1HNA A;  3IHG A;  4GTU A;  2VCX A;  2O87 A;  1Y25 A;  2TRX A;  3KCM A;  2TIR A;  3FR9 A;  4FO5 A;  3K8N A;  1RQM A;  3KIJ A;  4K6X A;  4J2F A;  2VM1 A;  3A5W A;  2H8L A;  4USS A;  1TI1 A;  1S3C A;  1JZD A;  5B7C A;  4BVY A;  1X0R A;  5D8I A;  4DEJ A;  1VF3 A;  1UA5 A;  3Q6O A;  3GH6 A;  2KUC A;  1WIK A;  4PUF C;  2DKH A;  3F6D A;  4GCI A;  1ERU A;  2XBI A;  2B1K A;  3GH9 A;  3TB2 A;  8GSS A;  4JU5 A;  3WT1 A;  2JAD A;  4K0G A;  1O85 A;  1ABA A;  3LXT A;  2YV9 A;  1U87 A;  4IN0 A;  3TCO A;  3TJK A;  2BTO T;  4J57 E;  4IJ3 A;  1XWB A;  4Q5N A;  4Z2R A;  2GZZ A;  3KM6 A;  4N0Z A;  1BQ7 A;  4ZL9 A;  3F6F A;  3UBL A;  5D96 A;  4HJ2 A;  4K7N A;  2DLX A;  5DAK B;  1VF2 A;  2VL9 A;  4MK3 A;  1F37 A;  3QAV A;  2K6V A;  4GSN A;  2G2Q A;  1MTC A;  3HY2 A;  3H8Q A;  4XHM A;  1BX9 A;  4N11 A;  1K0B A;  3A5I A;  2IN3 A;  2VLU A;  1O6J A;  1Z6M A;  3GUS A;  2RM5 A;  4NV5 A;  1U6T A;  2DKI A;  1K0C A;  2ON7 A;  2C8U A;  1Q98 A;  2G0F A;  1XXU A;  5DVB A;  1AAZ A;  1TRS A;  4G0I A;  2AV4 A;  4BWQ A;  4X4J A;  4MNN A;  5G31 A;  4IS0 A;  2GSS A;  2K8S A;  2X8G A;  1A2J A;  4K7O A;  2GGT A;  5EPF A;  4O92 A;  1GSE A;  2VCQ A;  3G9B A;  2OBI A;  4XS1 A;  2FGX A;  3R3E A;  1NSW A;  3F8U A;  3MDK A;  3HD5 A;  5H5Q A;  2VCV A;  2B6M A;  3IK9 A;  3UMA A;  1XZO A;  3IR4 A;  4MLY A;  1V9W A;  11GS A;  4QQ7 A;  2GQM A;  3ZFB A;  3EMP A;  4TR3 A;  3H4K A;  1SL1 B;  1YF0 A;  5DCH A;  6GSU A;  4K1F A;  5KOX A;  2AYT A;  4K2X A;  4ECC A;  1GSQ A;  2M72 A;  2DIZ A;  5E4W A;  3FEU A;  5CRW A;  4LL4 B;  3GV1 A;  1SK2 A;  3P8W A;  2LQQ A;  2GDR A;  3APQ A;  1LBK A;  2HRN A;  3DWV A;  1GSS A;  3L9S A;  3EYT A;  1HYU A;  3P2A A;  5D9V A;  4HS1 A;  3TRQ A;  3GRX A;  1YQ1 A;  4I8B A;  1THO A;  4FIW A;  4N10 A;  1N8J A;  12GS A;  3CMI A;  4DSS B;  4EO3 A;  2PVO C;  3ERW A;  3TKR A;  5FT3 A;  3U6V A;  4IQA A;  1ZYE A;  4ML1 A;  3EE2 A;  3ZL5 A;  3TDG A;  5GAN D;  2L4Q A;  3TJG A;  5J9C A;  3M3M A;  2YNX A;  4GSS A;  2NBS A;  3FMW A;  2K8V A;  3BCI A;  2O8V B;  1UC7 A;  5ECK B;  5GZZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...